4JIAA

Jak2 kinase (jh1 domain) in complex with compound 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
298
Chain Sequence
SGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Amino-[1,2,4]triazolo[1,5-a]pyridines as JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 298
sequence length 300
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jiaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jiaA01
4HNFA 4R8QA 5DHJA 4BDKA 5HORA 4RJ3A 1E1XA 2PVMA 4ITHA 4U3ZA 4YO4A 4HW7A 4O81A 4DF3A 1PYEA 5KZ0A 4O0YA 3BPRA 3W8LA 4HVIA 3U6HA 3G0EA 3EFWA 4BBEA 3DQXA 4DEGA 2EB2A 4MNEB 2J50A 4WG3A 4FTJA 3Q9WA 4GVJA 2C3LA 3HV6A 3PJCA 5D10A 3D15A 4I1ZA 4USFA 5HNGA 2C5XA 2JDVA 3LMHA 1KV1A 4PX6A 4XG7A 5H9BA 4HGSA 5C1QB 3EJ1A 4WA9A 3TM0A 2NP8A 2JDTA 4H05A 4G17A 4IX4A 3ZZWA 4BICA 3I60A 3TUDA 2XEZA 1BL7A 1OIUA 4B8MA 4FT5A 3CD3A 4LRKA 2WMRA 2ZV9A 5HG8A 5DI1A 2ITYA 3UE4A 3RHXA 4K33A 4V0GB 1GY3A 1L8TA 4WOVA 5GJDA 2R7IA 4D1SA 2QOOA 5CWZA 3RALA 4XS2A 4C0TA 4O0TA 4DITA 3NAYA 4OBOA 4AW0A 4CMUA 5IG1A 3ZUVA 2KTYA 3DBCA 3MFRA 4JRVA 4QYFA 1BI8A 3ZLYA 1FVVA 4F08A 4DA5A 5L8LA 1Y91A 3C0IA 2DYLA 3GC9A 4KNBA 4MBLA 5AR4A 4EKKA 4BCJA 4YURA 4IZ7A 4PUZA 3WF9A 3RJCA 5CF4A 4C59A 3BE2A 3NUPA 3R8LA 3RHKA 3MGYA 4F70A 1NVRA 4DCEA 2ACXA 4HVSA 4J71A 4CFXA 3ZEPA 2O0UA 4FEUA 3ZLWA 3UNJA 1PRYA 5L3AA 1W84A 3ALOA 2RFEA 2WMWA 3MY5A 2JDSA 2Y7JA 4MK0A 5AAFA 4XRLA 4ZSLA 4E4MA 3VWAA 3E3PA 3G90X 3MJ2A 3I0OA 3IW7A 3MH2A 3I81A 4U7ZA 4X2JA 3R7GA 5TT7A 3DBEA 3IG7A 3OVVA 1ZY5A 1GIHA 4FNZA 2QO9A 5EYDA 1R78A 3H10A 4QP4A 4WNMA 4XHKB 5A46A 3R1QA 3PXQA 4PNIA 4IAAA 1ZYCA 2W5AA 5EG3A 2GHMA 4D2SA 4EHEA 4NYEA 5EQEA 4M67A 4ZS0A 1MRUA 2XNNA 2FVDA 3OW3A 4Y8DA 4C4FA 3MY0A 4CRSA 4FKTA 3DU8A 3V01A 3HMOA 2JC6A 1E9HA 4LL5A 4RVLA 4QTAA 5HLPA 3TL8A 3PPKA 4JBOA 4TXCA 4PL3A 4W9WA 1SNXA 4M8TA 1NT2A 4DHFA 3FYKX 4BKZA 4KKGA 3IGGA 3CE3A 4FIFA 4KABA 4KS7A 5BVKA 3ZO4A 3CGOA 2VZ6A 3DAKA 4FGRA 5HTIA 4PMTA 2IVUA 4KBCA 2WTVA 3DBFA 3GEQA 2UW9A 3A99A 3EB0A 3R71A 3RAIA 5FXRA 5ANEA 3VF9A 5HO8A 1H4LA 4O7VA 4FEWA 3VS0A 3I7CA 3FDNA 3LFQA 4UZHA 3MIAA 1YI4A 4H3QA 4JNWA 2C5NA 2EXCX 4UXQA 1WBOA 1FVTA 1SVGA 3PE1A 5DR9A 4FT7A 5HD7A 3HZTA 1H28A 3PJ2A 4LRMA 5D1JA 4AA4A 3BQCA 5KNJA 3MB7A 3QCSA 1JKTA 3R7OA 3ZHPC 3ZYAA 5LMAA 4QMPA 3COMA 3LJ1A 5L2QA 5IEXA 2BRGA 4WIHA 2Z7QA 1YRPA 2BKZA 3D5VA 5DEWA 5FTOA 3MY1A 4RWLA 4AG8A 5EHOA 1XBCA 1OKYA 3RK5A 1H1PA 5EK7A 4DFYA 1ZMVA 4YMJA 3GCUA 3ZC6A 1VZOA 2W5BA 3KXZA 2QO2A 4M15A 3O51A 3Q3BA 2V62A 2XK3A 3VUIA 2ZV2A 1RQQA 2UV2A 2X8DA 3QRTA 5B0XA 3LXNA 4C2VA 3U54A 3WYXA 4FEXA 3F6XA 4YTCA 3NUNA 2HY0A 4EOOA 4CT1A 3R21A 4IM0A 1FQ1B 2C6KA 2XBJA 2Y6OA 3DTCA 3KMUA 5KMMA 3OUNB 4EBVA 2QOBA 4O27B 1SM2A 2QQ7A 2CJMA 4EWHA 2GQSA 2XS0A 5BX0A 3D94A 4B0GA 2BCJA 4ZTNA 4FV9A 2ITPA 2IVTA 3ROCA 4M13A 4XLIA 4QPSA 3QF9A 4QYHA 3FZSA 4PDPA 4P7EA 1U59A 5IQEA 2RIOA 3R8MA 1WVXA 4FK6A 4W4VA 3CJFA 2BHEA 5AP4A 2UZWE 3R7IA 3VC4A 3B8RA 3LXLA 5IISA 2IVSA 4BBFA 4ZY4A 5IQGA 3C4EA 2JKQA 3OTVA 3RGFA 5JZJA 2I0HA 5F20A 3NLBA 2VTRA 3R9NA 1PXLA 4BIEA 4EUUA 5EW3A 2O63A 3RINA 5AEPA 2WEIA 3HUCA 2YM3A 3OBJA 3C50A 4D28A 4F6UA 4I23A 5FGKA 4CLJA 1CDKA 3PXZA 1S9JA 4RVTA 4LGDA 5M56A 2X4ZA 2ZYBA 1JKKA 5L8JA 4DH1A 2QG7A 3H9FA 4EH7A 1H1SA 4YLKA 2C0OA 5JGBA 3LKMA 1YKRA 4L3JA 2NO3A 1JKSA 3TTJA 4OBPA 1CKPA 2HY81 3GU5A 2VTSA 1XR1A 3IK3A 4O21A 4XG4A 4R1VA 2WB8A 4TWPA 3AOXA 4KSQA 3H30A 2YIYA 4AU8A 4HCVA 3BCEA 4C35A 3NUAA 2C3KA 3AC5A 1KWPA 3ENMA 3MVHA 3F3UA 4WNKA 4YZBA 2XNOA 3IONA 4JIKA 4EH4A 4XRJA 4YHJA 4IWOA 2R3IA 3GU6A 3L8VA 2R3HA 3DPKA 3UNZA 2CKQA 3UO4A 5HE1A 4ASEA 4Z55A 5CU0A 4WSYA 4Q9ZA 1IEPA 3DJ5A 2DWBA 3VUKA 1O6KA 4BZDA 4ENYA 4BCIA 4FG7A 2R3PA 2GSFA 3NEWA 3TCPA 3Q96A 4UX9A 4V04A 3IDPA 2G01A 3O2MA 1R3CA 3UOLA 4KKEA 2R3OA 4HZSA 3MWUA 4BTKA 1R0PA 4U0IA 4V01A 4C33A 3LJ0A 3QD2B 5HD4A 1AD5A 3O50A 3TZ7A 4CTCA 3HRBA 2YCQA 4HGLA 1UKIA 5CY3A 3P7BA 3QC4A 3TDVA 5HU3A 4YPDA 2JAVA 3KRXA 3SW4A 5M51A 1H00A 4QNAA 3R7YA 3W2PA 4YUQA 5CANA 3CQEA 4H1MA 2W4JA 5J79A 2E2BA 4HGTA 3WOWA 2JIVA 3TEIA 1TVOA 2C0TA 2JBPA 1MP8A 4G3CA 5LCJA 4WSQA 3O96A 3V8SA 3BLRA 4CFNA 3VS7A 5GIOE 2P2HA 5CS6A 4LI5A 2PWLA 3F9NA 3KRRA 5E4HA 3ZSHA 4JJRA 5I9ZA 2R4BA 5FM3A 3GVUA 1OUYA 3FZOA 4XCUA 2XA4A 4J98A 3ORMA 3ORXA 3DAEA 4DT8A 3AMAA 5AV3A 4CZYB 3OCGA 3QTXA 2VWIA 3KXNA 4F1OA 4G3GA 3E88A 1K2PA 3FQSA 4O96A 4RGJA 3QALE 3PIXA 4Y5QA 3R7VA 4I6QA 2B52A 4KRDA 4IX3A 3SW7A 2OKRA 4FKIA 4JR3A 1GZOA 2B54A 2EXMA 3E7VA 1OL6A 3VW8A 3QGWA 4FTUA 3EIDA 4OAUC 1W7HA 4RX5A 4J8NA 1WVWA 3UMWA 4OGRA 3UOHA 4U45A 3ENHA 3NW6A 3GI3A 5HI2A 1JPAA 5HIEA 3NUUA 2OXXA 4L7SA 2YZLA 1QPJA 3AC2A 4G5PA 3FBVA 2E9VA 3JY0A 4ZEGA 4JX3A 5E8TA 3QXPA 3PXYA 4IBMA 4F1MA 2X0GA 5IMXA 4CG9A 1FGKA 2XRUA 4JI9A 2VTPA 3SD0A 4OTPA 2WHBA 2YM4A 4CRLA 1P4OA 1LR4A 5FP6A 3SXFA 4RJ6A 3FAAA 3PFQA 4FVPA 2XKEA 3KF7A 3QU0A 3PSCA 3TJCA 2AC3A 4EORA 1SVEA 2F7EE 2BALA 4ANBA 4G34A 3HAVA 5ETIA 3FMKA 1Q3WA 5M09A 2ITZA 3I7BA 4FVRA 4GFMA 3JS2A 3SLSA 2JIIA 4N70A 4LMUA 4HVHA 4ZSAA 5IA2A 4YBKA 5AR5A 4EH8A 2UZOA 3D83A 1BKXA 3P79A 5J7HA 3FC1X 3Q9YA 4IZYA 4Q2AA 3R9DA 5KMOA 5L6PA 4NJ3A 3POZA 3MFUA 5LVMA 5IQIA 4BZNA 1B39A 4CGAA 1GZNA 2XMYA 1UV5A 1KOAA 2YJRA 4BCKA 5GZAA 2CNUA 2WTJA 4DH5A 2IPXA 4PMPA 4O7SA 3K5UA 5H2UA 2QOQA 2VD5A 3OCSA 3FKNA 4N4SA 3OT8A 2F57A 1VEBA 3HVCA 4O0UA 5ANGA 2VNWA 1FPUA 3QKKA 4MHAA 4TYGA 2C5OA 3WYYA 2OH0E 2YWVA 1ZYLA 5KMIA 4R7IA 4H1JA 2UW7A 2HYYA 3FSFA 2YISA 3QTRA 3JUHA 4MEDA 3V8TA 4XLVA 2HZ4A 2PZ5A 3CP9A 3D7ZA 3HA8A 4DEDA 5CSHA 3CLYA 2VWXA 5EQPA 3EL8A 3HP2A 4ACMA 3QQKA 3NR9A 4BDGA 4E4NA 2P4IA 2UVYA 1CSNA 2HWOA 2XJ2A 4CQGA 4UMPA 1Y8GA 3KC3A 3VUHA 4EYJA 2PU8A 1Y6BA 4HCTA 3VQHA 1WBVA 2VTOA 3H0YA 3OZ6A 3WIGA 5LWNA 3BYOA 4FUXA 4TKSA 4UN0C 5IDPA 4C38A 5CEIA 2V55A 3K2LA 5ITAA 3DK3A 3VS6A 3GOPA 5M44A 3PWYA 3ZXZA 2XRWA 5CAPA 2O2UA 2VV9A 2WAJA 4QTBA 5HE0A 4DFLA 4YJOA 4D4RA 5DPVA 3UC3A 2PHKA 4W4XA 5BVNA 4AZSA 2XNEA 3EQCA 5AIKA 3IQ7A 4AZTA 4EH3A 4GW8A 4P2KA 3W55A 4C36A 4WRSA 4RJ8A 1PMVA 4IFGA 3OEFX 2C6IA 3RKBA 2PVRA 3GFEA 4ITIA 4K11A 3PZEA 4L00A 3FLWA 1J7UA 4ZJIA 3ZUTA 4EZ5A 3QQGA 4QTDA 3QAME 1R0EA 4L9IA 3BGPA 2CNVA 2PPQA 4AT5A 3I5NA 1QL6A 4YZDA 4TN6A 5AA9A 4WRGA 5J9YA 3SA0A 3NCGA 3ZDUA 2SRCA 4I0SA 5IQAA 2GCDA 1FBNA 3SG9A 4F99A 5I3RA 3C4CA 3DXPA 2O64A 2W1ZA 3BKBA 3OXZA 5CU3A 5ETFA 5GINE 2R2PA 3PJ8A 2Q83A 2W7XA 2RKUA 3DXNA 1QCFA 5HESA 2GHLA 2UZEA 4HCUA 2QHNA 4XG8A 3NNXA 3R8ZA 5AP6A 3QX4A 1OL5A 4RWJA 4E6DA 5DR2A 3I6WA 1OPLA 5K0XA 1TQMA 3LFFA 3QQJA 5E91A 5AUTA 1P14A 4BWPA 5HICA 1OKVA 3OWPA 3EYHA 2VWVA 4LQMA 3FXWA 3ZUUA 3KRWA 2W1GA 4AE9A 4PRJA 1PXOA 1UNGA 4F0GA 3F66A 3EYGA 3FV8A 3HAMA 4RJ4A 3CXWA 4E6QA 4PNKA 2Z7LA 4DG3E 4Q5EA 5BYYA 3F2AA 5J8IA 3QRJA 5GZ8A 1WZYA 1KE7A 2HELA 5LJJA 2CGUA 1H1RA 2W06A 4X3FC 4BIDA 3QYWA 3UQGA 2AUHA 4KD1A 1Z5MA 5IKWA 3AD5A 1H08A 2JKKA 4FNYA 5HQ0A 2OJIA 2CMWA 4EOKA 3NIZA 5AIRA 4FODA 2W1FA 4LGGA 4XV1A 5FLFA 3VUTA 1IRKA 3UZTA 4QP1A 2ZV7A 4TWCA 5AV0A 2X6DA 1I44A 1WBPA 5EYKA 1U46A 4OTGA 4WBOA 3UIBA 1G8AA 5EQYA 4D0WA 3EN9A 3L9LA 2XCKA 2Y8OA 3E8CA 3U4WA 4AGWA 2C0IA 4HYUA 4R3PA 2X39A 1SVHA 2CPKE 3OUKA 3C9WA 5ANIA 3GOKA 5AP2A 3QZFA 4CMTA 3QD4A 4JRNA 4HYSA 4F6SA 2XK8A 2RFDA 4X3JA 3UOKA 2LAVA 4FKSA 1FINA 1YXTA 3L8SA 3LM0A 5EI2A 2H34A 5LCKA 4GJ2A 2XKCA 5KBRA 4O1PA 4Z3VA 4R77A 3PP0A 2HENA 4G6LA 2IZSA 4RC2A 5AX3A 5I9UA 1REJA 4X3FB 4FKUA 3MB6A 1XKKA 3CD8A 3GQLA 3DLSA 4I6FA 4TY1A 1ZZLA 3ORZA 3SKCA 5JFXA 3A8XA 5FEQA 3COHA 2WMUA 3BEAA 4I24A 2I0YA 3H9RA 1YW2A 4GT5A 5FRIA 1YHWA 3DTWA 3HNGA 4YC3A 3IDCA 5DOSA 3EQGA 2VTMA 5E8YA 5I9WA 5L2SA 3QZHA 3NVMB 2PVFA 3PYYA 4PDOA 4L7FA 5CYIA 3S2PA 1TQPA 3GENA 3W2CA 5KMNA 4YJSA 3KN6A 5BVEA 1K3AA 2GNIA 3WARA 4YR8A 1AGWA 4XV2A 2X1NA 5IQBA 1OBGA 2R3MA 3EN6A 4C8BA 3SXRA 1BYGA 4OAVB 2R3JA 2R9SA 4BCGA 3IDBA 4QP9A 4XG2A 5IH4A 3OD6X 4A9SA 5HTBA 3GCQA 3QRKA 4U43A 4DLIA 5CZHA 4FZ7A 4BDAA 3H3CA 3KQ7A 4M69A 5DVRA 1GAGA 3NNWA 5H8EA 4BTJA 4DGMA 4EC8A 4TYJA 4R3RA 4ANSA 5JRQA 1YVJA 1M14A 2PMLX 2QCSA 3ROYA 4CQEA 3SVVA 1M2PA 1Q8TA 3CJGA 2BROA 3Q2JA 4YJNA 2HOGA 1UWJA 4LUEA 3Q6WA 3DQWA 5G1XA 3FJQE 1H26A 4R1YA 5FTQA 3R8VA 2B7AA 3R9HA 4OTWA 4N57A 4FOCA 3ZONA 4PDSA 3AT2A 3QTUA 3V51A 3FY0A 4BIBA 3QWJA 3FHIA 3ZH8A 4EK4A 3DFCB 5CU2A 5FDPA 4EUTA 4R5SA 2HXLA 3DA6A 4PPAA 5FD2A 4ZJVA 3R6XA 1JOWB 2VUWA 4L8MA 4I92A 4J7BA 3NUXA 4LL0A 5CI7A 3QQLA 3MDYA 3A4PA 3FSKA 3TNWA 2ZM4A 3FEGA 3DK7A 2WNTA 4YJQA 5I4NA 4DINA 2DS1A 4CSVA 2WTCA 4EJ7A 2PE1A 1PXIA 3V5LA 4F0IA 4FA2A 2C1BA 2QR8A 4GK4A 3W10A 4U5JA 4F9AA 2J6MA 3HDMA 4FSTA 4I3ZA 3TNIA 5A6NA 5GNKA 3OCTA 4QMYA 2CKPA 3ORTA 4G6OA 4B8LA 2VTHA 4GT3A 1IASA 4USDA 5L2WA 2BUJA 1O9UA 3ODZX 4G31A 3FI2A 3K3IA 4W8DA 5KE0A 3TACA 4AZFA 2X4FA 5HOAA 4KKHA 3OP5A 1H27A 4JBVA 1IA9A 1GZKA 5K9IA 3OBGA 1OIYA 4ORKA 2R3QA 2Z8CA 3GC0A 2I7QA 4D4VA 5FP5A 4EOQA 1AQ1A 4O84A 3UC4A 3LQ3A 3A7HA 2P3GX 4RIWA 5A3XA 2FSLX 2E9OA 3UYTA 4CFUA 3ZFXA 2V22A 1T46A 2PK9A 4IZ5A 5T3QA 5FG8A 4V05A 5K5XA 3GNIB 4M7IA 1Q61A 4O7LA 3I5ZA 2WQNA 3F69A 3EN5A 2GHGA 3MPMA 4KA3A 3A7JA 4RWIA 4KIOA 5EM6A 4FV5A 2HZNA 4RFYA 5T6KA 3ZSGA 5L4QA 2OIDA 2BIKB 5E8WA 3IECA 4IM2A 2YWPA 3FWQA 2YABA 2W1HA 4MYGA 2J0LA 4U8ZA 5EOLA 3RCDA 5FTGA 5FEDA 4AA5A 1PYXA 1NY3A 1O6YA 3KXGA 5C8NA 3D5UA 3C5IA 5CEQA 3V5WA 1QPCA 3E92A 3TXOA 1OVEA 2BZIB 2YAKA 4J96A 5AP3A 5FEEA 4YZMA 3FI8A 2QU5A 3RPVA 3KGAA 4EBWA 3T8OA 2WTKC 2WMAA 1F3MC 3ZBXA 5AUVA 3PSBA 1IAJA 2QOCA 3F2NA 3UIMA 1UU9A 3PTGA 4DEBA 4FKLA 4RIXA 5A6OA 4AN3A 4L67A 4NKSA 4JLCA 1VR2A 4EHVA 2XIRA 4XV9A 4WUAA 4BTMA 2QI8A 2C5VA 2VTAA 3EQFA 5ACBC 4EL9A 3S4QA 4GSBA 3TV4A 3PPJA 2B9IA 1IAHA 4WKQA 3POOA 4NKAA 3TZ8A 4ASZA 1J91A 5FQDC 4XG6A 4FKWA 5KKRC 4ZTMA 4J99A 4X2NA 5CT7A 4S32A 3E8EA 3R1SA 2UZNA 4DGGA 5A14A 2OZAA 3G51A 3GU7A 4IB0A 2WTKB 3EL7A 5JEBA 1PKGA 4JDHA 3FHRA 3HX4A 4PV0A 4O7WA 3F61A 5DT3A 5M07A 3GP0A 3CIKA 3VUDA 3I79A 1CM8A 2VTJA 3OEZA 4JQ7A 4MXAA 4G3DA 5EW8A 1UVRA 3ACKA 3U87A 4FL1A 4TYIA 3RAWA 2YM5A 4C58A 4MWIA 1RW8A 3NSZA 5AP5A 2BILB 3MFTA 4BGHA 4AFEA 2QODA 3U4UA 4FV0A 5CT0A 1YWVA 3MH1A 4JT3A 4JDJA 5E8UA 4ANMA 2Z2WA 2W4OA 4M69B 1ATPE 5AM7A 4C4IA 4TNBA 2VAGA 3EQRA 5KKRB 4Q5HA 3FI4A 5AV4A 3THBA 1UU8A 3G6GA 4M14A 2HWPA 5AADA 5IEYA 5DYJA 4LOOA 4MD8E 4BCOA 3EH9A 3QKMA 4FC0A 5D7VA 3N51A 4E5BA 2XF0A 1YOLA 1ZRZA 2PZIA 2UW4A 3D0EA 3MIYA 4M0YA 4LMNA 5I9VA 4DBXA 4AUAA 4I0RA 2EB3A 5E90A 4NM0A 4FV1A 4FSYA 2H6DA 2CHLA 2ITOA 2YIWA 4GG7A 3BBTB 1WBNA 5FXSA 4KUJA 2X7OA 5HE2A 3QA0A 4U40A 2OICA 1K9AA 4ACHA 2F49A 4A9YA 4S2ZA 2O65A 3FLYA 1FGIA 2OZOA 3NW5A 5JRSA 3C5UA 3OY1A 3Q5ZA 3WZEA 3PVWA 3KCKA 3LE6A 4UWCA 1NA7A 5TOZA 3BX5A 4HZRA 2QOIA 4A07A 5J9LA 2VO3A 3NYXA 4WHZA 3S00A 4QMSA 4OBQA 4YSJA 4PDYA 2HZ0A 5H8BA 1FMOE 2I0EA 1TQIA 3RNIA 4FT0A 2DQ7X 4GU9A 1G3NA 1CKIA 4XEYA 5M06A 2UZDA 4L44A 4DC2A 4JXFA 5HU9A 3VNTA 3RTPA 4UWYA 3NRMA 2B9JA 4I21A 1F0QA 1BMKA 4EZ7A 4FTMA 5JGAA 3VBVA 2C68A 1HCKA 4AGDA 2XCHA 2OIQA 5TKDA 3VS3A 4KS8A 4ZLOA 2GTMA 2UZLA 3P78A 2PMIA 4BCQA 2OXYA 1OB3A 4J52A 4RIWB 2NRYA 4UWBA 2QD9A 5LQFA 5LVPA 2IZRA 2J9MA 3DGKA 4KWPA 5JZNA 5CNOA 3OG7A 4ANQA 5A4EA 2IG7A 2C6LA 3DNEA 1T45A 3PA3A 3AMYA 3ITZA 2P2IA 4HVDA 5M55A 3DKCA 4BDJA 2VWUA 4ALVA 5CXHA 3QCXA 5BVFA 4ACDA 4ZZNA 4EOLA 1ZYSA 2V7OA 5CNNA 1Q24A 4IAYA 1M2QA 2ITXA 3B8QA 3HKOA 2OGVA 1YWRA 2BVAA 3MVJA 4QYEA 4APCA 2GNJA 4XV3A 5DN3A 5AAEA 1NW1A 3QX2A 2QLUA 3P4KA 2A1AB 4FIHA 3MYGA 3RZBA 4BCHA 3CPBA 2UW8A 2W1EA 3BU5A 4I6BA 4ZY5A 5IQCA 3UYSA 2ZMCA 1PJKA 4L53A 1GIIA 3PVBA 4O22A 2FSOX 1R39A 4ERKA 1XQZA 2YAAA 5I5ZA 3OXIA 3W2SA 4KBKA 2PVHA 4IJ9A 4RIXB 3O8UA 4UMRA 1PXNA 5A4TA 2G9XA 3V5JA 2F7XE 3AXWA 4GIHA 5D41A 4L6QA 4O1OA 5K4JA 2YERA 4QQ5A 2CLQA 3WILA 4K1BA 4O6LA 5ANOA 5AV1A 1H24A 4ZSEA 5HKMA 3A60A 2XJ0A 3DXQA 1I09A 3ZZEA 4FOBA 3EQDA 4Z9LA 4RX8A 4K6ZA 4EOJA 5B7VA 2VTIA 2IN6A 3VVHA 2VU3A 4QPAA 4RVKA 3DS6A 2VTNA 4FIEA 4Y5HA 5HVJA 1EH4A 3GQIA 5J5TA 3LFDA 5LMKA 2YDKA 2J0IA 5DMZA 3QCYA 2FSTX 2OZAB 4O0VA 3REPA 3V04A 4FEVA 4C34A 4F9CA 2R3LA 3DKGA 3VJNA 2PVLA 5BUIA 4BDDA 5K4IA 3A8WA 3G6HA 2C6DA 1YHVA 3N4TA 3ZXTA 4BYIA 3BWJA 4AACA 3HLLA 5CLPA 3GGFA 3QLGA 3HV5A 4ANOA 3SX9A 5IA3A 4DCAA 1Q99A 2GMXA 2J5FA 4FKOA 2W1IA 4L3LA 4GS6A 3MPTA 4FZ6A 4ITJA 1WAKA 1WCCA 2E9PA 2HIWA 4ZP5A 3U8WA 2OFVA 3H9OA 4FT9A 4RPVA 4O7NA 3GU8A 1ZZ2A 5HCZA 3RPSA 1Q62A 4JG6A 2W4KA 3ZS5A 4ALUA 5IUIA 4FSQA 2IZUA 4I5PA 2ZM3A 2WIHA 3PDTA 1LEZA 1YWNA 4E5WA 4ASXA 3NPCA 3AT3A 4O6EA 4ZSJA 4O7YA 3F3WA 2UW3A 3TI1A 3DFAA 2YIRA 4NH1A 5H3QA 2PVKA 3K5VA 5EH0A 2CN5A 1UWHA 4W4WA 5FUTA 2XK7A 4IC8A 4RA5A 4F63A 3IW4A 4Y73A 4CFMA 3QGYA 3OCBA 3IW6A 4BL1A 2EU9A 4FV6A 5IA0A 5HVYA 2XEYA 4C37A 1TKIA 3BLHA 4YTIA 2PVNA 5HBJA 5CI6A 3U9CA 3LFAA 4QMNA 1CMKE 5DIAA 4L3PA 3RWPA 2IWIA 2YZAA 4JOAA 2HW7A 3COKA 2I0VA 5CF8A 2QLQA 3DAJA 3EKKA 4RFMA 5GJGA 3PWDA 3F82A 1SMHA 4FTLA 3AG9A 2NNWB 4RX7A 3PXRA 4MF1A 3UOJA 3CQUA 3DNDA 1Z9XA 4IIRA 3S0OA 3U6JA 1WFCA 4X2GA 2QVSE 1XH6A 2GFSA 5C26A 3VUMA 3P7CA 2DUVA 2A2AA 3A61A 3Q9ZA 4G9RA 5HEZA 3KVWA 5IA1A 5D9HA 3MS9A 1CTPE 2LGCA 2YM6A 3OTUA 3HV3A 2Z7SA 4DE4A 3IS5A 2WZJA 3D2IA 2UZBA 1OECA 2VN9A 3O8PA 5TF9A 4F9WA 4DFBA 3QA8A 3W18A 4AE6A 3KMWA 5IA4A 3TKIA 4KIKA 1WBWA 4IANA 3TIZA 2FSMX 2NRUA 4PPBA 4U42A 1QMZA 2IVVA 1OBDA 1JWHA 4YZCA 3WF7A 3QTWA 3BU6A 4MX9A 1VYZA 3AC3A 3NIEA 2QOFA 4LG4A 4BRXA 4F4PA 5JQ8A 3SG8A 3DJ6A 5KZIA 4A9RA 4FZFB 5DG5A 4EWQA 4CVAA 5JMSA 3EN7A 2HW6A 1BX6A 5JFWA 1UNLA 3DCVA 4MD9E 4ONAA 4BYJA 4ZLYA 5BPYA 5D12A 4QP3A 3ZMMA 1JSTA 5M4CA 3BWFA 4FGBA 3OF0A 4RWKA 1IG1A 1DI9A 5CXZA 3TV7A 4FNXA 5EHLA 4NCTA 1NVSA 3BHYA 4O7RA 4FV3A 4YJTA 4ZMEA 1FOTA 3CR0A 4X3FA 4PQNA 5JK3A 4ZTLA 4EOSA 2RG5A 4R3CA 4Y72A 4M97A 5FWKK 4QYYA 4EOPA 5HLWA 2W0JA 3FMLA 1A9UA 1YOMA 4QMMA 2G1TA 3QBNA 4FICA 1DI8A 2VWYA 4EH9A 5LMKC 1MUOA 2Q0NA 2GTNA 4U81A 5CU4A 1KE5A 3CQWA 1U5RA 3ATSA 4AW2A 2ZM1A 4CZUA 4YP8A 4ZTSA 3OC1A 1FVRA 3HDNA 4C4JA 2XYNA 4M68A 2FH9A 1ERKA 3GU4A 2OLCA 5KUPA 2C6EA 3QLFA 5EDQA 4W4YA 2BZHB 3Q32A 5CSWA 2GQGA 2WKMA 2BHHA 3MTLA 3VQUA 2XM8A 4LOPA 1PKDA 2ZV8A 3BBWA 1QPDA 1XBAA 3QTSA 3ZFYA 3SV0A 3R1NA 4PPCA 1J7IA 1XJDA 3LJ2A 3O0GA 4AWIA 4PMSA 3LVPA 1SNUA 5J95A 4Y85A 4U9AA 4PWNA 5CQWA 4EEVA 2YDJA 5IH5A 3TWJA 3T3VA 5M4FA 5DR6A 4OR5A 4BTFA 3TUCA 4ID7A 4L43A 5GJFA 4WD5A 4QMWA 3PIZA 2ZAZA 4O2PA 4RIYA 3ZRMA 4DH7A 4U44A 4BCPA 4FIIA 4ZY6A 3KEXA 1NXKA 4FG9A 4ZZOA 3S1HA 4O38A 3ZCLA 5B2MA 1M7NA 4LYNA 4I41A 3IO7A 4DN5A 1MQ4A 2WD1A 4JBQA 4JDIA 4RQVA 4JVGA 5HVKA 4IC7A 3PSDA 3E8NA 3U6IA 4ZK5A 3DKFA 2X8IA 5BYZA 2F2UA 2JFLA 4AP7A 5J1WA 4RIOA 4FYOA 5IUHA 4M0ZA 2WOUA 4J1RA 4L42A 3C0GA 3PLSA 4GUEA 5EW9A 3GC7A 3ULIA 1PXKA 4P4CA 5BMMA 3UG1A 2E9NA 4ZTHA 2QG5A 4GH2A 4GYIA 2HAKA 5DA3A 4JS8A 4OTDA 2RF9A 3CCNA 3GCVA 2IW8A 4RC4A 5AP1A 4FTCA 4MQ1A 2RL5A 4BI1A 1Q3DA 2ETKA 1DAWA 3RBWA 1ZXEA 3C1XA 3R9RA 5DLSA 3F7WA 3VS4A 1GOLA 4ERWA 2I1MA 4UYAA 4ANNA 5HO6A 3G15A 1M2RA 3CSVA 3KREA 4PTCA 4BDHA 4CFVA 1HCLA 1IR3A 1V0PA 1UU7A 1ZARA 2FYSA 4EOMA 4EZ3A 1APME 3ACJA 5HBHA 4IFCA 3W33A 4FMQA 4NM3A 3VBTA 3ERKA 3NDMA 1YXSA 3KF4A 3C13A 2BRMA 1OM1A 2Z02A 2BIYA 4NM7A 5GZ9A 5I0BA 5LVNA 4Y83A 3DB8A 5F94A 3EQPA 2YA9A 2Z7RA 3UG2A 2UZTA 1KE9A 3LFCA 4AZEA 4BDFA 4AOJA 2PY3A 4YNEA 4NCTC 3JXWA 4IX5A 4PP9A 2ZVAA 4TWNA 2ERZE 2PSQA 2W05A 3AD6A 4JQEA 4KIPA 4P5ZA 2C47A 4TWOA 4XJ0A 3O8TA 4YZ9A 4BKYA 5L6OA 4NFNA 2HXQA 4QO9A 3R01A 4D0XA 1B6CB 3D9VA 3II5A 5KHWA 5KMKA 5TR6A 1OIRA 3EFLA 2GS6A 4KIKB 5CEMA 2OH4A 2C3IB 4QP8A 3AC8A 3P08A 3ZLXA 3CKXA 3UQFA 3HUBA 3L9NA 4GK3A 3VF8A 3VAPA 3LLAA 1XO2B 4ACGA 4HVGA 4H36A 4GK2A 3OWLA 3FMDA 3UZPA 4GG5A 3EQIA 5FXQA 1J3HA 3MW1A 3OWJA 3EOCA 2CLXA 1OMWA 5CTPA 3QD0A 5C4LA 4EH5A 2CGVA 5JT2A 4LFIA 4IADA 5T68A 3SHEA 2W1CA 2JFMA 4G3EA 5DGZA 4RVMA 3G2FA 3W1FA 3DLZA 3OROA 3R30A 3SC1A 2QU6A 2C6TA 1BI7A 4EJNA 2Y0AA 5E1EA 1H0WA 2C6OA 4FEQA 4YZNA 4C2WA 5EYCA 3FYJX 4JX7A 3MPAA 5JFVA 3UMXA 5CEKA 1V0OA 3BRBA 4DTBA 3OY3A 4C4HA 4CCUA 4OLIA 3HECA 4D9UA 3PA4A 2JDRA 3UODA 3LCTA 3R04A 4AOIA 4MXOA 2AYPA 4CZTA 4XOZA 3UTOA 2CGWA 4DFUA 4WNOA 4O2ZA 3LXKA 4QMZA 4YLLA 3FPMA 4JBPA 1YDSE 4FYNA 4D1XA 3UP7A 4F0FA 4UEUA 1YXVA 5IZFA 5AM6A 2AC5A 3FI3A 3Q4UA 2GPHA 4M66A 5J5SA 5DWRA 4AAAA 1PXMA 3NZ0A 4WBBB 3VW6A 4IW0A 2YJSA 2CKOA 1ZOEA 3FLNC 3CS9A 4M84A 3PG1A 5DE2A 3EKNA 4D4YA 4X2FA 4BC6A 5BVOA 3VBWA 4YU2A 3LFNA 3FY2A 5AP0A 5AUYA 3P1AA 4E4LA 4E1ZA 4FSWA 5JQ5A 2PTKA 3FZRA 3IOPA 4LV5A 3G9NA 4GYGA 2J90A 3AMBA 1DS5A 4G2FA 4QRCA 2RSVA 4RIYB 4Y95A 3ZTXA 4ZJJA 2YCFA 1S9IA 5HO7A 1XHAA 4HYHA 4GMYA 2R64A 3A7GA 4FSZA 5D7AA 4EK8A 4OTFA 5ANDA 3UVRA 2R3KA 2ZMDA 4XNEA 4YPSA 5AA8A 1UU3A 1M7QA 1ZLTA 4J97A 2WQEA 4KBAA 4NK9A 4S30A 4YTFA 5C4KA 1XBBA 3R0TA 3RPYA 3TJDA 3BELA 5AUUA 4TL0A 4K8AA 2JKMA 3TKUA 3O7LB 4TYHA 5ANJA 4B9DA 3GB2A 3D5XA 2JLDA 3IGOA 3BHHA 4NUSA 4NWMA 5IH6A 1OL2A 3PIYA 4MD7E 5LWMA 2BDWA 4IB1A 2QURA 3PZHA 4DEHA 2FB8A 4AGCA 2P0CA 2W17A 3PE2A 4AW5A 4MBIA 3KK8A 2XB7A 2HCKA 4EHZA 4MXZA 2BZJA 3I1AA 5DH3A 4FKRA 3SOAA 3D4QA 1W8CA 3OHTA 4QP7A 4ZAUA 2JBOA 2HK5A 2BDJA 3OS3A 4O0XA 4BGQA 4GIIA 1WBTA 4FE2A 5GHVA 2RGPA 4ANLA 1VJYA 5LVLA 5AWMA 4R78A 4FTKA 1UNHA 1H1QA 4QQCA 5BYLA 3MH3A 3HRCA 5AAGA 5ACKA 3A4OX 4CD0A 3GBZA 2EVAA 3QHWA 4RJ7A 3MVLA 4E5AX 5JFSA 4D55A 4FI1A 3WZUA 4CV9A 3VHEA 5HIDA 3H4JA 4RBLA 3AC4A 4B6LA 5IQHA 3ELJA 3L1SA 5HNBA 5M4IA 1OGUA 4BR3A 1DAYA 3JPVA 5ICPA 3VRZA 3MBLA 5AX9A 3NS9A 3MV5A 4BN1A 3WF8A 3Q4TA 4FTQA 4IH8A 5CENA 1URCA 4YNOA 3EZVA 4CMOA 4QMTA 4D2PA 1YDRE 3WE4A 2JAMA 5EOBA 4EH6A 1PMEA 5AV2A 5DT0A 3ZSIA 2XJ1A 5A4QA 4IVDA 2ZOQA 2JIUA 3OWKA 2J51A 3UPXA 4EC9A 3FXZA 2WTIA 4HGEA 4TPTA 4AT4A 2IO6A 5GIPE 4D58A 4FTIA 3BIZA 3HL7A 3DT1A 3PXKA 4UXLA 2VWBA 3L8PA 5CVGA 4RMZA 2J0KA 3QUDA 5DT4A 3RAKA 1PMUA 3VS1A 2BAQA 4WT6A 3T3UA 4FV8A 1JBPE 4K0YA 3UBDA 3OMVA 4HYIA 3RWQA 3PP1A 1W98A 2QR7A 4GV1A 4NW5A 2G2HA 2B53A 3BHUA 5HLNA 3G0FA 4H58A 4CYJA 5CEPA 5EYMA 3SGCA 2A19B 3D7TB 4GT4A 4P5QA 2BRHA 4GFGA 2OSCA 3FL5A 2J4ZA 3DZOA 3GUBA 4FT3A 2XNPA 4TZRA 4AS0A 3N4UA 3TKHA 4BGGA 4NT4A 3Q60A 3KXXA 4IM3A 3U55A 3F5PA 5HE3A 3ZOSA 3EHAA 3R02A 2WELA 4BI2A 4FKPA 4YJVA 2EWAA 4HPUE 5CALA 3LW0A 4TW9A 2UUEA 2WO6A 4O82A 1A48A 2WQBA 3R1YA 4NL0A 5M08A 4O0RA 3W8QA 3FZTA 2OBJA 3WE8A 3BE9A 1U4DA 3TNHA 3SRVA 2REIA 4GU6A 4X7QA 3S3IA 2B9FA 2WMTA 3ULZA 3AQVA 2P55A 4NIFA 4FL2A 3TNQB 4FSUA 4O0SA 2GS7A 3OOMA 4L01A 5H8GA 4JR7A 3D2KA 3ZRLA 4HNIA 2C30A 4MVFA 3VUGA 3AT4A 4C57A 3Q6UA 2PE0A 3CBLA 4AA0A 4XBUA 4YGAA 3F3ZA 3RM7A 4DH8A 5A9UA 1L3RE 5K3YA 1QPEA 2VTTA 3GXLA 4IWQA 4BDBA 4HJOA 3ZC5A 4EK5A 2O3PA 1PW2A 1KV2A 2X81A 4F64A 3GFWA 4FZAB 2WQOA 1H0VA 4BY9E 1OPKA 4CCBA 1H8FA 2BTSA 2ITWA 4MBJA 4I22A 4I93A 3HA6A 2UVXA 4RSSA 2YITA 3DOGA 2YCRA 3KXHA 3JYAA 4M12A 2C4GA 3BGQA 3RCJA 3K54A 1KSWA 3WZJA 4O86A 4F7JA 1Y8YA 1ZOGA 2CKEA 4OT6A 2X7FA 3D14A 3FKOA 3G5DA 2WMVA 3MI9A 2F4JA 2IW9A 5HCYA 1MRVA 5HX6A 4KIQA 3M42A 4UMUA 4ZS4A 2YIQA 3KRLA 3RNYA 3AGLA 4QD6A 2YCSA 3ZRKA 2XZSA 2VO7A 1Q4LA 3TTIA 1YXUA 4FSMA 4K18A 4I4EA 3BU3A 3FMMA 3LCOA 4PMMA 4BDEA 5A4LA 3R83A 3ZO2A 1STCE 3WF6A 4TYHB 5E8VA 3D5WA 3VN9A 3UO6A 3LHJA 1YHSA 2R0IA 2XKFA 4USEA 2ITNA 3HMIA 3U51A 5CSPA 4I6HA 4NTTA 5AJQA 3FC2A 3C4ZA 4U41A 2ONLC 1A06A 2GU8A 3C0HA 3OXTA 4X2KA 4AZWA 2WMBA 5C01A 4BCFA 2OXDA 5CU6A 4BCMA 4APPA 2OI4X 3ZU7A 1OIQA 3QUEA 2CN8A 2BRNA 2H8HA 4J95A 1U54A 4IAIA 5C8MA 2R3GA 4PF4A 2UZUE 3EMGA 3PY0A 2O5KA 2W1DA 3PJ1A 1RJBA 2PVJA 3MVMA 4GUBA 4OTHA 4C4EA 5CAOA 5DRBA 4UZDA 5CF6A 4D9TA 2JEDA 4RLLA 4L46A 3PJ3A 3DJ7A 3Q9XA 5EI8A 3UIXA 4JG8A 4IEBA 4LV8A 3P0MA 5EM7A 2PVYA 3A2CA 4XG9A 3W2OA 2CDZA 2GNLA 2ITTA 4QYGA 4AT3A 4IWDA 4QMXA 2XNGA 4UMQA 3OW4A 4NEUA 3IKAA 5E8XA 5AUZA 4B4LA 4DT9A 4PL5A 5FBNC 2C69A 3MFSA 4UY9A 2ETRA 3LOKA 4F7LA 4XP2A 3DZQA 2QKRA 2XIZA 3ZFMA 3MJ1A 3CC6A 4FTOA 5E9EA 2W99B 1YQJA 5EKOA 3RK9A 2BTRA 4AN2A 4BI0A 1LP4A 4CYIA 3C7QA 4U97A 5CASA 5HX8A 2VO6A 4MTAA 2BR1A 4LUDA 3BQRA 4I4FA 4JDKA 4OTIA 4GVAA 2G2IA 4W8EA 2YFXA 5ETAA 5G6VA 5DFPA 5KO1A 4E6CA 3SXSA 4DEIA 4IVAA 5KMLA 2CCIA 5I9YA 4YSMA 3GT8A 5JKGA 4L68A 3EFKA 5IDNA 4AGUA 1R1WA 4QQJA 4A9TA 2PUNA 2VGOA 3M11A 4DH3A 4E6AA 3FZPA 4EONA 5IQDA 2HZIA 1RDQE 4L52A 4Y46A 4IVBA 2V7AA 3LLTA 3F3VA 4C02A 5I9XA 5DEYA 1H01A 1O6LA 5E8SA 1UKHA 3M2WA 4FV7A 2VO0A 3LFSA 4C3RA 3QZGA 1W0XC 1XH8A 4FX3A 3OT3A 2R5TA 4CLIA 5EDPA 5B2LA 2VX1A 4I5CA 3QFVA 2XUUA 1BL6A 3NX8A 3R73A 4O91A 4QP2A 3O7LD 4S31A 4CKJA 5LMBA 1OL1A 2F7ZE 4RZWA 4IVCA 3VS2A 4IAFA 4EOIA 5BVDA 3RM6A 2X8EA 4IE9A 3BI6A 3KULA 4TT7A 3FZ1A 1ZYDA 5AR8A 2R7BA 3V3VA 1DM2A 3AC1A 5AR2A 1OKZA 1Q8UA 2OG8A 5EHYA 5IA5A 4CKRA 4FIJA 1JSVA 2X9FA 2XBAA 1WBSA 3BV3A 4F65A 4EQUA 4NM5A 3SRVB 5KHXA 3DV3A 1URWA 2A0CX 4FTRA 4J8MA 4NIFB 3JVSA 4DLJA 3HV7A 3Q53A 4CFFA 1V0BA 4RLKA 4NTSA 4FVQA 4X6RA 1GNGA 4C3PA 2PE2A 4QMQA 2YLFA 4R7BA 4G16A 3FPQA 1Y57A 4AW1A 3QTIA 4QNYA 4ZTRA 2C3JA 3IW5A 3R8PA 3RPRA 2EXEA 2V5QA 1U5QA 4BCNA 2QKWB 1Q8ZA 4FTTA 4RC3A 3RPOA 5CSXA 3TIYA 1OZ1A 4IXPA 4F7SA 1SYKA 4TYEA 5CX9A 3QYZA 4FV2A 4HOKA 4K2RA 3PXFA 1KUTA 3MA3A 4FF8A 2V0DA 4EH2A 3F5GA 4ALWA 4RA4A 3FKLA 3K3JA 3WIKA 2X6EA 3VO3A 4LGHA 2IZTA 4YJUA 5LXMA 1B38A 4RRVA 3A62A 2XK9A 1H1WA 4XX9A 5E8ZA 5AUXA 2OK1A 2X2KA 3QRUA 3V5QA 4WNPA 3TDWA 2ERKA 3HMPA 3LCKA 4IACA 3FQHA 2PMOX 5EDRA 5EFQA 2XIKA 3DY7A 2W5HA 3EQHA 4CV8A 4DFXE 1KE6A 4AFJA 2QOHA 1XH9A 3LAUA 4IAKA 4RX9A 1UA2A 4IQ6A 3QZIA 4IWPA 3W32A 3GC8A 3C4XA 3VBYA 2UW5A 3Q2MA 5AFVA 3L8XA 3EFJA 4R5YA 4ZZMA 3CPCA 1J1CA 2I40A 3ET7A 3QL8A 5IMEA 3JR1A 2WQMA 4N6YA 4EYMA 4TNDA 3TV6A 2BDFA 3E87A 1GZ8A 2WGJA 3P23A 5L6WL 2BFYA 4P90A 2WEVA 4I5MA 3V6SA 5M4UA 4XG3A 1V1KA 4C62A 3LMIA 4RQKA 4FKQA 3WF5A 3LXPA 4LOQA 3CGFA 3C4WA 3RI1A 4M3QA 3VS5A 1JSUA 3ANQA 3NUSA 3ZM4A 2B4SB 2C5YA 3FQEA 3PY3A 4E26A 3BLQA 1U54B 4FV4A 4H39A 3NYOA 3UVPA 4D2RA 4O0WA 2XK6A 1MQBA 1ZAOA 3QUPA 2OF2A 4EHGA 3DB6A 4F9BA 4I0TA 2XP2A 4BBMA 2CCHA 4CKIA 2XYUA 5F9EA 2R3RA 5ANKA 2GDOA 5BMSA 3BHVA 1LPUA 4TRLA 3RP9A 5EI6A 2J7TA 3E5AA 5CAVA 3E63A 2XVDA 4DG2E 1ZYJA 3BV2A 2YDIA 4YHFA 5J87A 2B1PA 2JKOA 3NNUA 3BHTA 1SZMA 2NPQA 5JSMA 4DAWA 3UO5A 2PZRA 1Q8YA 3I0QA 3UQCA 4WUNA 2EUFB 5HNIX 5E7RA 2VX3A 1E1VA 1BLXA 2VNYA 3KK9A 2PUUA 1ZOHA 2W96B 1Z57A 3V5TA 4ZTQA 3ATTA 3NYNA 2OJGA 2W9FB 4UBAA 3WZKA 3CY2A 4BKJA 3QWKA 4F9YA 4FIGA 2Q0BA 3NYVA 4W9XA 4CEGA 4A06A 4RFZA 1Q97A 2F9GA 5K5NA 3BEGA 1JQHA 3LMGA 4NSTA 3R2BA 3O23A 1Y6AA 3ODYX 3F5UA 3KN5A 3ORLA 4NZWB 2GFCA 4A4XA 3R9OA 4X6QC 3UZRA 2J0MB 2VX0A 3P7AA 1JNKA 2BMCA 2OO8X 2R0UA 3LCDA 4BDCA 3NMUF 3LFBA 2FA2A 5L8KA 5CQUA 1RE8A 3SOCA 3IW8A 4H3PA 1P4FA 2GQRA 5KBQA 3F2RA 4GKIA 5F95A 4X0MA 2WTWA 2WMQA 4ARKA 2ESMA 3HMNA 4CFWA 2WPAA 4DGLC 3QCQA 2B9HA 2OU7A 2RG6A 3A7IA 2Y6MA 2ZB1A 2VTLA 3W2RA 2VGPA 5HCXA 4MNFA 4B99A 3WI6A 3Q4CA 5BUJA 3QQFA 4IAZA 4XUFA 2WMSA 3SAYA 4A4LA 4UMTA 4D5HA 5IEVA 4ZMFA 4KRCA 3FXXA 2QOLA 4AXAA 3KULB 4YC8A 3LFEA 4S34A 4GL9A 4UYNA 5CZIA 4FZDB 4RJ5A 4YC6A 4O7TA 4Z16A 2BAKA 2PMNX 1GIJA 1P2AA 3LPBA 3LQ8A 4DGOA 1XWSA 2G15A 2Y9QA 4QT1A 3VHKA 4BVUA 3VRYA 5DBXA 1PXPA 3MN3A 2WMXA 4MCVA 2JGZA 2ITQA 3QC9A 4E20A 2BRBA 3NUYA 3RAHA 1F5QA 4FKGA 4MXYA 3BYSA 4FKJA 5LVOA 1M17A 4AZVA 4E8AA 2UW6A 4BHZA 4JQ8A 3CTQA 3ORPA 2WOTA 4GRBA 3R00A 3HV4A 4IB5A 3TN8A 3CTJA 3JVRA 4S33A 3E3BX 3OFMA 4KINA 3ORNA 4JAIA 2H96A 3ZO3A 4QQTA 4FNWA 3E64A 5AMNA 2CGXA 3E8DA 4QPMA 2O8YA 4F09A 5KCVA 4BWKA 3KY2A 1IA8A 1W83A 5FM2A 5FBOA 4OUCA 1G5SA 2XNMA 3I4BA 4MKCA 4R6VA 4ZLZA 4D1ZA 1HOWA 3TZ9A 2PZYA 3F88A 4LRJA 3V8WA 1KE8A 1YI3A 4FBXA 5HG5A 5A4CA 2PUPA 3WBLA 4FSRA 1Q8WA 5F1ZA 3FL4A 3T9TA 2PUIA 2XNBA 1MRYA 5I3OA 2ITVA 3NW7A 3CTHA 2PYWA 2OIBA 4JIAA 4U3YA 1BUHA 4AF3A 2C6MA 3HEGA 4QMUA 4LM5A 3DDQA 5BQ0A 3S95A 1REKA 3R22A 5L2TA 4UALA 2J2IB 3UPZA 1OITA 4OTRA 4XBRA 3ZEWA 3LIJA 3Q4ZA 4E7WA 1G8SA 4CXAA 1OKWA 3KFAA 3KL8A 3LZBA 3KVXA 4OW8A 5C9CA 3BZ3A 3TZMA 2CNQA 3HMMA 1ZMUA 3GCSA 2YHVA 3PUPA 3OOGA 4BHNA 4DEAA 5BNJA 4D4SA 3B2TA 4YTHA 3FMNA 4KSPA 3T9IA 5JN2A 2X2MA 3I6UA 3E62A 4R7HA 2PULA 4PY1A 5FDXA 3TUBA 4E93A 2OJJA 1YDTE 1PMNA 2W9ZB 2WFYA 1OL7A 1JLUE 2OJ9A 4IJPA 3VJOA 4QMVA 2VTQA 4EQCA 3DKOA 5CAQA 3R28A 3ETAA 3DBQA 3PLAE 3PA5A 1WMKA 5EM8A 3UJGA 5L2IA 5F4NA 1X8BA 5HZNA 1M52A 3KA0A 2ZB0A 4MF0A 4AX8A 4D2VA 3AGMA 3KRJA 3QXOA 3ZBFA 4O7ZA 3BYUA 3QTQA 3N9XA 5DNRA 1PXJA 3IPHA 4XP0A 2XM9A 4GCJA 5EKNA 4E4XA 4YHTA 2R3FA 4HPTE 2GNHA 3DBDA 4CT2A 1ZMWA 2XH5A 3R2YA 3QQUA 3R8UA 1H25A 5HHWA 2XIXA 3KU2A 4BZOA 4EI4A 2KULA 4A9UA 3EZRA 4G3FA 4AN9A 3R63A 1ZY4A 3D7TA 5CF5A 4OT5A 3PRFA 3QHRA 4A4OA 3R7EA 1Q41A 4EQMA 2P33A 1YOJA 1PY5A 3F3TA 2OFUA 4AOTA 2OF4A 2ZDTA 4KB8A 3R7UA 4E3CA 3RMFA 2UZVA 5E1SA 2YM8A 3QKLA 4FG8A 2F2CB 2J0JA 3RK7A 3CKWA 3C4FA 4XP3A 2RFNA 2IW6A 3FE3A 4RG0A 5IPJA 4G9CA 2B0QA 2WU6A 3VULA 1ZWSA 2BFXA 2R3NA 4C3FA 5M53A 3P5KA 1J7LA 4H3BA 4ZIMA 4D2WA 2WTDA 2YLEA 4MH7A 3U9NA 3HP5A 2X7GA 4GFOA 2BKKA 3SDJA 4Z7GA 2JDOA 3ORKA 2IJMA 1FMKA 2QHMA 3FLSA 3HRFA 4EKLA 5AP7A 4C61A 2JD5A 2G2FA 4FSNA 2QNJA 4GJ3A 4PTGA 3UIUA 4L45A 4EK3A 2VWZA 4XYFA 4YJRA 4RZVA 5TE0A 4G1WA 4I94A 3FMEA 5K0KA 1NVQA 5HG9A 5C27A 3DK6A 3NVKI 3UGCA 3E7OA 4O83A 5IUGA 4MNEA 4E73A 2QC6A 3CY3A 3PY1A 3TG1A 4C4GA 4IZAA 4U80A 1H07A 3KMMA 4DGNA 4F6WA 5CAUA 3UNKA 2PZPA 4ZOGA 5B2KA 4DYMA 3ID6C 1OPJA 1WVYA 3COIA 2QOKA 4FKVA 4IB3A 4XH6A 2BZKB 3QRIA 3N4VA 3KKVA 4MAOA 1W82A 4CNHA 3L9MA 3CEKA 5AR7A 3VIDA 3EQBA 3ZO1A 1JAMA 2CSNA 4PL4A 3BYMA 2JITA 4GKHA 1YXXA 4BF2A 3RZFA 3HYHA 1ND4A 4V0GA 4ZXTA 4K9YA 3F7ZA 3FMJA 3O71A 4B7TA 3RVGA 3QD3A 4DTAA 2ITUA 4WG4A 4NJDA 3A7FA 4BB4A 2YEXA 4MXCA 3LCSA 3PG3A 4FR4A 2YACA 4ZSGA 3IOKA 1PF8A 3W16A 2VRXA 3PRIA 3EN4A 1JKLA 3P86A 5D11A 4DFZE 2Y4IC 1OI9A 5AR3A 4EK6A 2UVZA 4II5A 3F5XA 3NWWA 3BYVA 3ORIA 4D2TA 3NCZA 5HG7A 2RFSA 5KMJA 2WU7A 5EM5A 3Q5IA 4JAJA 3B2WA 5C03A 4PP7A 5CVFA 2GNGA 3BGZA 4F7NA 4QP6A 4MWHA 4DG0E 2Y4PA 4DTKA 2YM7A 5BUEA 3E93A 1J1BA 4PTEA 2ZDUA 4QOXA 5CEOA 4Q9SA 4QTCA 5CSVA 5IU2A 4UB7A 2H9VA 5JH6A 3O17A 3L9PA 4NFMA 2GS2A 4ENXA 1XH5A 2QO7A 3SQQA 1PHKA 3PPZA 4D5KA 2PL0A 2WIPA 3G9LX 4IMYA 1XH4A 2B55A 4FTNA 4XMOA 3UVQA 2OWBA 2VWWA 2Y4IB 4WG5A 3JY9A 4DEEA 3KXMA 2XIYA 3MH0A 4NU1A 4G6NA 2QONA 2BPMA 2ONLA 3FLZA 3V6RA 3MTFA 3ZLSA 4CG8A 3MSSA 3FUPA 5LARA 4BDIA 4RT7A 3KCFA 2GNFA 3WZDA 4WO5A 4XOYA 4DBNA 4F1TA 3FMHA 4FL3A 5A54A 4AQCA 5J7BA 4C7TA 1P5EA 4OTQA 2A27A 5AUWA 2YN8A 3TNPC 5J9ZA 5LOHA 2YIXA 5HTCA 3ZM9A 2C1AA 2X2LA 3FLQA 3QTZA 4YBJA 4U79A 4FTAA 4A7CA 3GCPA 2J5EA 4TTHB 4X21A 1Q5KA 3UP2A 4I5HA 4IDVA 3ZDIA 1LUFA 5BVWA 4NW6A 3Q04A 3LM5A 4KAOA 1KOBA 3M1SA 3P9JA 4MQ2A 5HBEA 2OJFE 3G33A 2WXVA 3ANRA 5M57A 2E9UA 2XK4A 4N6ZA 1VYWA 2BAJA 4UV0A 3VBXA 4BFMA 3H0ZA 4QTEA 1JVPP 3NAXA 3QQHA 4G5JA 3HGKA 3PVUA 4GEOA 2A4LA 3C51A 2ETMA 3NNVA 5HGIA 4N0SA 3TT0A 4CTBA 2I6LA 4I20A 3MESA 1OUKA 2FO0A 4MXXA 4BWXA 4JL9A 4YO6A 5JGDA 2FUMA 3EWHA 2UW0A 4IDTA 1YI6A 4J53A 4QMOA 5TO8A 3VBQA 3W2QA 5IF1A 4FK3A 3LQ5A 2OW3A 3NGAA 3DDPA 1CKJA 5E92A 2XKDA 4FUYA 4IX6A 4QMLA 5HIBA 4ASDA 5KX8A 3KB7A 4K77A 5J1VA 2X9EA 3Q52A 5ETCA 5IQFA 1LEWA 4JG7A 1GJOA 3MA6A 4YJPA 2FGIA 5CVHA 4IHPA 4U6RA 4DFNA 5C8KA 3PVGA 3ALNA 2Z60A 1XH7A 2ZJWA 3V5PA 4Z7HA 3UDBA 4YLJA 4ACCA 3AD4A 5DRDA
chains in the Genus database with same CATH superfamily
4HNFA 4R8QA 5DHJA 4BDKA 5HORA 4RJ3A 1E1XA 2PVMA 4ITHA 4U3ZA 4YO4A 4HW7A 4O81A 4DF3A 1PYEA 5KZ0A 4O4FA 4O0YA 3BPRA 3W8LA 4HVIA 3U6HA 3G0EA 3EFWA 4BBEA 3DQXA 4DEGA 2EB2A 4MNEB 2J50A 4WG3A 4FTJA 3Q9WA 4GVJA 2C3LA 3HV6A 3PJCA 5D10A 3D15A 4I1ZA 4USFA 5HNGA 2C5XA 2JDVA 3LMHA 1KV1A 4PX6A 4XG7A 5H9BA 4HGSA 5C1QB 3EJ1A 4DHJA 4WA9A 3TM0A 2NP8A 2JDTA 4H05A 4G17A 4IX4A 3ZZWA 4BICA 3I60A 3TUDA 2XEZA 1BL7A 3BLAA 3TMOA 1OIUA 4B8MA 4FT5A 3CD3A 4LRKA 2WMRA 2ZV9A 5HG8A 5DI1A 2ITYA 3UE4A 3RHXA 4K33A 4V0GB 1GY3A 1L8TA 4WOVA 5GJDA 2R7IA 4D1SA 2QOOA 5CWZA 3RALA 4XS2A 4C0TA 4O0TA 4DITA 3NAYA 4OBOA 4AW0A 4CMUA 5IG1A 3ZUVA 2KTYA 3DBCA 3MFRA 4JRVA 4QYFA 1BI8A 3ZLYA 1FVVA 4F08A 4DA5A 5L8LA 1Y91A 3C0IA 2DYLA 3GC9A 4KNBA 4MBLA 5AR4A 4EKKA 4BCJA 4YURA 4IZ7A 4PUZA 3WF9A 3RJCA 5CF4A 4C59A 3BE2A 3NUPA 3R8LA 3RHKA 3MGYA 4F70A 4AXFA 1NVRA 4DCEA 2ACXA 4HVSA 4J71A 4CFXA 3ZEPA 2O0UA 4FEUA 3ZLWA 3UNJA 1PRYA 1G8JA 5L3AA 1W84A 3ALOA 2RFEA 2WMWA 3MY5A 2JDSA 2Y7JA 4MK0A 5AAFA 4XRLA 4ZSLA 4E4MA 3VWAA 3E3PA 3G90X 3MJ2A 3I0OA 3IW7A 3MH2A 3I81A 4U7ZA 4X2JA 3R7GA 1G8KA 5TT7A 3DBEA 3IG7A 3OVVA 1ZY5A 1GIHA 4FNZA 2QO9A 5EYDA 1R78A 3H10A 4QP4A 4WNMA 4XHKB 5A46A 3R1QA 3PXQA 4PNIA 4IAAA 1ZYCA 2W5AA 5EG3A 2GHMA 4D2SA 4EHEA 4NYEA 5EQEA 4M67A 4ZS0A 1MRUA 2XNNA 2FVDA 3OW3A 4Y8DA 4C4FA 3MY0A 4CRSA 4FKTA 3DU8A 3V01A 3HMOA 2JC6A 4F78A 1E9HA 4LL5A 4RVLA 4QTAA 5HLPA 3TL8A 3PPKA 4JBOA 4TXCA 4PL3A 4W9WA 1SNXA 4M8TA 1NT2A 4DHFA 3FYKX 4BKZA 4KKGA 3IGGA 3CE3A 4FIFA 4KABA 4KS7A 5BVKA 3ZO4A 4MUQA 3CGOA 1XMMA 2X0OA 2VZ6A 3DAKA 4FGRA 5HTIA 4PMTA 2IVUA 4KBCA 1W2FA 2WTVA 3DBFA 2UW9A 3A99A 3EB0A 3GEQA 3R71A 3RAIA 5ANEA 3VF9A 5FXRA 5HO8A 1H4LA 4O7VA 4FEWA 3VS0A 3I7CA 3FDNA 3LFQA 4UZHA 3MIAA 1YI4A 4H3QA 4JNWA 2C5NA 2EXCX 4UXQA 1WBOA 1FVTA 1SVGA 3PE1A 5DR9A 4FT7A 5HD7A 3HZTA 1H28A 3PJ2A 4LRMA 5D1JA 4AA4A 3BQCA 5KNJA 3MB7A 3QCSA 1JKTA 3R7OA 3ZHPC 3ZYAA 5LMAA 4QMPA 3COMA 3LJ1A 5L2QA 5IEXA 2BRGA 4WIHA 2Z7QA 1YRPA 2BKZA 3D5VA 5DEWA 5FTOA 3MY1A 4RWLA 4AG8A 5EHOA 1XBCA 1OKYA 3RK5A 1H1PA 5EK7A 4DFYA 1ZMVA 4YMJA 3GCUA 3ZC6A 1VZOA 2W5BA 3KXZA 2QO2A 4M15A 3O51A 3Q3BA 2V62A 2XK3A 3VUIA 2ZV2A 1RQQA 2UV2A 2X8DA 3QRTA 5B0XA 3LXNA 4C2VA 3U54A 3BL9A 3WYXA 4FEXA 3F6XA 4YTCA 3NUNA 2HY0A 4EOOA 4CT1A 3R21A 4IM0A 1FQ1B 2C6KA 2XBJA 2Y6OA 3DTCA 3KMUA 5KMMA 3OUNB 4EBVA 2QOBA 4O27B 1SM2A 2QQ7A 2CJMA 4EWHA 2GQSA 2XS0A 5BX0A 3D94A 4B0GA 2BCJA 4ZTNA 4FV9A 2ITPA 2IVTA 3ROCA 4M13A 4XLIA 4QPSA 3QF9A 4QYHA 3FZSA 4PDPA 4P7EA 1U59A 5IQEA 2RIOA 3R8MA 1WVXA 4FK6A 4W4VA 3CJFA 2BHEA 5AP4A 2UZWE 3R7IA 3VC4A 3B8RA 3LXLA 5IISA 2IVSA 1XMLA 4BBFA 4ZY4A 5IQGA 3C4EA 2JKQA 3OTVA 3RGFA 5JZJA 2I0HA 2IEWA 5F20A 3NLBA 2VTRA 3R9NA 1PXLA 4BIEA 4EUUA 5EW3A 2O63A 3RINA 4DHZA 5AEPA 2WEIA 3HUCA 2YM3A 3OBJA 3C50A 4D28A 4F6UA 4I23A 5FGKA 4CLJA 1CDKA 3PXZA 1S9JA 4RVTA 4LGDA 5M56A 2X4ZA 2ZYBA 1JKKA 5L8JA 4DH1A 2QG7A 3H9FA 4EH7A 1H1SA 4YLKA 2C0OA 5JGBA 3LKMA 1YKRA 4L3JA 2NO3A 1JKSA 3TTJA 4OBPA 1CKPA 2HY81 3GU5A 2VTSA 1XR1A 3IK3A 4O21A 4XG4A 4R1VA 2WB8A 4TWPA 3AOXA 4KSQA 3H30A 2YIYA 4AU8A 4HCVA 3BCEA 4C35A 3NUAA 2C3KA 3AC5A 1KWPA 3ENMA 3MVHA 3F3UA 4WNKA 4YZBA 2XNOA 3IONA 4JIKA 4EH4A 4XRJA 4YHJA 4IWOA 2R3IA 3GU6A 3L8VA 2R3HA 3DPKA 3UNZA 2CKQA 3UO4A 5HE1A 4ASEA 4Z55A 5CU0A 4WSYA 4Q9ZA 1IEPA 3DJ5A 2DWBA 3VUKA 1O6KA 4BZDA 4ENYA 4BCIA 4FG7A 2R3PA 2GSFA 3NEWA 3TCPA 3Q96A 4UX9A 4V04A 3IDPA 2G01A 3O2MA 1R3CA 3UOLA 4KKEA 2R3OA 4HZSA 3MWUA 4BTKA 1R0PA 4U0IA 4V01A 4C33A 3LJ0A 3PUFC 3QD2B 5HD4A 1AD5A 3O50A 3TZ7A 4CTCA 3HRBA 2YCQA 4HGLA 1UKIA 5CY3A 3P7BA 3QC4A 3TDVA 5HU3A 4YPDA 2JAVA 3KRXA 3SW4A 5M51A 1H00A 4QNAA 3R7YA 3W2PA 4YUQA 5CANA 3CQEA 3PFYA 4H1MA 2W4JA 5J79A 2E2BA 4HGTA 3WOWA 2JIVA 3TEIA 1TVOA 2C0TA 2JBPA 1MP8A 4G3CA 5LCJA 4WSQA 3O96A 3V8SA 3BLRA 4CFNA 3VS7A 5GIOE 2P2HA 5CS6A 4LI5A 2PWLA 3F9NA 3KRRA 5E4HA 2AQXA 3ZSHA 4JJRA 5I9ZA 2R4BA 5FM3A 3GVUA 1OUYA 3FZOA 4XCUA 2XA4A 4J98A 3ORMA 3ORXA 3DAEA 4DT8A 3AMAA 5AV3A 4CZYB 3OCGA 3QTXA 2VWIA 3KXNA 4F1OA 4DDGA 4G3GA 3W0OA 3E88A 1K2PA 3FQSA 4O96A 4RGJA 3QALE 3PIXA 4Y5QA 3R7VA 4QDVA 4I6QA 2B52A 4KRDA 4IX3A 3SW7A 2OKRA 4FKIA 4JR3A 1GZOA 2B54A 2EXMA 3E7VA 1OL6A 3VW8A 3QGWA 4FTUA 3EIDA 4OAUC 3UDZA 1W7HA 4RX5A 4J8NA 1WVWA 3UMWA 4OGRA 3UOHA 4U45A 3ENHA 3NW6A 2IF8A 3GI3A 5HI2A 1JPAA 5HIEA 3NUUA 2OXXA 4L7SA 2YZLA 1QPJA 3AC2A 4G5PA 3FBVA 2E9VA 3JY0A 4ZEGA 4JX3A 5E8TA 3QXPA 3PXYA 4IBMA 4F1MA 2X0GA 5IMXA 4CG9A 1FGKA 2XRUA 4JI9A 2VTPA 3SD0A 4OTPA 2WHBA 2YM4A 4CRLA 1P4OA 1LR4A 5FP6A 3SXFA 4RJ6A 3FAAA 3PFQA 4FVPA 2XKEA 3KF7A 3QU0A 3PSCA 3TJCA 2AC3A 4EORA 1SVEA 2F7EE 2BALA 4ANBA 4G34A 3HAVA 5ETIA 3FMKA 1Q3WA 5M09A 2ITZA 3I7BA 4FVRA 4GFMA 3JS2A 3SLSA 2JIIA 4N70A 4LMUA 4HVHA 4ZSAA 5IA2A 4YBKA 5AR5A 4EH8A 2UZOA 3D83A 1BKXA 3P79A 5J7HA 3FC1X 3Q9YA 4IZYA 4Q2AA 3R9DA 5KMOA 5L6PA 4NJ3A 3POZA 3MFUA 5LVMA 5IQIA 1OGYA 4BZNA 1B39A 4CGAA 1GZNA 2XMYA 1UV5A 1KOAA 2YJRA 4BCKA 5GZAA 2CNUA 2WTJA 4DH5A 2IPXA 4PMPA 4O7SA 3K5UA 5H2UA 2QOQA 2VD5A 3OCSA 3FKNA 4N4SA 3OT8A 2F57A 3TYKA 1VEBA 3HVCA 4O0UA 5ANGA 2VNWA 1FPUA 3QKKA 4MHAA 4TYGA 2C5OA 3WYYA 2OH0E 2YWVA 1ZYLA 5KMIA 4R7IA 4H1JA 2UW7A 2HYYA 3FSFA 2YISA 3QTRA 3JUHA 4MEDA 3V8TA 4XLVA 2HZ4A 2PZ5A 3CP9A 3D7ZA 3HA8A 4DEDA 5CSHA 3CLYA 2VWXA 5EQPA 3EL8A 3HP2A 4ACMA 3QQKA 3NR9A 4BDGA 4E4NA 2P4IA 2UVYA 1CSNA 2HWOA 2XJ2A 4CQGA 4UMPA 1Y8GA 3KC3A 3VUHA 4EYJA 2PU8A 1Y6BA 4HCTA 3VQHA 1WBVA 2VTOA 3H0YA 3OZ6A 3WIGA 5LWNA 3BYOA 4FUXA 4TKSA 4UN0C 5IDPA 4C38A 5CEIA 2V55A 3K2LA 5ITAA 3DK3A 3VS6A 3GOPA 5M44A 3PWYA 3ZXZA 2XRWA 5CAPA 2O2UA 2VV9A 2WAJA 4QTBA 5HE0A 4DFLA 4YJOA 4D4RA 5DPVA 3UC3A 2PHKA 4W4XA 5BVNA 4AZSA 2XNEA 3EQCA 5AIKA 3IQ7A 4AZTA 4EH3A 4GW8A 4P2KA 3W55A 4C36A 4WRSA 4RJ8A 1PMVA 4IFGA 3OEFX 2C6IA 3RKBA 2PVRA 3GFEA 4ITIA 4K11A 3PZEA 4L00A 3FLWA 1J7UA 4ZJIA 3ZUTA 4EZ5A 3QQGA 4QTDA 3QAME 1R0EA 4L9IA 3BGPA 2CNVA 2PPQA 4AT5A 3I5NA 1QL6A 4YZDA 4TN6A 5AA9A 4WRGA 5J9YA 3SA0A 3NCGA 3ZDUA 2SRCA 4I0SA 5IQAA 2GCDA 1FBNA 3SG9A 4F99A 5I3RA 3C4CA 3DXPA 2O64A 2W1ZA 3BKBA 3OXZA 5CU3A 5ETFA 5GINE 2R2PA 3PJ8A 2Q83A 2W7XA 2RKUA 3DXNA 1QCFA 5HESA 2GHLA 2UZEA 4HCUA 2QHNA 4XG8A 3NNXA 3R8ZA 5AP6A 3QX4A 1OL5A 4RWJA 4E6DA 5DR2A 3I6WA 1OPLA 5K0XA 1TQMA 3LFFA 3QQJA 5E91A 5AUTA 1P14A 4BWPA 5HICA 1OKVA 3OWPA 3EYHA 2VWVA 4LQMA 3FXWA 3ZUUA 3KRWA 2W1GA 4AE9A 4PRJA 1PXOA 1UNGA 4F0GA 3F66A 3EYGA 3FV8A 3HAMA 4RJ4A 3CXWA 4E6QA 4PNKA 2Z7LA 4DG3E 4Q5EA 5BYYA 3F2AA 5J8IA 3QRJA 5GZ8A 1WZYA 1KE7A 2HELA 5LJJA 2CGUA 1H1RA 2W06A 4X3FC 4BIDA 3QYWA 3UQGA 2AUHA 4KD1A 1Z5MA 5IKWA 3AD5A 1H08A 2JKKA 4FNYA 5HQ0A 2OJIA 2CMWA 4EOKA 3NIZA 5AIRA 4FODA 2W1FA 4LGGA 4XV1A 5FLFA 3VUTA 1IRKA 3UZTA 3P5JC 4QP1A 2ZV7A 4TWCA 5AV0A 2X6DA 1I44A 1WBPA 5EYKA 1U46A 4OTGA 4WBOA 3UIBA 1G8AA 5EQYA 4D0WA 3EN9A 3L9LA 2XCKA 2Y8OA 3E8CA 3U4WA 4AGWA 2C0IA 4HYUA 4R3PA 2X39A 1SVHA 2CPKE 3OUKA 3C9WA 5ANIA 3GOKA 5AP2A 3QZFA 4CMTA 3QD4A 4JRNA 4HYSA 4F6SA 2XK8A 2RFDA 4X3JA 3UOKA 2LAVA 4FKSA 1FINA 1YXTA 3L8SA 3LM0A 5EI2A 2H34A 5LCKA 4GJ2A 2XKCA 5KBRA 4O1PA 4Z3VA 4R77A 3PP0A 2HENA 4G6LA 2IZSA 4RC2A 5AX3A 5I9UA 1REJA 4X3FB 4FKUA 3MB6A 1XKKA 3CD8A 3GQLA 3DLSA 4I6FA 4TY1A 1ZZLA 3ORZA 3SKCA 5JFXA 3A8XA 5FEQA 3COHA 2WMUA 3BEAA 4I24A 2I0YA 3H9RA 1YW2A 4GT5A 5FRIA 1YHWA 3DTWA 3HNGA 4YC3A 3IDCA 5DOSA 3EQGA 2VTMA 5E8YA 5I9WA 5L2SA 3QZHA 3NVMB 2PVFA 3PYYA 4PDOA 4L7FA 5CYIA 2ZFYA 3S2PA 1TQPA 3GENA 3W2CA 5KMNA 4YJSA 3KN6A 5BVEA 1K3AA 2GNIA 3WARA 4YR8A 1AGWA 4XV2A 2X1NA 5IQBA 1OBGA 2R3MA 3EN6A 4C8BA 3SXRA 1BYGA 4OAVB 2R3JA 2R9SA 4BCGA 3IDBA 4QP9A 4XG2A 5IH4A 3OD6X 4A9SA 5HTBA 3GCQA 3QRKA 4U43A 4DLIA 5CZHA 4FZ7A 4BDAA 3H3CA 3KQ7A 4M69A 5DVRA 1GAGA 3NNWA 5H8EA 2XAOA 4BTJA 4DGMA 4EC8A 4TYJA 4R3RA 4ANSA 5JRQA 1YVJA 1M14A 2PMLX 2QCSA 3ROYA 4CQEA 3SVVA 1M2PA 1Q8TA 3CJGA 2BROA 3Q2JA 4YJNA 2HOGA 1UWJA 4LUEA 3Q6WA 3DQWA 5G1XA 3FJQE 1H26A 4R1YA 5FTQA 3R8VA 2B7AA 3R9HA 4OTWA 4N57A 4FOCA 3ZONA 4PDSA 3AT2A 3QTUA 3V51A 3FY0A 4BIBA 3QWJA 3FHIA 3ZH8A 4EK4A 3DFCB 5CU2A 5FDPA 4FRFA 4EUTA 4R5SA 2HXLA 3DA6A 4PPAA 5FD2A 4ZJVA 3R6XA 1JOWB 2VUWA 4L8MA 4I92A 4J7BA 3NUXA 4LL0A 5CI7A 3QQLA 3MDYA 3A4PA 3FSKA 3TNWA 2ZM4A 3FEGA 3DK7A 2WNTA 4YJQA 5I4NA 4DINA 2DS1A 4CSVA 2WTCA 4EJ7A 2PE1A 1PXIA 3V5LA 4F0IA 4FA2A 2C1BA 2QR8A 4GK4A 3W10A 4U5JA 4F9AA 2J6MA 3HDMA 4FSTA 4I3ZA 3TNIA 5A6NA 5GNKA 3OCTA 4QMYA 2CKPA 3ORTA 4G6OA 4B8LA 2VTHA 4GT3A 1IASA 4USDA 4LDTA 4DHIB 5L2WA 2BUJA 1O9UA 3ODZX 4G31A 3FI2A 3K3IA 4W8DA 5KE0A 3TACA 4AZFA 2X4FA 5HOAA 4KKHA 3OP5A 1H27A 4JBVA 1IA9A 1GZKA 5K9IA 3OBGA 1OIYA 4ORKA 2R3QA 2Z8CA 3GC0A 2I7QA 4D4VA 5FP5A 4EOQA 1AQ1A 4O84A 3UC4A 3LQ3A 3A7HA 2P3GX 4RIWA 5A3XA 2FSLX 2E9OA 3UYTA 4CFUA 3ZFXA 2V22A 1T46A 2PK9A 4IZ5A 5T3QA 5FG8A 4V05A 5K5XA 3GNIB 4M7IA 1Q61A 4O7LA 3I5ZA 2WQNA 3F69A 3EN5A 2GHGA 3MPMA 4KA3A 3A7JA 4RWIA 4KIOA 5EM6A 4FV5A 2HZNA 4RFYA 5T6KA 3ZSGA 5L4QA 2OIDA 2BIKB 5E8WA 3IECA 4IM2A 2YWPA 3FWQA 2YABA 2W1HA 4MYGA 2J0LA 4U8ZA 5EOLA 3RCDA 5FTGA 5FEDA 4AA5A 1PYXA 1NY3A 1O6YA 3KXGA 5C8NA 3D5UA 3C5IA 5CEQA 3V5WA 1QPCA 3E92A 3TXOA 1OVEA 2BZIB 2YAKA 4J96A 5AP3A 5FEEA 4YZMA 3FI8A 2QU5A 3RPVA 3KGAA 4EBWA 3T8OA 2WTKC 2WMAA 1F3MC 3ZBXA 5AUVA 3PSBA 1IAJA 2QOCA 3F2NA 3UIMA 1UU9A 3PTGA 4DEBA 4FKLA 4RIXA 5A6OA 4AN3A 4L67A 4NKSA 4JLCA 1VR2A 4EHVA 2XIRA 4XV9A 4WUAA 4BTMA 2QI8A 2C5VA 2VTAA 3NFFB 3EQFA 5ACBC 4EL9A 3S4QA 4GSBA 3TV4A 3PPJA 2B9IA 1IAHA 4WKQA 3POOA 4NKAA 3TZ8A 4ASZA 1J91A 5FQDC 4XG6A 4FKWA 5KKRC 4ZTMA 4J99A 4X2NA 5CT7A 4S32A 3E8EA 3R1SA 2UZNA 4DGGA 5A14A 2OZAA 3G51A 3GU7A 4IB0A 2WTKB 3EL7A 5JEBA 1PKGA 4JDHA 3FHRA 3HX4A 4PV0A 4O7WA 3F61A 5DT3A 5M07A 3GP0A 3CIKA 3VUDA 3I79A 1CM8A 2VTJA 3OEZA 4JQ7A 4MXAA 4G3DA 5EW8A 1UVRA 3ACKA 3U87A 4FL1A 4TYIA 3RAWA 2YM5A 4C58A 4MWIA 1RW8A 3NSZA 5AP5A 2BILB 3MFTA 4BGHA 4AFEA 2QODA 3U4UA 4FV0A 5CT0A 1YWVA 3MH1A 4JT3A 4JDJA 5E8UA 4ANMA 2Z2WA 2W4OA 4M69B 1ATPE 5AM7A 4C4IA 4TNBA 2VAGA 3EQRA 5KKRB 4Q5HA 3FI4A 5AV4A 1TFFA 3THBA 1UU8A 3G6GA 4M14A 2HWPA 5AADA 5IEYA 5DYJA 4LOOA 4MD8E 4BCOA 3EH9A 3QKMA 4FC0A 5D7VA 3N51A 4E5BA 2XF0A 1YOLA 1ZRZA 2PZIA 2UW4A 3D0EA 3MIYA 4M0YA 4LMNA 5I9VA 4DBXA 4AUAA 4I0RA 2EB3A 5E90A 4NM0A 4FV1A 4FSYA 2H6DA 2CHLA 2ITOA 2YIWA 4GG7A 3BBTB 1WBNA 5FXSA 4KUJA 2X7OA 5HE2A 3QA0A 4U40A 2OICA 1K9AA 4ACHA 2F49A 4A9YA 4S2ZA 2O65A 3FLYA 1FGIA 2OZOA 3NW5A 5JRSA 3C5UA 3OY1A 3Q5ZA 3WZEA 3PVWA 3KCKA 3LE6A 4UWCA 1NA7A 5TOZA 3BX5A 4HZRA 2QOIA 4A07A 5J9LA 2VO3A 3NYXA 4WHZA 3S00A 4QMSA 4OBQA 4YSJA 4PDYA 2HZ0A 5H8BA 1FMOE 2I0EA 1TQIA 3RNIA 4FT0A 2DQ7X 4GU9A 1G3NA 1CKIA 4XEYA 5M06A 2UZDA 4L44A 4DC2A 4JXFA 5HU9A 3VNTA 3RTPA 4UWYA 3NRMA 2B9JA 4I21A 1F0QA 1BMKA 4EZ7A 4FTMA 2X0PA 5JGAA 3VBVA 2C68A 1HCKA 4AGDA 2XCHA 2OIQA 5TKDA 3VS3A 4KS8A 4ZLOA 2GTMA 2UZLA 3P78A 2PMIA 4BCQA 2OXYA 1OB3A 4J52A 4RIWB 2NRYA 4UWBA 2QD9A 5LQFA 5LVPA 2IZRA 2J9MA 3DGKA 4KWPA 5JZNA 5CNOA 3OG7A 4ANQA 5A4EA 2IG7A 2C6LA 3DNEA 1T45A 3PA3A 3AMYA 3ITZA 2P2IA 4HVDA 5M55A 3DKCA 4BDJA 2VWUA 4ALVA 5CXHA 2XAMA 3QCXA 5BVFA 4ACDA 4ZZNA 4EOLA 1ZYSA 2V7OA 5CNNA 1Q24A 4IAYA 1M2QA 2ITXA 3B8QA 3HKOA 3O5AA 4AAYA 2OGVA 1YWRA 2BVAA 3MVJA 4QYEA 4APCA 2GNJA 4XV3A 5DN3A 5AAEA 1NW1A 3QX2A 2QLUA 3P4KA 2A1AB 4FIHA 3MYGA 3RZBA 4BCHA 3CPBA 2UW8A 2W1EA 3BU5A 4I6BA 4ZY5A 5IQCA 3UYSA 2ZMCA 1PJKA 4L53A 1GIIA 3PVBA 4O22A 2FSOX 1R39A 4ERKA 1XQZA 2YAAA 5I5ZA 3OXIA 3W2SA 4KBKA 2PVHA 4IJ9A 4RIXB 3O8UA 4UMRA 1PXNA 5A4TA 2G9XA 3V5JA 2F7XE 3AXWA 4GIHA 5D41A 4L6QA 4O1OA 5K4JA 2YERA 4QQ5A 2CLQA 3WILA 4K1BA 4O6LA 5ANOA 5AV1A 1H24A 4ZSEA 5HKMA 3A60A 2XJ0A 3DXQA 1I09A 3ZZEA 4FOBA 2XALA 3EQDA 4Z9LA 4RX8A 4K6ZA 4EOJA 5B7VA 2VTIA 2IN6A 3VVHA 2VU3A 4QPAA 4RVKA 3DS6A 3ML1A 2VTNA 4FIEA 4Y5HA 5HVJA 1EH4A 3GQIA 5J5TA 3LFDA 5LMKA 2YDKA 2J0IA 5DMZA 3QCYA 2FSTX 2OZAB 4O0VA 3REPA 3V04A 4FEVA 3W0NA 4C34A 4F9CA 2R3LA 3DKGA 3VJNA 2PVLA 4O4CA 5BUIA 4BDDA 5K4IA 3A8WA 3G6HA 2C6DA 1YHVA 3N4TA 3ZXTA 4BYIA 3BWJA 4AACA 3HLLA 5CLPA 3GGFA 3QLGA 3HV5A 4ANOA 3SX9A 5IA3A 4DCAA 1Q99A 2GMXA 2J5FA 4FKOA 2W1IA 4L3LA 4GS6A 3MPTA 4FZ6A 4ITJA 1WAKA 1WCCA 2E9PA 2HIWA 4ZP5A 3U8WA 2OFVA 3H9OA 4FT9A 4RPVA 4O7NA 4DDIA 3GU8A 1ZZ2A 5HCZA 3RPSA 1Q62A 4JG6A 2W4KA 3ZS5A 4ALUA 5IUIA 4FSQA 2IZUA 4I5PA 2ZM3A 2WIHA 3PDTA 1LEZA 1YWNA 4E5WA 4ASXA 3NPCA 3AT3A 4O6EA 4ZSJA 4O7YA 3F3WA 2UW3A 3TI1A 3DFAA 2YIRA 4NH1A 5H3QA 2PVKA 3K5VA 5EH0A 2CN5A 1UWHA 4W4WA 5FUTA 2XK7A 4IC8A 4RA5A 4F63A 3IW4A 4Y73A 4CFMA 3QGYA 3OCBA 3IW6A 4BL1A 2EU9A 4FV6A 5IA0A 5HVYA 2XEYA 4C37A 1TKIA 3BLHA 4YTIA 2PVNA 5HBJA 5CI6A 3U9CA 3LFAA 4QMNA 1CMKE 5DIAA 4L3PA 3RWPA 2IWIA 2YZAA 4JOAA 2HW7A 3COKA 2I0VA 5CF8A 2QLQA 3DAJA 3EKKA 4RFMA 5GJGA 3PWDA 3F82A 1SMHA 4FTLA 3AG9A 2NNWB 4RX7A 3PXRA 4MF1A 3UOJA 3CQUA 3DNDA 1Z9XA 4IIRA 3S0OA 3U6JA 1WFCA 4X2GA 2QVSE 1XH6A 2GFSA 5C26A 3VUMA 3P7CA 2DUVA 2A2AA 3A61A 3Q9ZA 4G9RA 5HEZA 3KVWA 5IA1A 5D9HA 3MS9A 1CTPE 2LGCA 2YM6A 3OTUA 3HV3A 2Z7SA 4DE4A 3IS5A 2WZJA 3D2IA 2UZBA 1OECA 2VN9A 3O8PA 5TF9A 4F9WA 4DFBA 3QA8A 3W18A 4AE6A 4QDEA 3KMWA 5IA4A 3TKIA 4KIKA 1WBWA 4IANA 3TIZA 2FSMX 2NRUA 4PPBA 4U42A 1QMZA 2IVVA 1OBDA 3KIOC 1JWHA 4YZCA 3WF7A 3QTWA 3BU6A 4MX9A 3VONA 1VYZA 3AC3A 3NIEA 2QOFA 4LG4A 4BRXA 4F4PA 5JQ8A 3SG8A 3DJ6A 5KZIA 4A9RA 4FZFB 5DG5A 4EWQA 4CVAA 5JMSA 3EN7A 2HW6A 1BX6A 5JFWA 1UNLA 3DCVA 4MD9E 4ONAA 4BYJA 4ZLYA 5BPYA 5D12A 4QP3A 3ZMMA 1JSTA 5M4CA 3BWFA 4FGBA 3OF0A 4RWKA 1IG1A 1DI9A 5CXZA 3TV7A 4FNXA 5EHLA 4NCTA 1NVSA 3BHYA 4O7RA 4FV3A 4YJTA 4ZMEA 1FOTA 3CR0A 4I6LA 4X3FA 4PQNA 5JK3A 4ZTLA 4EOSA 2RG5A 4R3CA 4Y72A 4M97A 5FWKK 4QYYA 4EOPA 5HLWA 2W0JA 3FMLA 1A9UA 1YOMA 4QMMA 2G1TA 3QBNA 4FICA 1DI8A 2VWYA 4EH9A 5LMKC 1MUOA 2Q0NA 2GTNA 4U81A 5CU4A 1KE5A 3CQWA 1U5RA 3ATSA 4AW2A 2ZM1A 4CZUA 4YP8A 4ZTSA 3OC1A 1FVRA 3HDNA 4C4JA 2XYNA 4M68A 2FH9A 1ERKA 3GU4A 2OLCA 5KUPA 2C6EA 3QLFA 5EDQA 4W4YA 2BZHB 3Q32A 5CSWA 2GQGA 2WKMA 2BHHA 3MTLA 3VQUA 2XM8A 4LOPA 1PKDA 2ZV8A 3BBWA 1QPDA 1XBAA