4JIAA

Jak2 kinase (jh1 domain) in complex with compound 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
298
Chain Sequence
b'SGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Amino-[1,2,4]triazolo[1,5-a]pyridines as JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 298
sequence length 300
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jiaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jiaA01
3UOKA 4TNBA 4RIXB 4XG4A 4MWHA 3IDPA 4AZWA 2FSLX 2XJ1A 2VO3A 3TL8A 3FZPA 4AZTA 4JDHA 3KU2A 3KRWA 4S33A 5BMSA 2HELA 4IAYA 4YJSA 3P4KA 4M14A 3GCVA 1MRYA 3I7BA 2WIPA 3FLZA 4FIGA 4D55A 4ZJJA 4EOJA 5CSPA 4RBLA 5HLPA 3UP2A 3F2RA 2NP8A 3DTCA 1KE6A 5K3YA 3SVVA 3JS2A 1PKDA 5CXHA 4QPMA 4XMOA 1Q62A 5TF9A 5I9XA 2J50A 2YAAA 3C7QA 5IZFA 3TI1A 1IA9A 2VTTA 1XH8A 2BTSA 1RE8A 3OW4A 4AGWA 5C8MA 4BKJA 4C3PA 4E6QA 3KREA 4OAUC 3DQWA 3NCZA 1DI8A 4HYIA 5EKNA 4CXAA 4F6UA 2PMLX 5BUIA 1XO2B 4L43A 3PYYA 3B8QA 4X2FA 2X7OA 4BI0A 2WOUA 4MXXA 4LRKA 3UNZA 4FSWA 3O8UA 2BFXA 3EKKA 4N0SA 3MN3A 4QYGA 2BVAA 3E62A 4GFOA 4I0SA 1OMWA 3QCYA 3FXXA 4JBOA 4QP8A 4QMXA 1PXKA 4W4YA 4EEVA 5L8KA 1LR4A 4IM0A 3T9TA 4IW0A 4F9BA 5AA8A 3ODZX 2WMAA 4G34A 5ICPA 5BNJA 3DFCB 2CPKE 3FPQA 4AGUA 4L7FA 4DYMA 2OJIA 1OL6A 2VWZA 4PWNA 3NIEA 2VWVA 4HPTE 4Q5EA 2W05A 3NS9A 3RPRA 5J79A 5M44A 2PUNA 4W4XA 3CKWA 3EL8A 3Q4CA 5CNNA 4GVAA 5AR2A 1ZOGA 3HUBA 4G3DA 4KBKA 5ACBC 2FSMX 3G90X 4EOLA 3MVHA 3PZEA 2Z8CA 3DK3A 3WZUA 4RIYA 3U9CA 5B7VA 3ORNA 3QU0A 1SNUA 4IC7A 4RPVA 5FRIA 3NLBA 4IAKA 4EOOA 2R3NA 4UWYA 3WZJA 5IEVA 3QWJA 4ZTNA 4FV5A 2B7AA 4XV9A 2ITPA 3UQGA 3EQPA 2BKKA 2IZTA 4FSQA 5DGZA 5JGDA 5M55A 5J9ZA 4L46A 4YPDA 2R3FA 3PA5A 1HCLA 5IU2A 3G9LX 3ULIA 4JI9A 5K0XA 3MTLA 3DAJA 2BTRA 3VWAA 1J1BA 4EOIA 4G3GA 3V8WA 3ZOSA 1HOWA 1YWRA 2PUIA 3FZRA 4U45A 5JKGA 4X3FB 4AN2A 5K9IA 5KMIA 4YBKA 3R83A 2NRYA 3GU8A 5CAPA 4BWKA 4EUUA 4FSUA 4ERKA 4PRJA 3U6HA 4YJVA 2C4GA 4V04A 2QHNA 3AD6A 4CKJA 3U6JA 1KUTA 3S1HA 1OPLA 4WG3A 3FSKA 3TCPA 5ANEA 4AT3A 2XNGA 3T8OA 3BIZA 2CJMA 4JBPA 5HO6A 5HTBA 1GZNA 1NT2A 4Z3VA 5IQFA 2VNWA 4RWJA 4WG4A 4Z55A 4F1TA 3QQKA 5E8VA 3E93A 3KMUA 2WQMA 4XLIA 1ZMUA 3RAKA 4ITHA 4L67A 5FBOA 4GW8A 2R0IA 2O2UA 4GK2A 2GHLA 4HZRA 4BZOA 2OH0E 2QOOA 3VN9A 4R8QA 5I4NA 1UWHA 3FQHA 4FE2A 4ARKA 4CTBA 4W8DA 4AQCA 4BBFA 3O51A 2PU8A 5CY3A 4WA9A 4FT9A 4D2WA 4IX3A 4E6DA 4USEA 4ASDA 3E7VA 4YJNA 4I5MA 2PYWA 4QPSA 2O63A 2JDRA 3KF7A 5I9UA 3DZQA 3MH0A 3O2MA 2HAKA 3ORZA 5FTOA 3W55A 4CMTA 4F0GA 2NNWB 4NM5A 4EC9A 3NAXA 1ZOHA 5C03A 4LG4A 1XH6A 4HVHA 2XB7A 2JIUA 3EOCA 3FKOA 4IDTA 5CEKA 2PE1A 2X8EA 5ANGA 5HTCA 1JSTA 3GEQA 2XEYA 3OG7A 4R3RA 4R7BA 4I6QA 2C5YA 2IW8A 4OTQA 1B6CB 4HNFA 4TWCA 4FEUA 3H9OA 4I0TA 4RVLA 2YM5A 1JBPE 3VS3A 4O7SA 3BYSA 3FSFA 2C3JA 3E87A 4PMSA 3TZMA 3ORLA 3Q04A 3PRIA 5CF5A 4Z7GA 4FICA 4OW8A 3LM0A 5KO1A 4YPSA 2B9JA 1AGWA 2YCQA 3EN7A 4IB3A 4YJQA 3FY2A 4F99A 5T6KA 5IA3A 3RAWA 4ZSGA 4GS6A 4F6WA 5AUZA 4BBMA 3RNYA 2UZTA 4RJ6A 4L7SA 3QC9A 2W4OA 3R63A 3Q6WA 2QURA 4YO4A 2FA2A 3SXSA 2DWBA 2VTMA 2CDZA 4G3CA 4H1JA 4B7TA 4BCFA 3QX2A 5HU9A 4PX6A 3H3CA 2XS0A 5HKMA 3LFBA 3QRUA 1ZLTA 5EYCA 4G3EA 4TL0A 3L9LA 1W82A 1KSWA 5M07A 3R9RA 3DKFA 3ZO2A 3VBTA 4C2WA 4KIKB 4V0GA 4RX9A 5K4IA 2GSFA 3Q3BA 3WF5A 3TNWA 3R73A 1OPJA 5HVYA 3G9NA 4IX5A 1H1WA 4V0GB 3S4QA 3R8UA 2GTMA 4LM5A 1MP8A 2QLUA 3CQEA 3FHIA 3KN6A 4YTHA 4PQNA 4PTEA 5IF1A 3H9RA 1Q8YA 5L2QA 4MVFA 4U3ZA 3T3VA 4FL1A 1A48A 1PMEA 1Q41A 3TKHA 3KA0A 4QMWA 4BIBA 1WFCA 3C4CA 4G16A 3HV6A 3RINA 3LFAA 1SVGA 3PSCA 2JLDA 4E4NA 4A4XA 5K5XA 3O71A 5M4CA 4J97A 2C30A 3FZTA 3C0IA 2VTIA 4QMUA 1M7QA 3M42A 4PNKA 3LCSA 1ZYDA 1ZY5A 3FL4A 3ZO3A 5AP1A 3A61A 1GIIA 1ZWSA 2X8DA 2QG7A 2DYLA 4TTHB 3FYKX 5CEQA 2BALA 2QVSE 3VUHA 1TKIA 5IQIA 1RDQE 5FD2A 5CAOA 4I24A 4QTBA 4WIHA 3BHHA 4KSPA 4I3ZA 4IADA 1OL2A 3QYZA 1CTPE 1PMVA 4R77A 4DGOA 3A7GA 2GHMA 4P7EA 3GXLA 2BAKA 1PYEA 3JXWA 5CVHA 1P5EA 4AZVA 5G6VA 4F64A 5CWZA 4M0YA 4BF2A 3D2KA 4AXAA 3NEWA 3UQCA 1V0PA 1YWVA 3IDBA 5AIKA 1FMOE 3VS4A 1O6LA 4M3QA 3QCSA 2QOIA 2YM4A 4ZTHA 3SGCA 3RCDA 4BCNA 2CNUA 3DNEA 3LM5A 4E1ZA 4FODA 5HLWA 4FEVA 3V5LA 1URWA 2ZAZA 3P86A 4RC3A 4W4VA 3UPZA 3VUMA 4ALUA 2GNIA 2JKKA 2B9HA 4O7NA 4BIEA 2E9OA 2WOTA 4EOMA 4F4PA 4ZSJA 3ENMA 3QQLA 1DI9A 3ENHA 4P5QA 4TWPA 4C0TA 4ZLYA 4P5ZA 3DDQA 1NW1A 4EWHA 3FI3A 4X2GA 3UOLA 3NZ0A 3I0QA 5EI6A 5C8NA 4DEHA 4YLLA 5A9UA 4NU1A 5BYLA 3RAHA 1O6YA 2XIXA 1CKIA 2X4FA 3D15A 3UPXA 4DLJA 4TPTA 2WB8A 3UZPA 2BIYA 4OTDA 4O7VA 4EH5A 4L6QA 5F1ZA 1YHVA 2XM9A 2UW8A 3A60A 4B99A 1FPUA 1XBBA 1W98A 4B8MA 3OHTA 4F65A 1IR3A 4RWKA 3C5UA 3IGGA 3TWJA 4FOCA 2YIQA 3NPCA 4I23A 4B6LA 4EK5A 4LV8A 2QOQA 3MIAA 1GOLA 3VBQA 1FQ1B 4YZDA 5ETAA 2PVYA 3V51A 2QOCA 2WMQA 4YMJA 4QTCA 2J0LA 4EK4A 3VUGA 3FE3A 3QCXA 5AR3A 4AW0A 4CFMA 5AWMA 5E92A 2XKDA 4I5HA 4A06A 3S2PA 2ZB0A 3SC1A 3T9IA 2CGXA 1R39A 2HOGA 2QI8A 3N51A 5LJJA 2W1FA 4XOYA 3DKGA 3FXZA 1KOBA 5TKDA 2JEDA 2QQ7A 4ITIA 2X1NA 3CJGA 1MUOA 1BI7A 2JBPA 4L3LA 3HRCA 4MHAA 1MQBA 4ZTSA 4QQTA 2VD5A 3FI4A 3ZYAA 1ZZLA 4H39A 1SNXA 1BX6A 1V0BA 2RG6A 2OXYA 4AW2A 3R9HA 4X3JA 3CGFA 5CASA 4MD7E 2PVNA 4I22A 3WZDA 4JX7A 5EW9A 5HIDA 4J95A 4PDSA 2CCHA 5EQYA 4QMPA 4KS8A 3CCNA 2PTKA 4EONA 1ZMWA 4BDAA 4N57A 4DFUA 5L8JA 3Q4ZA 3TXOA 4GT3A 3SAYA 4WSQA 2QG5A 3R8VA 3FDNA 5AV3A 5ETIA 3UO6A 3Q53A 2GFSA 1APME 5EK7A 3ZRLA 3KKVA 5DR9A 4GSBA 3HA6A 1VR2A 3EMGA 1DAWA 5KHXA 1WVWA 3U87A 3NUXA 4XNEA 3RZFA 3NX8A 3M2WA 4GYGA 2RL5A 4DC2A 4X21A 5EI2A 1JQHA 3BBWA 4WRSA 3AG9A 5JZJA 2XJ0A 4YZNA 4L3PA 4M15A 4QMYA 3IQ7A 4P90A 5JK3A 3NUYA 2X6EA 1FVVA 3QZIA 4U43A 4IAZA 3LKMA 5DN3A 5D41A 1PXPA 2XM8A 3DJ6A 1YXSA 4L9IA 4AN3A 5EM6A 4ANBA 3TJDA 2WEIA 4RFYA 4CG8A 2JDSA 5E8YA 4AA0A 1M14A 4R7HA 2BFYA 5CQUA 4YSJA 5FUTA 2J90A 3PRFA 4BGQA 1Q61A 4WHZA 4DN5A 4A9SA 4FG8A 2W17A 3QTQA 3VF8A 5C8KA 3GU4A 1ZARA 3DXPA 3R1QA 4IZ7A 4EH3A 5LWNA 3G0FA 1BUHA 2XCHA 3HLLA 3F88A 4IB5A 4C4EA 4FBXA 1IAJA 2YISA 2QKRA 4IIRA 1H26A 1L8TA 3AC1A 2QOLA 4CFWA 5HGIA 4YNEA 5IEXA 4ASEA 5GIOE 3NNWA 4M66A 2A4LA 4IB0A 2C69A 4KB8A 2JKQA 5BVFA 2WHBA 5EHOA 5HG7A 3UBDA 5A4CA 1J7LA 2I7QA 1M2PA 4AT4A 3HL7A 4D4SA 4JIAA 4XG2A 2BZKB 3E3PA 3IECA 4PPBA 3CR0A 4ALVA 2H34A 4AWIA 4YUQA 1F5QA 2UZNA 2VTQA 4JT3A 5AV0A 5AV2A 2B9IA 4IWDA 1LEZA 4QMLA 3F5PA 3KF4A 3L8XA 4GT4A 4HGSA 5K0KA 3P5KA 1GJOA 1PXLA 4AGCA 4LI5A 2ERZE 2JKOA 1PMUA 3NUPA 2IG7A 2A19B 4IWOA 4U40A 1YHWA 2CKEA 3NUAA 5M51A 3EFJA 2X39A 3C1XA 2QODA 5T68A 5AM6A 3UGCA 3O8TA 4DF3A 4FTTA 3I6UA 1YDRE 2FVDA 4USFA 2VTNA 4R1VA 2OJJA 3BGPA 2R4BA 4DEDA 4S30A 4QOXA 2UZDA 1XWSA 4TT7A 2XNEA 4FV8A 5KUPA 3C51A 3DV3A 4LYNA 1Q99A 2HW6A 2ZV9A 4D1XA 2JGZA 4FTJA 3S95A 4DG3E 5LOHA 1OIQA 1JAMA 2PZYA 3MESA 2NO3A 3A2CA 3HKOA 1OL1A 4BCQA 5HCYA 3COKA 5GZAA 4G6OA 3LCTA 4J7BA 1T46A 5AP5A 3NYXA 5CAUA 4ZZNA 2F7XE 4AZEA 1OGUA 3HDMA 2HWPA 4ANQA 4E8AA 2CN5A 3AC5A 2QONA 2QO2A 2C6MA 3HX4A 4FKQA 3KC3A 2XUUA 4PV0A 1L3RE 3QD4A 3F7ZA 1XJDA 3D5UA 1TQIA 5HE3A 4UEUA 4ACDA 4EH7A 1G8AA 4M69B 4YZBA 5KE0A 3F2AA 5AMNA 4YLJA 3TV6A 5DRDA 4C38A 2EXEA 5DT0A 4KRCA 3DBFA 4XG7A 4C7TA 4F63A 4IANA 4IAAA 1Q4LA 5LXMA 4QP4A 4AE9A 5J9YA 5FM3A 4EK8A 3P9JA 2QO9A 3PP0A 2Z7LA 3A4OX 4XG3A 4CYIA 2ZB1A 2PVHA 4YGAA 1W7HA 4XX9A 3SV0A 4MD9E 5IPJA 2RFNA 4I94A 2JAVA 4C37A 4BCMA 3UZRA 3WBLA 4LGDA 4EHVA 3OT8A 3RP9A 4C36A 3DAKA 2R3HA 3KRXA 3PXRA 1Y6BA 4U44A 4QNAA 2ITQA 4G17A 4AZFA 4LUDA 4Y83A 2UVYA 1Q24A 1YOJA 3MBLA 2HCKA 4LMNA 4FKVA 5GJDA 4EYJA 2WNTA 4YP8A 2ZVAA 3RHKA 4MAOA 2IVUA 2O64A 3DU8A 3OOGA 4CTCA 4E6AA 2XCKA 4NK9A 4GFMA 4EKLA 2C6LA 2ZDUA 2UZLA 3PPKA 3FZ1A 4NEUA 3W2RA 3D9VA 4GU9A 3ZH8A 3BX5A 5AUTA 4Y73A 5J1VA 3RCJA 2WMRA 1KE7A 1YXXA 3H0YA 2H6DA 3DQXA 3OY3A 5E91A 3AMAA 3C0GA 3E8CA 4ZY4A 4GYIA 4IZ5A 5D10A 3GCPA 2WTDA 3R22A 4FL2A 3PIXA 4RJ5A 4CV9A 5HZNA 5JRSA 3ZFMA 4PP7A 3Q5IA 3NUUA 3FL5A 5C1QB 4FTUA 3C0HA 2C0OA 2OIBA 2RF9A 4MBLA 4ENYA 3UJGA 2X8IA 3ALNA 4P2KA 5LCJA 3GB2A 1H00A 2BILB 5AM7A 4EC8A 3NVMB 4DGLC 2GPHA 5E8SA 4C3FA 4R6VA 3ATSA 3W2OA 5CTPA 4ASZA 1TQPA 4FR4A 4G5PA 5LMKA 3G6GA 5CAVA 3I6WA 3GC0A 4CT2A 4IAIA 2YLEA 4IJPA 4O6LA 2XMYA 5IQBA 2ZM4A 3QHRA 4BDFA 3R7UA 5BVWA 2FYSA 3V5QA 5A6OA 3FMDA 3MH1A 3ZM4A 1GY3A 3IO7A 3PG3A 3G51A 4TWOA 5EFQA 2Y9QA 3JYAA 4FV4A 2JC6A 4FSNA 5EOLA 3W2SA 4RJ8A 4EZ5A 2OK1A 1FMKA 2VTAA 4EBVA 3RMFA 3G33A 2REIA 4FV9A 4RRVA 4JQEA 4FMQA 4I93A 4O0TA 3QTZA 3PVWA 5CSWA 2EXMA 2GHGA 3TTIA 4FF8A 4J98A 4X6QC 5BVOA 3PA3A 1REJA 3UTOA 5A14A 4FNYA 4EHGA 4O82A 4O7TA 3JVRA 4NKSA 2YDJA 3RPOA 1P4FA 3VO3A 3IW8A 4OTHA 4EOSA 2YZLA 3FMKA 3NDMA 4E26A 5FLFA 3L8SA 3N4VA 3RALA 4FA2A 2WQOA 5ANKA 3OWKA 2YHVA 5M57A 3EZRA 3KN5A 2XKCA 4Y72A 4EKKA 1X8BA 3MFTA 4HVDA 1U54A 5HO8A 2ONLC 3R04A 3HP5A 4DBNA 2G2HA 3MB6A 5G1XA 1VJYA 2VTJA 3LJ2A 2VU3A 2WTIA 1NY3A 3UNKA 3FC2A 3DOGA 4NUSA 3WOWA 4BGHA 5DT4A 4AUAA 2R3KA 4RIXA 3QAME 3EB0A 3CD3A 4FKJA 4FTMA 4XP2A 4L00A 5FGKA 3TUCA 2ZDTA 4I4EA 4L52A 2WZJA 4BDDA 5LQFA 3NRMA 5CSXA 2CKQA 5DLSA 4YJPA 4EQCA 3QTIA 2VO6A 2R0UA 5M09A 3E5AA 1JLUE 4B0GA 4MYGA 4ZJIA 4ZTMA 2J0IA 4BL1A 2C3KA 4MWIA 4CG9A 2ZV7A 4PMTA 4BGGA 1QPCA 2OF4A 3D2IA 3EN9A 4E73A 1XH5A 3F7WA 4JG7A 3TZ8A 2HIWA 2VWXA 3V01A 4BDEA 4RWLA 4BR3A 3GFWA 4MX9A 3TN8A 2H96A 3V8SA 5L2IA 4F9WA 4G3FA 5HD7A 4I5PA 3PJ8A 3BHVA 3QZHA 5JSMA 4O21A 3MDYA 4NCTA 4OTGA 3PUPA 4H05A 1H08A 3Q2MA 1PF8A 4FKWA 2XF0A 4X2KA 1XBAA 2BAQA 4C61A 4BZDA 2Q83A 4K77A 1J7UA 3WE8A 5IKWA 3R30A 2ACXA 4J53A 3RK7A 2FGIA 3EFWA 4QMMA 4BZNA 4FZ7A 5KBQA 4ZXTA 4UV0A 3OXZA 3FLNC 3EQHA 3QQUA 1XHAA 3LFFA 4I4FA 2PVKA 3V5PA 5JZNA 5B2KA 1H1RA 5F95A 3P1AA 4GH2A 2J0MB 5CT7A 4FKUA 4M84A 3ORTA 5AJQA 2R64A 1G3NA 3ORIA 2XRWA 4MH7A 4UXQA 4FUXA 3ZZWA 2YM8A 2PL0A 3LQ5A 3NYNA 3Q9YA 4WBOA 3UYSA 3I79A 3QTXA 5BVDA 3UVRA 3KRRA 2F7EE 3FLWA 4S31A 3O17A 5GINE 2ETMA 2VWWA 4U79A 3DB6A 4YHJA 3OMVA 2BDJA 4IX6A 5CEOA 1H1PA 4MEDA 4AFJA 5EOBA 3U9NA 3R7VA 3FLYA 3NUSA 3ZS5A 1Y57A 5EHYA 1CDKA 2ZJWA 3I1AA 2O65A 3NUNA 4FTAA 5I3OA 4U81A 4DFNA 5L3AA 4NFMA 1AQ1A 3IGOA 4CD0A 4K8AA 3UVPA 2Y4IC 1RJBA 3SKCA 2ITXA 4PPCA 3O0GA 4U80A 1UKIA 4D4VA 4HNIA 4RVMA 2UW5A 3O7LB 4FIFA 4E4LA 2YM6A 4CMUA 4X3FA 5E90A 3DB8A 2Z02A 4EQMA 3PVUA 3ULZA 2ZYBA 5CSHA 4IVBA 3IONA 1UU7A 4YC3A 2LAVA 3VQUA 3LFEA 2WKMA 4CNHA 5AUVA 4DBXA 4EUTA 2DUVA 5CT0A 4M97A 2YCSA 3UMXA 1GAGA 3RAIA 2JFLA 3PJ3A 3NNUA 3O8PA 2BZIB 5C01A 3P79A 2JDVA 3OVVA 4N4SA 4GUEA 1LPUA 4JXFA 2R7BA 2C6EA 3TTJA 5IUGA 3EKNA 4EH4A 1QL6A 1FVRA 3PJ2A 4DFBA 5CXZA 1OKVA 1KE8A 3K2LA 3KVXA 2J4ZA 3EQGA 4YURA 2X2KA 3K5UA 5H8GA 3SQQA 2PVMA 4QP3A 4F9AA 3EN4A 3O96A 2VWYA 3UO5A 4RG0A 4K1BA 2W0JA 3PE1A 2VTOA 4TYEA 5I9WA 1ZXEA 1ATPE 4PY1A 5ITAA 3ROCA 4DINA 5CF8A 4FNWA 2AUHA 4ITJA 3VBVA 5D12A 5EM8A 5M08A 2HWOA 3BE9A 2C6TA 3K3JA 2OIDA 3GU7A 1YQJA 4O96A 5BYYA 5LVPA 5HCZA 1LP4A 2R3LA 3K54A 3GI3A 2F49A 4JR7A 5D7AA 2IZSA 1OM1A 3A7FA 4UX9A 3ZLYA 4CFFA 5HICA 2W1ZA 1H8FA 2YCFA 2C5NA 5AP3A 3S00A 1PXJA 3OCTA 4GIHA 2XA4A 1OBDA 2PE2A 4PL4A 2CGUA 1ERKA 2X4ZA 4PDPA 4L45A 5EG3A 5IQHA 3COMA 5EYDA 5CSVA 4RQVA 4D1SA 2V55A 4FL3A 4CFXA 5IQEA 2QU5A 4RIOA 3SD0A 5EDPA 3UNJA 5AV4A 3KY2A 5J1WA 2ETRA 5E8ZA 4C02A 1PRYA 4FV0A 4OAVB 3FJQE 3EQCA 1TQMA 3VF9A 1H27A 5KMMA 4I6FA 1YOLA 3DKCA 3EFLA 4QMVA 4ZSLA 5J7BA 1PJKA 4ALWA 4XV2A 3FHRA 1ZMVA 2JITA 1JKKA 1YXUA 4NTTA 4S34A 4ZSEA 3LHJA 3EQDA 1ZYJA 4XP0A 5FQDC 2RKUA 2WMXA 2XYUA 5KHWA 2C5VA 2OICA 2QOBA 2W5AA 5DI1A 3E88A 3VAPA 4RIWB 2YACA 3BKBA 3D5VA 3QBNA 2CGVA 4CZUA 3C5IA 5FXSA 4BY9E 2F57A 4I0RA 5GHVA 2UZEA 1R0EA 4MXOA 5JRQA 1FINA 3GCUA 3CEKA 4EH2A 4FYNA 3AQVA 4QNYA 3KXZA 4H1MA 4R78A 3PVBA 4FT7A 4C59A 4L8MA 3HMIA 3Q96A 3AT3A 2EXCX 3DTWA 3DT1A 4G9RA 4KIKA 4ANSA 2QNJA 1MRUA 4HPUE 3R00A 4QYEA 4TW9A 3RK9A 2IJMA 2XEZA 5JGBA 2EUFB 4ZLZA 1OUKA 2B4SB 1Q8UA 3JUHA 3F66A 3JY9A 3LXLA 2VTLA 1NXKA 3OXIA 4AT5A 2G01A 4L42A 2GS7A 4X0MA 4XG8A 4EQUA 3CIKA 3V5TA 1SYKA 2XZSA 5B0XA 3SG8A 2UVXA 1E1XA 4NW5A 3EZVA 3FMLA 4R7IA 2VTPA 5DYJA 1URCA 2VZ6A 1S9IA 4FI1A 3RWQA 3NVKI 3DLZA 3ZHPC 3ZLXA 1KE9A 2X2LA 2QO7A 4BTMA 4PDOA 5AR5A 3EHAA 4USDA 4K9YA 4IVAA 5DFPA 4JQ8A 4AOJA 2W1GA 3MPTA 4F1MA 3GENA 2FO0A 5IMEA 2VAGA 3BU6A 3KK8A 4QTAA 3V6SA 3VULA 4C4JA 3CKXA 1U4DA 4RWIA 5IA0A 5JH6A 1F3MC 2IPXA 3QGYA 4WUNA 3W16A 3NNXA 2Q0BA 2VX3A 4Z9LA 4BDCA 5CF4A 4IC8A 2V22A 4IZYA 4RJ7A 5DT3A 5I0BA 3FWQA 4ZK5A 2HENA 2OI4X 4J8MA 2XP2A 5HEZA 3BHTA 1H25A 2IZUA 3THBA 4EH9A 4ZJVA 2YIXA 4TYJA 4FT0A 2OFVA 2OKRA 4MK0A 1W0XC 5HHWA 4JOAA 1R0PA 3GQIA 4KBCA 3GVUA 4DEGA 1WMKA 3CGOA 4ONAA 4DTAA 1NVSA 4GFGA 1WBVA 4MD8E 5AAFA 3VJNA 4CLJA 4MKCA 1EH4A 4EOKA 3BYUA 2PULA 4PMMA 5L4QA 3HRBA 5EDRA 3RKBA 3BU3A 1WBTA 1I09A 3EL7A 3A4PA 3AGLA 4E20A 5KMJA 2W4KA 5FBNC 1W83A 3HA8A 4OUCA 4O7RA 2UW4A 4IBMA 4MF1A 4F7SA 3Q2JA 2UVZA 3ZRKA 2X9EA 4C62A 3VW8A 4M0ZA 5L2TA 4EOQA 4PNIA 3IW5A 3EN5A 1JSUA 4BN1A 3O50A 3GC7A 4R5SA 4EBWA 4UMPA 1RW8A 4IZAA 3OY1A 2C3IB 4JL9A 3R8PA 1JSVA 3P23A 5BVKA 2O5KA 4QTEA 3QLGA 2BDWA 5FTQA 5KMOA 5J5SA 1YHSA 2GCDA 4JRVA 1OPKA 4BDGA 5IH4A 2F9GA 3FMHA 3KXMA 1PHKA 2I1MA 2OU7A 3AD5A 2WPAA 2ETKA 3HVCA 4JVGA 1WVXA 2JD5A 2UZVA 3HMNA 5C4LA 1Z5MA 4YBJA 4DEBA 3TNQB 3BRBA 4JLCA 4CKIA 3AMBA 3OBGA 3I7CA 1WCCA 3SXFA 3SW7A 2XK8A 4YJRA 3W2QA 1YVJA 4I21A 2ITZA 3TIZA 4CFNA 4D2RA 1UU3A 3GU6A 1IAHA 1PXIA 1BL6A 4RA5A 3H30A 4BICA 4N6YA 3EJ1A 3QRKA 3NIZA 3VUDA 3OF0A 2VO7A 2OGVA 4WO5A 3KULA 3PJCA 4IAFA 3LQ3A 2UZWE 3ERKA 1DAYA 3DZOA 1F0QA 3AC3A 3I81A 3ORXA 3KULB 3QTWA 4EH6A 2GTNA 3QKMA 3QRJA 3ZBFA 4FZDB 2R3OA 2W1DA 4FNXA 4ZEGA 4I5CA 2WQNA 4ZTRA 3WF9A 4NL0A 5TT7A 2J5EA 3QXOA 4AN9A 3SRVB 3VS7A 4LFIA 5AP0A 3E64A 4YTFA 4UYAA 1WBNA 4BKYA 3RPVA 4FKIA 3KRJA 5HBHA 3PPZA 1BMKA 3QXPA 3R9OA 3R8ZA 3KL8A 2C68A 4CQEA 5JFVA 2XVDA 4OTFA 3R7OA 1OKYA 2PVLA 3R8LA 1PW2A 5JEBA 5ETCA 3MY1A 4O83A 4DH3A 2WGJA 5DH3A 4FTOA 3KK9A 5EHLA 1VYZA 2CNQA 3R9NA 3VVHA 4GUBA 4F6SA 3EYGA 3TZ7A 5J95A 4U97A 5DR6A 5C26A 3BEGA 1VYWA 4BKZA 1SVEA 3GOKA 3EIDA 3PY3A 2XNBA 3F82A 3ZEWA 4PTGA 3SDJA 4OR5A 3RHXA 1IG1A 5IUHA 2PUUA 5CALA 4XYFA 1DS5A 4C3RA 4S2ZA 3UIBA 5ACKA 4A4LA 2HYYA 2WMWA 4O2ZA 4ANOA 3LXNA 5BUJA 4DA5A 2O8YA 3FY0A 3QTSA 4K33A 3WE4A 1M2RA 5IA4A 3GU5A 3F6XA 5EW8A 3W8QA 4F1OA 3IK3A 4NT4A 4QP9A 3SOCA 2UZBA 3FMMA 2PSQA 3KCFA 4XLVA 3HV3A 3BLQA 3P7AA 4Y5QA 3MVMA 3TV4A 4QMNA 4UYNA 3P7CA 5ANOA 5BX0A 2WEVA 3NW6A 4UBAA 4CSVA 3SX9A 2WTCA 1QPEA 5EM5A 5CU3A 3DAEA 5HNBA 5IEYA 2W4JA 4HCTA 2Y8OA 1XH9A 4HGEA 1OECA 1Z9XA 2BUJA 3MB7A 4IM3A 3GFEA 5H9BA 1GIJA 4MQ2A 2ITOA 2G9XA 3MA6A 4O22A 4JRNA 4CFUA 2JIIA 5D1JA 3NW5A 5A4QA 4KSQA 3MYGA 3D7ZA 2VX1A 4JQ7A 1OBGA 2HK5A 2J0KA 2YM7A 3BHYA 3VUKA 3BZ3A 4HVIA 3OUNB 4HGTA 3UC3A 4WT6A 3D83A 4IVCA 2F7ZE 5HCXA 4B9DA 4C35A 4D9UA 4XCUA 3PTGA 4ACMA 1J1CA 2OJGA 1O6KA 4WNMA 3ZO4A 4O7ZA 2UV2A 3ZDIA 3BYVA 4FTQA 3DY7A 2RG5A 4BDIA 1NA7A 4DHFA 1WZYA 3MH2A 4QRCA 3BI6A 3JVSA 3PFQA 3NYVA 3TKUA 5E1EA 2I0YA 5HI2A 3WF6A 3CPBA 2BRHA 5A4TA 5AUXA 2PHKA 3U8WA 3QKLA 3QCQA 2OZOA 2Y4IB 5BYZA 2XNOA 4JX3A 2PVRA 2VTHA 3DGKA 3AGMA 2IO6A 3LIJA 3PIZA 4FT3A 4M68A 5CS6A 4KIOA 2IW9A 3WIGA 3VUTA 3UOHA 3HV4A 4U8ZA 3Q60A 3ZU7A 3F69A 5HE0A 4E6CA 4ZAUA 4ZZOA 3HRFA 3MV5A 2W06A 3QA8A 4GJ3A 5FXRA 5CZHA 4LOPA 5LMBA 5FEQA 5BQ0A 3MFRA 1Y8YA 1HCKA 3QRIA 3TEIA 4F9YA 5HQ0A 4QTDA 4FV2A 2ITNA 4BDBA 2XIZA 3SG9A 2EU9A 1B38A 3L9NA 2XK4A 2IVTA 5C4KA 4FSZA 2ZOQA 3R0TA 4W9WA 2IW6A 3ZONA 4I1ZA 4XRJA 4H36A 4IWPA 4RC2A 4AG8A 3EWHA 1KWPA 2YIRA 3DLSA 4PF4A 4IJ9A 4F70A 5AP2A 4L44A 4WNOA 3PG1A 3C9WA 3KCKA 4R3PA 3G5DA 5CVGA 3Q4TA 4EWQA 4W4WA 5CI7A 3TACA 2OSCA 2RIOA 3SLSA 5HNGA 3OBJA 4DCAA 3R7YA 2YWPA 4JS8A 2IVVA 4H3QA 3G15A 3NYOA 4KUJA 5AIRA 2P4IA 4FZ6A 3BQRA 2HXLA 1LEWA 4FKSA 4HGLA 4QMQA 1YI4A 2BHEA 5HVKA 4YZCA 4NIFB 4FKOA 5E7RA 3U6IA 3LPBA 4DTKA 3ET7A 3P0MA 4M69A 4S32A 3ZSIA 4MTAA 1ZYLA 4WD5A 5A54A 3IOKA 4DH8A 2A2AA 4O7YA 1WBOA 4DCEA 2YERA 4BDKA 4KBAA 3F3TA 3QUDA 5C27A 2P0CA 4K18A 3VS6A 5AAGA 4G6NA 4FTKA 4I20A 4OGRA 3F3UA 5AR4A 3ID6C 3OEFX 4LQMA 4I6HA 5HG8A 2VX0A 3POZA 3ZLWA 2IWIA 4NH1A 4BC6A 3NWWA 3WARA 2F2UA 5DNRA 1ZOEA 3OCSA 3DCVA 5EH0A 3UO4A 2WAJA 4AOTA 3UIXA 4AX8A 3II5A 3QL8A 5GZ9A 4RMZA 1YW2A 4GG5A 4AGDA 1UKHA 5LMAA 3ZCLA 1WBSA 4U0IA 4GL9A 5E9EA 3U51A 3ZTXA 2FH9A 5JQ5A 1NVQA 3R71A 4QP1A 4MQ1A 4X2JA 3SW4A 2I40A 3W1FA 3BPRA 3SOAA 4A4OA 4AW5A 4D5HA 3ZO1A 2OXXA 3FUPA 3QTUA 4RVKA 3AC2A 4Q5HA 3ORPA 2PE0A 3RWPA 4G1WA 2JIVA 3CLYA 3GOPA 2BIKB 3HYHA 5A3XA 4C4GA 4R3CA 5LVNA 3VNTA 2JFMA 4FIHA 4PMPA 1Q8WA 5AUYA 2E9NA 5AUWA 5AA9A 4ZLOA 3COIA 5AX9A 1SVHA 4XJ0A 4LOQA 2W1HA 3F5UA 3QGWA 4N70A 3CQUA 3QC4A 2W5HA 4J1RA 4Y46A 5DBXA 4YTCA 2YEXA 3E8EA 1PXOA 3BU5A 5LVOA 4J99A 3F3ZA 2YZAA 3LMIA 4MBIA 2WTKC 2OO8X 2YFXA 4D2PA 5B2LA 4ZS4A 2Z7SA 4TYHA 1UU8A 3IPHA 4KAOA 1JKTA 3KXNA 3QQGA 4K2RA 1SM2A 2XK7A 4RX5A 3ATTA 4TYHB 4UXLA 4C4FA 1K2PA 4CV8A 1WBWA 1IASA 4PDYA 3PXQA 3PXYA 3QZGA 2E9UA 5KCVA 1CKJA 3GQLA 3R6XA 2Y6MA 4DGGA 4F7LA 4NTSA 3G2FA 1JOWB 3GNIB 4CGAA 1CKPA 3BE2A 4Y95A 2WU6A 2IZRA 2HW7A 5EYKA 1FOTA 3IKAA 4UN0C 3MY5A 3JPVA 3DA6A 4LRMA 2ZMDA 4R5YA 3BYOA 4N6ZA 3BV2A 4FEQA 4EZ3A 3R7GA 1ZZ2A 4FT5A 1Q8TA 3ZMMA 3E63A 4HYSA 2R3IA 2CHLA 5CZIA 2BDFA 4PL5A 2AYPA 3UIMA 2XKFA 4XEYA 4C4HA 2YITA 5M56A 4D2VA 2WTVA 3POOA 3HAMA 3LZBA 2UW7A 5DEYA 3UE4A 2G2FA 5I3RA 1SZMA 2P2IA 3OEZA 4NYEA 2RFSA 4XUFA 2YN8A 2H9VA 3QUPA 4XP3A 4JBQA 4B4LA 2W99B 4QYHA 2PMNX 2GMXA 4QYFA 4BTJA 3A99A 4FYOA 3D5XA 4GK4A 4MNEA 4XS2A 3CBLA 2BRGA 3DBEA 3HEGA 3MGYA 4OT5A 4PUZA 4FC0A 3KXXA 3LCKA 2WQEA 4E93A 3D0EA 4MNEB 2V7OA 4TWNA 5CLPA 3LLTA 4C4IA 3ACJA 4LV5A 3TT0A 2WTWA 1REKA 4KA3A 4BRXA 4F0FA 4EORA 4U5JA 1XH4A 1FGKA 3CQWA 3TZ9A 4G2FA 4EYMA 2YJSA 5HORA 4ASXA 5E8TA 4YZMA 1QPDA 3GC8A 4FIEA 3P78A 3CTQA 5A46A 5CF6A 4FZAB 3OW3A 3CPCA 2BROA 3N4TA 5E8WA 5DOSA 5AP7A 5TO8A 2R3QA 2PWLA 3MA3A 3MJ2A 4GJ2A 5E8XA 3TKIA 2C6IA 3W2PA 4IB1A 1H4LA 2UW3A 2Y6OA 3FV8A 5AV1A 4PTCA 3EYHA 1M2QA 1Q5KA 3MI9A 3PXFA 5F4NA 4FZFB 3F3VA 4XG6A 2QC6A 5FP6A 4FSTA 1J3HA 1PXNA 3TIYA 3AT2A 4KKEA 2VTSA 1H1SA 1IRKA 1OKWA 3DKOA 4ZIMA 5L6PA 5LCKA 4O0YA 4D0XA 3B8RA 4TY1A 4LL0A 2C5OA 2XRUA 2BCJA 3HAVA 5IDPA 3Q6UA 3L9MA 2QCSA 2Y4PA 1K3AA 3DPKA 2C0TA 2E2BA 3SA0A 4U9AA 1OZ1A 3W8LA 4UZDA 1SMHA 1WBPA 2OZAA 3UG1A 5CEPA 3VRYA 5L6OA 4BVUA 4IACA 1YRPA 2HZ4A 4ZOGA 3HUCA 2OZAB 3CY2A 3BCEA 3F5GA 5BVEA 3QFVA 2NRUA 4C58A 1OL5A 2B1PA 5HNIX 2OH4A 4EJNA 1BKXA 4GMYA 3BGZA 2DQ7X 2ZM1A 3PSBA 1JKSA 4H58A 4BDJA 3L1SA 4G9CA 4M67A 4D58A 1ZAOA 2QR8A 2JDOA 1A06A 4MXZA 3H4JA 4XRLA 5JQ8A 3K5VA 4HW7A 4D4RA 4Z16A 1UA2A 5CI6A 4IEBA 4AAAA 5DG5A 3VS5A 4ZS0A 5HG9A 3KMMA 3TDVA 2QOHA 3MWUA 4WG5A 2J5FA 3TDWA 4BYJA 3GCSA 2LGCA 4K6ZA 4UMTA 4AP7A 2VN9A 1A9UA 4AZSA 4O84A 4YHFA 3QZFA 5FG8A 2G15A 2OWBA 3OXTA 4J52A 4NKAA 2ZMCA 5BMMA 5CYIA 3AC8A 4CVAA 4HVGA 2C6OA 2VWUA 4NM0A 1T45A 3VIDA 4D0WA 2WD1A 5I5ZA 2EVAA 4J71A 4U7ZA 5AX3A 1OUYA 5H2UA 1GIHA 3A8WA 1ZY4A 4G5JA 4IFCA 4RQKA 2P55A 4O1OA 4DEAA 2W1EA 2WU7A 3GC9A 5H8EA 4QMOA 2VWBA 5CEIA 3WYYA 4YLKA 3R8MA 2XNMA 3PWYA 3KFAA 4RT7A 2JDTA 4IX4A 5GNKA 3AXWA 2C5XA 3AMYA 3RVGA 4EH8A 3DXQA 3PXKA 3GT8A 3LFQA 4M7IA 2WMSA 4M13A 4OTWA 4EOPA 2VV9A 4XH6A 5H3QA 1NVRA 4UMUA 4JDJA 4QO9A 4X7QA 2BKZA 2X7GA 3GBZA 4RZWA 2I6LA 3C4EA 5DR2A 3ZFYA 4BCGA 3TNIA 3W32A 2V5QA 4YO6A 4OTPA 2B9FA 3VRZA 4ENXA 1E1VA 2R3JA 1VEBA 4RIYB 1UNLA 1OIRA 5H8BA 1MQ4A 4AS0A 2X0GA 3MY0A 3VW6A 2CMWA 1H0VA 5BPYA 2WMTA 2PZRA 2JAMA 1OI9A 3E3BX 4FTIA 4CLIA 2BHHA 3BYMA 5IDNA 2B55A 5IISA 2IVSA 3TNPC 1BYGA 3NGAA 3VS0A 1WAKA 3BLRA 3D94A 3LFCA 1UNGA 3S3IA 5JN2A 4WNKA 3IS5A 2QD9A 1H07A 3ANQA 3DS6A 3W10A 1B39A 3UVQA 5A4EA 3KMWA 2Z7QA 3IOPA 2CGWA 4BFMA 5CU6A 4L53A 1XBCA 3C4FA 3MIYA 4HCVA 4WUAA 5TE0A 4FG9A 3MPMA 3GCQA 2YWVA 4QMTA 1YKRA 5DMZA 4QYYA 4AE6A 1H01A 1KV1A 3LVPA 1YI6A 4IXPA 3R1YA 2J51A 4YJOA 1ND4A 5T3QA 1H24A 2C0IA 3FBVA 2VGPA 4FV7A 2WMBA 4I6BA 3Q9XA 2OFUA 5GJGA 4DE4A 3C50A 4OBPA 4XG9A 5AFVA 3FZOA 3QWKA 3FXWA 4FKRA 5CENA 3ZM9A 3QRTA 5HU3A 3K3IA 3LLAA 3LMHA 3ZUVA 5HX8A 4D9TA 3V8TA 3LJ1A 4HYUA 3PLAE 3OWJA 3JR1A 4DAWA 2RGPA 2CCIA 4U6RA 3RM7A 4EHEA 1Q3DA 1S9JA 2RFDA 5A6NA 3V5JA 4A9RA 4C8BA 4FG7A 3NR9A 5AP4A 4JR3A 4LOOA 3I0OA 4XV3A 5FDXA 2J0JA 3RPSA 3PDTA 4ERWA 4FKTA 4ZY5A 3Q32A 4E5AX 4J96A 2YLFA 5CNOA 3RK5A 4IDVA 4D2SA 5E4HA 4RJ3A 2W9FB 3OTVA 3QD2B 4CZYB 3RM6A 3MH3A 4JDKA 2F4JA 3VUIA 3PXZA 4KRDA 4BHNA 4WRGA 4WOVA 4RVTA 4F7JA 1UU9A 4ZTLA 5J7HA 2R3MA 2XIYA 3PY0A 3KXGA 5HBJA 5DRBA 4RIWA 1IEPA 2ERKA 3D7TA 2YABA 4MXYA 1W84A 3EFKA 2QLQA 5AADA 4UY9A 4TRLA 3D7TB 2VWIA 1U5RA 5LWMA 4BB4A 2W1IA 3ZXZA 3I60A 3R01A 4DFXE 4FVQA 5FTGA 1XKKA 1OL7A 3WF7A 4CEGA 2CN8A 3A7IA 2EB3A 2HY0A 3W2CA 4ACCA 4GRBA 3NW7A 4BTFA 3TUBA 2PPQA 4ZMFA 1OIUA 4JBVA 2VNYA 3BHUA 3F3WA 2RFEA 2XK3A 4FK3A 2W5BA 4IMYA 1R78A 2HXQA 2HY81 3CC6A 5AAEA 3V04A 4ZZMA 5CAQA 3PA4A 3ZRMA 2X81A 4IQ6A 1TVOA 2Z2WA 4RLLA 4WKQA 4ORKA 3PSDA 5M4IA 5FDPA 1YXTA 2CSNA 2GFCA 3B2WA 3W18A 4ANNA 1OB3A 2FSTX 3TNHA 1XQZA 5KZ0A 1MRVA 1G5SA 1XR1A 2W7XA 3OOMA 3MPAA 4RGJA 2W1CA 5AUUA 3PWDA 1KOAA 3Q5ZA 3OD6X 4QMSA 3QLFA 1YI3A 4BIDA 4QT1A 2BMCA 5FWKK 4XOZA 4GCJA 3LFDA 3VBXA 2F2CB 4BCOA 4DH1A 4E7WA 4EZ7A 4Y8DA 3C4XA 3H10A 4FTCA 5IA1A 5CU0A 2OW3A 3U4UA 2XBAA 2OJ9A 4MXAA 4JG6A 2FUMA 4O0XA 3PIYA 4W8EA 3A62A 4Y5HA 2YDIA 2YCRA 2YIYA 3QYWA 2PZIA 3OCGA 3R9DA 4RFZA 3GUBA 2AC3A 3VJOA 4BCJA 4BI1A 4CCUA 1GNGA 3VS1A 3M1SA 4DEIA 3HECA 5DWRA 4FEWA 4KKHA 5LMKC 1RQQA 1UV5A 4FTLA 4RX7A 5JFWA 3TUDA 1Z57A 2YIWA 1U59A 4K11A 5DA3A 2PY3A 4QQ5A 5FM2A 4A07A 3N4UA 2WTKB 3MFSA 4ACHA 4D4YA 5KNJA 3D5WA 4Y85A 1XH7A 3KEXA 3MS9A 4F9CA 1UNHA 1Q8ZA 3KXHA 3OFMA 4DG0E 3UMWA 3DJ5A 1P14A 3IDCA 4GG7A 3R7EA 3RBWA 1BL7A 2J2IB 4FGRA 5JFXA 3EH9A 2GNLA 3F61A 2Y7JA 4IHPA 3VQHA 4QQJA 3VBYA 3DK7A 3DFAA 2BAJA 3EN6A 4HOKA 2BZJA 3Q9WA 3L9PA 3IW6A 3AD4A 5LARA 4RX8A 3UZTA 3OTUA 4A9UA 3FAAA 1CMKE 2KULA 3OWLA 3H0ZA 3C4WA 1P2AA 2R7IA 4KS7A 5FP5A 3RI1A 5L2SA 1BI8A 2WO6A 3GGFA 3RPYA 5F94A 5K5NA 4FKGA 3RGFA 3CSVA 3T3UA 3RTPA 3L8VA 3DNDA 4KD1A 5ANIA 5FXQA 5D11A 5DHJA 3HZTA 4ZTQA 2QR7A 5I9ZA 2BPMA 4UWBA 2GQSA 3PE2A 2J6MA 3FLQA 3NAYA 3OCBA 4FSMA 3RNIA 3ROYA 3BWJA 1YOMA 2O3PA 3MW1A 3HMPA 4H3BA 4UWCA 5IQGA 4DTBA 2QU6A 2R3GA 3C13A 3HV5A 4FOBA 3BWFA 4JJRA 1FGIA 3LAUA 5KKRC 3R1SA 4FSYA 4XV1A 2CNVA 4FEXA 3R02A 4R1YA 2BZHB 5ANJA 3LW0A 3QA0A 4Q9SA 2GNGA 3CS9A 4FTRA 4YHTA 1V1KA 3LOKA 5J9LA 3PY1A 3VS2A 2QOFA 5KZIA 3HMMA 4FVPA 2AC5A 3RJCA 2E9PA 2J9MA 3VHKA 5K4JA 4GT5A 4IH8A 3ODYX 5HX6A 4O91A 2B53A 4ZY6A 2PVFA 2XH5A 4C33A 4GKHA 2GS6A 4KIQA 5TOZA 2C1AA 3U55A 1LUFA 2ESMA 5CU4A 1YDTE 3ZUTA 2CKPA 2GDOA 2QKWB 1J91A 5EKOA 4MXCA 2ONLA 4CMOA 1PYXA 4LRJA 4JAJA 5FEEA 4TYIA 3SRVA 4EL9A 3MSSA 5HOAA 4F09A 3FPMA 5EYMA 3CXWA 2ITUA 5D7VA 4RSSA 4DH5A 3FEGA 3ZLSA 1M52A 2R9SA 4YTIA 4BYIA 2YJRA 2WXVA 4O38A 4HJOA 2NPQA 4RFMA 1Q97A 2PMIA 3WILA 2UZUE 4GIIA 1KE5A 3MJ1A 4PP9A 4AA4A 4D1ZA 2W96B 4FV3A 3UODA 4E3CA 2QHMA 5BUEA 4NCTC 4O86A 4DT9A 4MBJA 3Q9ZA 2XK6A 5GIPE 2J7TA 2HZIA 3DBCA 4TXCA 2XJ2A 4HVSA 4GV1A 4FK6A 3FYJX 1H28A 3PLSA 3L8PA 5ANDA 3FQSA 4MCVA 4ID7A 4KIPA 3IW7A 4CZTA 2OF2A 1GZKA 2VGOA 3EQFA 3UOJA 4D5KA 1PMNA 3ZSHA 3QD3A 4A7CA 2HZNA 5AP6A 2GNFA 2R2PA 2X6DA 1JVPP 3HNGA 3CE3A 3ALOA 5JGAA 3UG2A 4E5BA 1G8SA 4FUYA 2ZM3A 3OUKA 2G1TA 3OP5A 1AD5A 4BCHA 2XKEA 3A8XA 2VO0A 5IH5A 5IA2A 4FGBA 3WYXA 3H9FA 2OIQA 3R2BA 5HVJA 2OG8A 4V05A 3AC4A 2XYNA 4QP2A 3RZBA 5IG1A 2WTJA 4O7WA 3E7OA 1QPJA 4U41A 4IM2A 2XK9A 4UZHA 3SHEA 1KV2A 1P4OA 5IQDA 4ACGA 1UVRA 2H8HA 1E9HA 2VTRA 4GK3A 4O1PA 4D2TA 3E8NA 4G31A 3G6HA 4DH7A 4BBEA 2XIKA 3UIUA 1GZOA 3DDPA 3HMOA 3Q52A 2GU8A 5HD4A 2PUPA 2YA9A 3F2NA 3VHEA 3LCOA 3I5NA 3QX4A 4QPAA 4BCPA 3O7LD 5IH6A 3ANRA 2FSOX 1VZOA 1I44A 4JAIA 4FTNA 4O27B 4CQGA 3DK6A 2HZ0A 4YJUA 4V01A 2OXDA 4X3FC 3WIKA 3KGAA 4FIJA 1CM8A 2ITWA 2OBJA 3PJ1A 2WQBA 4KWPA 1JNKA 5LVMA 3UQFA 3CD8A 4CT1A 2PMOX 4DFLA 3O23A 5DVRA 2C1BA 3HGKA 3FKNA 3IW4A 3TJCA 2V7AA 3TG1A 3D14A 4L01A 4DLIA 2ITVA 4DG2E 5I9YA 4FVRA 1PKGA 4FNZA 5AR7A 4AACA 5HIBA 3UP7A 3P7BA 1OVEA 2XIRA 4XBRA 1GZ8A 1UWJA 5HO7A 2GQRA 5DEWA 4M8TA 5HTIA 4U3YA 2B54A 3KRLA 5KMLA 3WI6A 5JMSA 2X2MA 2OLCA 1STCE 4KABA 3GP0A 4BHZA 5CX9A 1W8CA 2BRBA 4JIKA 3A7JA 5F9EA 3ZBXA 2IN6A 2I0VA 3BLHA 1ZRZA 3QKKA 4FKPA 3R21A 3G0EA 3M11A 3V6RA 4ZMEA 4JDIA 4GU6A 3FLSA 5LVLA 5AR8A 1H0WA 3FMJA 3LE6A 4XBUA 5CU2A 3TM0A 5M4UA 3VC4A 4C34A 4RLKA 4EJ7A 2JKMA 5KMNA 3DBDA 4DFYA 2Z7RA 2GNHA 1ZYCA 2CLQA 2ITTA 3LFSA 5KMKA 4WNPA 4JG8A 4TNDA 3E92A 2CKOA 2JBOA 3NSZA 1K9AA 4NW6A 4EI4A 5B2MA 4CKRA 4I92A 4I41A 2B52A 2C47A 2FB8A 4QP7A 4DEEA 2EB2A 3KQ7A 2EWAA 3P08A 5HIEA 2GS2A 3KB7A 4YZ9A 4LMUA 4YNOA 4J8NA 5GJFA 4II5A 2WMVA 3MVJA 4PPAA 5EQEA 3KVWA 3QQJA 1YDSE 4NIFA 4UALA 5JFSA 3R2YA 3ELJA 3MFUA 4ANLA 1J7IA 4E4XA 4IE9A 2WMUA 3HP2A 3D4QA 3EQBA 3WZKA 3AOXA 3HDNA 4O7LA 2B0QA 3U54A 3HV7A 5JT2A 3V3VA 2UW6A 3VBWA 4GVJA 5I9VA 4Q9ZA 1ZYSA 5DE2A 4B8LA 2XNNA 4BTKA 5CANA 4FX3A 1IA8A 3DXNA 3CP9A 4P4CA 4ZP5A 3UC4A 3ZEPA 3ORKA 3C4ZA 3S0OA 1U5QA 4Q2AA 4IWQA 1O9UA 3PPJA 5ETFA 2R3PA 4NM7A 5E1SA 3PZHA 3U4WA 2R5TA 4AA5A 4AU8A 5L8LA 4DFZE 2E9VA 3EQIA 4DT8A 4GEOA 5IA5A 4PL3A 1YWNA 3R7IA 5IMXA 3ITZA 4E5WA 2BR1A 3ORMA 3OS3A 1FVTA 1QMZA 5M53A 2I0EA 4LGGA 2G2IA 1H1QA 3QQFA 3F5XA 2CLXA 4X6RA 4BCIA 3ZC6A 4QQCA 3FZSA 3V5WA 4BDHA 4CYJA 5M4FA 1V0OA 4CFVA 3FI8A 3ZZEA 4EK6A 4UMRA 4FSRA 2P2HA 3PP1A 4DITA 1JPAA 3QHWA 2X9FA 3NMUF 3R28A 5HESA 4NJDA 4QP6A 1WVYA 1YXVA 4UB7A 4BI2A 4EK3A 3QUEA 4C2VA 3IG7A 3PVGA 4E4MA 4ANMA 3OC1A 5AEPA 4D28A 3BBTB 2C3LA 4O6EA 1M17A 4FV6A 3QD0A 5HBEA 4HYHA 4DGMA 3LFNA 4KINA 2XBJA 2GNJA 3ETAA 1OITA 4YU2A 5FEDA 4RZVA 4H3PA 1FBNA 3QF9A 4YR8A 2A0CX 5J5TA 4O0SA 2KTYA 3W33A 4AW1A 3BGQA 4C57A 4QD6A 4AOIA 3TV7A 4AF3A 4CRSA 3NCGA 4RA4A 5D9HA 5HLNA 1R3CA 4NJ3A 1Y6AA 1JWHA 2BRNA 2OJFE 2Z60A 2GQGA 3BEAA 3DBQA 4F7NA 3A7HA 3ZXTA 2UUEA 5KX8A 5EDQA 1R1WA 5EQPA 3AT4A 4CCBA 3WF8A 2UW0A 3CJFA 3OZ6A 4X2NA 5L6WL 3UYTA 4Z7HA 1Y8GA 2X7FA 2YDKA 1M7NA 5IQAA 4RJ4A 1OIYA 3I5ZA 3OWPA 3ACKA 3LQ8A 4U42A 5J87A 3ZUUA 3MVLA 5A4LA 5IQCA 4O0UA 4KKGA 5IUIA 5TR6A 3REPA 3E8DA 2SRCA 4O81A 5F20A 3CTHA 1PY5A 2ZV8A 2P3GX 3LXKA 1Y91A 4NSTA 4XHKB 4O0RA 4WBBB 5DIAA 3ZDUA 2Q0NA 4TN6A 1JKLA 4OBQA 3LJ0A 2UW9A 3QQHA 4FV1A 1U46A 2O0UA 4O2PA 2A27A 2W9ZB 2WIHA 3LXPA 2WELA 4TZRA 4OTIA 4YJTA 5BVNA 3Q4UA 3N9XA 2I0HA 4M12A 2PK9A 3BV3A 1QCFA 4NM3A 4YC6A 4NFNA 4FKLA 2ZV2A 4TKSA 2ITYA 5CQWA 4YSMA 5C9CA 1PXMA 4LUEA 2QOKA 2PZ5A 4KNBA 2YM3A 5E8UA 5HE2A 3OROA 2WFYA 4K0YA 4L68A 3ZSGA 2C6KA 3FMEA 2UZOA 4LGHA 4IVDA 3F9NA 4AFEA 3OT3A 5CVFA 3BQCA 5M06A 4L3JA 3QTRA 4YC8A 4APPA 2A1AB 2C6DA 4O0WA 3UDBA 4BWXA 5KBRA 4NWMA 4IFGA 3JY0A 3FKLA 4BCKA 1OKZA 3QALE 4APCA 3MTFA 3FMNA 4DGNA 1CSNA 4EHZA 4ZSAA 3LCDA 4A9TA 4HCUA 2VRXA 3WZEA 4O0VA 5DPVA 4QMZA 3NNVA 2VUWA 3CY3A 3I4BA 4RC4A 3DJ7A 3LMGA 4OTRA 4FIIA 4GKIA 4OLIA 4G6LA 2V62A 2BRMA 4W9XA 5HG5A 2V0DA 5CEMA 4OT6A 4CRLA 4NZWB 5L2WA 2PVJA 3BELA 1DM2A 3EQRA 4MF0A 5EI8A 5GZ8A 4MNFA 2RSVA 2Y0AA 3FI2A 3R1NA 4HZSA 1U54B 4OBOA 5HE1A 4F0IA 4BWPA 1Q3WA 3COHA 2XNPA 3FQEA 4LL5A 2DS1A 2YAKA 5J8IA 4F08A 5KKRB 3FC1X 4TYGA 4JNWA 3B2TA 3ZFXA 2P33A 5EM7A 4WSYA 3CTJA 4UMQA 1BLXA 4A9YA 2PZPA 3SXRA 5EW3A 2R3RA 3ZC5A
chains in the Genus database with same CATH superfamily
3UOKA 4TNBA 4RIXB 4XG4A 4MWHA 3IDPA 4AZWA 2FSLX 2XJ1A 2VO3A 3TL8A 3FZPA 4AZTA 4JDHA 3KU2A 3KRWA 4S33A 5BMSA 2HELA 4IAYA 4YJSA 3P4KA 4M14A 3GCVA 4O4FA 1MRYA 3I7BA 2WIPA 3FLZA 4FIGA 4D55A 4ZJJA 4EOJA 5CSPA 4RBLA 5HLPA 3UP2A 3F2RA 2NP8A 3DTCA 1KE6A 5K3YA 3SVVA 3JS2A 1PKDA 5CXHA 4QPMA 4XMOA 1Q62A 5TF9A 5I9XA 2J50A 2YAAA 3C7QA 5IZFA 3TI1A 1IA9A 2VTTA 1XH8A 2BTSA 1RE8A 3OW4A 4AGWA 5C8MA 4BKJA 4C3PA 4E6QA 3KREA 4OAUC 3DQWA 3NCZA 1DI8A 4HYIA 5EKNA 4CXAA 4F6UA 2PMLX 5BUIA 1XO2B 4L43A 3PYYA 3B8QA 4X2FA 2X7OA 4BI0A 2WOUA 4MXXA 4LRKA 3UNZA 4FSWA 3O8UA 2BFXA 3EKKA 4N0SA 3MN3A 4QYGA 2BVAA 3E62A 4GFOA 4I0SA 1OMWA 3QCYA 3FXXA 4JBOA 4QP8A 4QMXA 1PXKA 4W4YA 4EEVA 5L8KA 1LR4A 4IM0A 3T9TA 4IW0A 4F9BA 5AA8A 3ODZX 2WMAA 4G34A 5ICPA 5BNJA 3DFCB 2CPKE 3FPQA 4AGUA 4L7FA 4DYMA 2OJIA 1OL6A 2VWZA 4PWNA 3NIEA 2VWVA 4HPTE 4Q5EA 2W05A 3NS9A 3RPRA 5J79A 5M44A 2PUNA 4W4XA 3CKWA 3EL8A 3Q4CA 5CNNA 4GVAA 5AR2A 1ZOGA 3HUBA 4G3DA 4KBKA 5ACBC 2FSMX 3G90X 4EOLA 3MVHA 3PZEA 2Z8CA 3DK3A 3WZUA 3W0QA 4RIYA 3U9CA 5B7VA 3ORNA 3QU0A 1SNUA 4IC7A 4RPVA 5FRIA 3NLBA 4IAKA 4EOOA 2R3NA 4UWYA 3WZJA 5IEVA 3QWJA 4ZTNA 4FV5A 2B7AA 4XV9A 2AEGA 2ITPA 3UQGA 3EQPA 2BKKA 2IZTA 4FSQA 5DGZA 5JGDA 5M55A 5J9ZA 3TYKA 4L46A 4YPDA 2R3FA 3PA5A 1HCLA 5IU2A 3G9LX 3ULIA 4JI9A 5K0XA 3MTLA 3DAJA 2BTRA 3VWAA 1J1BA 4EOIA 4G3GA 3V8WA 3ZOSA 1HOWA 1YWRA 2PUIA 3FZRA 4U45A 5JKGA 4X3FB 4AN2A 5K9IA 5KMIA 2XALA 3NFFB 4YBKA 3R83A 2NRYA 3GU8A 5CAPA 4BWKA 4EUUA 4FSUA 4ERKA 4PRJA 3U6HA 4YJVA 2C4GA 3W0NA 4V04A 2QHNA 3AD6A 4CKJA 3U6JA 1KUTA 3AKKA 3S1HA 1OPLA 4WG3A 3FSKA 3NFGB 3TCPA 5ANEA 4AT3A 2XNGA 3T8OA 3BIZA 2CJMA 4JBPA 5HO6A 5HTBA 1GZNA 1NT2A 4Z3VA 5IQFA 2VNWA 4RWJA 4WG4A 4Z55A 4F1TA 3QQKA 5E8VA 3E93A 3KMUA 2WQMA 4XLIA 1ZMUA 3RAKA 4ITHA 4L67A 5FBOA 4GW8A 2R0IA 2O2UA 4GK2A 2GHLA 4HZRA 4BZOA 2OH0E 2QOOA 3VN9A 4R8QA 5I4NA 1UWHA 3FQHA 4FE2A 4ARKA 4CTBA 4W8DA 4AQCA 4BBFA 3O51A 2PU8A 5CY3A 4WA9A 4FT9A 4D2WA 4IX3A 4E6DA 4USEA 4ASDA 3E7VA 4YJNA 4I5MA 2PYWA 4QPSA 2O63A 2JDRA 3KF7A 5I9UA 3DZQA 3MH0A 3O2MA 2HAKA 3ORZA 5FTOA 3W55A 4CMTA 4F0GA 2NNWB 4NM5A 4EC9A 3NAXA 1ZOHA 5C03A 4LG4A 1XH6A 4HVHA 2XB7A 2JIUA 3EOCA 3FKOA 4IDTA 5CEKA 2PE1A 2X8EA 5ANGA 5HTCA 1JSTA 3GEQA 2XEYA 3OG7A 4R3RA 4R7BA 4I6QA 1XMMA 2C5YA 2IW8A 4OTQA 1B6CB 4HNFA 4TWCA 4FEUA 3H9OA 4I0TA 4RVLA 2YM5A 1JBPE 3VS3A 4O7SA 3BYSA 3FSFA 2C3JA 3E87A 4PMSA 3TZMA 3ORLA 3Q04A 3PRIA 5CF5A 4Z7GA 4FICA 4OW8A 3LM0A 5KO1A 4YPSA 2B9JA 1AGWA 2YCQA 3EN7A 4IB3A 4YJQA 3FY2A 4F99A 5T6KA 5IA3A 4DDGA 3RAWA 4ZSGA 4GS6A 4F6WA 5AUZA 4BBMA 3RNYA 2UZTA 4RJ6A 4L7SA 3QC9A 2W4OA 3R63A 3Q6WA 2QURA 4YO4A 2FA2A 3SXSA 2DWBA 2VTMA 2CDZA 4G3CA 4H1JA 4B7TA 4BCFA 3QX2A 5HU9A 4PX6A 3H3CA 2XS0A 5HKMA 3LFBA 3QRUA 1ZLTA 5EYCA 4G3EA 4TL0A 3L9LA 1W82A 1KSWA 5M07A 3R9RA 3DKFA 3ZO2A 3VBTA 4C2WA 4KIKB 4V0GA 4RX9A 5K4IA 2GSFA 3Q3BA 3WF5A 3TNWA 3R73A 1OPJA 5HVYA 3G9NA 4IX5A 1H1WA 4V0GB 3S4QA 3R8UA 2GTMA 4LM5A 1MP8A 2QLUA 3CQEA 3FHIA 3KN6A 4YTHA 4PQNA 4PTEA 5IF1A 3H9RA 1Q8YA 5L2QA 4MVFA 4U3ZA 3T3VA 4FL1A 1A48A 1PMEA 1Q41A 3TKHA 3KA0A 4QMWA 2X0PA 4BIBA 1WFCA 3C4CA 4G16A 3HV6A 3RINA 3LFAA 1SVGA 3PSCA 2JLDA 4E4NA 4A4XA 5K5XA 3O71A 5M4CA 4J97A 2C30A 3FZTA 3C0IA 2VTIA 4QMUA 1M7QA 3M42A 4PNKA 3LCSA 1ZYDA 1ZY5A 3FL4A 4QDVA 3ZO3A 5AP1A 3A61A 1GIIA 1ZWSA 2X8DA 2QG7A 2DYLA 3PUFC 4TTHB 3FYKX 5CEQA 2BALA 2QVSE 3VUHA 1TKIA 5IQIA 1RDQE 5FD2A 5CAOA 3VONA 4I24A 4QTBA 4WIHA 3BHHA 4KSPA 4I3ZA 4IADA 1OL2A 3QYZA 1CTPE 1PMVA 4R77A 4DGOA 3A7GA 2GHMA 4P7EA 3GXLA 2BAKA 1PYEA 3JXWA 5CVHA 1P5EA 4AZVA 5G6VA 4F64A 5CWZA 4M0YA 4BF2A 3D2KA 4AXAA 3NEWA 3UQCA 1V0PA 1YWVA 3IDBA 5AIKA 4AXDA 1FMOE 3VS4A 1O6LA 4M3QA 3QCSA 2QOIA 2YM4A 4ZTHA 3SGCA 3RCDA 4BCNA 2CNUA 3DNEA 3LM5A 4E1ZA 1XMLA 4FODA 5HLWA 4FEVA 3V5LA 1URWA 2ZAZA 3P86A 4RC3A 4W4VA 3UPZA 3VUMA 4ALUA 2GNIA 2JKKA 2B9HA 4O4DA 4O7NA 4BIEA 2E9OA 2WOTA 4EOMA 4F4PA 4ZSJA 3ENMA 3QQLA 1DI9A 3ENHA 4P5QA 4TWPA 4C0TA 4ZLYA 4P5ZA 3DDQA 1NW1A 4EWHA 3FI3A 4X2GA 3UOLA 3NZ0A 3I0QA 5EI6A 5C8NA 4DEHA 4YLLA 5A9UA 4NU1A 5BYLA 3RAHA 1O6YA 2XIXA 1CKIA 2X4FA 3D15A 3UPXA 4DLJA 4TPTA 2WB8A 3UZPA 2BIYA 4OTDA 4O7VA 4EH5A 4L6QA 5F1ZA 1YHVA 2XM9A 2UW8A 3A60A 4B99A 1FPUA 1XBBA 1W98A 4B8MA 3OHTA 4F65A 1IR3A 4RWKA 3C5UA 3IGGA 3TWJA 4FOCA 3UDTA 2YIQA 3NPCA 4I23A 4B6LA 4EK5A 4LV8A 2QOQA 3MIAA 1GOLA 3VBQA 3BLAA 1FQ1B 4YZDA 5ETAA 2PVYA 3V51A 2QOCA 2WMQA 4YMJA 2IEWA 4QTCA 2J0LA 4EK4A 3VUGA 3FE3A 3QCXA 5AR3A 4AW0A 4CFMA 5AWMA 5E92A 2XKDA 4I5HA 4A06A 3S2PA 2ZB0A 3SC1A 3T9IA 2CGXA 1R39A 2HOGA 2QI8A 3N51A 5LJJA 2W1FA 4XOYA 3DKGA 3FXZA 1KOBA 5TKDA 2JEDA 2QQ7A 4ITIA 2X1NA 3CJGA 1MUOA 1BI7A 2JBPA 4L3LA 3HRCA 4MHAA 1MQBA 4ZTSA 4QQTA 2VD5A 3FI4A 3ZYAA 1ZZLA 4H39A 1SNXA 1BX6A 1V0BA 2RG6A 2OXYA 4AW2A 3R9HA 4X3JA 3CGFA 5CASA 4MD7E 2PVNA 4I22A 3WZDA 4JX7A 5EW9A 5HIDA 4J95A 4PDSA 2CCHA 5EQYA 4QMPA 4KS8A 3CCNA 2PTKA 4EONA 1ZMWA 4BDAA 4N57A 4DFUA 5L8JA 3Q4ZA 3TXOA 4GT3A 3SAYA 4WSQA 2QG5A 3R8VA 3FDNA 5AV3A 5ETIA 3UO6A 3Q53A 2GFSA 1APME 5EK7A 3ZRLA 3KKVA 5DR9A 4GSBA 3HA6A 1VR2A 3EMGA 1DAWA 5KHXA 1WVWA 3U87A 3NUXA 4XNEA 3RZFA 3NX8A 3M2WA 4GYGA 2RL5A 4DC2A 4X21A 5EI2A 1JQHA 3BBWA 4WRSA 3AG9A 5JZJA 2XJ0A 4YZNA 4L3PA 4M15A 4DHJA 4QMYA 3IQ7A 4DDIA 4P90A 5JK3A 3NUYA 2X6EA 1FVVA 3QZIA 4U43A 4IAZA 3LKMA 5DN3A 5D41A 1PXPA 2XM8A 3DJ6A 1YXSA 4L9IA 4AN3A 5EM6A 4ANBA 3TJDA 2WEIA 4RFYA 4CG8A 2JDSA 5E8YA 4AA0A 1M14A 4R7HA 3W0RA 2BFYA 5CQUA 4YSJA 5FUTA 2J90A 3PRFA 4BGQA 1Q61A 4WHZA 4DN5A 4A9SA 4FG8A 2W17A 3QTQA 3VF8A 5C8KA 3GU4A 1ZARA 3DXPA 3R1QA 4IZ7A 4EH3A 5LWNA 3G0FA 1BUHA 2XCHA 3HLLA 3F88A 4IB5A 4C4EA 4FBXA 1IAJA 2YISA 2QKRA 4IIRA 1H26A 1L8TA 3AC1A 2QOLA 4CFWA 5HGIA 4YNEA 5IEXA 4ASEA 5GIOE 3NNWA 4M66A 2A4LA 4IB0A 2C69A 4KB8A 2JKQA 5BVFA 2WHBA 5EHOA 5HG7A 3UBDA 5A4CA 1J7LA 2I7QA 1M2PA 4AT4A 3HL7A 4D4SA 4JIAA 4XG2A 2BZKB 3E3PA 3IECA 4PPBA 3CR0A 4ALVA 2H34A 4AWIA 4YUQA 1F5QA 2UZNA 2VTQA 4JT3A 5AV0A 5AV2A 2B9IA 4IWDA 1LEZA 4QMLA 3F5PA 3KF4A 3L8XA 4GT4A 4HGSA 5K0KA 3P5KA 1GJOA 1PXLA 4AGCA 4LI5A 2ERZE 2JKOA 1PMUA 3NUPA 2IG7A 2A19B 4IWOA 4U40A 1YHWA 2CKEA 3NUAA 5M51A 3EFJA 2X39A 3C1XA 2QODA 5T68A 5AM6A 3UGCA 3O8TA 4DF3A 4FTTA 3I6UA 1W2CA 1YDRE 2FVDA 4USFA 2VTNA 4R1VA 2OJJA 3BGPA 2R4BA 4DEDA 4S30A 4QOXA 2UZDA 1XWSA 4TT7A 2XNEA 4FV8A 5KUPA 3C51A 3DV3A 4LYNA 1Q99A 2HW6A 2ZV9A 4D1XA 2JGZA 4FTJA 3S95A 4DG3E 5LOHA 1OIQA 1JAMA 2PZYA 3MESA 2NO3A 3A2CA 3HKOA 1OL1A 4BCQA 5HCYA 3COKA 5GZAA 4G6OA 3LCTA 4J7BA 1T46A 5AP5A 3NYXA 5CAUA 4ZZNA 2F7XE 4AZEA 4JMQA 1OGUA 3HDMA 2HWPA 4ANQA 4E8AA 2CN5A 3AC5A 2QONA 2QO2A 2C6MA 3HX4A 4FKQA 3KC3A 2XUUA 4PV0A 4BJJA 1L3RE 3QD4A 3F7ZA 1XJDA 3D5UA 1TQIA 5HE3A 4UEUA 4ACDA 4EH7A 1G8AA 4M69B 4YZBA 5KE0A 3F2AA 5AMNA 4YLJA 3TV6A 5DRDA 4C38A 2EXEA 5DT0A 4KRCA 3DBFA 4XG7A 4C7TA 2GQSA 4F63A 4IANA 4IAAA 1Q4LA 5LXMA 4QP4A 1OGYA 4AE9A 5J9YA 5FM3A 4EK8A 3P9JA 2QO9A 3PP0A 2Z7LA 3A4OX 4XG3A 4CYIA 2ZB1A 2PVHA 4YGAA 1W7HA 4XX9A 3SV0A 4MD9E 5IPJA 2RFNA 4I94A 2JAVA 4C37A 4BCMA 3UZRA 3WBLA 4LGDA 4EHVA 3OT8A 3RP9A 4C36A 3DAKA 2R3HA 3KRXA 3PXRA 1Y6BA 4U44A 4QNAA 2ITQA 4G17A 4AZFA 4LUDA 4Y83A 2UVYA 1Q24A 1YOJA 3MBLA 2HCKA 4LMNA 4FKVA 5GJDA 4EYJA 2WNTA 4YP8A 2ZVAA 3RHKA 4MAOA 2IVUA 3KIOC 2O64A 3DU8A 3OOGA 4CTCA 4E6AA 2XCKA 4NK9A 4GFMA 4EKLA 2C6LA 2ZDUA 2UZLA 3PPKA 3FZ1A 4NEUA 3W2RA 3D9VA 4GU9A 3ZH8A 3BX5A 5AUTA 4Y73A 5J1VA 3RCJA 2WMRA 1KE7A 1YXXA 3H0YA 2H6DA 3DQXA 3OY3A 5E91A 3AMAA 3C0GA 3E8CA 4ZY4A 4GYIA 4IZ5A 5D10A 3GCPA 2WTDA 3R22A 4FL2A 3PIXA 4RJ5A 4CV9A 5HZNA 5JRSA 3ZFMA 4PP7A 3Q5IA 3NUUA 3FL5A 5C1QB 4FTUA 3C0HA 2C0OA 2OIBA 2RF9A 4MBLA 2A98A 3UJGA 3ALNA 2X8IA 4P2KA 5LCJA 3GB2A 1H00A 2BILB 5AM7A 4EC8A 3NVMB 4DGLC 2GPHA 5E8SA 2X0OA 1ST4A 4C3FA 4R6VA 3ATSA 3W2OA 5CTPA 4ASZA 1TQPA 4FR4A 4G5PA 5LMKA 3G6GA 5CAVA 3I6WA 4MUQA 3GC0A 4CT2A 4IAIA 2YLEA 4IJPA 4O6LA 2XMYA 5IQBA 2ZM4A 3QHRA 4BDFA 3R7UA 5BVWA 2FYSA 3V5QA 5A6OA 3FMDA 3MH1A 3ZM4A 1GY3A 3IO7A 3PG3A 3G51A 3BL7A 4TWOA 5EFQA 2Y9QA 3JYAA 4FV4A 2JC6A 4FSNA 5EOLA 3W2SA 4RJ8A 4EZ5A 2OK1A 1FMKA 2VTAA 4EBVA 3RMFA 3G33A 2REIA 4FV9A 4RRVA 4JQEA 4FMQA 4I93A 4O0TA 3QTZA 3PVWA 5CSWA 2EXMA 2GHGA 3TTIA 4FF8A 4J98A 4X6QC 5BVOA 1W2DA 3PA3A 1REJA 3UTOA 5A14A 4FNYA 4EHGA 4O82A 4O7TA 3JVRA 4NKSA 2YDJA 3RPOA 3UDZA 1P4FA 3VO3A 3IW8A 4OTHA 4EOSA 2YZLA 3FMKA 3NDMA 4E26A 5FLFA 3L8SA 3N4VA 3RALA 4FA2A 2WQOA 5ANKA 3OWKA 2YHVA 5M57A 3EZRA 3KN5A 2XKCA 4Y72A 4EKKA 1X8BA 3MFTA 4HVDA 1U54A 5HO8A 2ONLC 3R04A 3HP5A 4DBNA 2G2HA 3MB6A 5G1XA 1VJYA 2VTJA 3LJ2A 2VU3A 4DHZA 2WTIA 1NY3A 3UNKA 3FC2A 3DOGA 4NUSA 3WOWA 4BGHA 5DT4A 4AUAA 2R3KA 4RIXA 3QAME 3EB0A 3CD3A 4FKJA 4FTMA 4XP2A 4L00A 5FGKA 3TUCA 2ZDTA 4I4EA 4L52A 2WZJA 4BDDA 5LQFA 3NRMA 5CSXA 2CKQA 5DLSA 4YJPA 4EQCA 3QTIA 2VO6A 2R0UA 5M09A 3E5AA 1JLUE 4B0GA 4MYGA 4ZJIA 4ZTMA 2J0IA 4BL1A 2C3KA 4MWIA 3AKLA 4CG9A 2ZV7A 4PMTA 4BGGA 1QPCA 2OF4A 3D2IA 3EN9A 4E73A 1XH5A 3F7WA 4JG7A 3TZ8A 2HIWA 2VWXA 3V01A 4BDEA 4RWLA 4BR3A 3GFWA 4MX9A 3TN8A 2H96A 3V8SA 5L2IA 4F9WA 4G3FA 5HD7A 4I5PA 3PJ8A 3BHVA 3QZHA 5JSMA 4O21A 3MDYA 4NCTA 4OTGA 3PUPA 4H05A 1H08A 3Q2MA 1PF8A 4FKWA 2XF0A 4X2KA 1XBAA 2BAQA 4C61A 4BZDA 2Q83A 4K77A 1J7UA 3WE8A 5IKWA 3R30A 2ACXA 4J53A 3RK7A 2FGIA 3EFWA 4QMMA 4BZNA 4FZ7A 5KBQA 4ZXTA 4UV0A 3OXZA 3FLNC 3EQHA 3QQUA 1XHAA 3LFFA 4I4FA 2PVKA 3V5PA 5JZNA 5B2KA 1H1RA 5F95A 3P1AA 4GH2A 2J0MB 5CT7A 4FKUA 4M84A 3ORTA 5AJQA 2R64A 1G3NA 3ORIA 2XRWA 4MH7A 4UXQA 4FUXA 3ZZWA 2YM8A 2PL0A 3LQ5A 3NYNA 3Q9YA 4WBOA 3UYSA 3I79A 3QTXA 5BVDA 3UVRA 3KRRA 2F7EE 3FLWA 4S31A 3O17A 5GINE 2ETMA 2VWWA 4U79A 3DB6A 4YHJA 3OMVA 2BDJA 4IX6A 5CEOA 1H1PA 4MEDA 4AFJA 5EOBA 3U9NA 3R7VA 3FLYA 3NUSA 3ZS5A 1Y57A 5EHYA 1CDKA 2ZJWA 3I1AA 2O65A 3NUNA 4FTAA 5I3OA 4U81A 4DFNA 5L3AA 4NFMA 1AQ1A 3IGOA 4CD0A 4K8AA 3UVPA 2Y4IC 1RJBA 3SKCA 2ITXA 4PPCA 3O0GA 4U80A 1UKIA 4D4VA 4HNIA 4RVMA 2UW5A 3O7LB 4FIFA 4E4LA 2YM6A 4CMUA 4X3FA 4AQKA 5E90A 3DB8A 2Z02A 4EQMA 3PVUA 3ULZA 2ZYBA 5CSHA 4IVBA 3IONA 1UU7A 4YC3A 2LAVA 3VQUA 3LFEA 2WKMA 4CNHA 5AUVA 4DBXA 3W0OA 4EUTA 2DUVA 5CT0A 4M97A 2YCSA 3UMXA 1GAGA 3RAIA 2JFLA 3PJ3A 3O5AA 3NNUA 3O8PA 2BZIB 5C01A 3P79A 2JDVA 3OVVA 4N4SA 4GUEA 1LPUA 4JXFA 2R7BA 2C6EA 3TTJA 5IUGA 3EKNA 4EH4A 1QL6A 1FVRA 3PJ2A 4DFBA 5CXZA 1OKVA 1KE8A 3K2LA 3KVXA 2J4ZA 3EQGA 4YURA 1G8JA 2X2KA 3K5UA 5H8GA 3SQQA 2PVMA 4QP3A 2AQXA 4F9AA 3EN4A 3O96A 2VWYA 3UO5A 4RG0A 4K1BA 2W0JA 3PE1A 2VTOA 4TYEA 5I9WA 1ZXEA 1ATPE 4PY1A 5ITAA 3ROCA 4DINA 5CF8A 4FNWA 2AUHA 4ITJA 3VBVA 5D12A 5EM8A 5M08A 2HWOA 3BE9A 2C6TA 3K3JA 2OIDA 3GU7A 1YQJA 4O96A 5BYYA 5LVPA 5HCZA 1LP4A 2R3LA 3K54A 3GI3A 2F49A 4JR7A 5D7AA 2IZSA 1OM1A 3A7FA 4UX9A 3ZLYA 4CFFA 5HICA 2W1ZA 1H8FA 2YCFA 2C5NA 5AP3A 3S00A 1PXJA 3OCTA 4GIHA 2XA4A 1OBDA 2PE2A 4PL4A 2CGUA 1ERKA 2X4ZA 4PDPA 4L45A 5EG3A 5IQHA 3COMA 5EYDA 5CSVA 4RQVA 4D1SA 2V55A 4FL3A 4CFXA 5IQEA 2QU5A 4RIOA 3UDSA 3SD0A 5EDPA 3UNJA 5AV4A 3KY2A 5J1WA 2ETRA 5E8ZA 4C02A 1PRYA 4FV0A 4OAVB 3FJQE 3EQCA 1TQMA 3VF9A 1H27A 5KMMA 4I6FA 1YOLA 3DKCA 3EFLA 4QMVA 4ZSLA 5J7BA 4FJVA 1PJKA 4ALWA 4XV2A 3FHRA 1ZMVA 2JITA 1JKKA 1YXUA 4NTTA 4S34A 4ZSEA 3LHJA 3EQDA 1ZYJA 4XP0A 5FQDC 2RKUA 2WMXA 2XYUA 5KHWA 2C5VA 2OICA 2QOBA 2W5AA 5DI1A 3E88A 3VAPA 4RIWB 2YACA 3BKBA 3D5VA 3QBNA 2CGVA 4CZUA 3C5IA 5FXSA 4BY9E 2F57A 4I0RA 5GHVA 2UZEA 1R0EA 4MXOA 5JRQA 1FINA 3GCUA 3CEKA 4EH2A 4FYNA 3AQVA 4QNYA 3KXZA 4H1MA 4R78A 3PVBA 4FT7A 4C59A 4L8MA 3HMIA 3Q96A 3AT3A 2EXCX 3DTWA 3DT1A 4G9RA 4KIKA 4ANSA 2QNJA 1MRUA 4HPUE 3R00A 4QYEA 4TW9A 3RK9A 2IJMA 2XEZA 5JGBA 2EUFB 4ZLZA 1OUKA 2B4SB 1Q8UA 3JUHA 3F66A 3JY9A 3LXLA 2VTLA 1NXKA 3OXIA 4AT5A 2G01A 4L42A 2GS7A 4X0MA 4XG8A 4EQUA 3CIKA 3V5TA 1SYKA 2XZSA 5B0XA 3SG8A 2UVXA 1E1XA 4NW5A 3EZVA 3FMLA 4R7IA 2VTPA 5DYJA 1URCA 2VZ6A 1S9IA 4FI1A 3RWQA 3NVKI 3DLZA 3ZHPC 3ZLXA 1KE9A 2X2LA 2QO7A 4BTMA 4PDOA 5AR5A 3EHAA 4USDA 4K9YA 4IVAA 5DFPA 4JQ8A 4AOJA 2W1GA 3MPTA 4F1MA 3GENA 2FO0A 5IMEA 2VAGA 3BU6A 3KK8A 4QTAA 3V6SA 3VULA 4C4JA 3CKXA 1U4DA 4RWIA 5IA0A 5JH6A 1F3MC 2IPXA 3QGYA 4WUNA 3W16A 3NNXA 2Q0BA 2VX3A 4Z9LA 4BDCA 5CF4A 4IC8A 2V22A 4IZYA 4RJ7A 5DT3A 5I0BA 3FWQA 4ZK5A 2HENA 2OI4X 4J8MA 2XP2A 5HEZA 3BHTA 1H25A 2IZUA 3THBA 4EH9A 4ZJVA 2YIXA 4TYJA 4FT0A 2OFVA 2OKRA 4MK0A 1W0XC 5HHWA 4JOAA 1R0PA 3GQIA 4KBCA 3GVUA 4DEGA 1WMKA 3CGOA 4ONAA 4DTAA 1NVSA 4GFGA 1WBVA 4MD8E 5AAFA 3VJNA 4CLJA 4MKCA 1EH4A 4EOKA 5BV3A 3BYUA 2PULA 4PMMA 5L4QA 3HRBA 5EDRA 3RKBA 3ML1A 3BU3A 1WBTA 1I09A 3EL7A 3A4PA 3AGLA 4E20A 5KMJA 2W4KA 5FBNC 1W83A 3HA8A 4OUCA 4O7RA 2UW4A 4IBMA 4MF1A 4F7SA 3Q2JA 2UVZA 3ZRKA 2X9EA 4C62A 3VW8A 4M0ZA 5L2TA 4EOQA 4PNIA 3IW5A 3EN5A 1JSUA 4BN1A 3O50A 3GC7A 4R5SA 4EBWA 4UMPA 1RW8A 4IZAA 3OY1A 2C3IB 4JL9A 3R8PA 1JSVA 3P23A 5BVKA 2O5KA 4QTEA 3QLGA 2BDWA 5FTQA 5KMOA 5J5SA 1YHSA 2GCDA 4JRVA 1OPKA 4BDGA 5IH4A 2F9GA 3FMHA 3KXMA 1PHKA 4ENYA 2I1MA 2OU7A 3AD5A 2WPAA 2ETKA 3HVCA 4JVGA 1WVXA 2JD5A 2UZVA 3HMNA 5C4LA 1Z5MA 4YBJA 4DEBA 3TNQB 3BRBA 4JLCA 4CKIA 3AMBA 3OBGA 3I7CA 1WCCA 3SXFA 3SW7A 2XK8A 4YJRA 3W2QA 1YVJA 4I21A 2ITZA 3TIZA 4CFNA 4D2RA 1UU3A 3GU6A 1IAHA 1PXIA 1BL6A 4RA5A 3H30A 4BICA 4N6YA 3EJ1A 3QRKA 3NIZA 3VUDA 3OF0A 2VO7A 2OGVA 4WO5A 3KULA 3PJCA 4IAFA 3LQ3A 2UZWE 3ERKA 1DAYA 3DZOA 1F0QA 3AC3A 3I81A 3ORXA 3KULB 3QTWA 4EH6A 2GTNA 3QKMA 3QRJA 3ZBFA 4FZDB 2R3OA 2W1DA 4FNXA 4ZEGA 4I5CA 2WQNA 4ZTRA 3WF9A 4NL0A 5TT7A 2J5EA 3QXOA 4AN9A 3SRVB 3VS7A 4LFIA 5AP0A 3E64A 4YTFA 4UYAA 1WBNA 4BKYA 3RPVA 4FKIA 3KRJA 5HBHA 3PPZA 1BMKA 3QXPA 3R9OA 3R8ZA 3KL8A 2C68A 4CQEA 5JFVA 2XVDA 4OTFA 3R7OA 1OKYA 2PVLA 3R8LA 1PW2A 5JEBA 5ETCA 3MY1A 4O83A 4DH3A 2WGJA 5DH3A 4FTOA 3KK9A 5EHLA 1VYZA 2CNQA 3R9NA 3VVHA 4GUBA 4F6SA 2NYAA 3EYGA 3TZ7A 5J95A 4U97A 5DR6A 5C26A 3BEGA 1VYWA 4BKZA 1SVEA 3GOKA 3EIDA 3PY3A 2XNBA 3F82A 3ZEWA 4PTGA 3SDJA 4OR5A 3RHXA 1IG1A 5IUHA 2PUUA 5CALA 4XYFA 1DS5A 4C3RA 4S2ZA 3UIBA 5ACKA 4A4LA 2HYYA 2WMWA 4O2ZA 4ANOA 3LXNA