1OM1A

Crystal structure of maize ck2 alpha in complex with iqa
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II, alpha chain
publication title Biochemical and three-dimensional-structural study of the specific inhibition of protein kinase CK2 by [5-oxo-5,6-dihydroindolo-(1,2-a)quinazolin-7-yl]acetic acid (IQA).
pubmed doi rcsb
molecule tags Transferase
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1om1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1om1A01
3G9LX 5M4IA 2YIRA 2BRNA 2VWZA 3P79A 1DAYA 1STCE 2W4KA 3EMGA 4FEUA 4Y72A 4S33A 3KY2A 4KBAA 1UA2A 4RX5A 3OXZA 3CD3A 4GEOA 3S95A 3KRXA 3I4BA 1PMEA 2P0CA 4CTBA 1YDSE 2R5TA 4RPVA 4O7LA 1IA8A 5F9EA 1PJKA 4UMPA 1OIRA 2R3KA 4BRXA 4GU9A 4QYHA 5F20A 4CZTA 2FSOX 3BHYA 1IEPA 3Q5IA 3OTVA 3ZC5A 5AR5A 1WBVA 3IGOA 4JI9A 3EFJA 4G3CA 2QQ7A 5IU2A 4EZ7A 4USDA 5HVKA 2HIWA 4QP8A 2BAKA 5DT3A 4KD1A 1WBTA 3UYSA 2R0IA 4ANQA 2OLCA 3LFQA 3QCQA 2C3KA 3VBTA 2GNFA 1ZXEA 2V0DA 2ZMCA 4IX3A 5AFVA 2A4LA 2UZLA 2ZV7A 4FKSA 4F1TA 4M0ZA 4N0SA 4DINA 5A14A 3R9RA 1OECA 3UMXA 3LXLA 4GVJA 4MTAA 3R7YA 3TWJA 4ERWA 4EYJA 1JQHA 3LFDA 3W2SA 5FEQA 2QR7A 5HIEA 1YXUA 3CC6A 2GCDA 4U9AA 2YCQA 4ACGA 3NLBA 3ATSA 3D9VA 4MXOA 3HMNA 2XH5A 5AM7A 4EK5A 4HVHA 5JGAA 4BI1A 1WMKA 5CX9A 4D1ZA 4AA4A 3I7BA 1OBDA 2GNJA 2WHBA 3KA0A 4ZEGA 4FOCA 2GU8A 3F7ZA 4LG4A 4W8DA 3SC1A 3PVGA 3KXHA 3U4WA 3B8QA 3I0QA 4FI1A 4A9RA 4W4WA 4C2VA 4OTIA 3EHAA 2OGVA 3DNEA 3HV3A 4MQ1A 2R3MA 2QOQA 5KNJA 2W1GA 2R0UA 1FOTA 1GIIA 4BGGA 1NXKA 5KMKA 1MQBA 2R3GA 5TR6A 3GCVA 3QL8A 3F3UA 3QGWA 3F9NA 3NCZA 1XH6A 4PX6A 3ZFXA 3U8WA 5ANIA 4AF3A 2Y6OA 4KKEA 2XIKA 1J7UA 5CEIA 5TE0A 5C27A 1YRPA 4GJ3A 5FXRA 5IQBA 1SYKA 3VNTA 4CG9A 2QOOA 3FSFA 3MDYA 3VF9A 3EQBA 4MH7A 3FMEA 3EH9A 1SVEA 4NUSA 3TKHA 2RL5A 4XH6A 4QMNA 4D0WA 3EJ1A 1V0OA 2XYUA 3RHKA 2OH0E 4G6NA 5HNGA 5KMIA 3U6HA 4GL9A 3CPCA 4GIIA 5E4HA 3MGYA 3OC1A 4I1ZA 2PVMA 3OUKA 4P5ZA 4BBMA 4K33A 2R2PA 4FF8A 5GHVA 1SVGA 3F2RA 4JNWA 4UV0A 5IKWA 3W8LA 4RFZA 3SW4A 1TQIA 3W18A 3QGYA 2G15A 3QLGA 4QMWA 4UYNA 3MH0A 3A7GA 5F95A 1WVYA 3SDJA 3MJ1A 4XP3A 2WKMA 2C0TA 2X6EA 3DS6A 5DNRA 4FT3A 4IVAA 4MD8E 4NKAA 5FWKK 3RAWA 5A9UA 5HTBA 3TZ8A 1MRVA 3CP9A 3KF7A 3R30A 4OW8A 1KE5A 5CSXA 3T3UA 4RG0A 4FEXA 4I6HA 4O0XA 3LFCA 2BDWA 3TACA 3SGCA 4RT7A 5DWRA 3G5DA 3UOKA 4FZDB 4ITHA 1WBWA 3OVVA 4H39A 4YLJA 3NGAA 3AXWA 1URCA 3K3JA 3OFMA 4K11A 3LFEA 4DT9A 4O0YA 4NM7A 1WVWA 3P23A 5JEBA 3CXWA 4FYNA 1YXVA 4CXAA 3AC1A 3R8LA 4GK3A 4KS8A 4D4VA 3JXWA 4BYIA 3KN6A 5LVPA 3ROYA 3O71A 4M12A 4GT3A 3Q04A 5HX8A 4D1SA 3PRIA 3GI3A 4PV0A 4XBRA 4YO4A 1OL6A 4TZRA 2YERA 2R64A 4BDFA 4QPSA 4FVQA 4EUTA 5A4QA 2CNUA 1SVHA 3B8RA 5EYKA 3KMUA 4L3JA 2B4SB 5IUGA 3U54A 5KE0A 4KNBA 4UALA 2W1DA 3ETAA 4CT1A 3I5NA 4HYSA 2HWOA 4ITIA 4X2FA 3I1AA 4PTCA 3VBQA 4ZAUA 1QPEA 3LLTA 4NIFA 4RZVA 3NUXA 1OKYA 5LARA 3ULIA 3MPAA 5J1WA 3ERKA 4AW1A 3FI8A 3ODYX 4Y5QA 5IQHA 4KIQA 5FM2A 4AU8A 4RJ3A 5AAFA 4QMOA 5A4CA 1PXLA 5C03A 4CGAA 5I9ZA 1IRKA 1CDKA 1KE7A 2E2BA 4NWMA 2X8IA 3IW4A 3BBWA 3PY0A 4FTLA 4E4LA 3KB7A 5E8TA 2XKCA 3REPA 4UX9A 4L9IA 5G1XA 3CBLA 1H1QA 4CFMA 3MH1A 1FINA 3QWKA 3UG2A 2PULA 3MVHA 4IB5A 4CEGA 5HESA 3PSCA 4JBVA 4EK8A 5CAOA 5BPYA 2RFEA 1YWVA 4YR8A 4X3FC 3OWJA 5ETFA 4D2VA 2PE0A 2V55A 1YW2A 4O0WA 3JVRA 4PF4A 3ZUVA 2VTRA 3QRJA 3NDMA 3FXZA 3ZSHA 2VWBA 4XG7A 2QR8A 3HECA 4QMPA 3MFUA 4JOAA 3W2CA 4G3FA 1M52A 1Y8YA 4GFGA 2IVVA 3FKLA 4I6BA 3ZM4A 5GINE 2ERKA 4TYEA 2WAJA 3RNYA 4FV8A 3QU0A 4NFMA 4NT4A 4BZDA 4FV2A 3V01A 3EKKA 2RG5A 2WELA 4IQ6A 4NCTA 3AT3A 3O17A 4LOQA 4N57A 3CR0A 4ENYA 4NYEA 3O7LD 1WVXA 2J0JA 3BYOA 3WI6A 2RF9A 3RWQA 2G9XA 2O5KA 3FV8A 4DFNA 1UWHA 1X8BA 4FC0A 5DRDA 3G90X 4ANMA 2GQSA 3BHHA 3NUSA 3WBLA 4EOOA 4QMYA 3FAAA 2YDKA 5GIOE 5JQ8A 3C4CA 1UKHA 3FLZA 5EYDA 1H1SA 3N9XA 4JX7A 3ZFYA 3DTCA 2WGJA 3ACJA 4UMQA 2X4ZA 5JRQA 1W7HA 4NIFB 3F69A 2LGCA 4ZS0A 3PY1A 2REIA 3B2WA 4G3EA 4R8QA 4U3ZA 2BDFA 4O0VA 4WA9A 5AUUA 1TKIA 1V1KA 5J79A 4FKRA 2JIUA 5JZNA 3SV0A 3HZTA 3LW0A 4Q2AA 2W4JA 3FY2A 3UG1A 3IDPA 4CCBA 2HAKA 3C0IA 4FTCA 3OWLA 4FTQA 3BHVA 4P5QA 4CMTA 2DS1A 2P2IA 4DFYA 4RWIA 5I9YA 1ZYCA 4DGMA 5HU3A 3LJ2A 3ZO2A 3OHTA 2VTHA 4IB1A 2W5AA 3F3ZA 3C5UA 1UKIA 5E8XA 1ZY4A 5EM8A 3ZEPA 2ZV8A 2IWIA 4I5PA 5HI2A 4GSBA 5IDPA 4DITA 2VWVA 3PG1A 4YLLA 5IISA 1OIYA 3LCOA 1MRUA 3Q6WA 5M57A 3RZFA 5KHXA 3I6UA 3QD3A 2P4IA 3D83A 4LRMA 3ELJA 4TYIA 3W2OA 3OMVA 4EI4A 3EQRA 3N51A 3VS4A 2FSTX 3LJ1A 4HCVA 5F94A 5HIDA 2JKOA 4K6ZA 4DCEA 3K5VA 4BBEA 5L2QA 4QPAA 4ZMEA 2CN5A 2IZSA 5TT7A 3R9NA 4YTIA 4ZOGA 5J95A 3UPXA 3IGGA 1H27A 4QMLA 3R8MA 4DT8A 2OO8X 5FEDA 4RIWB 1PW2A 2BPMA 3PLAE 2QG7A 4M13A 3GCQA 4FSUA 3R7UA 4DA5A 1Q8ZA 4C37A 3BPRA 1M14A 1S9IA 2VWWA 2WNTA 3A2CA 5DVRA 4KKGA 3S4QA 4D58A 3WE4A 2X6DA 4ARKA 4CQGA 4F0FA 4USFA 5HNBA 5I3RA 4BHNA 5AUYA 4FT9A 4DAWA 4JL9A 5GNKA 4NL0A 4RWKA 2R3NA 2WQNA 4MD9E 1Q41A 3Q60A 2J9MA 3SG8A 1R3CA 2B54A 3V5LA 3FPMA 4R3RA 1V0PA 3ZS5A 4CV9A 5E9EA 4H1JA 2VTNA 4DFXE 4F70A 5CXZA 4CG8A 2LAVA 5EKNA 1JOWB 3F61A 1YWNA 2XK6A 4J96A 4C4IA 5CAPA 1ZYJA 2YISA 3F3WA 4MD7E 4O0SA 4C2WA 1A06A 2EB3A 5KMJA 2B7AA 2WD1A 3QWJA 3MS9A 3R73A 4G31A 1GZKA 2FYSA 1GIJA 2Y4PA 4B9DA 5CANA 3OCGA 3MV5A 2XRUA 3O8TA 4XUFA 3VC4A 2C1BA 5CEKA 5JFVA 2UW4A 3GU6A 3WF7A 3VJOA 4IAYA 2GNGA 4G9CA 3NVMB 5HE3A 4YGAA 3V04A 3A7IA 3UO4A 1ZMWA 4ZXTA 4F7JA 4GV1A 3R22A 3IDCA 4OTQA 3DT1A 1ZZLA 4TXCA 2C47A 4G2FA 5K5NA 3CPBA 1A48A 1PRYA 1CKPA 4RLKA 3R8PA 2WTJA 3MVLA 4P7EA 5KMMA 2PU8A 4E26A 4HOKA 4R6VA 5G6VA 2J0MB 4GU6A 3BEGA 5H8EA 3ORIA 5AP7A 3TDWA 5CYIA 4YJUA 4DLJA 3LKMA 3UIBA 4FSWA 4C38A 5FBOA 1BLXA 3PP1A 3VS1A 3R9OA 4J95A 4RIXA 4AT5A 3TDVA 5T68A 4DH1A 1OZ1A 4DBNA 4ZS4A 3DXQA 4MF1A 4M8TA 5K4IA 3FYKX 5D11A 2OW3A 5AP5A 3IS5A 4YJOA 5JGBA 2WQEA 3BYUA 3PJ2A 3QHWA 4FTIA 3V6SA 3MWUA 4FTAA 4O1OA 5EHOA 1ZOGA 4HYIA 4L52A 1O9UA 4R5SA 1APME 4XYFA 3ZZEA 3D2IA 3FMDA 3MVMA 5A6OA 1H28A 2X9FA 3M42A 4DEHA 3JR1A 4XG4A 1IG1A 1CKIA 3KGAA 4IW0A 4LGDA 4ZTRA 4R78A 4WNKA 3F3VA 1NT2A 3DOGA 4OLIA 3ZSIA 4FNZA 2RSVA 4MWHA 3FMHA 4YSMA 3O96A 4BF2A 3E3BX 4C58A 3DXNA 4JIAA 4L42A 4UB7A 2HY0A 3U87A 2AC3A 3CCNA 4R3PA 4BDHA 4MNFA 4OUCA 2ZJWA 3GCUA 3VUMA 4JG8A 4RWJA 4F64A 4W4XA 3C5IA 3PXYA 2IW9A 1CKJA 2WTIA 4BY9E 5HVJA 2GHGA 5AEPA 4Z3VA 5A3XA 3FLNC 4O21A 3C4XA 1PF8A 3H0ZA 3OEFX 4JQEA 3HVCA 4YTCA 4JR3A 5J9LA 1SNUA 3ZRLA 4LGHA 4ZTNA 1GAGA 1ATPE 4YJNA 1HCKA 1QMZA 2BR1A 3EN9A 4R1YA 5FDPA 3PSBA 4RWLA 3KXNA 3PA5A 3RMFA 4E6QA 3HLLA 2UZBA 4JBOA 3Q2MA 3FL4A 3R02A 2WTDA 5H2UA 4BBFA 4J98A 2YIYA 2YHVA 3UOJA 3BBTB 4LL5A 2C5NA 4P90A 4A9SA 3S1HA 2PUNA 2O8YA 5J1VA 3E7VA 4HZSA 4FIFA 3C0HA 2VWUA 3PA3A 3TEIA 3MBLA 4IM3A 4YJPA 5HE1A 4C3FA 1PHKA 1PMVA 5IQEA 2YLEA 3BYSA 4RIYB 5AUXA 1JWHA 2BHHA 2E9UA 2HZ0A 2HOGA 5J8IA 3NUYA 4FSTA 4GUEA 3CY2A 2J2IB 4K1BA 4RIXB 4ZK5A 5M09A 2ZB1A 4DH8A 1HOWA 2B52A 2O3PA 5K9IA 3TV6A 4QQTA 3VUHA 4ZTLA 1K3AA 1JKSA 2VO0A 3U51A 4U43A 3VWAA 3ORNA 4U44A 2YN8A 5FXQA 5B2MA 2E9PA 3MTFA 2ZB0A 5DOSA 2AUHA 4CVAA 4ITJA 3G0EA 1R0PA 3Q3BA 3T8OA 3LLAA 3PRFA 2YZLA 4M7IA 3T9IA 3DZOA 5D10A 5C8MA 5CZIA 5L8KA 4ZJVA 4JVGA 5IA0A 1S9JA 2Y8OA 2WMXA 4I4FA 3O51A 4J8NA 4M68A 4TPTA 3OROA 3R7EA 2IZTA 5FDXA 4FV9A 3NSZA 3WOWA 4ORKA 4YZDA 2W9ZB 1O6YA 2UW7A 3OWKA 5K0KA 4NFNA 4J53A 3GB2A 3KXXA 1SZMA 3QTIA 2HY81 1MRYA 3TTIA 2YA9A 4D5HA 3EQGA 2J51A 2H96A 3QBNA 4BDKA 2PZPA 2R3OA 3CTJA 4CNHA 3OF0A 3I81A 3MESA 3CTQA 5EDRA 2C6IA 3D7TA 3KK9A 4JRNA 2A0CX 4IIRA 4I3ZA 4JT3A 4XG6A 5EH0A 2R3IA 4IH8A 4JAJA 4AW2A 2R3RA 4YMJA 4LMUA 4X21A 4DFBA 4MF0A 2EB2A 5CVGA 3W55A 5EQPA 3EQIA 3ZLXA 4Q9ZA 2GQGA 4O7NA 4BIBA 2JDRA 3G33A 4HGEA 3DBFA 4UBAA 3U6JA 4S32A 3C13A 2OZOA 4KINA 2PK9A 3PZHA 3IK3A 2WTKC 4RC3A 3BX5A 2C4GA 5HTIA 3QZHA 1YHVA 5F1ZA 3FMJA 4TNBA 2VTOA 4H58A 3FC1X 5IZFA 4IZYA 3SXFA 1KOAA 5L6WL 5FP6A 3TG1A 3NNVA 3GCSA 3PVUA 4S2ZA 1LEZA 3PJCA 3NYVA 4X7QA 4O7VA 3FZRA 3RPVA 1OBGA 2X81A 3KKVA 4FV7A 1H8FA 4RJ5A 4O84A 2W99B 3GFWA 1Q8YA 3NYXA 4DH5A 2BKZA 4ONAA 4EJNA 2BRMA 5B2LA 3QAME 2ACXA 2IVUA 2JKKA 4BB4A 4JR7A 2JBOA 5JGDA 3WYXA 4AZSA 4DN5A 4U45A 2FB8A 2QOCA 2X0GA 4GK2A 2WMRA 4RJ7A 3R7VA 1R1WA 3WE8A 1P2AA 5EW8A 4BVUA 2UZDA 1J1BA 4LRKA 2PUPA 4OT6A 4OTGA 2CHLA 4B4LA 3QUEA 3ZO1A 5ANDA 2CNQA 4PDPA 2W4OA 1F3MC 3FEGA 5DR9A 4MX9A 4F6WA 3O23A 4KSPA 4PNIA 3S0OA 3HRBA 5L6PA 4EKKA 1LUFA 2I7QA 3CJFA 4F9CA 3TNPC 1GZNA 4MXCA 2XJ2A 3LJ0A 5FBNC 1DI8A 3BLHA 1BMKA 3UQCA 5EDQA 1WBOA 2JGZA 4FTKA 3TNIA 4ZZNA 3RVGA 2PUUA 4Y85A 3QX2A 5HD7A 4WT6A 1U59A 3ZCLA 3ZO3A 4YZ9A 3BQCA 5IA5A 3WZDA 3NMUF 1Z9XA 2F2CB 2QKWB 3TCPA 5ACKA 2BCJA 4BCJA 3UOLA 3KK8A 2QLQA 3H4JA 4ALWA 2YAKA 1UU9A 1MP8A 3UIXA 3RTPA 1YDRE 3VUKA 3FI2A 3L8VA 5LVNA 2C6EA 3L9NA 2I1MA 4BTKA 4O7RA 3AOXA 5D7AA 5CLPA 4QTAA 4AE6A 1RE8A 1YI4A 3L9MA 4F9BA 3FQEA 3UVRA 5FQDC 4I20A 4XLIA 4YBKA 2VX3A 4CTCA 5HNIX 5HCZA 5LJJA 5J7BA 4ANBA 4LI5A 4IMYA 2BRGA 2RFNA 3HV6A 4FKJA 4D2WA 2WXVA 4IZ7A 3ZH8A 4CYJA 3MPTA 2OF4A 3H9OA 4BZNA 1YKRA 3OEZA 4O7SA 2CJMA 3OOGA 4GIHA 3MIYA 5T6KA 5HG9A 3ZDUA 1OUYA 3C51A 3JS2A 4AZEA 3MW1A 4IBMA 2V7OA 5DEWA 4ZSEA 4GYGA 1W98A 2QURA 4M3QA 4C33A 2ZM3A 3FE3A 4F0GA 3R9HA 3KU2A 3NPCA 3VUIA 3E8EA 3VHKA 3QD2B 2UZNA 4M69A 2VWYA 4FG7A 3C7QA 4F9AA 3RCJA 5IQIA 1LR4A 5FLFA 5CF8A 2BHEA 2VAGA 3DBQA 1UNHA 4M97A 3SAYA 4CMUA 5L2SA 4DFUA 4IJPA 5ANOA 3LQ8A 3QCSA 5IH6A 3FZSA 3R1NA 3CGOA 3PIYA 4R7HA 4WNOA 4CFWA 1Z5MA 3SQQA 2XIZA 4WG5A 1ZY5A 4PPAA 1G8SA 1XH5A 5AP3A 2W1ZA 4XG3A 4IX5A 1DI9A 5CSWA 5AR3A 4D4YA 5HLNA 2YCFA 2FGIA 1JNKA 4FMQA 5GIPE 1H08A 1FMKA 3OT8A 3PTGA 3ZOSA 3PZEA 3VQHA 4DFZE 4EYMA 2B9HA 3DU8A 1L8TA 2DYLA 3DTWA 4C61A 3VBYA 4BR3A 2C68A 2WFYA 2BRBA 4FT7A 4U80A 2PE1A 5FRIA 4EKLA 4CFFA 2WQBA 4RFYA 1BL6A 4HGLA 4MHAA 4Q5EA 3QQKA 3HV4A 4QP2A 5CENA 4C34A 3Q9WA 2ITXA 3AC2A 4FKLA 4PNKA 4DE4A 5IQAA 3SG9A 2VWXA 3R71A 4NU1A 1OMWA 4RX9A 3F82A 4PL3A 4L43A 4FSYA 1JSTA 2DUVA 2WU7A 3QQFA 4O96A 2Q83A 1U5RA 4EOKA 2QONA 2QODA 2JBPA 4ZSAA 3R63A 2OKRA 3Q52A 1VYWA 2XA4A 3QA0A 4O6EA 3P5KA 5DR2A 3RM7A 3AQVA 3ACKA 4IE9A 4BWKA 5E92A 2WQOA 3GP0A 2C69A 5AUWA 1P4FA 4LM5A 3H10A 5BYYA 2R9SA 4ZY4A 4YHTA 1URWA 4B99A 4C35A 3MA3A 2YIWA 3EZVA 4NKSA 3VRYA 4FT5A 4F08A 3DXPA 2X7OA 1CTPE 1O6LA 5EHLA 2RIOA 1XBAA 1XWSA 4WG4A 4IWOA 1ZMVA 2GTMA 2PZ5A 3LXPA 4Y73A 3AD4A 4EHVA 1VZOA 5AMNA 3PIZA 3BHUA 4OTRA 3GEQA 1BL7A 2BTSA 2PVNA 2EXCX 2Z7SA 5BUJA 3DK7A 4W4VA 3GGFA 2XNGA 5C9CA 4CLIA 3QTRA 1W8CA 4ZLOA 3ZEWA 3HMMA 4XCUA 3L8PA 1ZOEA 2WO6A 3AMBA 2F7EE 2JDSA 3R8ZA 2OG8A 2PVFA 3VVHA 1PKGA 4HNIA 4W9XA 5JMSA 4O38A 3BU5A 4P2KA 2PVJA 3MI9A 5DI1A 2XNOA 1KV1A 5DBXA 5HTCA 3RAIA 3GCPA 3OBJA 3R00A 3PYYA 2VTPA 4PMMA 4GW8A 4FV6A 3L1SA 1OKVA 3ET7A 2B9FA 4QT1A 5J87A 1LP4A 3DPKA 2WQMA 3AGLA 5C8NA 2OXDA 5A4TA 1CM8A 1K2PA 4CFVA 1FVVA 3EYGA 4D28A 5CT0A 5IQFA 3WF5A 4OAUC 3CIKA 3ENHA 2HYYA 3OW3A 4JDKA 5CVHA 3SLSA 4LV5A 2VWIA 2QNJA 2O65A 4BCPA 4TL0A 3P78A 2RFDA 3BCEA 4DC2A 3F88A 1KSWA 5CSPA 4Q9SA 4KIOA 3DK6A 1UU3A 3BI6A 5AA8A 3V8SA 3LVPA 3UNKA 4FK6A 1PKDA 3ZMMA 3WF6A 3SVVA 2J90A 3QRIA 4QP3A 4XV3A 1JKTA 3E64A 3PWDA 3DFAA 4IFGA 5EFQA 4QTBA 3UNJA 5FG8A 4C4HA 1YHWA 2HXQA 3THBA 5KZIA 4O82A 4APPA 3HMOA 3B2TA 2BDJA 2QO9A 3P1AA 5HE0A 3RJCA 3W16A 4ALUA 4BIDA 4YUQA 5IG1A 4G17A 1JBPE 3C4EA 3CLYA 2XEYA 3T3VA 5DFPA 4FEVA 4A4OA 3BQRA 2VO7A 3QF9A 3DY7A 5E90A 4L7FA 5CSVA 2WEVA 4IDVA 1XBBA 5DG5A 4FODA 2YEXA 4KABA 2R3HA 4DG0E 4V04A 2BAJA 4UEUA 4ZY6A 5BYZA 2FVDA 4DEGA 2SRCA 2YZAA 4RJ4A 5ANKA 1XKKA 3NAXA 3GQLA 2WMQA 3R83A 4Y95A 3V5QA 3MH2A 4EOSA 2R3LA 4EOQA 4QYGA 2WMTA 3TIZA 4C57A 5CEQA 2UV2A 3EIDA 4FL3A 3VRZA 4R7BA 4M84A 3EN4A 1Y6AA 1WBSA 2QOKA 2UZOA 2YM6A 3VBWA 4D9UA 3D14A 3MYGA 2CLXA 4RQVA 4FKIA 2BTRA 2R3JA 3EQPA 3TV7A 4U7ZA 5HZNA 3OWPA 2EUFB 5E8SA 2ITNA 4K2RA 4AAAA 3DQWA 4IC7A 4ZTQA 3FDNA 3RZBA 1UU8A 5FTGA 2VTLA 3R1YA 4KWPA 4BDJA 1YDTE 3IW6A 3PXRA 5ETCA 1FGKA 2VTJA 3DA6A 3BWFA 3OS3A 5D1JA 3HGKA 4QMMA 2X7GA 3FI4A 3QC4A 4MYGA 3RINA 3FWQA 5BVDA 1JLUE 4NM3A 2VTTA 2X8DA 2XK3A 3ORLA 4I22A 5BX0A 2Z7RA 3WF8A 1GJOA 3C9WA 3TUDA 3G15A 3HV7A 5M08A 2JDTA 4EBWA 5IDNA 3DKFA 4HZRA 3KN5A 5IA2A 3PE2A 4NTTA 5FD2A 1UNGA 3BKBA 4KA3A 2VX0A 3TKIA 4U3YA 3R9DA 2QHMA 4H36A 3LQ5A 4ASDA 4BCMA 4YHJA 5K0XA 2W96B 4YC6A 3PIXA 4QP7A 4R7IA 4XBUA 3RK5A 3UVQA 4U42A 1XHAA 4GCJA 5KMLA 3TI1A 3DJ6A 3NS9A 3QD0A 4I93A 5CZHA 2P55A 3A7FA 3FMKA 2ONLA 3QRKA 3NIZA 4HYHA 5D12A 2QCSA 2X8EA 1OL1A 1JSUA 3CY3A 3FYJX 4O7TA 3UC4A 1T45A 4NW5A 1KWPA 2UVXA 2E9VA 3L9LA 3EZRA 1Y6BA 4F99A 1IASA 1JKKA 2PMLX 2GTNA 3VS2A 2VTAA 5DMZA 2OIDA 2VTIA 4BWXA 2YIQA 4QTCA 3CEKA 5HGIA 4EOIA 5LVLA 3HRFA 3SX9A 4IAZA 2XKFA 4JAIA 2XNNA 1J1CA 2CKOA 4K8AA 4RC4A 3ALNA 4E7WA 3VF8A 4FKWA 2CSNA 5AV1A 5ETIA 2O0UA 4D2TA 5EQYA 3KXGA 5KZ0A 4K0YA 3U55A 3FQHA 2UW9A 5A4EA 2BFYA 3IOKA 4MEDA 2EWAA 1VYZA 3PLSA 3MH3A 3UJGA 4Z7GA 4BGQA 4U97A 3WF9A 2YM7A 3O8UA 5HG7A 3LZBA 2GSFA 3ZONA 3M1SA 4U5JA 3I7CA 1UVRA 1VR2A 2IZRA 3C4ZA 1WFCA 3QFVA 3R7IA 4EK4A 3MFSA 4FICA 1Q99A 1LPUA 3QA8A 4YTHA 4AX8A 3CKWA 3QQHA 4E6DA 2JD5A 3P08A 4H3QA 4I6QA 3DGKA 4KRCA 3OCBA 4FIJA 3CQEA 2W17A 2Y0AA 1LEWA 2J4ZA 4PL4A 4D4SA 4U8ZA 4MKCA 1ZYLA 1CSNA 3AT4A 5EHYA 3KMWA 4D2RA 1SM2A 4L45A 1H24A 1YWRA 2BIYA 3E3PA 3QXPA 4U40A 3UVPA 2F4JA 4I94A 4YBJA 4HNFA 4ZJIA 3RK9A 5L8LA 2YWVA 4I41A 2IPXA 4RMZA 2BKKA 4G3GA 3VS5A 4XS2A 1ZMUA 3ODZX 2KTYA 3ZSGA 3E62A 2OZAA 3O7LB 3COIA 4R5YA 2H8HA 4XOZA 2W1HA 3TZMA 2JKQA 2WTWA 2XP2A 3FJQE 3H9FA 4BCHA 3GU8A 3RNIA 2F2UA 2VTMA 3IW8A 4H1MA 4IVBA 3TZ7A 2XNEA 3GXLA 3G51A 3AC4A 3NYOA 3PE1A 5KHWA 3QXOA 1CMKE 1IA9A 2ESMA 4I0SA 3DBDA 4FSNA 4RZWA 3LXNA 4YJSA 2OXYA 2B9IA 4HJOA 4J1RA 2ITUA 4RSSA 5D9HA 3UOHA 5CNOA 3O8PA 3PXKA 3UBDA 2P33A 5EI2A 5AWMA 4KIPA 3VIDA 5AP1A 4TRLA 2BFXA 4PDYA 1TQMA 1W82A 2IO6A 4IDTA 2OICA 1JKLA 2C30A 4JX3A 3ZDIA 5CAUA 3G0FA 1YOMA 4J71A 3NRMA 2IW8A 1QPDA 3POZA 2X7FA 4IZAA 4AZFA 3KC3A 3OP5A 4Y8DA 4G1WA 4X2KA 3KRWA 5E8UA 4A9TA 2GFSA 1PY5A 3BRBA 2HZ4A 3FLQA 3QTQA 4D55A 4B7TA 3L8SA 1H26A 3F7WA 4Y5HA 3MY5A 1YOLA 2XK8A 3MTLA 4C59A 4HVGA 4QQJA 4R3CA 3ORXA 2XMYA 2ZOQA 4CFUA 3FQSA 2UZWE 4M14A 4A4XA 4R77A 3RHXA 4I4EA 3NEWA 1Q24A 3TM0A 4IVDA 3NNWA 4KRDA 2X4FA 4FKGA 4O0TA 5EDPA 3V8WA 3LFNA 3UO5A 3UQFA 2W5HA 3I0OA 4LUEA 4EC9A 3QUPA 3E88A 4RGJA 4YNEA 5HX6A 3E8CA 2C6MA 3NUPA 1Y8GA 4TKSA 1OPKA 4YZBA 2J0LA 4ZSLA 3SHEA 4HVSA 4Z16A 5IA1A 2CCIA 4AGCA 1NVSA 1TQPA 5AAGA 3QRUA 5LOHA 2ZDTA 5ANJA 3D94A 4I21A 4S31A 5C4LA 3KRJA 3COHA 4H3BA 4DGOA 3TNQB 2XK9A 4EK3A 4LRJA 2A27A 4D9TA 4AGDA 4U6RA 4L68A 4PL5A 3W33A 1PYEA 2W1FA 3KVWA 3LXKA 4IX4A 4UZHA 4OAVB 2OJJA 1XBCA 3I60A 5IQCA 2OZAB 5FEEA 5AV2A 4LMNA 4FTJA 3NUNA 2OBJA 3LCSA 4FTNA 2I0EA 2JITA 3DK3A 4ZMFA 3Q53A 4L3PA 5AR7A 2ZV9A 5BVWA 2C5YA 1OI9A 5HG8A 1Y91A 5M4UA 2ETKA 4IWDA 1FPUA 2ITQA 1OB3A 4U79A 4TT7A 2JC6A 3HP2A 3KULA 4DH3A 2I0HA 4F1OA 4HVIA 1WZYA 4AFEA 4USEA 3OUNB 1Q97A 4DTKA 1OPLA 4RX7A 2Z7LA 3PXZA 3HEGA 5HE2A 3ZXZA 4ZY5A 2X39A 5AADA 1ZLTA 2RGPA 2VRXA 3D2KA 3PXFA 5FXSA 4EH4A 4EEVA 4EQCA 4FEWA 5DYJA 5IQDA 4O81A 1Y57A 2Y4IB 4YO6A 5BVOA 4FGRA 2NP8A 3C0GA 4JBPA 2EXEA 4FT0A 2YCSA 3MA6A 2FSMX 2PL0A 2XKEA 4O6LA 3BLQA 3MY1A 5D7VA 3VQUA 4FKPA 3COKA 2Y9QA 3UYTA 5HQ0A 5AV0A 3UZRA 5JSMA 1FVTA 3DFCB 3ORZA 3TIYA 4N4SA 4AN3A 5AJQA 4AW0A 4D0XA 4E5AX 4RVMA 4YJVA 2NRYA 4UMRA 3C4WA 4IM0A 5AP4A 1MUOA 2YLFA 4TN6A 2B0QA 4JDHA 4NCTC 5JKGA 4BDIA 4AT4A 4FV0A 4FBXA 4X0MA 3KEXA 3C50A 3AMYA 3W8QA 1DAWA 4KB8A 1JVPP 2W1EA 4BYJA 4PMSA 2YM3A 3GC8A 4C3RA 4FTUA 5KCVA 3HMIA 2EU9A 2WMSA 2C3IB 3SXRA 4AACA 5BMSA 4GVAA 1UV5A 2XNBA 3ZRMA 3N4VA 4ACCA 5A54A 1G8AA 3FMLA 3UTOA 3MPMA 3N4UA 3NVKI 3CTHA 4ACMA 4NK9A 5CY3A 3LE6A 4L53A 3EQCA 4TWOA 3ULZA 4BCFA 4FV5A 3OW4A 3OZ6A 3VJNA 5A4LA 2EVAA 5M4FA 3FMMA 4ANOA 3QQGA 2Z2WA 3BE2A 3BWJA 3O2MA 4OTWA 3PXQA 4WSQA 3VO3A 3ZYAA 4AQCA 3FXXA 5LMAA 1RQQA 5FTOA 4CZUA 2R3QA 2YIXA 3GBZA 4G16A 5GZAA 2OJGA 3BE9A 3DLZA 2O64A 4C36A 5IMEA 5CVFA 2EXMA 2QI8A 3BU3A 3VUTA 4YP8A 2PMOX 4XX9A 4XG8A 4YZMA 3GFEA 4KBCA 3KULB 5M55A 3C4FA 1KUTA 3MFTA 3MN3A 3VS6A 2XVDA 3HAVA 4KIKA 3P7AA 2FH9A 1U4DA 1FBNA 4JG6A 5AUVA 1Q8TA 4K9YA 4QMTA 4F4PA 3GU5A 3BGQA 4B8MA 4HCTA 4G6LA 5LMBA 2NRUA 4AN9A 3F2NA 4BGHA 3HAMA 4EJ7A 1XQZA 4FL1A 2ETMA 1B39A 3U9NA 1P5EA 4EHEA 1H4LA 3R21A 2OFUA 3H0YA 3ORTA 3QUDA 3AC8A 3MB7A 4D5KA 5C1QB 5IUHA 2XRWA 4KBKA 4FV1A 5JRSA 3LMIA 3GNIB 1BX6A 2PVHA 3IW5A 1SMHA 4Y46A 1PXIA 1IR3A 4JXFA 1ND4A 2FSLX 2XIXA 4EWHA 1ZYDA 4RLLA 3LM0A 2GQRA 3A4OX 4WRSA 2GPHA 4XG2A 2B9JA 3PSDA 4DEAA 4XLVA 5I9WA 2J6MA 5J5TA 1T46A 3NX8A 3RPYA 4BDBA 3GENA 2XCKA 3F3TA 3GUBA 3WZJA 5AP2A 1O6KA 3PJ8A 5KKRB 3VN9A 3BV3A 5EYCA 5AP6A 1YOJA 2CKPA 1GNGA 1WBPA 2XJ1A 4EUUA 4F65A 1BYGA 3Q4ZA 2YJSA 3PY3A 3WILA 5CF5A 4EOMA 2BAQA 2W9FB 5CTPA 3S3IA 3D0EA 5L8JA 4GKHA 4KKHA 5EI6A 2ZV2A 2FUMA 5GZ8A 3VAPA 3P0MA 4FL2A 2YDIA 2UW6A 3NW5A 5IQGA 2PHKA 4X6QC 3UIMA 2XYNA 2YABA 3K5UA 5CS6A 1I44A 5BUEA 4NM5A 1W83A 2WB8A 4X2NA 4TYHA 1PXPA 3UDBA 1AQ1A 4G34A 1G3NA 5H9BA 3HRCA 3Q6UA 3POOA 2WOUA 3VULA 4WIHA 2XJ0A 3LFSA 3UP7A 4X3JA 3KMMA 1PYXA 3ZO4A 3DNDA 3FKOA 4TNDA 4XHKB 3UNZA 5HVYA 2CGVA 3LOKA 1H1PA 4V0GA 4XRLA 3PFQA 4JDIA 3KCFA 2XS0A 4EH2A 2HW6A 3LCTA 3SA0A 1XO2B 4J8MA 3PPKA 4KIKB 4L3LA 3V3VA 4ZLZA 4DTBA 2G1TA 1ZAOA 3FKNA 2CDZA 4JQ8A 3PUPA 2YWPA 3ZLYA 3MY0A 3H30A 4FGBA 4I6FA 3K54A 4FUXA 3NW6A 5HBHA 3R01A 3UODA 2RG6A 4A06A 2H34A 4TY1A 1W0XC 2WTCA 3GVUA 3PP0A 4JS8A 2OJ9A 4EHZA 4XP0A 4ZZOA 4E6CA 4YJQA 2H9VA 3FZTA 2ZM1A 3EQFA 2PVKA 5H8BA 4YPDA 4AUAA 4GFMA 2VN9A 2CPKE 3QTZA 4L44A 3BHTA 5FM3A 3T9TA 4KUJA 2Z7QA 2PZRA 3LFBA 3RPSA 3D7TB 3PJ3A 3DDQA 5HD4A 3RPOA 3ANRA 3ANQA 3CGFA 3NWWA 4ASXA 4EH6A 5IH5A 4JLCA 3VS7A 3QKKA 5BVEA 2R7BA 4FKQA 5K4JA 2CMWA 3NR9A 3SKCA 4FUYA 3WARA 2BALA 2BZIB 4RX8A 2X9EA 3QKLA 2UVZA 4WD5A 5E8WA 4AE9A 3FHIA 3QQLA 2W0JA 4AZTA 4BI2A 4EH3A 2A2AA 2O63A 1P4OA 2B53A 1Q62A 2PVRA 3P7BA 5TO8A 3RM6A 3KXMA 3QKMA 2GNLA 4PWNA 1Q5KA 2HXLA 5AR4A 2PYWA 1PXMA 2JAMA 3GC9A 4K77A 3ZRKA 5C26A 3FZPA 4RJ8A 3SOCA 4G5JA 4O2ZA 4BCOA 3LCKA 1OGUA 4DYMA 3ROCA 5J7HA 4HGSA 2QLUA 4QMXA 4XRJA 2OF2A 2HENA 3KQ7A 5J9YA 1BUHA 1K9AA 2R4BA 2F7ZE 3NUAA 2YFXA 5HLWA 4E5WA 4IB0A 4NM0A 3QHRA 5TKDA 3TUBA 3PPJA 1XH9A 3QQUA 4V0GB 3ZTXA 4OBQA 4G3DA 4BCGA 2ITVA 2G01A 4NZWB 4WNMA 4X3FA 4FOBA 2XEZA 1KE6A 2ITWA 1ERKA 4LFIA 5CQWA 5EG3A 4WUNA 5IA3A 4E4MA 2C6KA 5KMOA 2XIRA 4PTGA 1J3HA 3F5UA 4C4FA 3DCVA 3NNXA 5AR8A 3M2WA 3NNUA 3E63A 5EOLA 3UC3A 2PMIA 3R1SA 3AD5A 4JBQA 4DBXA 2WMUA 3JUHA 4YC8A 2YITA 4BICA 2WIPA 4BTJA 2YM4A 3NUUA 4GFOA 2YCRA 2NO3A 4KS7A 2IJMA 2I0VA 2VTSA 4GJ2A 4JQ7A 2UW0A 2DWBA 1M7QA 2AC5A 4FVPA 2HZNA 3I6WA 4NJDA 3L9PA 4DEIA 1G5SA 3LPBA 5IPJA 4FKVA 2ERZE 3RCDA 2ZDUA 2GHLA 4CKIA 4YZNA 3UIUA 2VX1A 3ORKA 5HO8A 2XUUA 3Q9XA 2PVYA 3RK7A 3QLFA 2UW8A 3IONA 3QZGA 3E5AA 4TYJA 4X2JA 4FG9A 4RA5A 3EWHA 3TNWA 1F0QA 4QP4A 3H9RA 5CU0A 3WZEA 1XH7A 4DGNA 3HDNA 2J0IA 3KL8A 4I23A 4FIIA 2BMCA 5L2IA 2XK4A 3VS0A 5AUZA 3FLYA 4RJ6A 3IKAA 5JFSA 2WPAA 4G9RA 1XJDA 3IOPA 3KCKA 3OD6X 4HGTA 1U5QA 2BZJA 2CNVA 3D4QA 2AYPA 3ID6C 4QP1A 2G2IA 5DN3A 3A61A 4EH9A 5ANGA 5AR2A 4ANLA 5ITAA 5JK3A 5LWMA 3PDTA 1VJYA 5C01A 4EOLA 4L01A 2CLQA 4LOOA 4U41A 4IC8A 3RGFA 4M69B 3ZLWA 4FNYA 2C6OA 3EYHA 1Q8WA 4ZIMA 3R8UA 3WIGA 4X3FB 3ZZWA 3FZ1A 4O0UA 5M53A 1YVJA 3OXIA 4OT5A 4L6QA 2XM9A 2C5VA 4GRBA 4O7WA 4ZLYA 3IPHA 4ALVA 5HHWA 5AP0A 2OSCA 5M44A 1YI3A 3E87A 3L8XA 3BIZA 3VS3A 1Q3DA 3AC3A 2ZAZA 4L8MA 4MAOA 4E1ZA 3EQDA 3FI3A 4WNPA 5KX8A 4AN2A 2GS7A 4FZ6A 2GMXA 5DEYA 3LMHA 3WZKA 3ITZA 4B8LA 4QYYA 2BROA 5E91A 1M2RA 1I09A 1KOBA 3GOKA 4MQ2A 4V01A 3GC7A 3MFRA 3MVJA 5IUIA 3EL8A 4GS6A 5AUTA 2A1AB 2IVSA 4IEBA 4B0GA 1NY3A 1NW1A 3TZ9A 3GOPA 4CFXA 4D4RA 3OOMA 4GT5A 4F63A 3JYAA 4UYAA 1MQ4A 2QO7A 3GC0A 4GYIA 5M07A 4D2SA 5GJGA 4XEYA 4DLIA 5EM5A 3D5VA 3FC2A 3FMNA 3UZPA 1OUKA 3PG3A 2VUWA 5JFWA 5L4QA 4PP9A 3U9CA 4GG5A 1XH8A 1H01A 4E4XA 3D5WA 5B0XA 1Q61A 4Z9LA 2QU6A 3A7HA 1ZARA 1XH4A 3A4PA 5HICA 3UMWA 2IG7A 3H3CA 5HIBA 3DB8A 4HCUA 5AV3A 1W84A 3ZBFA 4F9YA 3Q4TA 2V62A 1HCLA 2QO2A 4UZDA 2UUEA 5BVKA 4ZTHA 4E6AA 4ASZA 5B7VA 3QZFA 5HO7A 5I9XA 3P4KA 4RA4A 3TXOA 3A60A 3FHRA 2J50A 4DG2E 4IVCA 3VW6A 5KBQA 5BYLA 2ZM4A 1OL2A 3PVWA 5BQ0A 1RJBA 3FSKA 4YPSA 5KO1A 3HL7A 4YLKA 3OXTA 3UGCA 2C1AA 4AS0A 3D15A 4AT3A 2NPQA 2W1IA 5CAQA 4WHZA 5H3QA 3DQXA 4FZ7A 2Z60A 2JDOA 4C4JA 1NA7A 4RIOA 1FVRA 2ETRA 3EB0A 3W2QA 4ANSA 3E7OA 3HYHA 4GMYA 4FEQA 4EC8A 4HW7A 5M06A 2ITTA 3I79A 4BHZA 4FSQA 4U81A 3Q9ZA 2QKRA 1YQJA 5EW3A 5KBRA 2IZUA 4I5CA 5E8VA 3U4UA 3QC9A 4S34A 2OXXA 2UZVA 2HELA 4FTRA 1KE9A 4WKQA 5CT7A 4F6SA 3ZM9A 4ZP5A 4WO5A 4OGRA 1YXXA 3NYNA 3EKNA 4GT4A 4FSMA 4AGUA 2F7XE 2PTKA 4XV2A 3KRRA 1ZRZA 2W05A 3OBGA 4CT2A 2X2MA 4QMQA 4FZAB 4WBBB 4NW6A 5AX9A 5DIAA 4RC2A 4EZ5A 4IWPA 4BC6A 5AIRA 5EQEA 3HUBA 2J7TA 4GH2A 3CE3A 3GT8A 4UWYA 4CKJA 3OY1A 4FSZA 4IZ5A 5AX3A 5EM6A 4AG8A 2XIYA 3VW8A 1OL7A 5JQ5A 4X6RA 4LYNA 1PXNA 5CU3A 3K3IA 4ZSGA 4DHFA 2Z8CA 5LMKA 2XCHA 4FKTA 3RPRA 4DTAA 2F9GA 2Q0NA 3P9JA 1UWJA 2OK1A 5CI6A 3EQHA 4I5MA 1GZ8A 4UWCA 4MBIA 5GJDA 1H0VA 3MB6A 4E93A 1OKWA 4IAAA 4PRJA 4QOXA 1RW8A 2I0YA 2UW3A 2PUIA 1REJA 2BUJA 4BL1A 5KMNA 5DR6A 1BI7A 4M67A 4FSRA 4OBOA 4O7ZA 4ZJJA 4W8EA 2XB7A 3BU6A 3DKOA 3FL5A 1FQ1B 2CGXA 3QYWA 5DRBA 1AD5A 4E3CA 4IANA 3D5UA 1KE8A 4DCAA 4F7SA 1B38A 2OFVA 2JKMA 3PVBA 3U6IA 2XF0A 3CQUA 5JFXA 2GNHA 4AWIA 2FA2A 3BYVA 3R7OA 1FMOE 3NCGA 3SRVA 4QYEA 4PMPA 3JY0A 3TKUA 1QPCA 1H0WA 4RIWA 1OKZA 4C3PA 5HU9A 2XBJA 4CRLA 2HK5A 3II5A 4LOPA 3V5WA 4BFMA 3VUGA 4NEUA 2QOHA 4MBLA 2Y6MA 2XNPA 4EONA 4F1MA 3HA8A 3DJ5A 4W4YA 3PA4A 2PZYA 3KREA 3IQ7A 4YNOA 1YXSA 3TL8A 4APCA 4O83A 4PPCA 4AOTA 4LGGA 2OH4A 1ZYSA 4JIKA 4PUZA 3TJDA 1R0EA 2C6DA 2J5FA 3BGPA 3QQJA 4PDSA 4Z55A 1ZWSA 1P14A 2W06A 4ZSJA 1BKXA 4DG3E 4ENXA 5TOZA 4RRVA 5FGKA 5FTQA 2F49A 2UZUE 4BKZA 2ITYA 4PY1A 3F5GA 3V51A 3FY0A 5CU2A 4E4NA 3LQ3A 3EN7A 1V0BA 4XV9A 4GUBA 3R28A 2GDOA 4BTFA 2JIVA 1KV2A 1UU7A 2Z02A 2O2UA 4DGGA 3EN6A 3R0TA 4YZCA 1RDQE 4BKJA 4G5PA 3DAJA 4IAKA 5E8YA 4QMSA 3HA6A 3S00A 4QD6A 4OTDA 2Y7JA 4EOPA 3W2PA 4BDAA 1VEBA 2VZ6A 4J99A 3ZC6A 3DAEA 1H07A 2YM5A 3A8WA 3ORPA 4MXZA 4FTOA 5DT0A 3DBCA 4BZOA 5CU4A 5CF4A 3O50A 4M15A 5DLSA 2VNYA 4YJRA 4RBLA 1H25A 5E8ZA 2I6LA 1OPJA 3HUCA 3K2LA 3ORMA 5IF1A 5LMKC 2R3FA 2WMAA 2PZIA 3PPZA 4GK4A 2JFMA 3ZLSA 2WEIA 4EH7A 4FZFB 3TUCA 1OVEA 4BCKA 4EORA 4O91A 4FR4A 1M17A 3NIEA 4AA5A 3HX4A 4FTTA 3BLRA 2VV9A 3IG7A 3SRVB 2W5BA 1E1VA 5ETAA 3W32A 4Z7HA 1WCCA 5KUPA 1J91A 3ATTA 5K3YA 3SD0A 3VUDA 4EQMA 5A6NA 3QRTA 2G2FA 3FZOA 4FK3A 1Q8UA 3QD4A 5JT2A 1L3RE 3IW7A 1JAMA 3IO7A 3EL7A 4QYFA 1PXKA 4QMZA 5CF6A 4F09A 4CMOA 3UO6A 2BZHB 4OTHA 4QP6A 3V5TA 4CYIA 4YTFA 4PTEA 2ZVAA 3A7JA 3V8TA 3HMPA 5CEPA 4FNWA 4QO9A 3TV4A 3OT3A 3ZUUA 3LIJA 4J7BA 5ANEA 4UN0C 2WIHA 3JPVA 4MNEA 1OIQA 3JVSA 5EKOA 2JDVA 5EYMA 3EFWA 4AW5A 2HZIA 4TWNA 2QOIA 4MXXA 3TNHA 5E7RA 3KFAA 2JIIA 5BMMA 3VHEA 4ANNA 4HVDA 5I0BA 3RI1A 3JY9A 4UWBA 4FNXA 3RWPA 3G9NA 2OJFE 5C4KA 3DV3A 5DGZA 3QTWA 4I0RA 4XP2A 5AV4A 5IEXA 4HYUA 4QNYA 4IX6A 3UE4A 5J5SA 3LM5A 3RAKA 1ZOHA 2B55A 4IJ9A 1NVQA 3RP9A 3R1QA 5AAEA 3BELA 2HW7A 1M2QA 1H00A 4I24A 3LFFA 4L67A 4CCUA 2GS6A 2WZJA 3MJ2A 5DT4A 4AOJA 2C0OA 3G6HA 1WAKA 4OBPA 4V05A 3R2BA 2XZSA 3QALE 4O27B 3ZUTA 2GHMA 4W9WA 4C4GA 3DZQA 5CEOA 3KF4A 2V22A 4QRCA 5TF9A 4UY9A 1FGIA 1GIHA 2YM8A 3DJ7A 4AOIA 4HPTE 3AMAA 4BCIA 4D1XA 2IVTA 4XMOA 4ZTMA 5JN2A 5LQFA 2J5EA 2PWLA 2ITZA 1JSVA 3F2AA 4AXAA 5C8KA 2YACA 5DE2A 1NVRA 4NSTA 1QPJA 4FV3A 3R04A 4C7TA 3EFLA 4QTDA 5DA3A 4CSVA 4H05A 3VBVA 4ZZMA 4CRSA 4RIYA 5CWZA 3BZ3A 5ACBC 4MBJA 4I0TA 2WU6A 2QU5A 2R3PA 3CSVA 2QOFA 2XM8A 5BVFA 4N70A 4OTPA 4NTSA 1EH4A 2P3GX 1OL5A 2PE2A 2QHNA 2VU3A 4Y83A 3PJ1A 5K5XA 2QG5A 3OG7A 4IWQA 5E1EA 2HCKA 2QD9A 5EW9A 3R6XA 3FLSA 4F6UA 1XR1A 4EH5A 3QTXA 2G2HA 4BWPA 1IAJA 2JFLA 4F9WA 3QTUA 1M7NA 3Q9YA 4JRVA 5LCKA 4O7YA 4RVKA 3Q96A 1PXJA 2WTVA 3GU4A 2W7XA 3KVXA 5DPVA 1H1RA 4OR5A 2ONLC 2WTKB 1JPAA 4O22A 5D41A 2QOLA 1U54A 4MNEB 4N6YA 2GS2A 3P7CA 4AFJA 2C5XA 4FIHA 2WMVA 1Q4LA 4JDJA 4IAIA 3TTJA 4LV8A 1Z57A 4D2PA 2J0KA 3RAHA 1ZZ2A 1YXTA 3OY3A 4TWPA 4IADA 3TJCA 4J97A 5CQUA 3VBXA 3GU7A 3W10A 4AGWA 4CD0A 5FUTA 4XOYA 1OIUA 2ITPA 4C02A 1YI6A 4PDOA 5AM6A 4ID7A 4EH8A 1YHSA 2CN8A 2W1CA 2X2LA 2YDJA 4U0IA 1F5QA 5M51A 3RBWA 4EWQA 4WOVA 4FV4A 3EFKA 3OCTA 3FXWA 5A46A 2WMBA 1R39A 3LCDA 4MVFA 4BCNA 1TVOA 3SOAA 5IH4A 4XNEA 4KSQA 4J52A 5EM7A 3DAKA 4PP7A 1DM2A 2DQ7X 2OI4X 4EBVA 5CAVA 4FIGA 4E5BA 1M2PA 4FE2A 3GQIA 2VGOA 4BI0A 4Q5HA 4BDCA 4DEEA 4FA2A 4CLJA 3DDPA 5CI7A 3WIKA 4AZWA 4RQKA 4P4CA 1E9HA 1OITA 2RKUA 2OWBA 1GY3A 3Q32A 5EOBA 3TT0A 2C3JA 2BRHA 3AD6A 1UNLA 2PMNX 3F5PA 3PWYA 4ACDA 2IN6A 2X1NA 2F57A 3W1FA 4DGLC 3HDMA 4EOJA 2YJRA 4NH1A 4JJRA 3FPQA 2VO6A 3I5ZA 2BVAA 3QZIA 3UP2A 4QTEA 3DKCA 2GFCA 4YSJA 5HCXA 1QCFA 2I40A 2UZTA 4QP9A 4IACA 5AIKA 4EQUA 4ASEA 3CD8A 2BIKB 2JLDA 3QCYA 3OCSA 4M0YA 3R8VA 2JEDA 4CZYB 4E20A 3DKGA 3E92A 2CGWA 4N6ZA 4F7LA 4OTFA 3MSSA 4C4EA 3EOCA 4FG8A 5DHJA 5HO6A 4FVRA 4WBOA 4XG9A 3ZXTA 4WRGA 3G2FA 3A62A 4IXPA 2E9NA 2XNMA 3E8DA 3DLSA 5LWNA 4UXQA 5EK7A 4A7CA 3F6XA 5B2KA 4BDEA 4UMTA 2UZEA 4KAOA 3Q4CA 4MXYA 3LFAA 3RKBA 4CV8A 5M4CA 5IEYA 2RFSA 3AC5A 3LHJA 4FYOA 3ZFMA 4A07A 1GZOA 4O86A 2JAVA 3DBEA 5I3OA 2Q0BA 5I9UA 2FO0A 5H8GA 4DEBA 1U54B 1J7LA 2C5OA 4DFLA 5HCYA 1WBNA 2CGUA 2XKDA 5EI8A 4C0TA 5L2WA 2BILB 3DB6A 4II5A 2KULA 4MXAA 4A9YA 4ACHA 5HBJA 5LCJA 2PSQA 3ENMA 2VGPA 4UMUA 2PPQA 3HNGA 5FP5A 3IDBA 3R2YA 3N4TA 4QMVA 3D7ZA 2QC6A 4IHPA 4XV1A 4TTHB 4TWCA 5L3AA 4O2PA 3D5XA 4I5HA 2OIQA 4L7SA 4IAFA 5ICPA 5JH6A 3CQWA 4DEDA 5T3QA 2Y4IC 3WYYA 2CKEA 4S30A 2PY3A 3COMA 2BZKB 5GJFA 3V5PA 2WMWA 4BCQA 5HEZA 5LVMA 3Q4UA 3TN8A 3V6RA 3E93A 3KXZA 3M11A 2VD5A 5CSHA 3OTUA 2VO3A 1PXOA 5CALA 5L6OA 3FUPA 2B1PA 3ZHPC 2V7AA 3UQGA 4HPUE 4B6LA 4YJTA 5I5ZA 4DF3A 5CEMA 2VTQA 2VNWA 4BDDA 4CKRA 5I4NA 3ZU7A 5J9ZA 4FX3A 4H3PA 5HORA 1Q3WA 2CKQA 3F5XA 3A99A 3BEAA 2UW5A 3FLWA 5LVOA 3BGZA 1U46A 2CCHA 1OM1A 4RVTA 1SNXA 4WUAA 4AA0A 2X2KA 2XBAA 4NJ3A 4EHGA 5IA4A 1REKA 2ITOA 4AZVA 1AGWA 3CJGA 4TYGA 4E8AA 4A4LA 4ERKA 3CKXA 4CFNA 3IECA 5HG5A 2PVLA 3HP5A 2IW6A 5DH3A 1BI8A 1R78A 4UXLA 3ALOA 4LL0A 5E1SA 3W2RA 4F0IA 4EZ3A 3NW7A 3MIAA 1H1WA 4BTMA 4YHFA 4YU2A 5HLPA 3G6GA 5M56A 3QX4A 2OIBA 4LUDA 3FBVA 5F4NA 4IM2A 3QTSA 4K18A 2P2HA 2H6DA 5AA9A 3Q5ZA 4C8BA 2C0IA 4QQCA 3UZTA 4EL9A 3Q2JA 1A9UA 5HOAA 3HV5A 3R7GA 4FKOA 1J7IA 4CQEA 4L46A 2ZYBA 4ZTSA 4EK6A 3CS9A 4L00A 2QVSE 4QQ5A 3NZ0A 4YURA 4MWIA 3A8XA 4FTMA 4MCVA 5BNJA 4GG7A 3P86A 4PMTA 5CXHA 3SW7A 3RALA 1QL6A 3WZUA 2OJIA 1GOLA 4JG7A 5CASA 4BKYA 3QYZA 3EN5A 2R7IA 2HWPA 2YAAA 4X2GA 4FIEA 5HBEA 4BIEA 3C1XA 4R1VA 4E73A 4TW9A 3AT2A 2ZMDA 3HKOA 4O0RA 4PPBA 3V5JA 1PMUA 4AP7A 3AGMA 2GNIA 5CNNA 1IAHA 4G6OA 4IB3A 4RFMA 4RVLA 5IEVA 2V5QA 3QCXA 4M66A 4GKIA 2C6TA 3F66A 3NAYA 3S2PA 2WOTA 4O1PA 4I92A 4MK0A 4TYHB 2UVYA 4WG3A 4YC3A 3E8NA 3KRLA 5CU6A 5L2TA 5LXMA 4F7NA 2E9OA 1PMNA 3ZBXA 3LMGA 5BUIA 5HKMA 4LQMA 4BN1A 4DH7A 5IMXA 3LAUA 3BYMA 2QOBA 4FKUA 5JZJA 4BDGA 2NNWB 4QNAA 3UPZA 3O0GA 4A9UA 2A19B 4QPMA 4XJ0A 4QMUA 3BV2A 4C62A 4PQNA 2C6LA 2OU7A 2XK7A 4IFCA 5GZ9A 2C3LA 1E1XA 5I9VA 1DS5A 4WSYA 5KKRC 3AG9A 3SXSA 5BVNA 1B6CB
chains in the Genus database with same CATH superfamily
3G9LX 5M4IA 2YIRA 2BRNA 2VWZA 3P79A 1DAYA 1STCE 2W4KA 3EMGA 4FEUA 4Y72A 4S33A 3KY2A 4KBAA 1UA2A 4RX5A 3OXZA 3CD3A 4GEOA 3S95A 3KRXA 3I4BA 1PMEA 2P0CA 4CTBA 1YDSE 2R5TA 4RPVA 4O7LA 1IA8A 5F9EA 1PJKA 4UMPA 1OIRA 2R3KA 4BRXA 4GU9A 4QYHA 3TYKA 5F20A 4CZTA 2FSOX 3BHYA 1IEPA 3Q5IA 3OTVA 3ZC5A 5AR5A 1WBVA 3IGOA 4FRFA 4JI9A 3EFJA 4G3CA 2QQ7A 5IU2A 4EZ7A 4USDA 5HVKA 2HIWA 4QP8A 2BAKA 5DT3A 4KD1A 1WBTA 3UYSA 2R0IA 4ANQA 2OLCA 3LFQA 3QCQA 2C3KA 3VBTA 2GNFA 1ZXEA 2V0DA 2ZMCA 4IX3A 5AFVA 2A4LA 2UZLA 2ZV7A 4FKSA 4F1TA 4M0ZA 4N0SA 4DINA 5A14A 3R9RA 1OECA 3UMXA 3LXLA 4GVJA 4MTAA 3R7YA 3TWJA 4ERWA 4EYJA 1JQHA 3LFDA 3W2SA 5FEQA 2QR7A 5HIEA 1YXUA 3CC6A 2GCDA 4U9AA 2YCQA 4ACGA 3NLBA 3ATSA 3D9VA 4MXOA 3HMNA 2XH5A 5AM7A 4EK5A 4HVHA 5JGAA 4BI1A 1WMKA 5CX9A 4D1ZA 4AA4A 3I7BA 1OBDA 2GNJA 2WHBA 3KA0A 4ZEGA 4FOCA 2GU8A 3F7ZA 4LG4A 4W8DA 3SC1A 3PVGA 3KXHA 3U4WA 3B8QA 3I0QA 4FI1A 4A9RA 4W4WA 4C2VA 4OTIA 3EHAA 2OGVA 3DNEA 3HV3A 4MQ1A 2R3MA 2QOQA 5KNJA 2W1GA 2R0UA 1FOTA 1GIIA 4BGGA 1NXKA 5KMKA 1MQBA 2R3GA 5TR6A 3GCVA 3QL8A 3F3UA 3QGWA 3F9NA 3NCZA 1XH6A 4PX6A 3ZFXA 3U8WA 5ANIA 4AF3A 2Y6OA 4KKEA 2XIKA 1J7UA 5CEIA 5TE0A 5C27A 1YRPA 4GJ3A 5FXRA 5IQBA 1SYKA 3VNTA 4CG9A 2QOOA 3FSFA 3MDYA 3VF9A 3EQBA 4MH7A 3FMEA 3EH9A 1SVEA 4NUSA 3TKHA 2RL5A 4XH6A 4QMNA 4D0WA 3EJ1A 1V0OA 2XYUA 3RHKA 2OH0E 4G6NA 5HNGA 5KMIA 3U6HA 4GL9A 3CPCA 4GIIA 5E4HA 3MGYA 3OC1A 4I1ZA 4DDIA 2PVMA 3OUKA 4P5ZA 4BBMA 4K33A 2R2PA 4FF8A 5GHVA 1SVGA 3F2RA 4JNWA 4UV0A 5IKWA 3W8LA 4RFZA 3SW4A 1TQIA 3W18A 1OGYA 3QGYA 2G15A 3QLGA 4QMWA 4UYNA 3P5JC 3MH0A 3A7GA 5F95A 1WVYA 3SDJA 3MJ1A 4XP3A 3W0SA 2WKMA 2C0TA 2X6EA 3DS6A 5DNRA 4FT3A 4IVAA 4MD8E 4NKAA 5FWKK 3RAWA 5A9UA 5HTBA 3TZ8A 1MRVA 3CP9A 3KF7A 3R30A 4OW8A 1KE5A 5CSXA 3T3UA 4RG0A 4FEXA 4I6HA 4O0XA 3LFCA 2BDWA 3TACA 3SGCA 4RT7A 5DWRA 3G5DA 3UOKA 4FZDB 4ITHA 1WBWA 3OVVA 4H39A 4YLJA 3NGAA 3W0MA 3AXWA 1URCA 3K3JA 3OFMA 4K11A 3LFEA 4DT9A 4O0YA 4NM7A 1WVWA 3P23A 5JEBA 3CXWA 4FYNA 1YXVA 4CXAA 3AC1A 3R8LA 4GK3A 4KS8A 4D4VA 3JXWA 4BYIA 3KN6A 5LVPA 3ROYA 3O71A 4M12A 4GT3A 3Q04A 5HX8A 4D1SA 3PRIA 3GI3A 4PV0A 4XBRA 4YO4A 1OL6A 4TZRA 2YERA 2R64A 4BDFA 4QPSA 4FVQA 4EUTA 5A4QA 2CNUA 1SVHA 3B8RA 5EYKA 3KMUA 4L3JA 2B4SB 5IUGA 3U54A 5KE0A 4KNBA 4UALA 2W1DA 3ETAA 4CT1A 3I5NA 4HYSA 2HWOA 4ITIA 4X2FA 3I1AA 4PTCA 3VBQA 4ZAUA 1QPEA 3LLTA 4NIFA 4RZVA 3NUXA 1OKYA 2X0PA 5LARA 3ULIA 3MPAA 5J1WA 3ERKA 4AW1A 3FI8A 3ODYX 4Y5QA 5IQHA 4KIQA 5FM2A 4AU8A 4RJ3A 2XAMA 5AAFA 4QMOA 5A4CA 1PXLA 5C03A 4CGAA 5I9ZA 1IRKA 1CDKA 1KE7A 2E2BA 4NWMA 2X8IA 3IW4A 3BBWA 3PY0A 4FTLA 4E4LA 3KB7A 5E8TA 2XKCA 3REPA 4UX9A 4L9IA 5G1XA 3CBLA 1H1QA 4CFMA 3MH1A 1FINA 3QWKA 3UG2A 2PULA 3MVHA 4IB5A 4CEGA 5HESA 3PSCA 4JBVA 4EK8A 5CAOA 5BPYA 2RFEA 1YWVA 4YR8A 4X3FC 3OWJA 5ETFA 4D2VA 2PE0A 2V55A 1YW2A 4O0WA 3JVRA 4PF4A 3ZUVA 2VTRA 3QRJA 3NDMA 3FXZA 3ZSHA 2VWBA 4XG7A 2QR8A 3HECA 4QMPA 3MFUA 4JOAA 3W2CA 4G3FA 1M52A 1Y8YA 4GFGA 2IVVA 3FKLA 4I6BA 3ZM4A 5GINE 2ERKA 4TYEA 2WAJA 3RNYA 4FV8A 3QU0A 4NFMA 4NT4A 4BZDA 4FV2A 3V01A 3EKKA 2RG5A 2WELA 4IQ6A 4NCTA 3AT3A 3O17A 4LOQA 4N57A 3CR0A 4ENYA 4NYEA 3O7LD 1WVXA 2J0JA 3BYOA 3WI6A 2RF9A 3RWQA 2G9XA 2O5KA 3FV8A 4DFNA 1UWHA 1X8BA 4FC0A 5DRDA 3G90X 4ANMA 2GQSA 3BHHA 3NUSA 3WBLA 4EOOA 4QMYA 3FAAA 2YDKA 5GIOE 5JQ8A 3C4CA 1UKHA 3FLZA 5EYDA 1H1SA 3N9XA 4JX7A 3ZFYA 3DTCA 2WGJA 3ACJA 4UMQA 2X4ZA 5JRQA 4FJVA 1W7HA 4NIFB 3F69A 2LGCA 4ZS0A 3PY1A 2REIA 3B2WA 4G3EA 4R8QA 4U3ZA 2BDFA 4O0VA 4WA9A 5AUUA 1TKIA 4LV7A 1V1KA 5J79A 3W0OA 4FKRA 2JIUA 5JZNA 3SV0A 3HZTA 3LW0A 4Q2AA 2W4JA 3FY2A 3UG1A 3IDPA 4CCBA 2HAKA 3C0IA 4FTCA 3OWLA 4FTQA 3BHVA 4P5QA 4CMTA 2DS1A 2P2IA 4DFYA 4RWIA 5I9YA 1ZYCA 4DGMA 5HU3A 3LJ2A 3ZO2A 3OHTA 2VTHA 4IB1A 2W5AA 3F3ZA 3C5UA 1UKIA 5E8XA 1ZY4A 3VONA 5EM8A 3ZEPA 2ZV8A 2IWIA 2AQXA 4I5PA 5HI2A 4GSBA 5IDPA 4DITA 2VWVA 3PG1A 4YLLA 5IISA 1OIYA 3LCOA 1MRUA 3Q6WA 5M57A 3RZFA 5KHXA 3I6UA 3QD3A 2P4IA 3D83A 4LRMA 3ELJA 4TYIA 3W2OA 4AXFA 3OMVA 4EI4A 3EQRA 3N51A 3VS4A 2FSTX 3LJ1A 4HCVA 5F94A 5HIDA 2JKOA 4K6ZA 4DCEA 3K5VA 4BBEA 5L2QA 4QPAA 4ZMEA 2CN5A 2IZSA 5TT7A 3R9NA 4YTIA 4ZOGA 5J95A 3UPXA 3IGGA 1H27A 4QMLA 3R8MA 4DT8A 2OO8X 5FEDA 4RIWB 1PW2A 2BPMA 3PLAE 2QG7A 4M13A 3GCQA 4FSUA 3R7UA 4DA5A 1Q8ZA 4C37A 3BPRA 1M14A 1S9IA 2VWWA 2WNTA 3A2CA 5DVRA 4KKGA 3S4QA 4D58A 3WE4A 2X6DA 4ARKA 4CQGA 4F0FA 4USFA 5HNBA 5I3RA 4BHNA 5AUYA 4FT9A 4DAWA 4JL9A 5GNKA 4NL0A 4RWKA 2R3NA 2WQNA 4MD9E 1Q41A 3Q60A 2J9MA 3SG8A 1R3CA 2B54A 3V5LA 3FPMA 4R3RA 1V0PA 3ZS5A 4CV9A 5E9EA 4H1JA 2VTNA 4DFXE 4F70A 5CXZA 4CG8A 2LAVA 5EKNA 1JOWB 3F61A 1YWNA 2XK6A 4J96A 4C4IA 5CAPA 1ZYJA 2YISA 3F3WA 4MD7E 4O0SA 4C2WA 1A06A 2EB3A 5KMJA 2B7AA 2WD1A 3QWJA 3MS9A 3R73A 4G31A 1GZKA 2FYSA 1GIJA 4MUQA 2Y4PA 4B9DA 5CANA 3OCGA 3MV5A 2XRUA 3O8TA 4XUFA 3VC4A 2C1BA 5CEKA 5JFVA 2UW4A 3GU6A 3WF7A 3VJOA 4IAYA 2GNGA 4G9CA 3NVMB 5HE3A 4YGAA 3V04A 3A7IA 3UO4A 1ZMWA 4ZXTA 4F7JA 4GV1A 3R22A 3IDCA 4OTQA 3DT1A 1ZZLA 4TXCA 2C47A 4G2FA 5K5NA 3CPBA 1A48A 1PRYA 1CKPA 4RLKA 3R8PA 2WTJA 3MVLA 4P7EA 5KMMA 2PU8A 4E26A 4HOKA 4R6VA 5G6VA 2J0MB 4GU6A 3BEGA 5H8EA 3ORIA 5AP7A 3TDWA 5CYIA 4YJUA 4DLJA 3LKMA 3UIBA 4FSWA 4C38A 5FBOA 1BLXA 3PP1A 3VS1A 3R9OA 4J95A 4RIXA 4AT5A 3TDVA 5T68A 4DH1A 1OZ1A 4DBNA 4DHZA 4ZS4A 3DXQA 4MF1A 4M8TA 5K4IA 3FYKX 5D11A 2OW3A 5AP5A 3IS5A 4YJOA 5JGBA 2WQEA 3BYUA 3PJ2A 3QHWA 4FTIA 3V6SA 3MWUA 4FTAA 4O1OA 5EHOA 1ZOGA 4HYIA 4L52A 1O9UA 4R5SA 1APME 4XYFA 3ZZEA 3D2IA 3UDTA 3FMDA 3MVMA 5A6OA 1H28A 2X9FA 3M42A 4DEHA 3JR1A 4XG4A 1IG1A 1CKIA 3KGAA 4IW0A 4LGDA 4ZTRA 4R78A 4WNKA 3F3VA 1NT2A 3DOGA 4OLIA 3ZSIA 4FNZA 2RSVA 4MWHA 3FMHA 4YSMA 3O96A 4BF2A 3E3BX 4C58A 3DXNA 4JIAA 4L42A 4UB7A 2HY0A 3U87A 2AC3A 3CCNA 4R3PA 4BDHA 3O5AA 4MNFA 4OUCA 2ZJWA 3GCUA 3VUMA 4JG8A 4RWJA 4F64A 4W4XA 3C5IA 3PXYA 2IW9A 1CKJA 2WTIA 4BY9E 5HVJA 3UDSA 2GHGA 5AEPA 4Z3VA 5A3XA 3FLNC 4O21A 3C4XA 1PF8A 3H0ZA 3OEFX 4JQEA 3HVCA 4YTCA 4JR3A 5J9LA 1SNUA 3ZRLA 4LGHA 4ZTNA 1GAGA 1ATPE 4YJNA 1HCKA 1QMZA 2BR1A 3EN9A 4R1YA 5FDPA 3PSBA 4RWLA 3KXNA 3PA5A 3RMFA 4E6QA 3HLLA 2UZBA 4JBOA 3Q2MA 3FL4A 3R02A 2WTDA 5H2UA 4BBFA 4J98A 2YIYA 2YHVA 3UOJA 3BBTB 4LL5A 2C5NA 4P90A 4A9SA 3S1HA 2PUNA 2O8YA 5J1VA 3E7VA 4HZSA 4FIFA 3C0HA 2VWUA 3PA3A 3TEIA 3MBLA 4IM3A 4YJPA 5HE1A 4C3FA 1PHKA 1PMVA 5IQEA 2YLEA 3BYSA 4RIYB 5AUXA 1JWHA 3ML1A 2BHHA 2E9UA 2HZ0A 2HOGA 5J8IA 3NUYA 4FSTA 4GUEA 3CY2A 2J2IB 4K1BA 4RIXB 4ZK5A 5M09A 2ZB1A 4DH8A 1HOWA 2B52A 2O3PA 5K9IA 3TV6A 4QQTA 3VUHA 4ZTLA 1K3AA 1JKSA 2VO0A 3U51A 4U43A 3VWAA 3ORNA 4U44A 2YN8A 5FXQA 5B2MA 4QDVA 2E9PA 3MTFA 2ZB0A 5DOSA 2AUHA 4CVAA 4ITJA 3G0EA 1R0PA 3Q3BA 3T8OA 3LLAA 3PRFA 2YZLA 4M7IA 3T9IA 3DZOA 5D10A 5C8MA 5CZIA 5L8KA 4ZJVA 4JVGA 5IA0A 1S9JA 2Y8OA 2WMXA 4I4FA 3O51A 4J8NA 4M68A 1ST4A 4TPTA 3OROA 3R7EA 2IZTA 5FDXA 4FV9A 3NSZA 3WOWA 4ORKA 4YZDA 2W9ZB 1O6YA 2UW7A 3W0RA 3OWKA 5K0KA 4NFNA 4J53A 3GB2A 3KXXA 1SZMA 3QTIA 2HY81 1MRYA 3TTIA 2YA9A 4D5HA 3EQGA 2J51A 2H96A 3QBNA 4BDKA 2PZPA 2R3OA 3CTJA 4CNHA 3OF0A 3I81A 3MESA 3CTQA 5EDRA 2C6IA 3D7TA 3KK9A 4JRNA 2A0CX 4IIRA 4I3ZA 4JT3A 4XG6A 5EH0A 2R3IA 4IH8A 4JAJA 4AW2A 2R3RA 4YMJA 4LMUA 4X21A 4DFBA 4MF0A 2EB2A 5CVGA 3W55A 5EQPA 3EQIA 3ZLXA 4Q9ZA 2GQGA 4O7NA 4BIBA 2JDRA 3G33A 4HGEA 3DBFA 4UBAA 3U6JA 4S32A 3C13A 2OZOA 4KINA 2PK9A 3PZHA 3IK3A 2WTKC 4RC3A 3BX5A 2C4GA 5HTIA 3QZHA 1YHVA 5F1ZA 3FMJA 4TNBA 2VTOA 4H58A 3FC1X 5IZFA 4IZYA 3SXFA 1KOAA 5L6WL 5FP6A 3TG1A 3NNVA 3GCSA 3PVUA 4S2ZA 1LEZA 3PJCA 3NYVA 4X7QA 4O7VA 3FZRA 3RPVA 1OBGA 2X81A 3KKVA 4FV7A 1H8FA 4RJ5A 4O84A 2W99B 3GFWA 1Q8YA 3NYXA 4DH5A 2BKZA 4ONAA 4EJNA 2BRMA 5B2LA 3QAME 2ACXA 2IVUA 2JKKA 4BB4A 4JR7A 2JBOA 5JGDA 3WYXA 4AZSA 4DN5A 2X0QA 4U45A 2FB8A 2QOCA 2X0GA 4GK2A 2WMRA 4RJ7A 3R7VA 1R1WA 3WE8A 1P2AA 5EW8A 4BVUA 2UZDA 1J1BA 4LRKA 2PUPA 4OT6A 4OTGA 2CHLA 4B4LA 3QUEA 3ZO1A 5ANDA 2CNQA 4PDPA 2W4OA 1F3MC 3FEGA 5DR9A 4MX9A 4F6WA 3O23A 4KSPA 4PNIA 3S0OA 3HRBA 5L6PA 4EKKA 1LUFA 2I7QA 3CJFA 4F9CA 3TNPC 1GZNA 4MXCA 2XJ2A 3LJ0A 5FBNC 1DI8A 3BLHA 1BMKA 3UQCA 5EDQA 1WBOA 2JGZA 4FTKA 3TNIA 4ZZNA 3RVGA 2PUUA 4Y85A 3QX2A 5HD7A 4WT6A 1U59A 3ZCLA 3ZO3A 4YZ9A 3BQCA 5IA5A 3WZDA 3NMUF 1Z9XA 2F2CB 2QKWB 3TCPA 5ACKA 2BCJA 4BCJA 3UOLA 3KK8A 2QLQA 3H4JA 4ALWA 2YAKA 1UU9A 1MP8A 3UIXA 3RTPA 1YDRE 3VUKA 3FI2A 3L8VA 5LVNA 2C6EA 3L9NA 2I1MA 4BTKA 4O7RA 3AOXA 5D7AA 5CLPA 4QTAA 4AE6A 1RE8A 1YI4A 3L9MA 4F9BA 3FQEA 3UVRA 5FQDC 4I20A 4XLIA 4YBKA 2VX3A 4CTCA 5HNIX 5HCZA 5LJJA 5J7BA 4ANBA 4LI5A 4IMYA 2BRGA 2RFNA 3HV6A 4FKJA 4D2WA 2WXVA 4IZ7A 3ZH8A 4CYJA 3MPTA 2OF4A 3H9OA 4BZNA 1YKRA 4DDGA 3OEZA 4O7SA 2CJMA 3OOGA 4GIHA 3MIYA 5T6KA 5HG9A 3ZDUA 1OUYA 3C51A 3JS2A 4AZEA 3MW1A 4IBMA 2V7OA 5DEWA 4ZSEA 4GYGA 1W98A 2QURA 4M3QA 4C33A 2ZM3A 3FE3A 4F0GA 3R9HA 3KU2A 3NPCA 3VUIA 3E8EA 3VHKA 3QD2B 2UZNA 4M69A 2VWYA 4FG7A 3C7QA 4F9AA 3RCJA 5IQIA 1LR4A 5FLFA 5CF8A 2BHEA 2VAGA 3DBQA 1UNHA 4M97A 3SAYA 4CMUA 5L2SA 4DFUA 4IJPA 5ANOA 3LQ8A 3QCSA 5IH6A 3FZSA 3R1NA 3CGOA 3PIYA 4R7HA 1W2FA 4WNOA 4CFWA 1Z5MA 3SQQA 2XIZA 4WG5A 1ZY5A 4PPAA 1G8SA 1XH5A 5AP3A 2W1ZA 4XG3A 4IX5A 1DI9A 5CSWA 5AR3A 4D4YA 5HLNA 2YCFA 2FGIA 1JNKA 4FMQA 5GIPE 1H08A 1FMKA 3OT8A 3PTGA 3ZOSA 3PZEA 3VQHA 4DFZE 4EYMA 2B9HA 3DU8A 1L8TA 2DYLA 3DTWA 4C61A 3VBYA 4BR3A 2C68A 2WFYA 2BRBA 4FT7A 4U80A 2PE1A 5FRIA 4EKLA 4CFFA 2WQBA 4RFYA 1BL6A 4HGLA 4MHAA 4Q5EA 3QQKA 3HV4A 4QP2A 5CENA 4C34A 3Q9WA 2ITXA 3AC2A 4FKLA 4PNKA 4DE4A 5IQAA 3SG9A 2VWXA 3R71A 4NU1A 1OMWA 4RX9A 3F82A 4PL3A 4L43A 4FSYA 1JSTA 2DUVA 2WU7A 3QQFA 4O96A 2Q83A 1U5RA 4EOKA 2QONA 2QODA 2JBPA 4ZSAA 3R63A 1TZDA 2OKRA 3Q52A 1VYWA 2XA4A 3QA0A 4O4FA 4O6EA 3P5KA 5DR2A 3RM7A 3AQVA 3ACKA 4IE9A 4BWKA 5E92A 2WQOA 3GP0A 2C69A 5AUWA 1P4FA 4LM5A 3H10A 5BYYA 2R9SA 4ZY4A 4YHTA 1URWA 4B99A 4C35A 3MA3A 2YIWA 3EZVA 4NKSA 3VRYA 4FT5A 4F08A 3DXPA 2X7OA 1CTPE 1O6LA 5EHLA 2RIOA 1XBAA 1XWSA 4WG4A 4IWOA 1ZMVA 2GTMA 2PZ5A 3LXPA 4Y73A 3AD4A 4EHVA 1VZOA 5AMNA 3PIZA 3BHUA 4OTRA 3GEQA 1BL7A 2BTSA 2PVNA 2EXCX 2Z7SA 5BUJA 3DK7A 4W4VA 3GGFA 2XNGA 5C9CA 4CLIA 3QTRA 1W8CA 4ZLOA 3ZEWA 3HMMA 4XCUA 3L8PA 1ZOEA 2WO6A 3AMBA 2F7EE 2JDSA 3R8ZA 2OG8A 2PVFA 3VVHA 1PKGA 4HNIA 4W9XA 5JMSA 4O38A 3BU5A 4P2KA 2PVJA 3MI9A 5DI1A 2XNOA 1KV1A 5DBXA 5HTCA 3RAIA 3GCPA 3OBJA 3R00A 3PYYA 2VTPA 4PMMA 4GW8A 4FV6A 3L1SA 1OKVA 3ET7A 2B9FA 4QT1A 5J87A 1LP4A 3DPKA 2WQMA 3AGLA 5C8NA 2OXDA 5A4TA 1CM8A 1K2PA 4CFVA 1FVVA 3EYGA 4D28A 5CT0A 5IQFA 3WF5A 4OAUC 3CIKA 3ENHA 2HYYA 3OW3A 4JDKA 5CVHA 3SLSA 4LV5A 2VWIA 2QNJA 2O65A 4BCPA 4TL0A 3P78A 2RFDA 3BCEA 4DC2A 3F88A 1KSWA 5CSPA 4Q9SA 4KIOA 3DK6A 1UU3A 3BI6A 5AA8A 3V8SA 3LVPA 3UNKA 4FK6A 1PKDA 3ZMMA 3WF6A 4QDEA 3SVVA 2J90A 3QRIA 4QP3A 4XV3A 1JKTA 3E64A 3PWDA 3DFAA 4IFGA 5EFQA 4QTBA 3UNJA 5FG8A 4C4HA 1YHWA 2IF8A 2HXQA 3THBA 5KZIA 4O82A 4APPA 3HMOA 3B2TA 2BDJA 2QO9A 3P1AA 5HE0A 3RJCA 3W16A 4ALUA 4BIDA 4YUQA 5IG1A 4G17A 1JBPE 3C4EA 3CLYA 2XEYA 3T3VA 5DFPA 4FEVA 4A4OA 3BQRA 2VO7A 3QF9A 3DY7A 5E90A 4L7FA 5CSVA 2WEVA 4IDVA 1XBBA 5DG5A 4FODA 2YEXA 4KABA 2R3HA 4DG0E 4V04A 2BAJA 4UEUA 4ZY6A 5BYZA 2FVDA 4DEGA 2SRCA 2YZAA 4RJ4A 5ANKA 1XKKA 3NAXA 3GQLA 2WMQA 3R83A 4Y95A 3V5QA 3PFYA 3MH2A 4EOSA 2R3LA 4EOQA 4QYGA 2WMTA 3TIZA 4C57A 5CEQA 2UV2A 3EIDA 4FL3A 3VRZA 4R7BA 4M84A 3EN4A 1Y6AA 1WBSA 2QOKA 2UZOA 2YM6A 3VBWA 4D9UA 3D14A 3MYGA 2CLXA 4RQVA 4FKIA 2BTRA 2R3JA 3EQPA 3TV7A 4U7ZA 5HZNA 3OWPA 2EUFB 5E8SA 2ITNA 4K2RA 4AAAA 3DQWA 4IC7A 4ZTQA 3FDNA 3W0PA 3RZBA 1UU8A 5FTGA 2VTLA 3R1YA 4KWPA 4BDJA 1YDTE 3IW6A 3PXRA 5ETCA 1FGKA 2VTJA 3DA6A 3BWFA 3OS3A 5D1JA 3HGKA 4QMMA 2X7GA 3FI4A 3QC4A 4MYGA 3RINA 3FWQA 5BVDA 1JLUE 4NM3A 2VTTA 2X8DA 2XK3A 3ORLA 4I22A 5BX0A 2Z7RA 3WF8A 1GJOA 3C9WA 3TUDA 3G15A 3HV7A 5M08A 2JDTA 4EBWA 5IDNA 3DKFA 4HZRA 3KN5A 5IA2A 3PE2A 4NTTA 5FD2A 1UNGA 3BKBA 4KA3A 2VX0A 3TKIA 4U3YA 3R9DA 2QHMA 4H36A 3LQ5A 4ASDA 4BCMA 4YHJA 5K0XA 2W96B 4YC6A 3PIXA 4QP7A 4R7IA 4XBUA 3RK5A 3UVQA 4U42A 1XHAA 4GCJA 5KMLA 3KIOC 3TI1A 3DJ6A 3NS9A 3QD0A 4I93A 5CZHA 2P55A 3A7FA 3FMKA 2ONLA 3QRKA 3NIZA 4HYHA 5D12A 2QCSA 2X8EA 1OL1A 1JSUA 3CY3A 3FYJX 4O7TA 3UC4A 1T45A 4NW5A 1KWPA 2UVXA 2E9VA 3L9LA 3EZRA 1Y6BA 4F99A 1IASA 1JKKA 2PMLX 2GTNA 3VS2A 2VTAA 5DMZA 2OIDA 2VTIA 4BWXA 2YIQA 4QTCA 3CEKA 5HGIA 4EOIA 5LVLA 3HRFA 3SX9A 4IAZA 2XKFA 4JAIA 2XNNA 1J1CA 2CKOA 4K8AA 4RC4A 3ALNA 4E7WA 3VF8A 4FKWA 2CSNA 5AV1A 5ETIA 2O0UA 4D2TA 5EQYA 3KXGA 5KZ0A 4K0YA 3U55A 3FQHA 2UW9A 5A4EA 2BFYA 3IOKA 4MEDA 2EWAA 1VYZA 3PLSA 3MH3A 3UJGA 4Z7GA 4BGQA 4U97A 3WF9A 2YM7A 3O8UA 5HG7A 3LZBA 2GSFA 3ZONA 3M1SA 4U5JA 3I7CA 1UVRA 1VR2A 2IZRA 1W2CA 1WFCA 3C4ZA 3QFVA 3R7IA 3MFSA 4EK4A 4FICA 1Q99A 1LPUA 3QA8A 4YTHA 4AX8A 3CKWA 3QQHA 4E6DA 2JD5A 4AQKA 3P08A 4H3QA 4I6QA 3DGKA 4KRCA 3OCBA 4FIJA 3CQEA 2W17A 2Y0AA 1LEWA 2J4ZA 4PL4A 4D4SA 4U8ZA 4MKCA 1ZYLA 1CSNA 3AT4A 5EHYA 3KMWA 4D2RA 1SM2A 4L45A 1H24A 1YWRA 2BIYA 3E3PA 3QXPA 4U40A 3UVPA 2F4JA 4I94A 4YBJA 4HNFA 4ZJIA 3RK9A 5L8LA 2YWVA 4I41A 2IPXA 4RMZA 2BKKA 4G3GA 3VS5A 4XS2A 1ZMUA 3ODZX 2KTYA 3ZSGA 3E62A 2OZAA 3O7LB 3COIA 4R5YA 2H8HA 4XOZA 2W1HA 3TZMA 2JKQA 2WTWA 2XP2A 3FJQE 3H9FA 3W0QA 4BCHA 3GU8A 3RNIA 2F2UA 2VTMA 3IW8A 4H1MA 4IVBA 3TZ7A 2ZFYA 2XNEA 3GXLA 3G51A 3AC4A 3NYOA 3PE1A 5KHWA 3QXOA 1CMKE 1IA9A 1TFFA 2ESMA 4I0SA 3DBDA 4FSNA 4RZWA 3LXNA 4YJSA 2OXYA 2B9IA 4HJOA 4J1RA 2ITUA 4RSSA 5D9HA 3UOHA 5CNOA 3O8PA 3PXKA 3UBDA 2P33A 5EI2A 5AWMA 4KIPA 3VIDA 5AP1A 4TRLA 2BFXA 4PDYA 1TQMA 1W82A 2IO6A 4IDTA 2OICA 1JKLA 2C30A 4JX3A 3ZDIA 5CAUA 3G0FA 1YOMA 4J71A 3NRMA 2IW8A 1QPDA 3POZA 2X7FA 4IZAA 4AZFA 3KC3A 3OP5A 4Y8DA 4G1WA 4X2KA 2AEGA 3KRWA 5E8UA 4A9TA 2GFSA 1PY5A 3BRBA 2HZ4A 3FLQA 3QTQA 4D55A 4B7TA 3L8SA 1H26A 3F7WA 4Y5HA 3MY5A 1YOLA 2XK8A 3MTLA 4C59A 4HVGA 4QQJA 4R3CA 3ORXA 2XMYA 2ZOQA 4CFUA 3FQSA 2UZWE 4M14A 4A4XA 4R77A 3RHXA 4I4EA 3NEWA 1Q24A</