1OM1A

Crystal structure of maize ck2 alpha in complex with iqa
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II, alpha chain
publication title Biochemical and three-dimensional-structural study of the specific inhibition of protein kinase CK2 by [5-oxo-5,6-dihydroindolo-(1,2-a)quinazolin-7-yl]acetic acid (IQA).
pubmed doi rcsb
total genus 111
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1om1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1om1A01
2WTCA 5HNIX 2GNFA 5DR9A 3K5VA 3NGAA 4MWIA 4AXAA 3N51A 4XG6A 3ZTXA 3ZUVA 3Q5ZA 2PY3A 3VHKA 4B8LA 5ACBC 1PMUA 4I5MA 4I5PA 3JY9A 3WOWA 3ZFMA 5LARA 5A4EA 4MTAA 2PUPA 4CRLA 4Z55A 4AE9A 2QO7A 4CD0A 2UW9A 4WNKA 1R39A 2CLQA 3KRJA 4XG2A 4C7TA 2XEYA 2ETMA 3Q04A 3S4QA 2XKDA 5L2IA 2ITVA 4HOKA 4H1MA 4ZXTA 2VO3A 4OT5A 3LFSA 4IWOA 5AR5A 4RJ8A 3W2CA 3F82A 4I4FA 4CV8A 3S0OA 3KY2A 2F2CB 4DEGA 2JDVA 2H9VA 4JBVA 4QP6A 1ZMVA 4J8NA 2QOBA 4ZTMA 5JGBA 3MTFA 4I6QA 4LL0A 3BBTB 4FIHA 4MBLA 4KBAA 5FLFA 2VWYA 4IX6A 3LM0A 2GQGA 3QD0A 4O0SA 1PXKA 4FTMA 4O96A 5CQWA 2PULA 3CTJA 3DZQA 4KBKA 3D2KA 3LCSA 4GKIA 4K8AA 3IKAA 3QALE 4W4XA 3OZ6A 3G15A 4GIIA 3IK3A 2OXXA 4FSWA 3ZFYA 4QMLA 3RHXA 5KHXA 1OKWA 5ETIA 1NT2A 5HG7A 2WMSA 4LMNA 5CT0A 1H25A 3UGCA 3L8PA 3BYSA 3D5UA 5F94A 2VO0A 5CEQA 2JD5A 4O7YA 2WU7A 2O0UA 5AP1A 4DCEA 4QTAA 2VN9A 3UPZA 1V1KA 1WAKA 4YBJA 4LV8A 2JDRA 3G90X 5HTIA 5IQDA 3O2MA 3C9WA 3UIBA 1PMNA 5HEZA 2QONA 1QPEA 3VC4A 3BYVA 5JGAA 2YZLA 3FI3A 1L3RE 2GCDA 5B0XA 5HORA 4BR3A 4AZSA 1Q62A 2QOFA 2PVFA 3V5WA 2XK7A 4EK8A 4JG6A 2GFSA 4F9YA 3F5XA 3RPVA 1JSUA 3M2WA 4FT3A 3EN7A 1Q8WA 3DTCA 2HY0A 5FGKA 3R8VA 2OG8A 2ERKA 2R3OA 5AIKA 5EFQA 3FKLA 4DEIA 5DI1A 4WRSA 2DYLA 3R9NA 2VGPA 4JX3A 4Q5HA 1DAYA 2X6DA 1VYWA 4JR7A 5FQDC 3UNZA 3W2RA 3O23A 4E6DA 4FEVA 2V5QA 3MPTA 4FKOA 3BKBA 4NSTA 1MRVA 1CKPA 2C0TA 3QYWA 4M67A 4LOOA 2A2AA 3GC7A 3MY0A 4AOIA 3BE9A 1GJOA 2YIYA 3COHA 1L8TA 3HA6A 5ANIA 4DINA 4RJ6A 4U8ZA 2A27A 2UW4A 1ZARA 3NIEA 4F7JA 1BKXA 3A61A 4XHKB 3BEGA 3ORKA 3I7BA 2WZJA 1FMOE 4C38A 5A4CA 3TDWA 4Y95A 4GFOA 3VWAA 5BVKA 1KE7A 4EI4A 4L3PA 3QLGA 4AOJA 3R0TA 4FTKA 3VF9A 4JDIA 4C58A 3TNQB 4NW5A 3PLAE 3IGOA 4EBWA 3LQ3A 3KN6A 3MSSA 4I41A 4GT5A 2J0MB 5BVFA 4B8MA 3DDPA 4BDBA 5M56A 3SXRA 3TIZA 1KE8A 4G34A 4GW8A 3UIXA 2QQ7A 4LRKA 2QKRA 4YNEA 5AP4A 4HYIA 4IB3A 5CU6A 1H07A 2YHVA 3O0GA 2ZV7A 3DCVA 3DNDA 3SOAA 3UOJA 3GU4A 4RVTA 2YM3A 3NW6A 4YNOA 4EZ5A 4DT9A 4CLIA 4EUTA 3RKBA 3DJ5A 4J8MA 4X2FA 4JAJA 4Y5HA 5HCZA 4BCGA 2XK3A 4G3CA 4FTLA 4R8QA 4FKJA 4YBKA 2WMTA 4G3EA 4ALVA 5FUTA 5KX8A 3P7AA 3GU7A 1GZKA 1WBSA 1JKKA 4EH9A 3VBVA 4FSUA 4BI1A 2Z02A 3ALNA 4OTIA 4ERWA 3E87A 3EMGA 4JRVA 4QQTA 1UU3A 3C1XA 3QL8A 3V6RA 4QP2A 3OFMA 4MXYA 1K2PA 3SQQA 5GINE 2QLUA 2FH9A 2PVYA 4ZSGA 3O8PA 2W1CA 3R63A 4BBEA 4JJRA 4ZTLA 5FM2A 4X21A 1ZWSA 4MAOA 3DA6A 1LP4A 4CFVA 5EI2A 4G2FA 3VN9A 3IOPA 4CMTA 3DLZA 1TKIA 3DS6A 1H1SA 3H0ZA 3QUEA 5FBNC 5KZIA 4Z16A 3C0GA 1STCE 2CLXA 3BLQA 4J1RA 4IANA 4C02A 2OH0E 3EQBA 2IVVA 3BZ3A 3F2NA 3EYHA 3KMWA 3QAME 4FZ6A 4K18A 3QWKA 4WRGA 2EWAA 2OF2A 3I5NA 3PZHA 5CF8A 2YIRA 5M4UA 4FOCA 3FLYA 4PL5A 4M8TA 2BZKB 2IVTA 3QRIA 3BEAA 4RA5A 4RVMA 1BL7A 3QRUA 4IAKA 4TWOA 4C4FA 3HMMA 5FXRA 4M7IA 2BTSA 1P2AA 3ORMA 2UZOA 1H1RA 4EJNA 3VULA 1H26A 2ZDTA 4CG8A 3EYGA 5IH6A 3N4UA 3BU3A 3DFCB 1M52A 5CSHA 3DQXA 4PMSA 5IPJA 3U51A 1UNHA 2QD9A 5HG9A 4FSZA 2QR8A 5L2QA 2Q83A 2W9ZB 2E9OA 2UW0A 1FVRA 1J1BA 4NW6A 4HVGA 3P08A 4IADA 5AP2A 3DFAA 4D2VA 2BIKB 3GXLA 3BIZA 1ERKA 4HCTA 2F7ZE 5EM6A 1JKSA 3A7FA 4L67A 1OGUA 4O0UA 2Y4PA 3EL7A 4YZDA 3C4WA 4M13A 5AR7A 4AW2A 2DQ7X 5GZ8A 2H34A 1OKVA 1XBBA 3FLSA 3PXKA 4AW1A 2CKPA 1JKLA 3K5UA 3WZEA 5A6OA 5J5TA 3F6XA 5EM8A 4K33A 2CCHA 2R0IA 2C3KA 3GQLA 4K2RA 4V01A 3I6WA 2WQNA 3R2YA 2HZ0A 4MQ2A 4LRMA 5HIDA 4DGNA 4O38A 2VTQA 4ACHA 2VWWA 1XQZA 3MTLA 4X2JA 4H3QA 4HVDA 2NO3A 2WTKC 4J52A 4DAWA 1YI3A 1WBOA 3CD3A 4FKLA 2UUEA 5AWMA 2WIHA 3HVCA 3LQ8A 5EDPA 5I0BA 2CNUA 4OBQA 2XRWA 4RIWA 2C5OA 2X9FA 2FUMA 3G2FA 4O86A 4DEHA 4ID7A 3PZEA 3FYJX 3TIYA 2NNWB 3NZ0A 2VGOA 3VRYA 2HK5A 5A6NA 4U5JA 3WF8A 4LOQA 4IC7A 3KFAA 4IM2A 2YM7A 4BCJA 3QUDA 4NZWB 2YIWA 4EH2A 5H9BA 3UVPA 4U40A 2OIBA 3CGOA 1M14A 1UU7A 2PUUA 4W4VA 4C62A 1OPKA 3KRWA 5DOSA 4C3FA 5CNNA 4E5WA 5M53A 3H9FA 5C27A 4ZTHA 4YGAA 2YLFA 2UZBA 5JKGA 1CDKA 3DT1A 4YHFA 3DKOA 3FXXA 5KZ0A 1RW8A 3ZM4A 1WVXA 4TNDA 1OL7A 4BYJA 3TT0A 1NW1A 4W9XA 5HE1A 2QO2A 3PVWA 4IXPA 4JI9A 4A9SA 2OKRA 3NCGA 3NUSA 4FL1A 2ZV9A 2BKKA 1OITA 3OCSA 4U97A 4RFZA 3THBA 2C69A 3LAUA 4DG3E 5AX3A 2HW6A 2O2UA 4GJ2A 3BELA 3JS2A 3PRIA 5K0XA 5M4IA 5FWKK 2O3PA 2C68A 4A06A 4DA5A 2XK9A 5JK3A 2KULA 4FSMA 4RWJA 2YAKA 2BMCA 3ENMA 4L42A 4YC3A 4FEWA 4F9AA 4MXXA 4R3PA 1JSTA 2VX1A 3P9JA 3QFVA 5AV3A 4BI2A 2B53A 3NPCA 4YJTA 4E6QA 4RC4A 1PF8A 2OBJA 4ASXA 3P4KA 1Q41A 3ALOA 4YLJA 1YVJA 4I23A 3H10A 2PK9A 5IDPA 3NDMA 2WMRA 2VU3A 5AMNA 3PLSA 5IQBA 2YIXA 2I0HA 2J90A 1PXIA 4U81A 4B9DA 2ETRA 3FC1X 4WG3A 2AYPA 3RI1A 3TNHA 3UTOA 3RPRA 4XS2A 1W0XC 2WFYA 1GAGA 5F95A 4BKZA 5FDPA 2HWPA 3R9RA 4EYJA 3UC3A 2BHHA 4OR5A 4N0SA 4OTQA 3TZMA 4XG8A 1Z5MA 2GTNA 3GUBA 2P3GX 2Y6OA 2J5FA 3EN9A 2J0JA 3QHWA 4XG4A 3S3IA 3TXOA 4ANMA 4WKQA 2YM4A 3D94A 5H8BA 5BUEA 4G6NA 4ZSEA 4AW5A 4X6QC 3R7YA 3PXQA 3GVUA 3UQGA 3EFJA 2PMIA 5ANKA 1ZMWA 4I4EA 3E3PA 5F4NA 3A7IA 4E7WA 4CSVA 5IQFA 4FT0A 4YZBA 3VHEA 4S30A 3Q4CA 1FGIA 4DFNA 4M15A 4AOTA 2V22A 4PF4A 3PFQA 3OCGA 1V0BA 2IZRA 4QMWA 4TT7A 4XRJA 3GCSA 4UYAA 5TR6A 1WMKA 3WI6A 3GOKA 2BKZA 1PRYA 1QPCA 1M2RA 3ZO4A 3SKCA 1FPUA 4GT3A 2YEXA 2C5YA 4IVDA 3MFUA 4O0RA 1PJKA 4D2RA 2YABA 3W33A 3DAJA 4R5YA 3RNIA 1YDSE 3PXFA 1YXXA 4HYHA 3LQ5A 4S32A 1YWVA 2W5AA 4AN3A 3V8SA 4C36A 2J5EA 3KB7A 4DEDA 2PPQA 3CJFA 4FT7A 4FGBA 4MXOA 4L00A 4GSBA 1U5RA 2C3LA 2WMVA 3CTHA 3ROYA 4DBNA 3Q5IA 2FA2A 3IONA 5M09A 1PXOA 3DV3A 4YMJA 1UU8A 4QNAA 4XP0A 2GNIA 3PJCA 1YI6A 3B8QA 3OF0A 5EDRA 4FMQA 4UN0C 5LMKA 4E4XA 1BI8A 3T8OA 4YLKA 3ZLYA 4UMUA 2A19B 3TUBA 2GNHA 4RZVA 3GC8A 4U3YA 4YJPA 5I9VA 3FC2A 2PZRA 3C13A 4U44A 2XM9A 5EKNA 4L43A 2JKKA 4AU8A 4D5KA 4PP7A 5JRQA 5K4IA 2CKQA 3ORZA 3UNJA 3W8LA 3TZ9A 3KC3A 4CYIA 3PWDA 5HGIA 3JPVA 4WSQA 1YWRA 2X81A 4NTSA 4JBQA 3G0FA 4G31A 3ZRKA 4BWKA 1M2PA 1LEWA 1PYEA 2GS6A 3TV7A 1PXPA 1SVHA 2O65A 3EB0A 2WQEA 5CSPA 3BCEA 4E6AA 3VRZA 5K9IA 4FG9A 4IB5A 2OW3A 3ZZEA 4U9AA 4A4LA 4DG0E 4I93A 4M97A 1YOJA 3VF8A 2XUUA 4ZLYA 5IA2A 3SHEA 3OD6X 4FZ7A 5G6VA 4BHNA 4IZAA 2YWPA 1JOWB 3D7ZA 4C33A 3ODZX 5BYYA 3FZRA 4F4PA 2NPQA 3PVGA 4FV7A 5TF9A 3QCQA 2ESMA 1G8SA 5EK7A 4XX9A 1KE9A 3UOKA 2CGXA 5CAOA 3H0YA 2VTLA 3UBDA 3HRFA 3I0QA 5CENA 3VS0A 3KF4A 2IWIA 2PE1A 4XBRA 2W5BA 4NH1A 4BCKA 4Z7HA 4TL0A 3ZLXA 3PA4A 4FF8A 4TY1A 4C3PA 4CZYB 4IWQA 3AOXA 3Q9ZA 5C8NA 4L52A 2UZTA 3AD5A 4XOZA 2P55A 4FEXA 2CKEA 5C8MA 2WB8A 2X1NA 5IQAA 5L8KA 3SC1A 4MF1A 4NFNA 4PTGA 3FQEA 2JEDA 4TRLA 2ZAZA 2PTKA 3G6HA 3IQ7A 3FMHA 4FSQA 3TNPC 1ZY4A 3VBXA 3KK9A 3NX8A 2Q0NA 4RFMA 4XMOA 4DGMA 5GIPE 3NUAA 3ZCLA 3NUUA 3COMA 4LGDA 2E2BA 5L6OA 2RSVA 3KXNA 4H05A 1OUYA 5HVJA 2BHEA 4GUEA 4LFIA 3QZHA 4IE9A 3W2PA 5M07A 1YW2A 1KE5A 4E4MA 4M84A 3L9PA 4O7VA 1F5QA 2CPKE 4OTHA 3PG3A 3QYZA 5JN2A 5CU3A 4QTEA 3CSVA 2C6EA 4U3ZA 2QOCA 3B8RA 2HOGA 3WE4A 2XNEA 1OZ1A 3LE6A 3PG1A 5EQPA 5L6PA 5KKRC 4EJ7A 5EW9A 3I81A 5HESA 4FVQA 3VJNA 5BVEA 4HZRA 1YQJA 4DH3A 3SLSA 5M06A 3AXWA 4ACCA 4PQNA 2RL5A 3W8QA 2JFLA 2RG6A 3LCKA 3QQGA 1DI8A 4BBFA 4FEUA 4F1OA 1KV1A 2QHMA 1W8CA 3PY1A 2VTNA 5IKWA 3RVGA 3ULIA 4EH6A 4PRJA 4DT8A 2XM8A 5HCYA 4F1TA 2XJ2A 3QXOA 1NVQA 3NVMB 2PZPA 4F64A 3SRVB 3EWHA 5K5XA 4XYFA 4ANQA 2X7GA 3ZXZA 1ZOHA 4MXZA 1RJBA 3PJ8A 2UW6A 2EU9A 4FKWA 2GPHA 3EN6A 2PVJA 4ZY6A 4C8BA 2X2MA 1Q3WA 3E92A 4QT1A 2PL0A 3TTJA 4L7SA 2WD1A 2OFUA 3PSCA 5AAEA 5FDXA 2ONLC 2R7BA 5AA9A 3U87A 4BY9E 4BGQA 4CNHA 2IPXA 1VEBA 4EWQA 3FLQA 3HDMA 4B6LA 3HUCA 2W99B 3O50A 4DTKA 5HBHA 2C6OA 3SRVA 3F5GA 1NY3A 1G5SA 2BDWA 2QOKA 4D1XA 5I9WA 2HYYA 5A3XA 5EI8A 3I7CA 1Q8TA 2YN8A 5H8EA 4ACGA 4ASEA 4XOYA 4D9TA 5BMSA 4YSJA 3K3IA 4A4OA 5E9EA 3RHKA 3CLYA 3R1NA 1Q24A 2VV9A 3LW0A 4MEDA 5IG1A 5CU4A 3N4TA 3LMHA 2EVAA 3G9LX 1SMHA 4QNYA 3KK8A 3AGMA 3PSDA 3MY5A 3KVWA 4JDJA 4IAYA 4BCMA 2RFNA 3HV4A 4O0WA 5EYDA 4GK4A 4V04A 4RIYB 4ZS0A 2BRMA 5T68A 1H27A 3FI4A 4HVIA 4Y73A 1OECA 4FV2A 4I0SA 2OJ9A 4O83A 2EXMA 3GQIA 5G1XA 4P4CA 5CY3A 1J7UA 1UKIA 2ONLA 3LLTA 5HE0A 5J5SA 3ATTA 2ZM4A 4O82A 2WKMA 2CGUA 2XKCA 1O9UA 3TZ8A 4ZSAA 2PVLA 2R7IA 5HNGA 3U4WA 3W1FA 3LFEA 3WF5A 2VTMA 2WQOA 4RIYA 1YHWA 3AT3A 4XJ0A 2IZTA 2QG5A 3QTSA 2V62A 3CTQA 4QP8A 1Y57A 4CZTA 4CCBA 4EZ3A 2XVDA 3AMBA 4HYUA 3TV6A 1UVRA 1WZYA 2HZNA 3A99A 1G3NA 2YISA 1ZOEA 3PRFA 4GS6A 4AF3A 5F9EA 2BR1A 2Y6MA 3PVBA 4AW0A 3W18A 3I4BA 4WSYA 2WTDA 3NR9A 4F0FA 3KCKA 5FP6A 2H6DA 3SD0A 2QVSE 4EOQA 1JAMA 1A06A 3RAWA 5ICPA 3O8UA 3P23A 3CP9A 3EIDA 4BI0A 4PPBA 4PNKA 4NK9A 1PXLA 3P1AA 4QQ5A 4RVKA 4GVJA 1OUKA 2OZOA 2J51A 1XH8A 3KMMA 1O6KA 1CKJA 3NUYA 3UP2A 2ZYBA 4J99A 2XBJA 4FTJA 4YO6A 3F3WA 4GV1A 4EZ7A 5JQ8A 3ZONA 2R3NA 3V5TA 3L9MA 4AA0A 3R22A 3F2AA 2UZEA 3D5WA 3UO4A 4AACA 3E7VA 3VUHA 4TYHB 5AR3A 4OAVB 3ZSIA 2J0KA 3BHUA 4FTQA 4S31A 3CPCA 4BTFA 3SGCA 3HUBA 1XH4A 2UZDA 2YFXA 4IMYA 5DT4A 3PIYA 4JG8A 1JVPP 3DY7A 4KSQA 3PY0A 2XYNA 3PXZA 2WELA 4LI5A 4JS8A 4M69B 5DRBA 3SV0A 3VJOA 5ANOA 3QQKA 3UMWA 3IDCA 4EONA 4CKRA 4EHEA 3NNWA 4R3RA 3LFBA 4G6LA 3UIMA 4PWNA 2IZUA 4MHAA 5GJDA 3TN8A 4CZUA 3MWUA 4J7BA 3LFNA 1O6LA 3QCSA 4TYHA 2PVRA 4UMPA 2R4BA 3QTIA 4I1ZA 2ITQA 2YCFA 4IX4A 3KEXA 2PMOX 4GRBA 2XMYA 3MW1A 5EM5A 3SOCA 2YM5A 4ZTSA 3EQCA 3Q6WA 4IM3A 4M69A 3EQDA 4TYIA 4YZNA 1NXKA 4U41A 4EOOA 3UO5A 3T3VA 5D9HA 2F7XE 2JDOA 3R7GA 1YXUA 2C6MA 4MYGA 1DS5A 4HNIA 4WNPA 1IEPA 4MBJA 4P5ZA 3FL4A 3N9XA 4GUBA 4D5HA 4ORKA 3ZM9A 1YDRE 1WBNA 1QPDA 3HKOA 3KQ7A 2GNGA 3QTUA 5HQ0A 4A9RA 2HELA 4BCIA 4CG9A 2EB2A 3IW7A 5BYLA 4MWHA 4M14A 3R1YA 2UVXA 4X3JA 4UWYA 1OKYA 2YIQA 1UWJA 2CJMA 4MX9A 2XIXA 4XG9A 5FBOA 2LAVA 5L3AA 5CX9A 2B54A 1NVRA 2OJGA 3OHTA 4FIGA 5ANDA 3NIZA 3TUDA 1J7IA 2OJIA 2X7OA 5KNJA 4GT4A 4FK6A 3D83A 1IAJA 1H08A 2W06A 3JVRA 1GZNA 4JRNA 4R1YA 4O1OA 5HCXA 3JY0A 3PIZA 3OS3A 2BZJA 4TWPA 4O0YA 5D12A 3N4VA 2X7FA 2GS7A 3L1SA 3MN3A 5DT0A 3NUXA 5CAUA 5IMEA 4IDVA 4F1MA 4GCJA 5I5ZA 4GVAA 4EKKA 3LM5A 3QTXA 4H3PA 4N6ZA 3WBLA 2XZSA 3O51A 4R7BA 4RVLA 1J91A 3QTQA 4AGUA 3Q9YA 1WBPA 2XNNA 4G9CA 4GFGA 4P7EA 3NWWA 1GIIA 2PMNX 2Z7LA 4U79A 3CS9A 1GIJA 4B0GA 3LVPA 4D2WA 5IUGA 4CKJA 2RGPA 5BVDA 2WTVA 4QPMA 4C57A 5CAQA 3ZEWA 3CY3A 4G9RA 4IAAA 3TACA 5HHWA 3VUDA 2YWVA 1M2QA 2J6MA 2VWVA 2XP2A 4O0XA 3R71A 3W10A 3QTRA 1OL1A 5T6KA 4EL9A 1PKDA 3TEIA 4YTFA 3TUCA 1JBPE 4ANBA 1OIRA 3DBDA 4O7LA 3RPOA 3QZGA 3QD4A 5DYJA 5KHWA 4TNBA 2VTTA 1U5QA 4JQ8A 3LKMA 4FNXA 4JQ7A 2YDJA 4AGCA 1OPJA 3HP2A 1BI7A 3WZUA 4C2VA 3TDVA 4FYOA 3CEKA 3C0HA 1R78A 3EJ1A 5E8SA 3V04A 3MVMA 2FSMX 1DAWA 1ZLTA 4FKPA 4HYSA 5A14A 1RQQA 3ITZA 3GOPA 3QXPA 3DNEA 5H8GA 4ARKA 3WIGA 5CS6A 4Q9ZA 5I3RA 3DBFA 3GC9A 4KA3A 3C0IA 5KBQA 3ACJA 3VUTA 4R77A 4FR4A 3QKLA 3C51A 3BPRA 4FKUA 2VWIA 4DH8A 5IA1A 1TVOA 3L9NA 4N57A 3BU6A 1CTPE 3FBVA 1FBNA 3TKHA 3TL8A 4RLLA 1Z9XA 3RJCA 4QP4A 2R3PA 2ZM3A 1YDTE 4TYGA 2BZIB 2A0CX 3E93A 3BYMA 4WIHA 5EW8A 4BBMA 3UOHA 5AADA 1P4FA 1KE6A 4JBOA 4AGDA 3LJ2A 4MNEB 2CGWA 3O17A 3ORPA 5E90A 3VS7A 5TT7A 5DMZA 4OBOA 3A62A 1PYXA 1YOMA 3WF6A 4LRJA 4MBIA 3GB2A 4DLJA 2JKQA 3FWQA 3MVLA 3BV3A 3HECA 1SYKA 4OW8A 4NIFB 3OT3A 5AV2A 1WBWA 3RBWA 3UG2A 3LFFA 3KU2A 3MV5A 1SM2A 5LMAA 2HENA 4PP9A 4FIJA 4ACDA 3EQFA 3KCFA 4BIBA 2C6DA 2YITA 3LJ0A 4YJUA 4YC8A 2QOOA 3BI6A 3TJCA 2PVKA 3U55A 3GNIB 5AR2A 3UO6A 3UVQA 4Z7GA 5A4LA 2C6TA 4W9WA 4OT6A 2X39A 4FV0A 2GDOA 4MNEA 3FKNA 4UMTA 5FG8A 4CMUA 4LV5A 4KIPA 2R3GA 4N6YA 4IWDA 3FQHA 3AT4A 4RX9A 5EYMA 5ACKA 3FXWA 3R02A 2QOIA 5E8VA 4QYGA 5CZHA 2RFEA 3D2IA 4NIFA 4F09A 5L8LA 4DGLC 4HNFA 5HIBA 5EQEA 2WOTA 3FLWA 2B9FA 5J79A 4IB0A 2ERZE 3BHYA 4EWHA 3FSFA 1OL6A 3OXIA 5EHOA 3E8CA 5IEYA 2Q0BA 5IA5A 3ORLA 3DGKA 2WMQA 2R3LA 2JFMA 2XNGA 2Z7RA 5DLSA 4QTDA 3VS6A 4D1SA 5HX6A 3U6HA 3G0EA 4FL3A 3D9VA 5AUXA 4FG7A 3PXRA 4R7IA 4UZHA 4AE6A 5AUVA 3O71A 3RK7A 4CTBA 1WBVA 4BTJA 3VUKA 2AC5A 3EZVA 3KXMA 4CGAA 4D58A 3HP5A 3SDJA 4A9UA 4IAIA 3KL8A 1OBDA 4K6ZA 3DXPA 2QLQA 2X4ZA 2ITYA 1XHAA 2YJRA 3IOKA 4XCUA 5FEQA 3GP0A 4DEEA 5F1ZA 2B55A 2BROA 3ACKA 4MD7E 5HVYA 4ITIA 1XH7A 2C6IA 2B9HA 2XK8A 3NAYA 4QMPA 4JX7A 4CLJA 3P5KA 5HVKA 1YHSA 4PDSA 2XBAA 4AZFA 3TM0A 4FX3A 3MA3A 3D4QA 3EFKA 5FXQA 5EDQA 2HXQA 4C4HA 4FV4A 3COIA 4FNWA 4BN1A 4U6RA 1MRYA 3C4FA 3E8DA 5IQGA 4ZJVA 2WMBA 4ALWA 3MH3A 4G5PA 4E93A 1XR1A 4GYGA 4CQGA 4QP9A 4E26A 5CAPA 2G2IA 2QG7A 3LXKA 5DE2A 5I4NA 3AC2A 3P78A 5EH0A 5JZJA 4J96A 5E1SA 4LQMA 4BFMA 4H39A 4IVAA 5FTOA 4AQCA 4CTCA 4CVAA 2KTYA 3H9OA 3HV3A 4JDHA 4XUFA 1YOLA 5IH5A 4FUYA 2JIUA 1UWHA 3HAMA 3A2CA 4IZ7A 1PHKA 1SVGA 4M0YA 5CEPA 4R78A 2BRBA 3UYSA 5IA3A 3LCOA 3R9OA 4QQCA 4FT5A 3MH1A 1SVEA 4V0GB 5DHJA 4EOLA 2J4ZA 2WTKB 4TYJA 2CHLA 4Q2AA 2E9PA 3OCBA 2RF9A 1FQ1B 2WTJA 3AC3A 3FZSA 2JAMA 2BALA 2CN8A 5DBXA 4KRCA 4CT1A 5GIOE 4TKSA 4EQUA 3EKKA 4OBPA 2OO8X 2ZDUA 3G9NA 1MQ4A 4PMPA 4YJSA 3UODA 5HE3A 2OSCA 2P33A 1YHVA 4LM5A 4Y5QA 2JKOA 1ZAOA 4I5CA 1A9UA 2HZIA 4XP3A 4FVRA 2VAGA 3RNYA 3UJGA 2BPMA 2X0GA 5IF1A 4FICA 4V0GA 4AWIA 2IVUA 5DT3A 3E62A 4F70A 4RJ5A 4ANSA 4EK6A 1W98A 4TXCA 3U8WA 4KKGA 4FKSA 2UW7A 5HG5A 3W2QA 5JFXA 3R21A 3DB8A 4CXAA 1WCCA 4KB8A 3LMIA 2ZB0A 3Q32A 2C6LA 1XH5A 4GMYA 4YUQA 5IQEA 2QOQA 2YLEA 4CKIA 2FGIA 5KE0A 3RTPA 4F65A 2VTSA 4FKVA 4FV8A 3QZFA 2FSTX 1BX6A 4HGEA 4YHTA 3RAIA 3UOLA 1Q8ZA 4AGWA 4ZP5A 3IW6A 4ZEGA 2VNYA 1WVYA 1I44A 5HI2A 4GU6A 3DBQA 2GHLA 1H01A 3POZA 4OTRA 4E5AX 4O27B 3II5A 3R8MA 2EUFB 2UVZA 3M11A 3ZEPA 4JQEA 4F63A 1CKIA 4GFMA 3HAVA 3LOKA 3PJ3A 2QNJA 4IBMA 2QURA 3VBTA 3ZRMA 2B4SB 3AGLA 3WZJA 2CCIA 1PKGA 3ZBFA 1Y8YA 2YM8A 2XJ1A 4GH2A 1ATPE 1ZZ2A 3MB6A 3NSZA 3A8XA 4ZZMA 3PJ1A 2G9XA 2UV2A 3ZXTA 4IIRA 1UNLA 2R3IA 3AD6A 3GI3A 4RZWA 4UMQA 3IGGA 5ANJA 5BYZA 1VJYA 2CMWA 4BL1A 3UDBA 3PXYA 1CM8A 3GCPA 5FP5A 3ETAA 1HOWA 3I60A 4TYEA 1UKHA 4DLIA 2O64A 3SA0A 2RFSA 3MIAA 4QP3A 2HXLA 1SNUA 4XV9A 2GS2A 5J1VA 1UNGA 5LXMA 4LGGA 2WOUA 2UVYA 2WU6A 4Z9LA 3ZYAA 4DH7A 4YR8A 5CXZA 5LVMA 4A9YA 4PUZA 4II5A 3G51A 4EK5A 1Q61A 2ITXA 3NYNA 4XV1A 4DGGA 4PNIA 4MQ1A 4CFMA 3DXQA 2JBOA 3HMOA 3D0EA 4WOVA 1VR2A 4MD8E 3Q4ZA 4DE4A 3F88A 5FD2A 4BWPA 3UG1A 3ELJA 3QD2B 4OTWA 2CGVA 2XCHA 5LMBA 5CEIA 1GY3A 3BBWA 4BDGA 2WQBA 4O7TA 1BYGA 3Q9XA 3PP0A 4EQMA 3VBWA 3FDNA 2JIIA 5AP7A 5ETFA 4YTIA 5EQYA 3HEGA 3Q4UA 2WMUA 4Y72A 4GG7A 4F6UA 3IW4A 3UMXA 1GNGA 2HW7A 2R3KA 3A4PA 3MPMA 3OWPA 2HZ4A 3KRRA 5DRDA 3VS4A 1WFCA 4BZDA 4HGLA 1OM1A 3OTVA 4G17A 3KULB 3Q60A 4KAOA 1V0PA 2XIKA 2VTOA 3EQGA 4WHZA 5DA3A 2C1AA 1IR3A 4ZZNA 3MH2A 2IW6A 3PPKA 4I6FA 2I6LA 2CNVA 2Y4IC 3A4OX 2UZNA 2Y7JA 2Z2WA 2XS0A 2OF4A 1PW2A 3A7JA 3I5ZA 3ANQA 3R83A 4FV1A 4YURA 2PHKA 3EFWA 4BZNA 4O81A 4MNFA 2IW8A 3U6IA 3MH0A 1H4LA 2R5TA 4Q5EA 3KULA 3RPYA 2W1GA 4ONAA 4O21A 1V0OA 3ANRA 2X2LA 3QTWA 4W4WA 3IO7A 3UYTA 1T45A 4M3QA 2CSNA 3BGQA 3LFQA 5F20A 3VUIA 3DJ7A 3A60A 3OG7A 4LMUA 5LVNA 1M7NA 3DTWA 4UX9A 2BILB 4BZOA 5FXSA 4BICA 1YRPA 3ZC6A 4FOBA 2EB3A 3G33A 5CYIA 3QUPA 5HLPA 3ZO3A 4F7LA 2J0LA 3AC5A 4FGRA 1IG1A 2R2PA 2W4JA 3DAEA 3OCTA 3OT8A 3D14A 4PY1A 5GHVA 3QCXA 3RAHA 4BDCA 4IACA 5CEKA 2UW8A 3HRBA 3QTZA 3V8WA 4OTFA 1TQIA 4C3RA 3Q52A 4RFYA 3HV5A 2F4JA 4IHPA 4EOKA 1P5EA 3IDPA 2O8YA 1YKRA 4L68A 4O22A 3TTIA 2B9JA 4EOPA 4ACMA 4E1ZA 2VTHA 5LJJA 2XNPA 5IQCA 4G6OA 4EK4A 4BWXA 2HWOA 5B2MA 2NP8A 4YPSA 5DEYA 5IUIA 5KBRA 3QWJA 3UZRA 4IZ5A 3QGYA 4CV9A 4F0IA 1U54B 2ITUA 4QMYA 2ZVAA 5IQHA 3CQUA 3OBJA 4D4RA 3C4ZA 4R7HA 4ZSLA 1H0VA 4NFMA 5CXHA 3RALA 5ITAA 3KRLA 5E4HA 4H3BA 4MVFA 3NW5A 3NUPA 2YDKA 3ZO1A 3VUGA 3NEWA 3ZDIA 3L8VA 5D1JA 4B7TA 3LFCA 5AA8A 5C1QB 4DTAA 2QC6A 2R3QA 3DOGA 3TKIA 2V7AA 2VWUA 1OVEA 2W5HA 3F2RA 4JG7A 2VX3A 4DHFA 5HLWA 1VYZA 4GEOA 4XV2A 4M66A 5HBEA 2FYSA 2RIOA 3OC1A 5KMOA 1YXVA 2YJSA 4I5HA 1U54A 1Q97A 3R1QA 4XG3A 2VWXA 2F9GA 3TI1A 2RFDA 4WNOA 3VIDA 4IVBA 2R3MA 2FB8A 4UXQA 1XJDA 4K9YA 2R9SA 2I0VA 4V05A 2GQRA 1GZOA 4MD9E 3ZOSA 3LXNA 5HNBA 2OU7A 4NU1A 4RQKA 4C2WA 5IEVA 4YTHA 4Q9SA 3Q53A 2OZAB 3ET7A 4UV0A 2YCQA 5J95A 5JRSA 5HU3A 3BYUA 4NEUA 5ETAA 2YCRA 3DPKA 5AAFA 2CN5A 2WMXA 4GIHA 4AZTA 2XK4A 2XF0A 2YDIA 3RWPA 4J95A 5E1EA 4NWMA 5JT2A 4X0MA 5FM3A 2C3IB 2PUNA 4FIEA 5E7RA 3K54A 4FTAA 5CAVA 5CEOA 4J71A 5KKRB 2PSQA 3NMUF 4FK3A 3G5DA 3ZUTA 5KMKA 3C5IA 3RZBA 1BL6A 2F7EE 2VX0A 3DBEA 2WNTA 3NYOA 2C30A 4ZJIA 5J9YA 4HVSA 3ATSA 1E1XA 3OW3A 4JOAA 4RX8A 4BDFA 3RK9A 2X9EA 4QPSA 3PJ2A 1ZOGA 4XLIA 1IRKA 3CE3A 3NLBA 2JAVA 4KBCA 4BDEA 3ZU7A 3WYYA 1JPAA 4FV3A 4A4XA 5I9YA 2GHGA 4NTTA 4FV9A 4D4SA 4O91A 2E9VA 4BCPA 4LGHA 3DU8A 3R8UA 4O6EA 4FG8A 3NRMA 5AR8A 4ITHA 5DH3A 4OTPA 3ZDUA 3SW7A 4DFUA 5M08A 4UMRA 4WO5A 3QHRA 5TOZA 3QQHA 2FO0A 4FTNA 4N4SA 2G2HA 5DEWA 5EHLA 1XH6A 1YXSA 4BDIA 5BVWA 5IU2A 4FTCA 2IZSA 2O5KA 2R3JA 3OUKA 3KREA 4TZRA 3GGFA 3NNXA 3EZRA 1J1CA 4QMVA 4RJ3A 4P5QA 3FMJA 3JXWA 3FSKA 3GC0A 4KD1A 3AC8A 3SXSA 5CLPA 5JFWA 4FKRA 4E8AA 5KO1A 5J9LA 1FVTA 1OKZA 3PSBA 4AAAA 1QL6A 3OXTA 5AM7A 4JIAA 5KMMA 3Q9WA 4G16A 4L9IA 4TN6A 2VUWA 4ASZA 3WF7A 4YZCA 3BRBA 5IISA 3ZC5A 2G1TA 4A7CA 4PDYA 2CKOA 4FVPA 4H36A 3MBLA 3RMFA 5KMIA 4NM5A 3O7LB 3DB6A 5I3OA 3DAKA 4EEVA 3U9CA 2Y0AA 4LG4A 4YP8A 4WG5A 2ZV2A 5LVPA 3CD8A 1QPJA 3FMKA 4TWNA 3PWYA 4LL5A 4YJOA 3O8TA 4NM7A 1KWPA 1O6YA 2I0EA 3D15A 3EN5A 2DS1A 4I20A 4IQ6A 2BDFA 4N70A 5K3YA 4DG2E 3CBLA 3HDNA 3WE8A 4AP7A 3DXNA 2BAQA 5JH6A 2PZ5A 4DFBA 1P4OA 3HNGA 4ENXA 4FIIA 4F99A 3PA5A 5CEMA 3VQUA 5DG5A 4S2ZA 3DKCA 3EHAA 3EQHA 4D28A 4YTCA 5JFSA 3OEFX 4KINA 4W8EA 4GK3A 5L2TA 4BHZA 5JEBA 3F3TA 3F3ZA 1OIUA 4I6BA 3V6SA 5KUPA 3CGFA 3VAPA 5CZIA 5CSWA 4IC8A 1PXJA 3F61A 3FMNA 3RP9A 4FNZA 1M7QA 4R5SA 3MYGA 3E8EA 4O7SA 1JQHA 4EHZA 1XWSA 3R7UA 3CIKA 4BGGA 3BX5A 5EYCA 1K3AA 4JIKA 4NYEA 3I0OA 2G2FA 5LWMA 2G01A 4RC3A 4CMOA 4D9UA 2CNQA 4BDKA 4FSTA 4APCA 4CFNA 4FTTA 3T9IA 5EM7A 4MXAA 5K5NA 1OI9A 1W83A 5AR4A 5LWNA 3BLRA 3KKVA 3BWFA 2YCSA 4NL0A 2VWBA 3SAYA 2ZMCA 5C03A 2QI8A 4FTIA 2PVNA 5HBJA 3FMLA 2P0CA 4KS8A 3ZHPC 2ACXA 3NUNA 4KKEA 4KWPA 4NT4A 3C7QA 5BUIA 1ZXEA 2X4FA 4UZDA 3RK5A 5J7BA 4IVCA 1BMKA 3QD3A 3R1SA 4HZSA 4IWPA 4EHGA 1TQMA 2ZV8A 3DKGA 2J7TA 4I0TA 5AP0A 5AUYA 3PIXA 4EH7A 5GZAA 4AT3A 3GEQA 5AP5A 3V51A 3M42A 5D10A 2AUHA 3HMPA 1PXMA 3FYKX 3EFLA 1JKTA 2WEVA 1YWNA 3F5UA 3RCDA 3V3VA 2XYUA 4QP1A 5GJGA 4BYIA 2WO6A 4LYNA 2Z7SA 3TWJA 2OXYA 3FHIA 1IA9A 4O7NA 4PPAA 4PTCA 5J9ZA 3NNUA 2ITWA 5IA4A 2C3JA 3KMUA 5E8WA 5HO7A 3P79A 3U4UA 3LJ1A 3R6XA 2V55A 4G3FA 4U0IA 1T46A 2GNJA 1R0PA 3FZTA 3FY2A 4YU2A 4I24A 5A4TA 4AA4A 5KMLA 2JC6A 4B99A 2X8DA 4BTMA 4ZAUA 2GQSA 3FV8A 5JQ5A 1F3MC 1DI9A 2UW5A 4F9CA 1REJA 3QQJA 4X2GA 3QBNA 1H1WA 4IAZA 2IVSA 2RKUA 5HTBA 3JUHA 3QRTA 2XJ0A 1OMWA 2R3FA 4C37A 4W8DA 3PUPA 2X8EA 4X2NA 2UZLA 3R28A 3KXXA 4I94A 4QMNA 3SX9A 1B38A 3QRJA 4J97A 5A9UA 5M57A 5CNOA 4FZAB 1OIQA 2Y9QA 4JDKA 4YSMA 5HG8A 4FSYA 2G15A 4ERKA 4GK2A 2W4KA 2IW9A 2JIVA 2WPAA 3AMYA 5IEXA 2I1MA 1WBTA 3FKOA 4O7ZA 4L7FA 4U43A 3UC4A 4HJOA 1ZYSA 4FSRA 4USFA 4C35A 4XEYA 5E92A 1Q5KA 3AC4A 4QTBA 4RSSA 3ZO2A 3OY3A 4FT9A 3BGPA 3PTGA 4EUUA 2OIDA 1PMVA 4RMZA 4EBVA 2YAAA 4DFLA 2V0DA 2LGCA 4O0VA 3BHVA 4DTBA 3CKXA 3OOGA 4O6LA 4FV6A 2W1HA 3DZOA 3HLLA 2WGJA 3BYOA 5BNJA 4NM0A 4D0XA 1U59A 4BTKA 1YXTA 3ENHA 1XBCA 2OIQA 3FI2A 3KXZA 2YM6A 4FV5A 3CJGA 4UBAA 1CSNA 2FVDA 1ZYLA 3KN5A 1WVWA 3QX2A 4QMSA 4RWIA 3LXLA 4I21A 2Z7QA 5AUWA 4AG8A 4BGHA 3HZTA 4KABA 4IFCA 3HRCA 3ZBXA 3H3CA 4U42A 5L8JA 4WNMA 2XIRA 1NA7A 1J3HA 4GU9A 4RBLA 1XKKA 5CSXA 5D7AA 4BCFA 4ZTRA 3OP5A 3U9NA 2OJJA 2FSLX 2VWZA 2X6EA 3K2LA 4TPTA 4UALA 3V5PA 3CQEA 4H58A 4BDJA 4EKLA 4DH1A 5EW3A 3TJDA 3E63A 5C4KA 3SW4A 3A7GA 3ODYX 4FKIA 2E9NA 4NJ3A 3B2WA 3EN4A 1FVVA 1Q4LA 5EI6A 3D5XA 3MJ2A 3UNKA 3AQVA 3V5QA 3GU5A 4EH8A 3QC9A 4NCTC 5TKDA 4YZ9A 4FSNA 3RCJA 4L8MA 3R8ZA 4RA4A 1PY5A 3FLZA 4ZK5A 4YJVA 4WG4A 3AD4A 3MPAA 4G3GA 4M12A 3VW6A 3WIKA 3MFRA 5IA0A 5IH4A 1Y6BA 5M44A 5EG3A 3VNTA 4AN2A 3VS2A 3QLFA 1Z57A 3QQLA 3EL8A 4RJ4A 1UV5A 1H24A 3OW4A 2BRGA 3H30A 4L46A 4LUEA 4AS0A 2JKMA 1QCFA 2ITZA 3Q4TA 3MJ1A 1R1WA 3COKA 2XEZA 2E9UA 3W2SA 4BKJA 4EHVA 3KF7A 4F7SA 1IAHA 3BQCA 4QTCA 2OJFE 3IECA 2GNLA 5FTGA 1H1PA 1ND4A 2OWBA 2BTRA 3LMGA 3KXGA 3QGWA 5CF4A 5HIEA 2C5VA 2ITTA 2Z8CA 4AZVA 1VZOA 4FYNA 2J9MA 3GENA 3QC4A 2P2HA 4K11A 2C5NA 4YZMA 4UY9A 2JGZA 2C47A 3W16A 4PV0A 3P7CA 4ZJJA 4OLIA 3K3JA 3FPQA 4D2SA 4FKQA 4RQVA 5FRIA 2PU8A 4ZMEA 5AP3A 4PX6A 4NCTA 2BCJA 3GU6A 3KVXA 3E88A 2OH4A 4HCVA 4UWCA 2QHNA 2J0IA 4FNYA 5CVHA 2UZVA 2P4IA 2REIA 5CASA 5HX8A 2QU6A 3MS9A 2ZMDA 4XV3A 2C4GA 5K0KA 1ZZLA 4L53A 3V5LA 1F0QA 4Y85A 2VTRA 3BHTA 5DN3A 4F6SA 3T3UA 3MY1A 4AZWA 4C0TA 5AFVA 4PDPA 2VO7A 3F69A 3A7HA 4EOMA 3ZFXA 3FEGA 4GYIA 2W4OA 2W1IA 4M68A 4USDA 5ANEA 3SVVA 3REPA 4DFYA 5HTCA 5DR2A 5AX9A 3WARA 1JWHA 4R1VA 3Q2JA 1ZY5A 3FHRA 4RIXB 2GTMA 3TKUA 3FZ1A 2UZUE 3NVKI 5CF6A 2C6KA 1ZRZA 2QCSA 4WD5A 5C9CA 1U4DA 4JVGA 5LOHA 3IG7A 2BIYA 3OY1A 1AGWA 5B2KA 3HX4A 2C0IA 4BIEA 2YACA 4TTHB 1FOTA 1FMKA 3LIJA 4KIQA 3RINA 3GU8A 3FE3A 4LOPA 2WTIA 3ORNA 3ZZWA 2OK1A 2HAKA 5GNKA 5M4FA 3I79A 4DYMA 5M51A 3W2OA 2XIZA 4F0GA 2F57A 3UZTA 4RIXA 4AZEA 3BWJA 1LR4A 4GL9A 4NKSA 4X3FC 1M17A 2GSFA 5LCKA 3SG9A 5AV4A 5J1WA 3TNWA 3OROA 5M55A 3LHJA 3UPXA 2I7QA 3F9NA 1MQBA 2BDJA 3MVJA 4FTRA 3RZFA 4PMTA 4RIWB 3TCPA 4Y83A 5T3QA 3DK7A 3HMIA 3OMVA 3R04A 3UP7A 3QA0A 4JL9A 3M1SA 4JBPA 4X3FB 2XKEA 3VUMA 2NRUA 1E9HA 3E8NA 3QCYA 5CI6A 2C1BA 3EQPA 4ZSJA 4EQCA 5GJFA 2XCKA 3OOMA 2I40A 3HL7A 4BKYA 5CT7A 3MFSA 1W84A 4FEQA 5E91A 2GMXA 3WF9A 5LVOA 1Q3DA 3B2TA 3JYAA 3R00A 4QMOA 5E8TA 4O1PA 2BFYA 3FLNC 3C5UA 3O96A 4IDTA 3VQHA 4AUAA 4DEBA 4E73A 2QO9A 4LUDA 4RJ7A 4XBUA 4C61A 4K0YA 2IJMA 2W05A 4QPAA 3OWJA 5ETCA 5I9UA 3RM6A 5C26A 3UQCA 2R3RA 3S95A 3PE1A 4F9BA 3V5JA 4F9WA 4ALUA 2F49A 4ITJA 4X3FA 4O2ZA 3TV4A 4KRDA 3GCVA 3I1AA 4L3LA 4S34A 1K9AA 2JBPA 4CFWA 5EHYA 2B1PA 4APPA 2VTIA 4GJ3A 4DEAA 4CFXA 2XIYA 3FJQE 1W82A 4L45A 4E6CA 2WIPA 1CMKE 1Q8UA 3PPJA 4ZLZA 2ZJWA 3DK6A 4ZY4A 4UB7A 2H8HA 5D41A 5HD4A 5TO8A 1TQPA 2VRXA 3DBCA 4BRXA 4U45A 1LUFA 3FY0A 4RT7A 3R7IA 3R01A 5AUTA 5AUZA 2OGVA 1ZYDA 2QU5A 4QD6A 1P14A 2ITNA 4CEGA 3NAXA 2B9IA 1AQ1A 3Q3BA 5B2LA 4OAUC 2F2UA 2QR7A 2Z60A 2OLCA 5IMXA 3AT2A 3BLHA 3S00A 4QMMA 4PL3A 2QKWB 2VO6A 4WUAA 3PP1A 2ETKA 1LEZA 4MKCA 1H1QA 4QYEA 2HCKA 4FC0A 4DH5A 4P90A 4BCHA 3OXZA 2JDSA 4YJNA 3C4XA 5HO8A 2X8IA 4KIOA 3F3VA 2H96A 1PXNA 1OIYA 4CT2A 3FPMA 2YERA 2W96B 4TW9A 5JGDA 3F3UA 1B6CB 4MF0A 2OXDA 3LPBA 3Q2MA 4RPVA 5CU2A 4PPCA 4K77A 5CWZA 3HYHA 4HVHA 4H1JA 1Q99A 5HLNA 2CDZA 4OGRA 1H28A 1YI4A 3BQRA 5GZ9A 4PMMA 3HV6A 3ZLWA 4HW7A 3OUNB 4CCUA 4ZY5A 1OPLA 5IQIA 3P7BA 3MA6A 2W7XA 4JR3A 4I22A 4U80A 3NCZA 4BB4A 5CSVA 5E8ZA 4IAFA 4O2PA 5H3QA 4BDHA 2XH5A 4AFJA 2XB7A 4FUXA 3AC1A 4QMZA 4A9TA 3U54A 2W0JA 2X2KA 3JVSA 1KOBA 5BVOA 3LXPA 2JITA 3PPZA 4HCUA 4IJ9A 3WILA 4IX3A 3WYXA 2ZB1A 2DWBA 3QZIA 2EXEA 4IH8A 2VZ6A 4ZZOA 1EH4A 5LVLA 1KV2A 5CALA 4IJPA 3R8PA 3ZLSA 3SXFA 3ZUUA 4AT5A 3OVVA 4JAIA 4E4NA 5D11A 4O7WA 5J7HA 4GG5A 4DF3A 3AG9A 2UZWE 2XA4A 3QKKA 5LMKC 4M0ZA 4G5JA 4F08A 3Q96A 4OTDA 5C4LA 2WMWA 5EYKA 4QYFA 4X7QA 4F6WA 4BVUA 5IUHA 2ITOA 1OBGA 5E8UA 1XH9A 3VS5A 3CQWA 3OBGA 3GFEA 3R9HA 4B4LA 4C4GA 5CVFA 3RPSA 3ULZA 1BUHA 3KXHA 5L2SA 1AD5A 3FZPA 1JLUE 1Y6AA 4ANOA 4D2TA 4R6VA 4BDDA 5BPYA 3BV2A 3CXWA 4DGOA 4OTGA 1RDQE 3LCTA 3IDBA 5C8KA 3C4EA 3CKWA 2R64A 3OWLA 4P2KA 4PTEA 4JXFA 4KNBA 3PA3A 4XRLA 3V8TA 5KMNA 3L9LA 4WUNA 4IZYA 5LQFA 4I0RA 4XP2A 4RG0A 2BZHB 2BRNA 3MIYA 4DBXA 3R73A 3DLSA 1OL5A 5AAGA 3BHHA 4YLLA 3FUPA 3NW7A 5DVRA 5A46A 4QRCA 4XNEA 2UW3A 3EH9A 2Y4IB 5AUUA 2PZIA 5L2WA 5A4QA 4D55A 1HCLA 3DJ6A 1XO2B 3MFTA 3V01A 4EH4A 3PYYA 4WT6A 4X2KA 3CR0A 1SNXA 4U7ZA 4C4IA 5I9ZA 4DITA 3ZSHA 3R2BA 5AP6A 4AN9A 3UE4A 5JSMA 3QA8A 3L8SA 4RGJA 5BQ0A 4RC2A 2PZYA 4EYMA 5E8XA 4XH6A 2HIWA 4QYHA 1B39A 4NM3A 4XG7A 5C01A 3LFAA 3MGYA 2C0OA 5DGZA 3RM7A 4QOXA 3FI8A 3RWQA 1MP8A 1MUOA 5DPVA 5DR6A 5ANGA 3SG8A 3S2PA 3R30A 4ZOGA 3QKMA 4JT3A 3R7EA 2W1DA 1S9IA 5HICA 2QOHA 4MK0A 1E1VA 4BIDA 5AEPA 1GZ8A 2JLDA 3BU5A 3Q6UA 3LCDA 2EXCX 4UEUA 5CVGA 5FEEA 3IPHA 3ROCA 4QMQA 2PE2A 1PMEA 2OFVA 2QOLA 2V7OA 3GFWA 3EOCA 4HGSA 4NJDA 3WZDA 3FAAA 2WTWA 1QMZA 2A1AB 1OB3A 3FMDA 3P86A 3UVRA 4W4YA 2QODA 3VS3A 4E3CA 2J50A 2PUIA 4ANLA 1W7HA 3RGFA 4J53A 2YZAA 3DQWA 5LCJA 4AX8A 3ZRLA 4BDAA 3CC6A 4NUSA 3GCQA 4YJQA 1MRUA 3HA8A 2VD5A 4QQJA 3IW8A 3JR1A 4S33A 3E5AA 2VNWA 2VTPA 4D4YA 3DK3A 1SZMA 5EOLA 4E5BA 2PYWA 4KS7A 4CFUA 3PVUA 2WAJA 3I6UA 4D1ZA 2VTJA 3FQSA 3H4JA 4FZFB 4C4EA 2PVHA 3CCNA 2IG7A 4IFGA 5EOBA 4QYYA 3VW8A 4AFEA 5CF5A 4Z3VA 2B0QA 2P2IA 1FGKA 3FMEA 4BF2A 4E4LA 2NRYA 5CTPA 3ZH8A 3FZOA 3HV7A 4FL2A 3MVHA 4Y8DA 4YJRA 4ZIMA 1JSVA 2YA9A 4QMXA 3T9TA 1S9JA 3UZPA 4DN5A 5IDNA 4RX7A 3LLAA 3QF9A 1IA8A 3PY3A 4KIKB 5B7VA 4I92A 3L8XA 4TWCA 1FINA 4EC9A 4GKHA 3CPBA 3PE2A 3LZBA 3ZMMA 2B7AA 1R0EA 4USEA 3W55A 3S1HA 5BX0A 1Y91A 5JMSA 2GU8A 4FZDB 4D4VA 4L3JA 2WHBA 3NYVA 5FEDA 1X8BA 1I09A 4C59A 2R0UA 5H2UA 3CY2A 5CI7A 5CANA 3NYXA 4EK3A 3VS1A 5L6WL 4AA5A 5AIRA 2BRHA 4QO9A 1GOLA 3HGKA 4KIKA 4YO4A 2WEIA 4RWLA 5AV0A 2OZAA 5E8YA 3OTUA 3KA0A 4PDOA 3TG1A 3UIUA 3POOA 1LPUA 5K4JA 4FI1A 2PE0A 2XNMA 1NVSA 4FIFA 4FBXA 1H8FA 2RG5A 3F66A 3E64A 4CYJA 1ZYJA 4DC2A 5J87A 4ZS4A 4FKGA 1ZYCA 2WMAA 3G6GA 3FXZA 3R7VA 3RAKA 3DKFA 3NS9A 5CQUA 4IX5A 1APME 1DM2A 2O63A 4L6QA 2DUVA 4EOJA 2WQMA 4ANNA 2FSOX 4ZTNA 1URWA 3F7WA 1ZMUA 4G3DA 4JNWA 4J98A 3A8WA 4UWBA 4Y46A 5D7VA 4FE2A 1URCA 4MXCA 3R9DA 4MH7A 3MDYA 4YC6A 4O7RA 4YPDA 5A54A 2ITPA 3QQUA 4EH5A 3E3BX 4BCOA 2B52A 4CQEA 3ORTA 2OICA 3TZ7A 4HPTE 3FL5A 3R8LA 5HO6A 4CRSA 4ZLOA 5BVNA 5HU9A 5HD7A 2C5XA 5TE0A 3W32A 1RE8A 3KRXA 4O0TA 2PVMA 3OWKA 3GT8A 4I6HA 3KGAA 5BMMA 4D0WA 5KMJA 3ID6C 4HGTA 4BC6A 3H9RA 5CU0A 2PWLA 4IW0A 4EOIA 1UA2A 4RX5A 4O84A 4CFFA 3D5VA 3F5PA 4G1WA 4K1BA 4QMUA 3HMNA 4ASDA 3QRKA 3MESA 2XNBA 3EQIA 3C4CA 4FODA 4YHJA 4RIOA 2W1FA 4NKAA 3NNVA 1KSWA 3P0MA 2OI4X 4WA9A 1Q8YA 2R3HA 4FTOA 4IEBA 4XLVA 3U6JA 4IB1A 3ERKA 3ZSGA 4EH3A 1J7LA 1HCKA 2PMLX 5DWRA 2ZOQA 2BFXA 2VTAA 2W17A 4WBBB 1BLXA 3VBQA 4BCNA 3DDQA 3WZKA 4AT4A 3IS5A 4PL4A 1H00A 1U46A 2J2IB 3OEZA 4MCVA 1JNKA 3AMAA 3ORIA 3VO3A 3C50A 4I3ZA 2IN6A 3QQFA 4UYNA 2GFCA 2W1EA 2BVAA 2GHMA 2I0YA 1R3CA 3E7OA 4X6RA 5AJQA 4C34A 4E20A 4EC8A 4KUJA 4OUCA 3PDTA 1GIHA 2BUJA 3MI9A 3BE2A 4QMTA 4DFZE 4DCAA 3GCUA 2SRCA 3TNIA 5HZNA 4R3CA 2XRUA 4A07A 2Y8OA 2AC3A 3GBZA 5JZNA 3VBYA 3BGZA 3FMMA 3F7ZA 4KSPA 1REKA 5IZFA 5M4CA 1OL2A 4ENYA 3IW5A 4ZTQA 3R7OA 3ORXA 4EOSA 1IASA 3D7TB 3EQRA 1H0WA 3O7LD 4JLCA 5HOAA 2W9FB 4BCQA 4WBOA 4DFXE 2XNOA 1XBAA 5JFVA 2W1ZA 5EKOA 5KCVA 5DIAA 1G8AA 5AM6A 3MB7A 3QX4A 4ZMFA 4FA2A 2XK6A 5HE2A 2BAKA 4F7NA 5HKMA 2A4LA 4KKHA 3EKNA 5AV1A 2XKFA 2ZM1A 5DFPA 5FTQA 4RWKA 4UXLA 1UU9A 5BUJA 1KOAA 2JDTA 4EORA 4QP7A 1A48A 4FTUA 5DNRA 2HY81 3ZS5A 3D7TA 5I9XA 3LFDA 4C4JA 5L4QA 1Y8GA 4HPUE 4D2PA 4RRVA 3QU0A 3VVHA 3UQFA 4FKTA 1KUTA 2BAJA 2WXVA 2IO6A 4IM0A 5J8IA 4L44A 4L01A 4RLKA
chains in the Genus database with same CATH superfamily
2WTCA 5HNIX 2GNFA 5DR9A 3K5VA 3NGAA 4MWIA 4AXAA 3N51A 4XG6A 3ZTXA 3ZUVA 3Q5ZA 2PY3A 3VHKA 4B8LA 5ACBC 1PMUA 4I5MA 4I5PA 3JY9A 3WOWA 3ZFMA 5LARA 5A4EA 4MTAA 4O4CA 4CRLA 2PUPA 4Z55A 4AE9A 4DHJA 2QO7A 4CD0A 2UW9A 4WNKA 1R39A 2CLQA 3KRJA 4XG2A 4C7TA 2XEYA 3BL9A 2ETMA 3Q04A 3S4QA 2XKDA 5L2IA 2ITVA 4HOKA 4H1MA 4ZXTA 2VO3A 4OT5A 3LFSA 4IWOA 5AR5A 4RJ8A 3W2CA 3F82A 4I4FA 4CV8A 3S0OA 3KY2A 2F2CB 4DEGA 2JDVA 2H9VA 4JBVA 4QP6A 1ZMVA 4J8NA 2QOBA 4ZTMA 5JGBA 3MTFA 4I6QA 4LL0A 3BBTB 4FIHA 4MBLA 4KBAA 5FLFA 2VWYA 4IX6A 3LM0A 2GQGA 3QD0A 4O0SA 1PXKA 4FTMA 4O96A 5CQWA 2PULA 3CTJA 3DZQA 4KBKA 3D2KA 3LCSA 4GKIA 4K8AA 3IKAA 3QALE 4W4XA 3OZ6A 3G15A 4GIIA 3IK3A 2OXXA 4FSWA 3ZFYA 4QMLA 3RHXA 5KHXA 1OKWA 5ETIA 1NT2A 5HG7A 2WMSA 4LMNA 5CT0A 1H25A 3UGCA 3L8PA 3BYSA 3D5UA 5F94A 2VO0A 5CEQA 2JD5A 4O7YA 2WU7A 2O0UA 5AP1A 4DCEA 4QTAA 2VN9A 3UPZA 1V1KA 1WAKA 4YBJA 4LV8A 2JDRA 3G90X 5HTIA 5IQDA 3O2MA 3C9WA 3UIBA 1PMNA 5HEZA 2QONA 1QPEA 3VC4A 3BYVA 5JGAA 2YZLA 3FI3A 1L3RE 2GCDA 5B0XA 5HORA 4BR3A 4AZSA 1Q62A 2QOFA 2PVFA 3V5WA 2XK7A 4EK8A 4JG6A 2GFSA 4F9YA 3F5XA 3RPVA 1JSUA 3M2WA 4FT3A 3EN7A 1Q8WA 3DTCA 2HY0A 5FGKA 3R8VA 2OG8A 2ERKA 2R3OA 5AIKA 5EFQA 3FKLA 4DEIA 5DI1A 4WRSA 2DYLA 3R9NA 2VGPA 4AXDA 4JX3A 4Q5HA 1DAYA 2X6DA 1VYWA 4JR7A 5FQDC 3UNZA 3W2RA 3O23A 4E6DA 4FEVA 2V5QA 3MPTA 4FKOA 3BKBA 4NSTA 1MRVA 1CKPA 2C0TA 3QYWA 4M67A 4LOOA 2A2AA 3GC7A 3MY0A 4AOIA 3BE9A 1GJOA 2YIYA 3COHA 1L8TA 3HA6A 4MUQA 5ANIA 4DINA 4RJ6A 4U8ZA 2A27A 2UW4A 1ZARA 3NIEA 4F7JA 1BKXA 3A61A 4XHKB 3BEGA 3ORKA 1TZDA 3I7BA 2WZJA 1FMOE 4C38A 5A4CA 3TDWA 4Y95A 4GFOA 3VWAA 5BVKA 1KE7A 4EI4A 4L3PA 3QLGA 4AOJA 3R0TA 4FTKA 3VF9A 4JDIA 4C58A 3TNQB 4NW5A 3PLAE 3IGOA 4EBWA 3LQ3A 3KN6A 3MSSA 4I41A 4GT5A 2J0MB 5BVFA 4B8MA 3DDPA 4BDBA 5M56A 3SXRA 3TIZA 1KE8A 4G34A 4GW8A 3UIXA 2QQ7A 4LRKA 2QKRA 4YNEA 5AP4A 4HYIA 4IB3A 5CU6A 1H07A 2YHVA 3O0GA 2ZV7A 3DCVA 3DNDA 3SOAA 3UOJA 3GU4A 4RVTA 2YM3A 3NW6A 4YNOA 4EZ5A 4BJJA 4DT9A 4CLIA 4EUTA 3RKBA 3DJ5A 4J8MA 4X2FA 4JAJA 4Y5HA 5HCZA 4BCGA 2XK3A 4G3CA 4FTLA 4R8QA 4FKJA 4YBKA 2WMTA 4G3EA 4ALVA 5FUTA 5KX8A 3P7AA 3GU7A 1GZKA 1WBSA 1JKKA 4EH9A 3VBVA 4FSUA 4BI1A 2XAMA 2Z02A 3ALNA 4OTIA 4ERWA 3E87A 3EMGA 4JRVA 4QQTA 1UU3A 3C1XA 3QL8A 3V6RA 4QP2A 3OFMA 4MXYA 1K2PA 3SQQA 5GINE 2QLUA 2FH9A 2PVYA 4ZSGA 3O8PA 2W1CA 3R63A 4BBEA 4JJRA 4ZTLA 5FM2A 4X21A 1ZWSA 4MAOA 3DA6A 1LP4A 4CFVA 5EI2A 4G2FA 3VN9A 3IOPA 4CMTA 3DLZA 1TKIA 3DS6A 1H1SA 3H0ZA 3QUEA 5FBNC 5KZIA 4Z16A 3C0GA 1STCE 2CLXA 3BLQA 4J1RA 4IANA 4C02A 2OH0E 3EQBA 2IVVA 3BZ3A 3F2NA 3EYHA 3KMWA 3QAME 4FZ6A 4K18A 3QWKA 4WRGA 2EWAA 2OF2A 3I5NA 3PZHA 5CF8A 2YIRA 5M4UA 4FOCA 3FLYA 4PL5A 4M8TA 2BZKB 2IVTA 3QRIA 3BEAA 4RA5A 4RVMA 1BL7A 3QRUA 4IAKA 4TWOA 4C4FA 3HMMA 5FXRA 4M7IA 2BTSA 1P2AA 3ORMA 2UZOA 1H1RA 4EJNA 3VULA 1H26A 2ZDTA 4CG8A 3EYGA 5IH6A 3N4UA 3BU3A 3DFCB 1M52A 5CSHA 3DQXA 4PMSA 5IPJA 3U51A 1UNHA 2QD9A 5HG9A 4FSZA 2QR8A 5L2QA 2Q83A 2W9ZB 2E9OA 2UW0A 1FVRA 1J1BA 4NW6A 4HVGA 3P08A 4IADA 5AP2A 3DFAA 4D2VA 2BIKB 3GXLA 3BIZA 1ERKA 4HCTA 2F7ZE 5EM6A 1JKSA 3A7FA 4L67A 1OGUA 4O4FA 4O0UA 2Y4PA 3EL7A 4YZDA 3C4WA 4M13A 5AR7A 4AW2A 2DQ7X 5GZ8A 2H34A 1OKVA 1XBBA 3FLSA 3PXKA 4AW1A 2CKPA 1JKLA 3K5UA 3WZEA 5A6OA 5J5TA 3F6XA 5EM8A 4K33A 2CCHA 2R0IA 2C3KA 3GQLA 4K2RA 4V01A 3I6WA 2WQNA 3R2YA 2HZ0A 4MQ2A 4LRMA 5HIDA 4DGNA 4O38A 2VTQA 4ACHA 2VWWA 1XQZA 3MTLA 4X2JA 4H3QA 4HVDA 2NO3A 2WTKC 3AKLA 4J52A 4DAWA 1YI3A 1WBOA 3CD3A 4FKLA 2UUEA 5AWMA 2WIHA 3HVCA 3LQ8A 5EDPA 4DDGA 5I0BA 2CNUA 4OBQA 2XRWA 4RIWA 2C5OA 2X9FA 2FUMA 3G2FA 4O86A 2IEWA 4DEHA 4ID7A 3PZEA 3FYJX 3TIYA 2NNWB 3NZ0A 2VGOA 3VRYA 2HK5A 5A6NA 4U5JA 3WF8A 4LOQA 4IC7A 3KFAA 4IM2A 2YM7A 4BCJA 3QUDA 4NZWB 2YIWA 4EH2A 5H9BA 3UVPA 4U40A 2OIBA 3CGOA 1M14A 1UU7A 2PUUA 4W4VA 4C62A 1OPKA 3KRWA 5DOSA 4C3FA 2X0OA 5CNNA 4E5WA 3H9FA 5M53A 5C27A 4ZTHA 4YGAA 2YLFA 2UZBA 5JKGA 1CDKA 3DT1A 4YHFA 3DKOA 3FXXA 5KZ0A 1RW8A 3ZM4A 1WVXA 4TNDA 1OL7A 4BYJA 3TT0A 1NW1A 4W9XA 5HE1A 2QO2A 3PVWA 4IXPA 4JI9A 4A9SA 2OKRA 3NCGA 3NUSA 4FL1A 2ZV9A 2BKKA 1OITA 3OCSA 4U97A 4RFZA 3THBA 2C69A 3LAUA 4DG3E 5AX3A 2HW6A 2O2UA 4GJ2A 3BELA 3JS2A 3PRIA 5K0XA 3W0QA 5M4IA 5FWKK 2O3PA 2C68A 4A06A 4DA5A 2XK9A 2AEGA 5JK3A 2KULA 4FSMA 4RWJA 2YAKA 2BMCA 3ENMA 4L42A 4YC3A 4FEWA 4AQKA 4F9AA 4MXXA 4R3PA 1JSTA 2VX1A 3P9JA 3QFVA 5AV3A 4BI2A 2B53A 3NPCA 4YJTA 4E6QA 4RC4A 1PF8A 2OBJA 4ASXA 3P4KA 1Q41A 3ALOA 4YLJA 1YVJA 4I23A 3H10A 2PK9A 5IDPA 3NDMA 2WMRA 2VU3A 5AMNA 3PLSA 5IQBA 2YIXA 2I0HA 2J90A 1PXIA 4U81A 4B9DA 2ETRA 3FC1X 2IF8A 2AYPA 4WG3A 3RI1A 3TNHA 3UTOA 3RPRA 4XS2A 1W0XC 2WFYA 1VLRA 1GAGA 5F95A 4BKZA 5FDPA 2HWPA 3R9RA 4EYJA 3UC3A 2BHHA 4OR5A 4N0SA 4OTQA 3TZMA 4XG8A 1Z5MA 2GTNA 3GUBA 2P3GX 2Y6OA 2J5FA 3EN9A 2J0JA 3QHWA 4XG4A 3S3IA 3TXOA 4ANMA 4WKQA 2YM4A 3D94A 5H8BA 5BUEA 4G6NA 4ZSEA 4AW5A 4X6QC 3R7YA 3PXQA 3GVUA 3UQGA 3EFJA 2PMIA 5ANKA 1ZMWA 4I4EA 3E3PA 5F4NA 3A7IA 4E7WA 4CSVA 5IQFA 4FT0A 4YZBA 3VHEA 4S30A 3Q4CA 1FGIA 4DFNA 4M15A 4AOTA 2V22A 4PF4A 3PFQA 3OCGA 1V0BA 2IZRA 4QMWA 4TT7A 4XRJA 3GCSA 4UYAA 5TR6A 1WMKA 3WI6A 3GOKA 2BKZA 1PRYA 1QPCA 1M2RA 3ZO4A 3SKCA 1FPUA 4GT3A 2YEXA 2C5YA 4IVDA 3MFUA 4O0RA 1PJKA 4D2RA 2YABA 3W33A 3DAJA 4R5YA 3RNIA 1YDSE 3PXFA 1YXXA 4HYHA 3LQ5A 4S32A 1YWVA 2W5AA 4AN3A 3V8SA 4C36A 2J5EA 3KB7A 4DEDA 2PPQA 3CJFA 4FT7A 4FGBA 4MXOA 4L00A 4GSBA 1U5RA 2C3LA 2WMVA 3CTHA 3ROYA 4DBNA 3Q5IA 2FA2A 3IONA 3W0MA 1PXOA 3DV3A 4YMJA 1UU8A 4QNAA 1W2FA 4XP0A 2GNIA 3PJCA 1YI6A 3B8QA 3OF0A 5EDRA 4FMQA 4UN0C 5LMKA 4E4XA 1BI8A 3T8OA 4YLKA 3ZLYA 4UMUA 2A19B 3TUBA 2GNHA 4RZVA 3GC8A 4U3YA 4YJPA 5I9VA 3FC2A 2PZRA 3C13A 4U44A 2XM9A 5EKNA 4L43A 2JKKA 4AU8A 4D5KA 4PP7A 5JRQA 5K4IA 2CKQA 3ORZA 3UNJA 3W8LA 4QDVA 3TZ9A 3KC3A 4CYIA 3PWDA 5HGIA 3JPVA 4WSQA 1YWRA 2X81A 4NTSA 4JBQA 3TMOA 5M09A 3G0FA 4G31A 3ZRKA 4BWKA 1M2PA 1LEWA 1PYEA 2GS6A 3TV7A 1PXPA 1SVHA 2O65A 3EB0A 2WQEA 5CSPA 3BCEA 4E6AA 3VRZA 5K9IA 4FG9A 4IB5A 2OW3A 3ZZEA 4U9AA 4A4LA 4DG0E 4I93A 4M97A 1YOJA 3VF8A 2XUUA 4ZLYA 5IA2A 3SHEA 3OD6X 4FZ7A 5G6VA 4BHNA 4IZAA 2YWPA 1JOWB 3D7ZA 4C33A 3ODZX 5BYYA 3FZRA 4F4PA 2NPQA 3PVGA 4FV7A 5TF9A 3QCQA 2ESMA 1G8SA 5EK7A 4XX9A 1KE9A 3UOKA 2CGXA 5CAOA 3H0YA 2VTLA 3UBDA 3HRFA 3I0QA 4O4DA 5CENA 3VS0A 3KF4A 3BLAA 2IWIA 2PE1A 4XBRA 2W5BA 4NH1A 4BCKA 4Z7HA 5BV3A 4TL0A 3ZLXA 3PA4A 4FF8A 4TY1A 4C3PA 4CZYB 4IWQA 3AOXA 3Q9ZA 5C8NA 4L52A 2UZTA 3AD5A 4XOZA 2P55A 4FEXA 2CKEA 5C8MA 2WB8A 2X1NA 5IQAA 5L8KA 3SC1A 4MF1A 4NFNA 4PTGA 3FQEA 2JEDA 4TRLA 2ZAZA 2PTKA 3G6HA 3IQ7A 3FMHA 4FSQA 3TNPC 1ZY4A 3VBXA 3KK9A 3NX8A 2Q0NA 4RFMA 4XMOA 4DGMA 5GIPE 3NUAA 3ZCLA 3NUUA 3COMA 4LGDA 2E2BA 5L6OA 2RSVA 3KXNA 4H05A 1OUYA 5HVJA 2BHEA 4GUEA 4LFIA 3QZHA 4IE9A 3W2PA 5M07A 1YW2A 1KE5A 4E4MA 4M84A 3L9PA 4O7VA 1F5QA 4QDEA 2CPKE 4OTHA 3PG3A 3QYZA 5JN2A 5CU3A 4QTEA 3CSVA 2C6EA 4U3ZA 2QOCA 3B8RA 2HOGA 3WE4A 2XNEA 1OZ1A 3LE6A 3PG1A 5EQPA 1TFFA 5L6PA 5KKRC 4EJ7A 5EW9A 3I81A 5HESA 4FVQA 3VJNA 5BVEA 4HZRA 1YQJA 4DH3A 3SLSA 5M06A 3AXWA 4ACCA 4PQNA 3W0SA 2RL5A 3W8QA 2JFLA 2RG6A 3LCKA 3QQGA 1DI8A 4BBFA 4FEUA 4F1OA 1KV1A 2QHMA 1W8CA 3PY1A 2VTNA 5IKWA 3RVGA 3ULIA 4EH6A 4PRJA 4DT8A 2XM8A 5HCYA 4F1TA 2XJ2A 3QXOA 1NVQA 3NVMB 2PZPA 4F64A 3SRVB 3EWHA 5K5XA 4XYFA 4ANQA 2X7GA 3ZXZA 1ZOHA 4MXZA 1RJBA 3PJ8A 2UW6A 2EU9A 4FKWA 2GPHA 3EN6A 2PVJA 4ZY6A 4C8BA 2X2MA 1Q3WA 3E92A 4QT1A 2PL0A 3TTJA 4L7SA 2WD1A 2OFUA 3PSCA 5AAEA 5FDXA 2ONLC 2R7BA 5AA9A 3U87A 4BY9E 4BGQA 4CNHA 2IPXA 1ST0A 1VEBA 4EWQA 3FLQA 3HDMA 4B6LA 3HUCA 2W99B 3O50A 4DTKA 5HBHA 2C6OA 3SRVA 3F5GA 1NY3A 1G5SA 2BDWA 2QOKA 4D1XA 5I9WA 2HYYA 5A3XA 5EI8A 3I7CA 1Q8TA 2YN8A 5H8EA 4ACGA 4ASEA 4XOYA 4D9TA 5BMSA 4YSJA 2ZFYA 3K3IA 4A4OA 5E9EA 3RHKA 3CLYA 3R1NA 1Q24A 2VV9A 3LW0A 4MEDA 5IG1A 5CU4A 3N4TA 3LMHA 2EVAA 3G9LX 1SMHA 4QNYA 3KK8A 3AGMA 3PSDA 3MY5A 3AKKA 3KVWA 4LV7A 4JDJA 4IAYA 4BCMA 2RFNA 3HV4A 4O0WA 5EYDA 4GK4A 4V04A 4RIYB 4ZS0A 2BRMA 5T68A 1H27A 3FI4A 4HVIA 4Y73A 1OECA 4FV2A 4I0SA 2OJ9A 4O83A 2EXMA 3GQIA 5G1XA 4P4CA 5CY3A 3O5AA 1J7UA 1UKIA 2ONLA 3LLTA 5HE0A 5J5SA 3ATTA 2ZM4A 4O82A 2WKMA 2CGUA 2XKCA 1O9UA 3TZ8A 4ZSAA 2PVLA 2R7IA 5HNGA 3U4WA 3W1FA 3LFEA 3WF5A 2VTMA 2WQOA 4RIYA 1YHWA 3AT3A 4XJ0A 2IZTA 2QG5A 3QTSA 2V62A 3CTQA 4QP8A 1Y57A 4CZTA 4CCBA 4EZ3A 2XVDA 3AMBA 4HYUA 3TV6A 1UVRA 1WZYA 2HZNA 3A99A 1G3NA 2YISA 1ZOEA 3PRFA 4GS6A 4AF3A 5F9EA 2BR1A 2Y6MA 3PVBA 4AW0A 3W18A 3I4BA 4WSYA 2WTDA 3NR9A 4F0FA 3KCKA 5FP6A 2H6DA 3SD0A 2QVSE 4EOQA 1JAMA 1A06A 3RAWA 5ICPA 3O8UA 3P23A 3CP9A 3EIDA 4BI0A 4PPBA 4PNKA 4NK9A 1PXLA 3P1AA 4QQ5A 4RVKA 4GVJA 1OUKA 2OZOA 2J51A 1XH8A 3KMMA 1O6KA 1CKJA 3NUYA 3UP2A 2ZYBA 4J99A 2XBJA 4FTJA 4YO6A 3F3WA 4GV1A 4EZ7A 5JQ8A 3ZONA 2R3NA 3V5TA 3L9MA 4AA0A 3R22A 3F2AA 2UZEA 3D5WA 3UO4A 4AACA 3E7VA 3VUHA 4TYHB 5AR3A 4OAVB 3ZSIA 2J0KA 3BHUA 4FTQA 4S31A 3CPCA 4BTFA 3SGCA 3HUBA 1XH4A 2UZDA 2YFXA 4IMYA 5DT4A 3PIYA 4JG8A 1JVPP 3DY7A 4KSQA 3PY0A 2XYNA 3PXZA 2WELA 4LI5A 4JS8A 4M69B 5DRBA 3SV0A 3VJOA 5ANOA 3QQKA 3UMWA 3IDCA 4EONA 4CKRA 4EHEA 3NNWA 4R3RA 3LFBA 4G6LA 3UIMA 4PWNA 2IZUA 4MHAA 5GJDA 3TN8A 4CZUA 3MWUA 4J7BA 3LFNA 1O6LA 3QCSA 4TYHA 2PVRA 4UMPA 2R4BA 3QTIA 4I1ZA 2ITQA 2YCFA 4IX4A 3KEXA 2PMOX 4GRBA 2XMYA 3MW1A 5EM5A 3SOCA 2YM5A 4ZTSA 3EQCA 3Q6WA 4IM3A 4M69A 3EQDA 4TYIA 4YZNA 1NXKA 4U41A 3PFYA 4EOOA 3UO5A 3T3VA 5D9HA 2F7XE 2JDOA 3R7GA 1YXUA 2C6MA 4MYGA 1DS5A 4HNIA 4WNPA 1IEPA 4MBJA 4P5ZA 3FL4A 3N9XA 4GUBA 4D5HA 4ORKA 3ZM9A 1YDRE 1WBNA 1QPDA 3HKOA 3KQ7A 2GNGA 3QTUA 5HQ0A 4A9RA 2HELA 4BCIA 4CG9A 2EB2A 3IW7A 5BYLA 4MWHA 4M14A 3R1YA 2UVXA 4X3JA 4UWYA 1OKYA 2YIQA 1UWJA 2CJMA 4MX9A 2XIXA 4XG9A 5FBOA 2LAVA 5L3AA 5CX9A 2B54A 1NVRA 2OJGA 3OHTA 4FIGA 5ANDA 3NIZA 3TUDA 1J7IA 2OJIA 2X7OA 5KNJA 4GT4A 4FK6A 3D83A 1IAJA 1H08A 2W06A 3JVRA 1GZNA 4JRNA 4R1YA 4O1OA 5HCXA 3JY0A 3PIZA 3OS3A 2BZJA 4TWPA 4O0YA 5D12A 3N4VA 2X7FA 2GS7A 3L1SA 3MN3A 5DT0A 3NUXA 5CAUA 5IMEA 4IDVA 4F1MA 4GCJA 5I5ZA 4GVAA 4EKKA 3LM5A 3QTXA 4H3PA 4N6ZA 3WBLA 2XZSA 3O51A 4R7BA 4RVLA 1J91A 3QTQA 4AGUA 3Q9YA 1WBPA 2XNNA 4G9CA 4GFGA 4P7EA 3NWWA 1GIIA 2PMNX 2Z7LA 4U79A 3CS9A 1GIJA 4B0GA 3LVPA 4D2WA 5IUGA 4CKJA 2RGPA 3TYKA 5BVDA 2WTVA 4QPMA 4C57A 5CAQA 3ZEWA 1XMLA 3CY3A 4G9RA 4IAAA 3TACA 5HHWA 3VUDA 2YWVA 1M2QA 2J6MA 2VWVA 2XP2A 4O0XA 3R71A 3W10A 3QTRA 1OL1A 5T6KA 4EL9A 1PKDA 3TEIA 4YTFA 3TUCA 1JBPE 4ANBA 1OIRA 3DBDA 4O7LA 3RPOA 3QZGA 3QD4A 5DYJA 5KHWA 4TNBA 2VTTA 1U5QA 4JQ8A 3LKMA 4FNXA 4JQ7A 2YDJA 4AGCA 1OPJA 3HP2A 1BI7A 3WZUA 4C2VA 3TDVA 4FYOA 3CEKA 3C0HA 1R78A 3EJ1A 5E8SA 3V04A 3MVMA 2FSMX 1DAWA 1ZLTA 4FKPA 4HYSA 5A14A 1RQQA 3ITZA 3GOPA 3QXPA 3DNEA 5H8GA 4ARKA 3WIGA 5CS6A 4Q9ZA 5I3RA 3DBFA 3GC9A 4KA3A 3C0IA 5KBQA 3ACJA 3VUTA 4R77A 4FR4A 3QKLA 3PUFC 3C51A 3BPRA 4FKUA 2VWIA 4DH8A 5IA1A 1TVOA 3L9NA 4N57A 3BU6A 1CTPE 3FBVA 1FBNA 3TKHA 3TL8A 4RLLA 1Z9XA 3RJCA 4QP4A 2R3PA 2ZM3A 1YDTE 4TYGA 2BZIB 2A0CX 3E93A 3BYMA 4WIHA 5EW8A 4BBMA 3UOHA 5AADA 1P4FA 1KE6A 4JBOA 4AGDA 3LJ2A 4MNEB 2CGWA 3O17A 3ORPA 5E90A 3VS7A 5TT7A 5DMZA 4OBOA 3A62A 1PYXA 1YOMA 3WF6A 4LRJA 4MBIA 3GB2A 4DLJA 2JKQA 3FWQA 3MVLA 3BV3A 3HECA 1SYKA 4OW8A 4NIFB 3OT3A 5AV2A 1WBWA 3RBWA 3UG2A 3LFFA 3KU2A 3MV5A 1SM2A 5LMAA 2HENA 4PP9A 4FIJA 4ACDA 3EQFA 3KCFA 4BIBA 2C6DA 2YITA 3LJ0A 4YJUA 4YC8A 2QOOA 3BI6A 3TJCA 2PVKA 3U55A 3GNIB 4O4EA 5AR2A 3UO6A 3UVQA 4Z7GA 5A4LA 2C6TA 4W9WA 4OT6A 2X39A 4FV0A 2GDOA 4MNEA 3FKNA 4UMTA 5FG8A 4CMUA 4JMQA 4LV5A 4KIPA 2R3GA 4N6YA 4IWDA 3FQHA 3AT4A 4RX9A 5EYMA 5ACKA 3FXWA 3R02A 2QOIA 5E8VA 4QYGA 5CZHA 2RFEA 3D2IA 4NIFA 4F09A 5L8LA 4DGLC 4HNFA 5HIBA 5EQEA 2WOTA 3FLWA 2B9FA 5J79A 4IB0A 2ERZE 3BHYA 4EWHA 3FSFA 1OL6A 3OXIA 5EHOA 3E8CA 5IEYA 2Q0BA 5IA5A 3ORLA 3DGKA 2WMQA 2R3LA 2JFMA 2XNGA 2Z7RA 5DLSA 4QTDA 3VS6A 4D1SA 5HX6A 3U6HA 3G0EA 4FL3A 3D9VA 5AUXA 4FG7A 3PXRA 4R7IA 4UZHA 4AE6A 5AUVA 3O71A 3RK7A 4CTBA 1WBVA 4BTJA 3VUKA 2AC5A 3EZVA 3KXMA 4CGAA 4D58A 3HP5A 3SDJA 4A9UA 4IAIA 3KL8A 1OBDA 4K6ZA 3DXPA 2QLQA 2X4ZA 2ITYA 1XHAA 2YJRA 3IOKA 4XCUA 5FEQA 3GP0A 4DEEA 5F1ZA 2B55A 2BROA 3ACKA 4MD7E 5HVYA 4ITIA 1XH7A 2C6IA 2B9HA 2XK8A 3NAYA 4QMPA 4JX7A 4CLJA 3P5KA 5HVKA 1YHSA 4PDSA 2XBAA 4AZFA 3TM0A 4FX3A 3MA3A 3D4QA 3EFKA 5FXQA 5EDQA 2HXQA 4C4HA 2NYAA 4FV4A 3COIA 4FNWA 4BN1A 4U6RA 1MRYA 3C4FA 3E8DA 5IQGA 4ZJVA 2WMBA 4ALWA 3MH3A 4G5PA 4E93A 1XR1A 4GYGA 4CQGA 4QP9A 4E26A 5CAPA 2G2IA 2QG7A 3LXKA 5DE2A 5I4NA 3AC2A 3P78A 5EH0A 5JZJA 4J96A 5E1SA 4LQMA 4BFMA 4H39A 4IVAA 5FTOA 4AQCA 4CTCA 4CVAA 2KTYA 3H9OA 3HV3A 4JDHA 4XUFA 1YOLA 5IH5A 4FUYA 2JIUA 1UWHA 3HAMA 3A2CA 4IZ7A 1PHKA 1SVGA 4M0YA 5CEPA 4R78A 2BRBA 3UYSA 5IA3A 3LCOA 3R9OA 4QQCA 4FT5A 3MH1A 1SVEA 4V0GB 5DHJA 4EOLA 2J4ZA 2WTKB 4TYJA 2CHLA 4Q2AA 2XALA 2E9PA 3OCBA 2RF9A 1FQ1B 2WTJA 3AC3A 3FZSA 2JAMA 2BALA 2CN8A 5DBXA 4KRCA 4CT1A 5GIOE 4TKSA 4EQUA 3EKKA 4OBPA 2OO8X 2ZDUA 3G9NA 1MQ4A 4PMPA 4YJSA 3UODA 5HE3A 2OSCA 2P33A 1YHVA 4LM5A 4Y5QA 3AKJA 2JKOA 1ZAOA 4I5CA 1A9UA 2HZIA 4XP3A 4FVRA 2VAGA 3RNYA 3UJGA 2BPMA 2X0GA 5IF1A 4FICA 4V0GA 4AWIA 2IVUA 5DT3A 3E62A 4F70A 4RJ5A 4ANSA 4EK6A 1W98A 4TXCA 3U8WA 4KKGA 4FKSA 2UW7A 5HG5A 3W2QA 5JFXA 3R21A 3DB8A 4CXAA 1WCCA 4KB8A 3NFGB 3LMIA 2ZB0A 3Q32A 2C6LA 1XH5A 4GMYA 4YUQA 5IQEA 2QOQA 2YLEA 4CKIA 2FGIA 5KE0A 3RTPA 4F65A 2VTSA 4FKVA 4FV8A 3QZFA 2FSTX 1BX6A 4HGEA 4YHTA 3RAIA 3UOLA 1Q8ZA 4AGWA 4ZP5A 3IW6A 4ZEGA 2VNYA 1WVYA 1I44A 5HI2A 4GU6A 3DBQA 2GHLA 1H01A 3POZA 4OTRA 4E5AX 4O27B 3II5A 3R8MA 2EUFB 2UVZA 3M11A 3ZEPA 4JQEA 4F63A 1CKIA 4GFMA 3HAVA 2XAOA 3LOKA 3PJ3A 2QNJA 4IBMA 2QURA 3VBTA 3ZRMA 2B4SB 3AGLA 3WZJA 2CCIA 1PKGA 3ML1A 3ZBFA 1Y8YA 2YM8A 2XJ1A 4GH2A 3UDSA 1ATPE 1ZZ2A 3MB6A 3NSZA 3A8XA 4ZZMA 3PJ1A 2G9XA 2UV2A 3ZXTA 4IIRA 1UNLA 2R3IA 3AD6A 3GI3A 4RZWA 4UMQA 3IGGA 5ANJA 5BYZA 1VJYA 2CMWA 4BL1A 3W0NA 3UDBA 3PXYA 1CM8A 3GCPA 5FP5A 3ETAA 1HOWA 3I60