4XJ0A

Crystal structure of erk2 in complex with an inhibitor 14k
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
345
Chain Sequence
EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Discovery of highly potent, selective, and efficacious small molecule inhibitors of ERK1/2.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 345
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xj0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xj0A01
2IZSA 2W7XA 3ZLYA 5J87A 2VRXA 5KMKA 3S1HA 3UO5A 4RC4A 2DYLA 5B0XA 3TKIA 4EK3A 5I0BA 1O9UA 1YXTA 2J0JA 4ERKA 1MQ4A 3ZONA 2AUHA 5L8JA 4EH3A 1UA2A 2WEIA 3KVWA 4CCBA 3SX9A 4CG8A 4GIIA 3O51A 1GAGA 3PFQA 3R2YA 1DI8A 2R2PA 3ET7A 4R7BA 3O7LB 3LXLA 4UB7A 2C47A 5M07A 4YJQA 1P4FA 5LARA 2ZV2A 3OC1A 1JVPP 2H34A 4FIEA 4A06A 3FLSA 5I9ZA 2O65A 2CGXA 2C68A 2DQ7X 2NRYA 4MXZA 3I0QA 3QCSA 3FSKA 4E3CA 3CD3A 5LMKA 2X81A 3IOKA 5CAUA 3RK7A 5DG5A 5CNNA 3HV6A 1HOWA 3MN3A 4AWIA 3IW8A 1IEPA 1JBPE 2CGUA 4DFZE 4DEBA 4D2RA 3WZJA 4GFMA 2C5XA 2XM8A 1SMHA 2J2IB 2XIKA 3DTCA 1ZYDA 3FI2A 5AP3A 2WQNA 4QP4A 3K54A 4V05A 4GU9A 4E26A 3FLZA 4Y83A 4NH1A 5FM3A 2XIYA 2BUJA 4FKUA 5M57A 4O83A 3V5WA 3O17A 5BMMA 2RSVA 4OTHA 3DK6A 4IFCA 3PJCA 2OZAB 3C4CA 3ZHPC 4RVTA 3BYVA 3IK3A 3WI6A 2NRUA 2X2KA 1H28A 2BZIB 3FLYA 3WARA 4F65A 2BRHA 3V6SA 3Q2JA 5HCYA 5H8BA 3EN6A 3EKNA 3IDPA 3OEFX 5FDPA 5IMXA 5E8WA 4JVGA 4EK5A 3ATSA 4FKTA 2BHEA 4F9WA 4I23A 3TZMA 3OROA 3DJ6A 3L9NA 5DEYA 2I0EA 1NW1A 2YZAA 4FL1A 5F1ZA 5GJFA 5J1VA 2PUNA 2W5BA 5GNKA 4E6CA 2HXLA 4KBKA 3Q9XA 5H3QA 4RRVA 2PVFA 1PMUA 4ZTLA 1RE8A 5C26A 5J5TA 3TTIA 3BGQA 1ZZLA 3W1FA 4Q2AA 3RI1A 2UW4A 4IXPA 3R7EA 2C5OA 3GB2A 4GL9A 4R3RA 4JL9A 4Z16A 5M06A 5M44A 2O0UA 2VWWA 2YAKA 3EHAA 4O96A 4QNYA 5CU4A 3P78A 2CDZA 4XRJA 4M13A 5FG8A 3RM6A 4GYIA 2EXMA 3RK5A 2IN6A 3HNGA 3LQ5A 2PULA 5AX9A 4UMTA 5AV2A 3CXWA 3PZHA 5BVNA 2X6DA 2UZDA 3ORZA 4IX4A 4CZTA 3MDYA 5DOSA 3UTOA 2UW0A 3QA0A 4B99A 4NFNA 5CVFA 2WXVA 3R73A 5B7VA 3AD4A 3L8PA 1AGWA 3FZ1A 4PMPA 2ETKA 3IG7A 5LCKA 5CENA 3LFFA 4DH1A 4XOZA 4OTRA 3HX4A 4FIIA 3BI6A 4LL5A 4GK4A 4FK6A 3FI3A 5GZAA 3LXKA 3PVUA 4EOKA 4O38A 5EYCA 3OP5A 3VS1A 2HW7A 5IU2A 3UZRA 3L1SA 4G3CA 4TPTA 3FYJX 2FH9A 1ZWSA 5ACBC 4E4NA 4FEXA 1H1PA 3V5TA 3DBEA 3OFMA 4FF8A 4WOVA 3BEGA 3F5GA 5ANGA 5HHWA 3A7HA 2WMQA 2B4SB 2OFVA 2Q0BA 1TKIA 4GRBA 4IX6A 4Q9SA 4QPSA 4XP3A 3SXFA 3WILA 5EQEA 3F7WA 2HYYA 1SVHA 2OJIA 4AN3A 2XK7A 3HMIA 4CNHA 3POOA 5HNBA 3GCVA 2XK9A 1GZOA 3JPVA 4CT1A 2WQBA 3IPHA 3Q2MA 2JFMA 3UZPA 4KSQA 3FXWA 4ZXTA 4RZWA 1JKKA 2ZB0A 4O0RA 4QMTA 4RWLA 3AT4A 2W1HA 3PUPA 2F9GA 3R7IA 4EOMA 3CJFA 3R00A 3PPZA 4IIRA 5DWRA 3TJDA 1IAJA 3LMHA 5E8TA 3BE2A 4OTQA 5M08A 5D7VA 2UZTA 3RTPA 3PE1A 3GC9A 3VS7A 2OLCA 5HG9A 3V5JA 3R7YA 4J97A 4K6ZA 1Q8UA 4FV3A 3O7LD 4XBRA 1Q97A 4UEUA 3TXOA 3OBJA 5CSPA 3VW6A 3C4XA 4I22A 4PF4A 3TNIA 2G9XA 4LMUA 3FMMA 3MB7A 2O63A 3NYNA 3VW8A 4Y95A 4AF3A 2W5AA 4JNWA 4NTSA 1W98A 4D9UA 4AX8A 4NK9A 5CS6A 2EXEA 3EKKA 1KOBA 4XP0A 3MYGA 4ZS0A 4MKCA 4YNEA 4DFXE 1OPJA 1E1VA 3LMGA 2XZSA 5L8KA 2OJGA 3IW5A 4HYUA 3LLTA 5CT7A 4AZFA 5HICA 3V8TA 4ZTMA 5KMMA 3TZ7A 3DKOA 3JVRA 5AP1A 4HCUA 5M55A 5E90A 1G3NA 3MPTA 4B0GA 2Z2WA 4O7WA 2XIXA 3ZU7A 4CKRA 5FXQA 3NW7A 3OT8A 4AG8A 4U3YA 1U46A 3IDCA 1MUOA 4R7HA 3NAYA 1BYGA 3FPMA 4W9XA 4QP1A 2CLQA 4EHVA 3CY3A 3ZUVA 1OUKA 4U80A 2BRGA 3QQHA 4UBAA 4HW7A 1SVGA 1BKXA 5EKOA 4BC6A 4CV8A 5AR7A 2ZB1A 3ORKA 4BVUA 1PMEA 2AYPA 3C5UA 4JS8A 5CEQA 4CFNA 4GKHA 3QX2A 2AC3A 5J95A 3N4UA 4F9BA 2JDVA 3Q60A 1UWJA 4BY9E 1PJKA 4G3EA 4FVPA 4II5A 1OI9A 4NIFB 2OJJA 4R1VA 3R9OA 4KIPA 3I6WA 4QOXA 4FOCA 2O64A 4IWQA 5JFXA 3NVMB 3O8UA 5C4LA 4A9UA 5D1JA 5AX3A 4V01A 4YSJA 5HKMA 3TNHA 3MJ1A 2HAKA 4ZTRA 2HZNA 4DEEA 2CCHA 4CVAA 3NVKI 2R3JA 5DLSA 3TJCA 5HLWA 3MH1A 4GV1A 2PU8A 3PIYA 3GC0A 4FKPA 3GOKA 2X8EA 3A4PA 4L53A 5M4CA 4FSQA 3KN5A 3D7TA 4QMZA 4LGGA 3OWLA 4C3PA 1PXNA 4HGEA 2GQRA 5JQ8A 2R3KA 4FV9A 5EG3A 4D2SA 3ZDIA 2G2FA 3ANRA 4RX7A 2GQGA 3JVSA 4QMLA 4YC6A 5E1SA 3R9NA 3UE4A 3SOAA 3ZZWA 1OGUA 4ZAUA 3IO7A 4FKWA 4ACCA 5JT2A 4JLCA 1H1QA 4M67A 3VIDA 3QQJA 4PWNA 3NIEA 4YJVA 3WZEA 4EH7A 3NUAA 3G0EA 4RMZA 4Y72A 4YGAA 1YHWA 3LMIA 3OS3A 4GYGA 4R6VA 5ANDA 2OO8X 1OECA 4S30A 3Q9WA 4XG8A 1OL7A 2WO6A 1K9AA 2JBPA 3PJ3A 4HZRA 2LAVA 3NNUA 3U4WA 3OCSA 3QTXA 4FKVA 3W8LA 1ZMVA 4N57A 2QHMA 2B0QA 3MTFA 4JQEA 3P7CA 4MD7E 5D41A 2CGVA 2Z7QA 4FI1A 4PDOA 3DFCB 3P1AA 3MFSA 2F7XE 2O2UA 4ITHA 4QP6A 3TEIA 3WF6A 2OICA 1OKWA 1QPDA 3EQRA 2XKCA 4F08A 1ZYCA 1OIRA 3KF4A 1HCLA 1NVQA 3VBVA 1LUFA 3G9LX 3VQHA 4AOTA 3D7TB 4HZSA 3CSVA 2PZYA 4MCVA 3F7ZA 4UWYA 4RX8A 4C7TA 3BV2A 5KE0A 2CKEA 2DS1A 5HE1A 1XBAA 3DAKA 5EHYA 3Q3BA 1BI7A 3PVWA 5FEEA 3D0EA 3ENMA 3FJQE 4FIGA 3UQFA 4TWOA 3WZDA 3RGFA 2WAJA 1WZYA 3CS9A 2WMSA 4YJOA 5HO6A 5HE2A 4BI1A 5BUIA 2C6TA 2W1GA 4C3RA 4TY1A 1PF8A 2E9NA 2VWUA 3L9PA 4M15A 5CQWA 4C61A 3MIAA 2GNIA 4QYYA 3P4KA 4WKQA 1MRVA 4JQ7A 4WRSA 2JEDA 2RFSA 3C4WA 5HZNA 4FODA 4FKGA 1FQ1B 2W9FB 3AMYA 4CRLA 4KIQA 3DPKA 3T8OA 1WBNA 3UBDA 2IW6A 2FB8A 4U3ZA 4CTBA 4EK6A 3OUKA 1ZLTA 2ZM1A 2I1MA 1YDSE 3S4QA 2IW9A 3SHEA 4AA0A 4C4HA 3BHUA 2UV2A 4M69A 3TZ9A 3DZQA 2R3PA 2W17A 3E3BX 2CGWA 2J0LA 3PG3A 2PVJA 1JKTA 2QD9A 4J52A 3TNPC 4A4XA 5HX6A 2ITNA 1Y57A 1YXUA 3BU3A 4X6RA 5CEKA 2C30A 2ETMA 3RK9A 5I9VA 2WMAA 1SNXA 2QOOA 4GEOA 5KUPA 4CSVA 3II5A 4JJRA 1BI8A 3GENA 4FA2A 4RFZA 5CEIA 2ZMDA 4F7NA 2RIOA 3C4ZA 4L67A 3R8ZA 5E8UA 2A4LA 4FZAB 4O22A 2P2IA 3CY2A 4FR4A 3CKXA 4XOYA 3FKLA 3EH9A 4NU1A 4EOLA 3PLSA 2UW6A 4JDIA 4DGOA 2OW3A 4ZY4A 2VWVA 3QA8A 3BHVA 4TRLA 4RWIA 5CI7A 5A14A 4IANA 2B52A 2NP8A 2QU5A 4YC8A 2UVYA 2OJFE 1ZOGA 2X1NA 3COHA 4QP8A 4XEYA 5ANIA 5AADA 3BLRA 1KE8A 3UYTA 1Q8TA 3AT3A 4GCJA 5J1WA 2BTRA 3ZXTA 1OL6A 4ANNA 3BYSA 3QFVA 5JFSA 4E6QA 4C58A 5CNOA 1OB3A 3KF7A 4U41A 4Z7GA 5BUJA 5I5ZA 3AXWA 3H0ZA 5ITAA 1UNGA 4D0XA 2FSMX 4XG2A 2XRUA 5L6OA 2FSTX 3OT3A 1WBPA 2H8HA 4BDIA 4UYNA 3TNWA 5AM6A 4CCUA 4JX7A 2CJMA 4TYIA 1IG1A 3Q4ZA 2OIDA 2X6EA 3QC9A 5JQ5A 5DGZA 5EI8A 2HW6A 4D1XA 3PJ1A 3DA6A 4EKLA 3G2FA 3N4TA 4MNEB 2WD1A 3DLZA 2W1ZA 2W05A 4A4OA 4BZDA 3V6RA 4UMPA 4L46A 4APCA 4WG4A 4G3DA 4IQ6A 1LR4A 3CCNA 4L45A 4USDA 1YDRE 5ETAA 3CKWA 2C5NA 2GS7A 3CQEA 2WEVA 4E4MA 2C3KA 4O0XA 5M56A 3Q4TA 2IZUA 5HQ0A 4O91A 4L42A 1CSNA 4IE9A 4I20A 5FGKA 2XJ2A 3LFAA 3T3UA 4I0RA 3MB6A 3DDPA 3A8WA 2PZRA 4GG7A 2XNGA 1H1SA 3FMHA 5CSWA 1OUYA 5AJQA 4EJNA 2R3OA 4L3PA 4OAVB 3R1QA 2CKOA 3ZEPA 5GZ9A 1P14A 3NS9A 4BB4A 1FVRA 5KNJA 1GIJA 2VTPA 3KRJA 5C03A 4AA5A 4KD1A 2H9VA 3BZ3A 4FKOA 3D94A 2CN5A 3LOKA 4I94A 3QHRA 3ZH8A 1X8BA 3ITZA 3H3CA 4NUSA 3H30A 2YA9A 3BYMA 4D1ZA 2UW7A 4AW5A 2O8YA 3QCXA 5A6NA 1SNUA 4AQCA 2CPKE 3I7BA 4M7IA 2WPAA 3H9RA 4MQ2A 3UDBA 5IH5A 3R6XA 1W84A 1JAMA 2XNNA 4G5JA 5K9IA 5AP5A 3CGOA 5KHXA 5DHJA 4R78A 4FV7A 2F7ZE 3Q53A 3DKCA 4CQEA 4RIWB 5G6VA 4BTKA 3BYOA 5FEDA 4EEVA 2ZJWA 2Y8OA 3W2OA 1YWRA 4CFMA 3PVGA 5FXRA 3BX5A 4PX6A 5E92A 4BR3A 5EFQA 4BDDA 3ORMA 4TN6A 3OEZA 2QOFA 2F57A 2VTHA 4JDJA 3ZO1A 4BTJA 3GQLA 1I44A 1WBSA 4K77A 4F9CA 4HGLA 3HRFA 2PUUA 2XEZA 4PNKA 4FL3A 1FOTA 4DEIA 3PXZA 4BDGA 1J1CA 3FHRA 1E9HA 2C69A 1SYKA 2F7EE 4ZSEA 5HGIA 4DG0E 3EQBA 4OT6A 4XH6A 4DFYA 3TV6A 2VTRA 4TTHB 2R3IA 4FEVA 5EOBA 4ORKA 2BROA 2FYSA 3R8PA 3E7VA 4UXLA 4RSSA 5CYIA 4EQMA 2Y9QA 1R1WA 4BDEA 4LRKA 5FP5A 4NM5A 4ZLYA 4J98A 2W1IA 1PXOA 2OIQA 4DGGA 3KXGA 3M1SA 2VTMA 3Q5ZA 5I9UA 1H8FA 3DJ5A 2JDTA 2YWVA 3KXZA 4UWBA 4BTFA 4ZSAA 4OTIA 3QCQA 4UMRA 1O6YA 1BUHA 1Q62A 4AZVA 3MWUA 4QMNA 1PYXA 2QNJA 2LGCA 2PVLA 2IVVA 3ANQA 1PXIA 1XH5A 5EKNA 5IQHA 1VYWA 4MWHA 4Y8DA 3VUDA 3MH2A 5CVHA 1JPAA 1WVWA 3D5UA 4I5HA 3WF7A 3CIKA 3EFKA 3KRRA 4KIKA 5DIAA 3GU6A 4GH2A 2G01A 4ZK5A 2C6IA 3TACA 4PMMA 3ZLXA 1BLXA 4IDTA 4I6QA 4R1YA 5DN3A 2SRCA 4DLIA 5JSMA 3G6GA 3H9OA 3PWDA 5AUXA 4FTKA 2VTNA 4WUNA 4MBLA 3FI8A 3Q32A 3OTUA 3TDWA 3QF9A 5EW8A 3MPAA 3DZOA 4I24A 3GXLA 4WG5A 3BQCA 3FZTA 4ANMA 2VO3A 2JD5A 2WQOA 4C4IA 4EUUA 2YDJA 5JGBA 4BBMA 2ZAZA 3OXIA 1ZY5A 4ASDA 5A4EA 4C0TA 1E1XA 2QR7A 2UZNA 4LL0A 4YPSA 4K33A 4ASZA 1UNHA 2YABA 2IPXA 5EYKA 1YI3A 3WYYA 1L8TA 5ICPA 4FGRA 4O0WA 2YZLA 4O27B 3FE3A 4Z7HA 2UVXA 3W2RA 4FG9A 4HVSA 2XK8A 3B8RA 3R28A 3GFEA 5HIDA 4DH8A 1DAWA 4EORA 3SG9A 1YQJA 4RWKA 2JDSA 3KRWA 2XF0A 3D5VA 2B55A 2QOIA 3ZO3A 2PVMA 5KMJA 4BZNA 4X6QC 4WBOA 5EHLA 4LOOA 3A61A 3NZ0A 4CFUA 3TL8A 1LEWA 4M0YA 4NKAA 3ORNA 1AD5A 1DAYA 2YM8A 3UC4A 2W4KA 2PE2A 2WMTA 1O6KA 4Y85A 1TQIA 2C1AA 2ONLC 2VO6A 4ZLZA 4GU6A 3RPYA 5LWMA 2OK1A 5L2SA 2BFXA 2J4ZA 3I5NA 1OIUA 5AV4A 2WNTA 2YAAA 4CZYB 5M53A 5M09A 4KKEA 3FLNC 5CU2A 5HNGA 1GZNA 3R9RA 1CDKA 3GOPA 3NRMA 4BN1A 3GU8A 3KK9A 2R3LA 2X2MA 4B4LA 4E73A 4O7SA 2YM5A 5I4NA 4FSWA 5AA8A 4DYMA 3K2LA 5JRQA 3TKUA 5DT0A 3ROYA 1XH9A 2QCSA 2R3MA 3FC1X 3BQRA 1QL6A 3C13A 3EIDA 4WD5A 3S2PA 5CSXA 4RIYA 3LZBA 4D9TA 4EK8A 1YOMA 4RT7A 4TYEA 5TOZA 3VS0A 4J95A 4NW5A 3PJ2A 4I6BA 4F6WA 2QOCA 3NNXA 4XP2A 2PZ5A 1S9JA 5AV0A 3LXNA 5HNIX 4F7LA 3D83A 1J7UA 3QRUA 4RWJA 5IA5A 3FXZA 5M4FA 3R21A 3ZRMA 4CLJA 3SA0A 3NUUA 3FDNA 3HMOA 4MXAA 4F9AA 1GZ8A 4M3QA 4CZUA 4YJNA 2OXYA 4AFEA 4L3JA 4RGJA 2OXXA 1YHVA 3IW4A 2QOLA 5CSVA 1VYZA 4IX5A 3R7VA 1YOLA 2Y4IB 3OWJA 4X2KA 3KY2A 3LE6A 4FZDB 4IH8A 4X2NA 4RLKA 5CF5A 2XNEA 1U54B 3F88A 3ZTXA 2R3QA 4DGLC 4RVKA 5IEYA 1ZYSA 2ZDTA 2IZTA 5D12A 5HG7A 3QBNA 3DY7A 4S2ZA 2R5TA 3MTLA 4FV0A 3VUGA 1H01A 1URCA 3R9HA 4C4GA 4RIYB 5DR2A 4ENYA 2YDIA 2VZ6A 4FTJA 3A7GA 4FTIA 2ONLA 4AFJA 3R02A 3HYHA 4FGBA 3BLHA 2W9ZB 4KBCA 3Q5IA 2G2IA 3E62A 5JMSA 5LMAA 5CWZA 5AIRA 5DT4A 2PPQA 3SXRA 1WCCA 4FK3A 4JXFA 4KSPA 4M14A 2ZMCA 5ACKA 2XBAA 3H9FA 3IONA 2B53A 2HXQA 2Z02A 5H8EA 3OF0A 4KWPA 3ZFYA 3O8PA 4ARKA 4X3FB 3ZRLA 2XNBA 3LCKA 2YM4A 3KULB 3NCGA 2C0TA 3HGKA 3OOGA 3RCJA 3NDMA 4ZIMA 4D2VA 3HMPA 2X8IA 4MQ1A 1PKGA 2F49A 3L8VA 2V0DA 3MPMA 2PE1A 2UZOA 3VUIA 4WSQA 5KO1A 3BRBA 3NLBA 3L8XA 2QQ7A 4BYIA 4O81A 5C8KA 3A7IA 4FVRA 4H39A 2OBJA 4LV8A 5FTOA 4EQUA 5IQDA 3AMAA 4F09A 4HPUE 3UQGA 2G15A 4AUAA 4TYGA 3RAWA 3QZIA 4AOIA 4RX5A 1Q5KA 5HCZA 1FGKA 4BDFA 5AAEA 4E4LA 4YSMA 2OI4X 2XIZA 4G1WA 2QI8A 4R3CA 1K3AA 4FTNA 2E9VA 2UVZA 3ORXA 4AU8A 4V0GA 5BYYA 4BIDA 5IH6A 4HYHA 4X2GA 2UUEA 2E9OA 3RHKA 3F69A 3VS3A 3UOLA 4EHZA 1UU7A 1NVSA 4ZSGA 4YP8A 5JK3A 3ZRKA 2XK4A 1H1RA 1XH7A 2XUUA 5L2IA 3HUBA 4FIFA 2EU9A 2G1TA 3AT2A 3PP1A 5E9EA 2JFLA 3SC1A 4I6HA 5M4IA 3QZGA 4YBJA 4YHFA 1VZOA 3E8DA 4JR3A 5EDQA 5CEMA 2WIPA 2HENA 3JYAA 3BHTA 5M51A 1B6CB 5C8NA 5BVKA 4CMUA 1RQQA 3BEAA 2X39A 4CFXA 2GQSA 3LQ3A 3QQUA 4HNFA 3BPRA 4EHGA 3REPA 3NW6A 4L7SA 3OD6X 2J51A 4OTWA 1W8CA 2UZUE 4BCKA 3VAPA 3QD3A 4H05A 3CQUA 3RZBA 2IVTA 4C37A 1HCKA 1M2PA 4XLVA 5HBEA 3ZCLA 3MW1A 4FTMA 5IA3A 5IG1A 4NM7A 2VN9A 5CEPA 4ZZOA 5EM5A 4ZJVA 2R0IA 3OWKA 3RINA 3SW7A 4O84A 4G3FA 3DBFA 5IMEA 4IAKA 4O2ZA 2BDWA 3G9NA 5E8VA 4FV5A 2W1EA 4UMQA 3ELJA 3CPCA 4TL0A 1ZXEA 3DS6A 2QOBA 3ZBXA 5IISA 3C1XA 2YEXA 3DXQA 4ZZNA 3FAAA 1WAKA 1URWA 5KX8A 2WOTA 3VS5A 1YOJA 2WQEA 3A2CA 4B9DA 5FM2A 2XK6A 3EFJA 2WMXA 1M17A 4L01A 1DS5A 1OIQA 4IVAA 4JX3A 3UMWA 3HAVA 4O0SA 3D7ZA 1UKIA 3GUBA 4JAJA 2QURA 4DTKA 3HV7A 4IVBA 4L00A 3AC3A 1PXLA 3AC8A 4GUEA 4JIKA 3ORTA 4S33A 4MXOA 5F94A 4IAAA 4G9CA 3NEWA 2ITYA 4J8MA 2P0CA 4RIXA 3JS2A 3G33A 2H96A 3E3PA 3FZSA 3MH0A 3UC3A 4E7WA 3QQGA 4BYJA 3PY0A 1PXJA 4RPVA 2B9HA 3GNIB 2PSQA 3QC4A 4R3PA 4DINA 3RMFA 3C0IA 2I0VA 2PL0A 3E8EA 5FLFA 4BBEA 3FHIA 4XNEA 4CFFA 2F4JA 2J90A 1SVEA 5LOHA 4JDKA 5EW3A 3PWYA 3FKOA 3CQWA 2P3GX 3BHYA 3QD4A 3Q9YA 4FIJA 4L44A 4WT6A 1XQZA 3PDTA 1WBWA 3D5WA 3H0YA 3HZTA 3NNVA 4ENXA 2UZVA 4JBOA 4WNOA 3E92A 5AUYA 3QRTA 2YIYA 3OTVA 2W99B 3GT8A 3QUEA 2C6OA 5GHVA 4GG5A 3MV5A 4OBPA 4WIHA 3VWAA 1UKHA 3E64A 1NVRA 3EQDA 4L6QA 2WHBA 4DBXA 3IKAA 3QRIA 3UOJA 3VBXA 3LFEA 1VR2A 2XJ1A 1BX6A 4FICA 1REJA 2Q0NA 3PSBA 5KMLA 5D9HA 5JGDA 2PYWA 3BCEA 4QQTA 4IB1A 3R71A 1FPUA 2YHVA 4HVIA 2WMVA 3CTQA 3HUCA 5CLPA 4RIXB 5T68A 4QTAA 4JAIA 4D55A 4YPDA 4Y5HA 5LCJA 4E8AA 1ZZ2A 2XKEA 4CFVA 2REIA 2JKKA 2WFYA 2YDKA 3HMMA 4PDSA 3RBWA 4IZAA 5B2MA 3PSDA 5HIEA 3ULIA 4BDKA 4FTQA 5K5NA 5HVYA 1PYEA 1G5SA 5DRDA 4BI0A 3IDBA 5EI6A 2GTNA 3EOCA 1ZOHA 3LM0A 4K1BA 1W83A 4U43A 3FMNA 1IASA 3T9TA 4NM3A 4XJ0A 3FKNA 5JFWA 5BYLA 4FZFB 2YIWA 1W7HA 3K5VA 2YITA 2OZOA 3QL8A 2W0JA 4XYFA 4QNAA 3ZDUA 4CMTA 1XHAA 4YJSA 1FMKA 1OL1A 2X9EA 2J5EA 2YIRA 3OZ6A 4H1MA 4RFYA 4GT4A 5LVOA 4YHJA 4IW0A 2I6LA 2R4BA 4G6LA 4K18A 4U42A 4QTDA 5J9ZA 4UWCA 4L68A 4FT0A 4Y5QA 3HV4A 4CKJA 3Q96A 3W8QA 5AP2A 3RPOA 4BCIA 4G2FA 5L8LA 2A2AA 3DJ7A 5TR6A 3NYOA 3KXMA 5E1EA 4IC7A 4LV5A 2WMRA 4BDBA 4JBQA 3A60A 4BWKA 4GS6A 2ETRA 4G5PA 3R7UA 1BMKA 2ACXA 3QKKA 4RQVA 2XVDA 3QXPA 4D5KA 4U79A 4FV1A 4D2TA 4FNXA 3UMXA 4FTAA 4CFWA 4DTBA 4EZ3A 4EKKA 4BKZA 4WHZA 5GJGA 3AGLA 3KXXA 4BGQA 4HYSA 5BVWA 4AGCA 5A9UA 2W4JA 2WOUA 4ZZMA 5BQ0A 5CAPA 4ZTNA 3G51A 4OW8A 3PXRA 1H1WA 1PW2A 3F3VA 1W82A 2BKKA 3QKMA 4EQCA 5J79A 2FO0A 3EMGA 3QLGA 4QMXA 4O7ZA 2HWOA 4OT5A 3RNYA 2BHHA 3PRIA 2QG5A 4N0SA 3JR1A 3C4EA 3EZRA 4HGTA 1STCE 4DEHA 5GIOE 4Z55A 2YISA 3MH3A 3QUPA 4YZNA 4CMOA 4CXAA 4DEGA 4O2PA 3KMUA 2PMOX 4FSRA 2VTLA 4PUZA 3FMLA 4C3FA 2Q83A 3QAME 3F2RA 3QYZA 3ORLA 2A1AB 2YERA 3MY0A 4TWNA 4CTCA 5M4UA 2CNVA 3EB0A 1MRUA 2IG7A 2X7FA 4I5PA 2GPHA 4AA4A 5KZ0A 4IACA 4IM3A 3ALNA 3NPCA 3W2SA 2XKFA 4AT3A 2OIBA 2OSCA 3A4OX 2OH0E 3I1AA 3TWJA 2WIHA 1Q41A 4QMUA 3V51A 5CTPA 1OKVA 2QO7A 2OKRA 2PTKA 5A3XA 3FMJA 4PP9A 3BELA 4YJTA 5ANEA 3VRYA 2NPQA 3C50A 4I0TA 1V0PA 3DK7A 4MF0A 4K0YA 3IECA 1Y91A 3LCTA 3TN8A 4DFNA 3HL7A 3UPXA 5KCVA 2HY81 3HDMA 4F7JA 1YXVA 3IGOA 1R78A 5H9BA 4AGDA 4QP3A 5IQFA 3LPBA 2UW9A 1GNGA 4CLIA 5B2LA 1ZARA 4CEGA 3I7CA 4WNPA 5J9LA 4O1PA 2WTJA 3G15A 4BCQA 4AN2A 3DXNA 1Q8ZA 2O3PA 4XV2A 3P0MA 4QYEA 2J0IA 4I93A 4PPBA 4WA9A 3UP7A 3LVPA 3UG1A 1M14A 2RGPA 2ZDUA 4O7YA 3WOWA 3FYKX 4AAAA 5DBXA 4DEDA 1Y8GA 4J96A 3CTHA 5LMBA 1A9UA 2YM6A 4NYEA 4TYHA 5E7RA 4F70A 2Z7SA 3W2QA 4NEUA 4R5YA 3DAEA 4J99A 3EQPA 5DR9A 4UZHA 4EH6A 4KUJA 4FTLA 3NWWA 4X7QA 5C9CA 5BMSA 3TDVA 1XH6A 1IA9A 1WBTA 4ACGA 2IWIA 3ROCA 4DF3A 4J7BA 3SRVA 4BCOA 4RLLA 3LFQA 3QKLA 4L7FA 4BCMA 4RJ7A 4N70A 1XBCA 4YJRA 3ZS5A 4DEAA 5FRIA 5IDNA 4OTFA 4DGMA 3GQIA 5CAOA 4YU2A 4UALA 4F7SA 5AAFA 4RJ3A 5AUVA 3QTWA 5J9YA 2C3IB 3O96A 4CGAA 4NWMA 4ONAA 2YCQA 3ORIA 4IX3A 2WTWA 3A8XA 4O0VA 4CV9A 2VD5A 2W96B 3V8SA 3GVUA 1H0WA 1Y6BA 3DQXA 4MK0A 4JR7A 2R3NA 4FKJA 4M69B 5FQDC 2OH4A 4WNKA 3V8WA 3ZM9A 4QD6A 4F1MA 3D14A 4FVQA 4EBVA 4P2KA 4W4VA 3DBCA 2HZ0A 2RG6A 1UU3A 5BVFA 1SM2A 2CLXA 5HI2A 5K0KA 3TIYA 4BCFA 4KINA 3R83A 4OBQA 3NGAA 5LVMA 3QTSA 3EQCA 4L43A 3ULZA 1H24A 4TYHB 3TV7A 3O2MA 5LQFA 3PRFA 4LG4A 5HLNA 1OL2A 3QXOA 5BUEA 1WVYA 4PMTA 1ERKA 2XEYA 1G8AA 4EOSA 2B9JA 1RDQE 3DDQA 2BIYA 5LVLA 3Q6UA 3FQEA 2BRMA 1R39A 3OHTA 3QZFA 5FBOA 4W8DA 5A4QA 3ATTA 4X2JA 2GHGA 2JIIA 3DLSA 3N51A 3FEGA 3GCPA 3I4BA 3ZXZA 3VF8A 5IPJA 2BAJA 3WZUA 2QVSE 3A7JA 3PTGA 5AMNA 2BAKA 4FKLA 1FINA 3UIBA 4M12A 5AUWA 3HA6A 1JSUA 3M42A 3E7OA 3KMMA 4PV0A 4C4JA 1GY3A 2BAQA 3CD8A 2EVAA 5D7AA 3DOGA 3R9DA 1OM1A 4XS2A 3WYXA 5HU3A 4QTBA 3TUDA 2VU3A 5DA3A 3QGWA 4C2VA 2X2LA 4QMWA 5CY3A 3IW6A 2OGVA 3MA6A 3COIA 3ZO4A 5EW9A 4J1RA 4A9SA 4AZTA 3EQHA 2CMWA 3BU5A 2R7IA 4E5WA 2XK3A 2X7GA 4MNFA 4RG0A 3G90X 2QLUA 4EH4A 4ZLOA 1IAHA 3QYWA 4YTFA 2PE0A 4O0UA 3SVVA 4C59A 4NW6A 2BILB 2BMCA 4UN0C 4RJ8A 3ZMMA 5AR4A 2Y4PA 3SQQA 4DHFA 3HECA 4D2PA 2A27A 4FIHA 3TKHA 3AC5A 2QOHA 4FMQA 4LGHA 2C6DA 3R30A 4MX9A 2YACA 3MS9A 4ZTSA 1U59A 2ITVA 2ITPA 2R3GA 4EOJA 3R8MA 4RC2A 4I0SA 2WKMA 3NNWA 3ERKA 2R0UA 4W4YA 1P5EA 4HJOA 2VNWA 3LCDA 2JKQA 1CKPA 4E5AX 5EYDA 3VVHA 4U40A 3HA8A 5CXHA 2QU6A 4WG3A 2R7BA 3C7QA 3OVVA 4YJUA 4O7TA 4IAFA 5AR8A 4EHEA 1R0EA 5DR6A 4E5BA 5EDPA 1FGIA 4AXAA 2JAMA 4CYJA 4C36A 4Z9LA 4MH7A 1YVJA 2WTKC 2BDFA 4FT7A 2VGPA 2B1PA 4R5SA 3QWJA 2VAGA 1RW8A 2YM3A 4FT5A 5HO7A 5TF9A 3WF5A 1F3MC 3LW0A 3R63A 4NSTA 4AGUA 3LFCA 5EYMA 3U9NA 2CSNA 5IUHA 3E63A 5EM6A 1KUTA 1H08A 1NXKA 4YTCA 3V5LA 4FNYA 5ANOA 4PTCA 3KCKA 4DH7A 1U5QA 3ORPA 5AUZA 4AN9A 3NUPA 4APPA 2QOKA 3ZFXA 1KE7A 4LUDA 2G2HA 1F0QA 3FPQA 4F6UA 2YIXA 2PY3A 4G17A 4F4PA 5IUIA 2WB8A 1CKIA 1XO2B 5ANJA 4ACDA 3KXHA 1U4DA 3JXWA 4MEDA 2V22A 5CAVA 3GCQA 2WTIA 3FSFA 5HE0A 2Z7RA 3NR9A 3NUNA 4USFA 4NT4A 5GZ8A 3T3VA 2CNUA 1YW2A 2GS2A 5CI6A 4MBIA 5JKGA 3ZSGA 2JLDA 1IR3A 5A4LA 3D2KA 3B8QA 5EM7A 5AR3A 2CKPA 5I3OA 2VX1A 1EH4A 3HP5A 3E88A 4A4LA 5KKRC 2Y7JA 2X7OA 3KREA 4FT3A 1Q4LA 4PDPA 1OKZA 2PVYA 4FG7A 5KZIA 4DFLA 5L4QA 2GU8A 4OTPA 3LAUA 2B9FA 5L6PA 3GP0A 2IJMA 4BI2A 3W16A 3LFDA 3KRLA 2FUMA 4B8MA 5EHOA 1Y8YA 2GNJA 4HVGA 3MIYA 1OPLA 3NYVA 4DA5A 4FEUA 3A7FA 2PMNX 5FDXA 3UIUA 3P08A 4J71A 4I1ZA 3Q6WA 2VX0A 4LYNA 3UQCA 3NSZA 4KBAA 4R77A 4HNIA 4DH5A 2V7AA 3LFNA 5E4HA 3MBLA 4BZOA 4F6SA 4NM0A 3EFLA 3PY3A 4TXCA 2C4GA 3VBWA 4J53A 3BU6A 2HZ4A 2YCFA 4NCTC 5GINE 1KE9A 3W10A 4ALUA 4X3JA 5C8MA 3W33A 4W4WA 4FKSA 4W9WA 3QRJA 4RBLA 3U6IA 3A99A 3RZFA 5GJDA 3P7BA 2IO6A 4BBFA 4UV0A 4KIKB 5IQGA 3PE2A 4ZY6A 3TNQB 5C01A 2VWYA 4BKYA 3C5IA 4O86A 3OW4A 4KB8A 4YZCA 5EDRA 5G1XA 5IQBA 5TE0A 2AC5A 2W1CA 4QMVA 4IVDA 2O5KA 4EWQA 2VUWA 5HD7A 4DFBA 3QUDA 5HO8A 5AP0A 2UZLA 4R7IA 1V1KA 3MFTA 4I41A 1OL5A 4XHKB 5H2UA 4E4XA 2VWZA 3BGZA 4HPTE 3VUHA 4DN5A 5IA0A 5LJJA 3S0OA 3C4FA 5LVNA 5FWKK 1YXSA 5BYZA 5I9WA 4QMPA 3TUCA 3VS6A 4K9YA 4Z3VA 4FSMA 2J9MA 1AQ1A 1KWPA 2XYNA 4S31A 3HAMA 3G0FA 2ITQA 1OMWA 2BIKB 2GNGA 3DBDA 1PHKA 4IDVA 1FBNA 2GDOA 5KHWA 4QPMA 4XG4A 4C02A 4PP7A 2W1FA 3L9LA 1T45A 4UY9A 4E1ZA 1B38A 3A62A 4OAUC 4UMUA 3QQLA 4ITJA 3SV0A 1IA8A 3MVMA 5BX0A 3E93A 4O0TA 3NYXA 3U6JA 1ZOEA 5FP6A 2BZHB 3PIZA 4YURA 3VQUA 4DE4A 2XCKA 4YZBA 3WF8A 1PRYA 4TYJA 3VUKA 2V5QA 3AC2A 4ANLA 1XH8A 4O6LA 4C38A 3VC4A 3NUXA 4DCAA 4FTCA 5IQEA 2PUPA 3U51A 3LHJA 3R8VA 5CU0A 4ACMA 4EC9A 2JKMA 3QHWA 4JBPA 3DKGA 2H6DA 4RX9A 4U44A 5J8IA 3KRXA 5AV3A 2P55A 4IEBA 4H3BA 5K3YA 3GC7A 4DCEA 3E8NA 2XCHA 4JDHA 1TQMA 4G16A 4TNDA 3WE4A 4DLJA 4ZTHA 1ZMWA 4C4EA 2NNWB 2BDJA 2IW8A 2PUIA 2YWPA 2CCIA 3BBWA 3U87A 4O1OA 2UW5A 3PJ8A 4MXXA 3U8WA 2GHMA 5EK7A 3BV3A 5K4JA 4XG9A 2QKRA 3O23A 3V04A 3R2BA 5IA2A 2Z60A 1DM2A 1PXKA 4CT2A 4RFMA 4A9RA 3OUNB 3PPKA 1IRKA 2ERZE 2YJSA 4MD9E 3ZC5A 5ETFA 3VNTA 3Q4CA 5HTCA 2EXCX 2YCSA 2ZV8A 4AW2A 2NO3A 5HOAA 1A06A 1J1BA 3LJ1A 1XKKA 3W2PA 4XUFA 2Z7LA 4BCJA 5AP6A 4D58A 5D10A 2OZAA 1JLUE 1YRPA 4YR8A 4U81A 4QMOA 3GI3A 2HELA 4DT9A 4BIEA 4YZMA 1JOWB 2XM9A 2QC6A 2QKWB 5BVDA 4U45A 4P7EA 4C62A 4XG6A 3QD0A 3HEGA 1O6LA 4PQNA 2DUVA 3C9WA 4N4SA 4DFUA 3BHHA 2R9SA 3PYYA 2JIUA 2VWBA 4MWIA 3P9JA 1QMZA 2XMYA 3R1YA 5CEOA 3RWPA 5H8GA 1CKJA 3EL7A 5DE2A 1XWSA 2XYUA 2V7OA 1YI6A 3FLQA 5EQYA 4DITA 1BL7A 4M84A 4YTHA 4G3GA 2CHLA 2XS0A 3PXKA 1Q3DA 5JEBA 1JQHA 4YLLA 3P79A 4EH8A 2RL5A 3ZEWA 2C6MA 5IA1A 3DU8A 3HP2A 1Z9XA 2C6LA 5F4NA 1R0PA 5DVRA 3TIZA 3NUYA 3TTJA 4F63A 5HVJA 4ALWA 3F2AA 4AT4A 2HY0A 3V5PA 4C34A 4D28A 4QRCA 2B9IA 4A9TA 4BDHA 5HG8A 3UO6A 3HVCA 4IB5A 1JKSA 3W18A 3UODA 4P5QA 3RALA 3VUMA 2F2UA 3DB6A 2BVAA 4XV1A 4XV3A 5T6KA 3ZO2A 3Q9ZA 4LUEA 4EJ7A 4FNWA 3PA3A 2UZWE 4BGHA 4DTAA 2I7QA 3KB7A 4FV2A 2XIRA 3AD6A 4YZDA 3PLAE 2WU7A 4PMSA 4WUAA 4DG3E 3FMDA 3U54A 3FXXA 4NKSA 3G5DA 3WF9A 3RP9A 2B54A 4CKIA 2IZRA 3EFWA 4IM0A 3DQWA 4I5CA 3C51A 4M0ZA 1WMKA 3O0GA 4XX9A 5DT3A 3UYSA 1P2AA 1T46A 5CASA 3QLFA 3W2CA 4FUYA 5HEZA 5CF4A 4P90A 3V01A 2XA4A 2WMBA 3CGFA 4QTEA 5J5SA 5I3RA 1W0XC 2FVDA 5HD4A 4O7VA 5EQPA 4CQGA 2R3HA 2VV9A 3FC2A 3JY9A 4ZJJA 1GZKA 3VS4A 3F3TA 2PVRA 4FG8A 4FEQA 3FL5A 1J91A 4IJPA 1XH4A 2ITXA 3MGYA 3RWQA 3Q4UA 3HV5A 3PY1A 4FSNA 2VTQA 1PXMA 1JNKA 4JOAA 1Z57A 4FL2A 2FGIA 3QX4A 4XBUA 5F20A 4V0GB 4D2WA 3G6HA 5HTBA 2ITUA 3F66A 5DRBA 3PPJA 3HRBA 1XR1A 4GT5A 1WBOA 3CE3A 5CX9A 3U55A 3FL4A 5C1QB 3CC6A 1J7IA 5GIPE 4WRGA 3AC1A 3FMEA 2JIVA 3D2IA 3KC3A 3FZPA 1PKDA 1QPEA 3WE8A 2XBJA 4FKIA 1V0BA 1Z5MA 2GCDA 3QWKA 4E93A 4KAOA 5J7BA 4AACA 5L2WA 2VTOA 5E8XA 3VBQA 4CD0A 4EI4A 4NL0A 4H3PA 3D4QA 2C6KA 3O50A 3R0TA 2BCJA 3VBTA 4ZMFA 3W32A 3S00A 1WFCA 4X2FA 5DI1A 3TI1A 1OVEA 4AP7A 4LQMA 4MTAA 5DPVA 1M2QA 4DGNA 3ALOA 3FBVA 4G6OA 3AD5A 1VEBA 1H00A 3DKFA 3K3IA 1ZRZA 3MSSA 4TW9A 4BGGA 5HBJA 1GJOA 4G9RA 5K0XA 3R1NA 3VULA 3S3IA 4ITIA 2XJ0A 5HVKA 4YTIA 4GK2A 4QQ5A 4L9IA 4QT1A 4AZEA 2A19B 4EOQA 2RKUA 4ANOA 2WQMA 1MRYA 2YN8A 2ZYBA 3GU5A 1G8SA 4O7LA 4IAYA 4TT7A 1ZY4A 4YO6A 3E8CA 3VJNA 5IEXA 4Q5HA 4OTDA 5IQAA 2JGZA 3LFBA 4LFIA 4GVJA 3CP9A 5ETIA 2BTSA 2C3LA 2WTDA 1ZAOA 3LQ8A 3NUSA 4YZ9A 5B2KA 4HOKA 4FX3A 4EZ7A 3UGCA 4GFGA 4IAIA 1LPUA 2PHKA 1JSVA 4MF1A 4MYGA 5EOLA 3I81A 2OXDA 2VWXA 2ZOQA 4FYOA 4JIAA 3PXYA 4QMMA 2GNFA 2JKOA 3UJGA 3RCDA 3SXSA 4D1SA 1OIYA 3IW7A 5I9XA 2GS6A 4UXQA 4UYAA 3T9IA 4MD8E 3VUTA 4AGWA 1YHSA 3I6UA 2ZVAA 4I4EA 2PVNA 3F5XA 3Q04A 5L2TA 4FYNA 5LVPA 3WBLA 5IKWA 5FTQA 4NIFA 2YM7A 5J7HA 4AW0A 2E9UA 2ITOA 1OBGA 3I0OA 4L52A 1OBDA 4KKHA 3QRKA 2GSFA 5DYJA 1OKYA 4ID7A 4EOPA 4BL1A 4F1TA 4U9AA 4F99A 4CG9A 3TCPA 3MESA 4Q5EA 5KBQA 5AR5A 3LKMA 3PSCA 3AC4A 2OJ9A 2QOQA 1KE5A 4UX9A 3EN4A 4H58A 1SZMA 4C35A 4EWHA 4YLJA 1F5QA 2RG5A 4E20A 5L2QA 2WGJA 2UZBA 2X4FA 4D4YA 4EZ5A 4PPAA 4RA4A 4FSUA 4AZWA 5AFVA 5CT0A 2CKQA 3QTQA 2BZJA 4FTOA 4GK3A 5ANKA 5FUTA 3R01A 3LLAA 4MHAA 5IUGA 2VO7A 3QQFA 4FOBA 3PP0A 4L8MA 4Y73A 3COKA 4LOPA 5BVEA 3RPRA 5KMNA 4FV8A 1L3RE 1WBVA 4C8BA 1J7LA 3SAYA 4BRXA 5JH6A 1NY3A 3JY0A 4KKGA 4FKQA 5BVOA 1REKA 4NTTA 3DK3A 4TWPA 3WIKA 3CTJA 3EWHA 4LM5A 4FEWA 4D4SA 1YDTE 4IWOA 4D5HA 3EN9A 2C6EA 5KBRA 5AWMA 2QO9A 3KK8A 5IF1A 3CBLA 3NX8A 5CQUA 4WNMA 2F2CB 3S95A 5FD2A 1LEZA 5JN2A 2GFSA 2WMWA 2VGOA 3UG2A 1ZMUA 3ZUUA 4HCVA 4LOQA 4BDAA 2PVKA 2KTYA 2I0HA 5CAQA 5EM8A 3FWQA 4I6FA 4B6LA 5IA4A 2WMUA 2X8DA 3OOMA 2WZJA 3UIXA 4IZ7A 3UOHA 1DI9A 1FVVA 4U6RA 3OY1A 3BBTB 4BIBA 3DNEA 4EK4A 4B8LA 2YCRA 3MI9A 4WO5A 2DWBA 2EWAA 2HZIA 3VS2A 4D0WA 4HVDA 2C0IA 5DFPA 3C0HA 4EL9A 5CF6A 1Q8YA 2VTJA 4K2RA 2J6MA 2VTTA 1UNLA 2PMLX 2PZPA 3Q52A 3QCYA 3QTUA 1YI4A 4HGSA 4QP2A 2OF4A 3M11A 4QO9A 1KSWA 4I4FA 4EH2A 3GGFA 4K8AA 4OTGA 4LMNA 4FE2A 5KMOA 4U0IA 3F3ZA 3F82A 3U9CA 4DBNA 2X4ZA 3F61A 2I40A 3WIGA 2A0CX 3VF9A 3OCTA 1QPJA 1U5RA 2OFUA 2XB7A 4FKRA 4JG8A 4W8EA 5DMZA 3C0GA 4F0FA 5EI2A 2P2HA 3NMUF 3PVBA 4XV9A 3AOXA 2JITA 2YLFA 3DB8A 4HYIA 1Q8WA 3K3JA 4IC8A 4F9YA 2BPMA 5JZNA 4TZRA 1YKRA 4IVCA 4BDCA 4D4VA 4L3LA 3UPZA 1H0VA 4HCTA 2QHNA 3HLLA 5IDPA 4GSBA 5AEPA 4NJ3A 3BYUA 4RJ5A 4ALVA 4IMYA 2OU7A 5HORA 3F6XA 4MXYA 2EB3A 2JAVA 5E91A 2Y6OA 2QLQA 1QPCA 3RM7A 1UU8A 4QYHA 5AP4A 1BL6A 3ZSIA 4EYJA 3KFAA 2JBOA 4JRVA 1H27A 4DT8A 4ZTQA 5D11A 3TZ8A 1OITA 2UW3A 3ODYX 5CF8A 2FSOX 3QD2B 1GOLA 3GU7A 4W4XA 3BIZA 3L9MA 4GT3A 4PNIA 3VHKA 3W55A 1MQBA 5JFVA 2C0OA 4IWDA 3VHEA 2PZIA 2VWIA 3GBZA 4A9YA 1M52A 1V0OA 3EYGA 2HK5A 4O0YA 4ZEGA 1ATPE 1CTPE 4YNOA 3KMWA 1LP4A 1PMVA 3FI4A 3ZLWA 5AA9A 5JZJA 1RJBA 2CNQA 3OY3A 3BE9A 4GJ3A 4LI5A 4KABA 5E8YA 2YLEA 2P33A 5T3QA 3SDJA 3SG8A 2P4IA 2W5HA 3D5XA 3DXPA 4FZ6A 5HBHA 4YBKA 1A48A 1VJYA 1OZ1A 2YFXA 4H36A 4OR5A 3OBGA 3EQGA 4G31A 4GW8A 4X21A 3F5UA 3SGCA 3AQVA 2QG7A 2VX3A 3COMA 4MXCA 4OBOA 3CPBA 4DG2E 3QZHA 4BDJA 2BZKB 3FY0A 4ANSA 4ZMEA 3TG1A 5IH4A 2IVUA 4FTTA 4XG7A 4M97A 4MNEA 2XP2A 4I5MA 5AM7A 1KE6A 4Q9ZA 2QR8A 1Q61A 1R3CA 3UZTA 5AP7A 3TV4A 3KU2A 4G34A 3D15A 3MVJA 5CU3A 3ID6C 5IQCA 2PMIA 3DCVA 3LFSA 4F0IA 4KS8A 4FSTA 3R8LA 1H25A 2EB2A 2XH5A 5F9EA 5E8SA 4LRJA 4FSZA 1NT2A 2HCKA 4RZVA 4BICA 4PPCA 3H4JA 4ZY5A 3P23A 2I0YA 4QYGA 3ZUTA 3ZZEA 3GFWA 4EONA 3KCFA 2YJRA 4KS7A 3TM0A 1J3HA 4PRJA 5HIBA 4JG7A 1FMOE 4NFMA 3HDNA 3D9VA 5CSHA 4BHZA 5EH0A 4E6AA 4QMQA 4EUTA 2Y0AA 3IS5A 4QYFA 4AW1A 5L3AA 4RIOA 1YWNA 4JI9A 3U4UA 4IBMA 5BNJA 1PY5A 2GNLA 5AUTA 3QTRA 3BWFA 3SRVB 3SKCA 3R8UA 4YHTA 3UP2A 4CYIA 5LWNA 4BF2A 3ZC6A 4F64A 5DNRA 4ZSJA 4GVAA 4U97A 2ITWA 4HVHA 4BHNA 5LXMA 2J50A 4BWPA 1H26A 4BCPA 4TWCA 1UU9A 3P7AA 5A4TA 5FTGA 3RAIA 4GMYA 3RPVA 4RIWA 3M2WA 2GNHA 4RVLA 2ZV9A 4AT5A 4XG3A 1APME 4I21A 5CXZA 3HV3A 4XLIA 3MA3A 4U5JA 3LXPA 4MAOA 2GMXA 4FSYA 5AUUA 4BCHA 2XNPA 5A46A 4YUQA 4G6NA 4FZ7A 4JT3A 5DH3A 4M66A 5E8ZA 3RPSA 4FT9A 4I3ZA 3AMBA 4ZS4A 2ZV7A 2W06A 3GCSA 4PY1A 4TNBA 1XJDA 4OUCA 3HKOA 3QGYA 5CU6A 3CLYA 4OLIA 3RHXA 4AOJA 4QMSA 1XBBA 4FV6A 3FZOA 4S34A 4TKSA 3EN5A 5AIKA 4FBXA 4UZDA 3R7OA 2HIWA 3AGMA 4IZYA 4NJDA 2E9PA 1TVOA 3PXQA 4EOOA 3FMKA 2PWLA 2VTSA 2WU6A 3KKVA 1MP8A 4LGDA 4YLKA 3VN9A 3BGPA 4RQKA 2GHLA 3OXZA 5HX8A 3TUBA 3PA4A 3JUHA 4O7NA 3E5AA 5FXSA 2VNYA 2V55A 4KRCA 4XRLA 3KL8A 3VO3A 4IZ5A 2VTAA 3NCZA 3P5KA 4O82A 4GJ2A 2WTCA 3ZLSA 2R3FA 4IADA 4RJ4A 2OF2A 4IWPA 4A07A 2IVSA 5IZFA 2XRWA 3R04A 4QTCA 3CR0A 2BR1A 3QTIA 3EL8A 3U6HA 5IQIA 3DV3A 3NAXA 1CMKE 4JQ8A 4WBBB 3LCOA 5F95A 3F5PA 3I60A 2BKZA 3ACJA 3DGKA 3PG1A 4K11A 3OG7A 4USEA 3UNKA 1ZYLA 3FUPA 1K2PA 3V3VA 3UNZA 3VRZA 4E6DA 2UW8A 4AE9A 1GIHA 3O8TA 4GFOA 5AR2A 3DTWA 2WELA 3FV8A 4N6YA 3DAJA 3OWPA 3DNDA 4AS0A 4IB0A 4BKJA 4EOIA 4FTRA 3GEQA 4QP9A 5JGAA 4P4CA 3CJGA 5IEVA 3LM5A 1PXPA 4ACHA 2QONA 2BALA 3V5QA 4N6ZA 1TQPA 2CN8A 3ZM4A 4V04A 4DH3A 3MY1A 3HMNA 2FA2A 3UNJA 3DFAA 1H07A 3R7GA 2B7AA 4DAWA 2UZEA 2XKDA 4XCUA 5HESA 1JWHA 2J0MB 4PL3A 4KA3A 3F3WA 2Y4IC 2PK9A 4S32A 3I5ZA 4I92A 2JDRA 4FC0A 3SOCA 3AG9A 3BWJA 4DC2A 3EQIA 2JDOA 1GIIA 1NA7A 2R3RA 1OPKA 3MFUA 4GUBA 4O6EA 4RVMA 3RVGA 4AE6A 5HTIA 3F9NA 1P4OA 3QU0A 3FY2A 4ZP5A 1Q99A 3TT0A 4IHPA 3UIMA 5ETCA 3IGGA 3QALE 4C33A 3LJ0A 3MVHA 4WSYA 2BRBA 3GCUA 2ERKA 3B2TA 2ESMA 2YIQA 4KIOA 4ANQA 4IFGA 2R64A 3EQFA 4JBVA 2HOGA 3KN6A 4ZJIA 4BCNA 1WVXA 4IAZA 4PDYA 5K4IA 3THBA 4U7ZA 4U8ZA 4JRNA 2XNOA 3HRCA 4PTEA 2RFDA 4ANBA 2E2BA 4FTUA 5FEQA 2QODA 3ZSHA 3BKBA 2VO0A 4FV4A 3UO4A 4KRDA 5A6OA 2Y6MA 5HU9A 4P5ZA 3EN7A 1UVRA 3ACKA 2RFNA 2C1BA 3ETAA 3GC8A 1UWHA 5C27A 4M8TA 1QCFA 2V62A 4IJ9A 3UVRA 5HLPA 2J5FA 4EH5A 4ASXA 4YMJA 1M7QA 4QQCA 4QPAA 2X9FA 3FLWA 3PZEA 4F0GA 4AZSA 4QQJA 4X3FC 1JKLA 1ZYJA 4YC3A 3R22A 2OWBA 3PA5A 3EZVA 3N4VA 5BPYA 4C57A 3NIZA 2EUFB 3F2NA 4RC3A 2OG8A 2ITTA 4LRMA 4JG6A 4PL5A 3SLSA 2RFEA 4O7RA 2BFYA 1PMNA 2KULA 4F1OA 4R8QA 3KEXA 5AV1A 5L6WL 3QQKA 3IOPA 4FUXA 3IQ7A 3B2WA 4ERWA 3ENHA 4QMYA 4EBWA 5K5XA 3OCGA 4O21A 4BFMA 5C4KA 3WZKA 1Y6AA 1KV1A 3KXNA 3O71A 4MBJA 4C4FA 2QO2A 3OXTA 3DT1A 3ZYAA 3MJ2A 3F3UA 4IM2A 4A7CA 4BTMA 4PL4A 3L8SA 4MVFA 4YJPA 1H4LA 2RF9A 1M7NA 4KNBA 1CM8A 5HG5A 3ZBFA 5TO8A 4C2WA 1U54A 4IB3A 5JRSA 5AAGA 5FBNC 5KMIA 2C5VA 5TT7A 2ZM4A 4EC8A 4X0MA 2W1DA 3NW5A 2WTKB 1Q3WA 3PIXA 5HCXA 1YXXA 3RNIA 1KOAA 3I79A 3VJOA 4GIHA 4ASEA 3R1SA 3VBYA 2VTIA 3PXFA 4OGRA 1UV5A 5TKDA 5LMKC 4BWXA 3E87A 4H1JA 3LJ2A 4YO4A 1I09A 3ZOSA 1FVTA 2Z8CA 2PVHA 3P86A 5CZHA 4FNZA 3MVLA 5I9YA 3MY5A 2J7TA 4RJ6A 3UOKA 4GKIA 3FQHA 5A54A 3DBQA 3OMVA 3BLQA 4ZSLA 3SD0A 4B7TA 3KA0A 1Q24A 2XNMA 4NCTA 4J8NA 2C3JA 2ITZA 3CEKA 5HE3A 3OCBA 4RA5A 3RAHA 2GTMA 3FZRA 3H10A 2BRNA 4XMOA 5CVGA 4BCGA 4CRSA 3RAKA 3UVPA 1M2RA 2GFCA 1JSTA 2J0KA 3K5UA 4Y46A 5CZIA 4X3FA 4NZWB 3RKBA 3SW4A 3RJCA 3LIJA 3N9XA 3ZFMA 3KULA 3GU4A 4D4RA 3QTZA 2FSLX 1YWVA 4EYMA 3KGAA 3FQSA 4QP7A 3KVXA 3OW3A 1ND4A 4EH9A 3UVQA 5KKRB 5DEWA 3KQ7A 4M68A 1B39A 3ODZX 4H3QA 5CALA 1KV2A 3LCSA 3MFRA 2ZM3A 3EJ1A 5CANA 3POZA 2WTVA 4PTGA 3EYHA 2C5YA 2HWPA 2JC6A 2X0GA 4ZOGA 2W4OA 5A4CA 1S9IA
chains in the Genus database with same CATH superfamily
2IZSA 2W7XA 3ZLYA 5J87A 2VRXA 5KMKA 3S1HA 3UO5A 4RC4A 2DYLA 5B0XA 3TKIA 4EK3A 5I0BA 1O9UA 1YXTA 2J0JA 4ERKA 1MQ4A 3ZONA 2AUHA 5L8JA 4EH3A 1UA2A 2WEIA 3KVWA 4CCBA 3SX9A 4CG8A 4GIIA 3O51A 1GAGA 3PFQA 3R2YA 1DI8A 2R2PA 3ET7A 4R7BA 3O7LB 3LXLA 4UB7A 2C47A 5M07A 4YJQA 1P4FA 5LARA 2ZV2A 3OC1A 1JVPP 2H34A 4FIEA 4A06A 3FLSA 5I9ZA 2O65A 2CGXA 2C68A 2DQ7X 2NRYA 4MXZA 3I0QA 3QCSA 3FSKA 4E3CA 3CD3A 5LMKA 2X81A 3IOKA 5CAUA 3RK7A 5DG5A 5CNNA 3HV6A 1HOWA 3MN3A 4AWIA 3IW8A 1IEPA 1JBPE 2CGUA 4DFZE 4DEBA 4D2RA 3WZJA 4GFMA 2C5XA 2XM8A 1SMHA 2J2IB 2XIKA 3DTCA 1ZYDA 3FI2A 5AP3A 2WQNA 4QP4A 3K54A 4V05A 4GU9A 4E26A 4MUQA 3FLZA 4Y83A 4NH1A 5FM3A 2XIYA 2BUJA 4FKUA 5M57A 4O83A 3V5WA 3NFFB 3O17A 5BMMA 2RSVA 4OTHA 3DK6A 4IFCA 3PJCA 2OZAB 3C4CA 3ZHPC 4RVTA 3BYVA 2X0OA 3IK3A 3WI6A 2NRUA 2X2KA 1H28A 2BZIB 3FLYA 3WARA 4F65A 2BRHA 3V6SA 3Q2JA 5HCYA 5H8BA 3EN6A 3EKNA 3IDPA 3OEFX 5FDPA 5IMXA 5E8WA 4JVGA 4EK5A 3ATSA 4FKTA 2BHEA 4F9WA 4I23A 3TZMA 3OROA 3DJ6A 3L9NA 5DEYA 2I0EA 1NW1A 2YZAA 4FL1A 5F1ZA 5GJFA 5J1VA 2PUNA 2W5BA 5GNKA 4E6CA 2HXLA 4KBKA 3Q9XA 5H3QA 4RRVA 2PVFA 1PMUA 4ZTLA 1RE8A 5C26A 5J5TA 3TTIA 3BGQA 1ZZLA 3W1FA 1G8KA 4Q2AA 3RI1A 2UW4A 4IXPA 3R7EA 2C5OA 3GB2A 4GL9A 4R3RA 4JL9A 4Z16A 5M06A 5M44A 2O0UA 2VWWA 2YAKA 3EHAA 4O96A 4QNYA 5CU4A 3P78A 4FJVA 2CDZA 4XRJA 4M13A 5FG8A 3RM6A 4GYIA 2EXMA 3RK5A 2IN6A 3HNGA 3LQ5A 2PULA 5AX9A 4O4EA 4UMTA 3CXWA 3PZHA 5AV2A 5BVNA 2X6DA 2UZDA 3ORZA 4IX4A 4CZTA 3MDYA 5DOSA 3UTOA 2UW0A 3QA0A 4B99A 4NFNA 5CVFA 2WXVA 3R73A 5B7VA 3AD4A 3L8PA 1AGWA 3FZ1A 4PMPA 2ETKA 3IG7A 5LCKA 5CENA 3LFFA 4DH1A 4XOZA 4OTRA 3HX4A 1OGYA 4FIIA 3BI6A 4LL5A 4GK4A 4FK6A 3FI3A 5GZAA 3LXKA 3PVUA 4EOKA 4O38A 5EYCA 3OP5A 3VS1A 2HW7A 5IU2A 3UZRA 3L1SA 4G3CA 4TPTA 3FYJX 2FH9A 1ZWSA 5ACBC 4E4NA 4FEXA 1H1PA 3V5TA 3DBEA 3OFMA 4FF8A 4WOVA 3BEGA 3F5GA 5ANGA 5HHWA 3A7HA 2WMQA 2B4SB 2OFVA 2Q0BA 1TKIA 4GRBA 4IX6A 4Q9SA 4QPSA 4XP3A 3SXFA 3WILA 5EQEA 3F7WA 2HYYA 1SVHA 2OJIA 4AN3A 2XK7A 3HMIA 4CNHA 3POOA 5HNBA 3GCVA 2XK9A 1GZOA 3JPVA 4AAYA 4CT1A 2WQBA 3IPHA 3Q2MA 2JFMA 3UZPA 4KSQA 3FXWA 1ST0A 4ZXTA 4RZWA 1JKKA 2ZB0A 4O0RA 4QMTA 4RWLA 3AT4A 2W1HA 3PUPA 2F9GA 3R7IA 4EOMA 3CJFA 3R00A 3PPZA 4IIRA 5DWRA 3TJDA 1IAJA 3LMHA 5E8TA 3BE2A 4OTQA 5M08A 5D7VA 2UZTA 3RTPA 3PE1A 3GC9A 3VS7A 2OLCA 5HG9A 3V5JA 3R7YA 4J97A 4K6ZA 1Q8UA 4FV3A 3O7LD 4XBRA 1Q97A 4UEUA 3TXOA 3OBJA 5CSPA 3VW6A 3C4XA 4I22A 4PF4A 3TNIA 2G9XA 4LMUA 3FMMA 3MB7A 2O63A 3NYNA 3VW8A 4Y95A 4AF3A 2W5AA 4JNWA 4NTSA 1W98A 4D9UA 4AX8A 4NK9A 5CS6A 4LDTA 2EXEA 3EKKA 1KOBA 4XP0A 3MYGA 4ZS0A 4MKCA 4YNEA 4DFXE 1OPJA 1E1VA 3LMGA 2XZSA 5L8KA 2OJGA 3IW5A 4HYUA 3LLTA 5CT7A 4AZFA 5HICA 3V8TA 4ZTMA 5KMMA 3TZ7A 3DKOA 3JVRA 5AP1A 4HCUA 5M55A 5E90A 1G3NA 3MPTA 4B0GA 2Z2WA 4O7WA 2XIXA 3ZU7A 4CKRA 5FXQA 3NW7A 3OT8A 4AG8A 4U3YA 1U46A 3IDCA 1MUOA 4R7HA 3NAYA 1BYGA 3FPMA 4W9XA 4QP1A 2CLQA 4EHVA 3CY3A 3ZUVA 1OUKA 3W0SA 4U80A 2BRGA 3QQHA 4UBAA 4HW7A 1SVGA 1BKXA 5EKOA 4BC6A 4CV8A 5AR7A 2ZB1A 3ORKA 4BVUA 1PMEA 2AYPA 3C5UA 4JS8A 5CEQA 4CFNA 4GKHA 3QX2A 4FRFA 2AC3A 5J95A 3N4UA 4F9BA 2JDVA 3Q60A 1UWJA 4BY9E 1PJKA 4G3EA 4FVPA 4II5A 1OI9A 4NIFB 2OJJA 4R1VA 3R9OA 4KIPA 3I6WA 4QOXA 4FOCA 2O64A 4IWQA 5JFXA 3NVMB 3O8UA 5C4LA 4A9UA 5D1JA 5AX3A 4V01A 4YSJA 5HKMA 3TNHA 3MJ1A 2HAKA 4ZTRA 2HZNA 4DEEA 2CCHA 4CVAA 3NVKI 2R3JA 5DLSA 3TJCA 5HLWA 3MH1A 4GV1A 2PU8A 3PIYA 3GC0A 4FKPA 3GOKA 2X8EA 3A4PA 4L53A 5M4CA 4FSQA 3KN5A 3D7TA 4QMZA 4LGGA 3OWLA 4C3PA 1PXNA 4DHZA 4HGEA 2GQRA 5JQ8A 2R3KA 4FV9A 5EG3A 4D2SA 3ZDIA 2G2FA 3ANRA 4RX7A 2XALA 2GQGA 3JVSA 4QMLA 4YC6A 5E1SA 3R9NA 3UE4A 3SOAA 3ZZWA 1OGUA 4ZAUA 3IO7A 4FKWA 4ACCA 5JT2A 4JLCA 1H1QA 4M67A 3VIDA 3QQJA 4PWNA 3NIEA 4YJVA 3WZEA 4EH7A 3NUAA 3G0EA 4RMZA 4Y72A 4YGAA 1YHWA 3LMIA 3OS3A 4GYGA 4R6VA 5ANDA 4JMQA 4O4BB 2OO8X 1OECA 4S30A 3Q9WA 4XG8A 1OL7A 2WO6A 1K9AA 2JBPA 3PJ3A 4HZRA 2LAVA 3NNUA 3U4WA 3OCSA 3QTXA 4FKVA 3W8LA 1ZMVA 4N57A 2QHMA 2B0QA 3MTFA 4JQEA 3P7CA 4MD7E 5D41A 2CGVA 2Z7QA 4FI1A 4PDOA 3DFCB 3P1AA 3MFSA 2F7XE 2O2UA 4ITHA 4QP6A 3TEIA 2X0QA 2OICA 1OKWA 1QPDA 3WF6A 3EQRA 2XKCA 4F08A 1ZYCA 1OIRA 3KF4A 1HCLA 1NVQA 3VBVA 1LUFA 3G9LX 3VQHA 4AOTA 3D7TB 4HZSA 3CSVA 2PZYA 4MCVA 3F7ZA 4UWYA 3W0QA 4RX8A 4C7TA 2XARA 3BV2A 5KE0A 2CKEA 2DS1A 5HE1A 1XBAA 3DAKA 5EHYA 3Q3BA 1BI7A 3PVWA 5FEEA 3D0EA 3ENMA 3FJQE 4FIGA 3UQFA 4TWOA 3WZDA 3RGFA 2WAJA 1WZYA 3CS9A 2WMSA 4YJOA 5HO6A 5HE2A 4BI1A 5BUIA 2C6TA 2W1GA 4C3RA 4TY1A 1PF8A 2E9NA 2VWUA 3L9PA 4M15A 5CQWA 4C61A 3MIAA 2GNIA 4QYYA 3P4KA 4WKQA 1MRVA 4JQ7A 4WRSA 2JEDA 2RFSA 3C4WA 5HZNA 4FODA 4FKGA 1FQ1B 2W9FB 3AMYA 4CRLA 4KIQA 3DPKA 3T8OA 1WBNA 3UBDA 2IW6A 4AXDA 2FB8A 4U3ZA 4CTBA 4EK6A 3OUKA 1ZLTA 2ZM1A 2I1MA 1YDSE 3S4QA 2IW9A 3SHEA 4AA0A 4C4HA 3BHUA 2UV2A 4M69A 3TZ9A 3DZQA 2R3PA 2W17A 3E3BX 2CGWA 2J0LA 3PG3A 2PVJA 1JKTA 2QD9A 4J52A 3TNPC 4A4XA 5HX6A 2ITNA 1Y57A 1YXUA 3BU3A 4X6RA 5CEKA 2C30A 2ETMA 3RK9A 5I9VA 2WMAA 1SNXA 2QOOA 4GEOA 5KUPA 4CSVA 3II5A 4JJRA 1BI8A 3GENA 4FA2A 4RFZA 5CEIA 2ZMDA 4F7NA 2RIOA 3C4ZA 4L67A 3R8ZA 5E8UA 2A4LA 4FZAB 4O22A 2P2IA 3CY2A 4FR4A 3CKXA 4XOYA 3FKLA 3EH9A 4NU1A 4EOLA 3PLSA 2UW6A 4JDIA 4DGOA 2OW3A 4ZY4A 2VWVA 3QA8A 3BHVA 4TRLA 4RWIA 5CI7A 5A14A 3P5JC 4IANA 2B52A 2NP8A 2QU5A 4YC8A 2UVYA 2OJFE 1ZOGA 2X1NA 3COHA 4QP8A 4XEYA 5ANIA 5AADA 3BLRA 1KE8A 3UYTA 1Q8TA 3AT3A 4GCJA 5J1WA 2BTRA 3ZXTA 1OL6A 4ANNA 3BYSA 3QFVA 5JFSA 4E6QA 4C58A 5CNOA 1OB3A 3KF7A 4U41A 4Z7GA 5BUJA 5I5ZA 3AXWA 3H0ZA 5ITAA 1UNGA 4D0XA 2FSMX 4XG2A 2XRUA 5L6OA 2FSTX 3OT3A 1WBPA 2H8HA 4BDIA 4UYNA 3TNWA 5AM6A 4CCUA 4JX7A 2CJMA 4TYIA 1IG1A 3Q4ZA 2OIDA 2X6EA 3QC9A 5JQ5A 5DGZA 5EI8A 2HW6A 4D1XA 3PJ1A 3DA6A 4EKLA 3G2FA 3N4TA 4MNEB 2WD1A 3DLZA 2W1ZA 2W05A 4A4OA 4BZDA 3UDTA 3V6RA 4UMPA 4L46A 4APCA 1TZDA 4WG4A 4G3DA 4IQ6A 1LR4A 3CCNA 4L45A 4USDA 1YDRE 5ETAA 3CKWA 2C5NA 2GS7A 3CQEA 2WEVA 4E4MA 2C3KA 4O0XA 5M56A 3Q4TA 2IZUA 5HQ0A 4O91A 4L42A 3W0NA 1CSNA 4IE9A 4I20A 5FGKA 2XJ2A 3LFAA 3T3UA 4I0RA 3MB6A 3DDPA 3A8WA 2PZRA 4GG7A 2XNGA 1H1SA 3FMHA 5CSWA 1OUYA 5AJQA 4EJNA 2R3OA 4L3PA 4OAVB 3R1QA 2CKOA 3ZEPA 5GZ9A 1P14A 3NS9A 4BB4A 1FVRA 5KNJA 1GIJA 2VTPA 3KRJA 5C03A 4AA5A 4KD1A 2H9VA 3BZ3A 4FKOA 3D94A 2CN5A 3LOKA 4I94A 3QHRA 3ZH8A 1X8BA 3ITZA 3H3CA 4NUSA 3H30A 2YA9A 3BYMA 4D1ZA 4F78A 2UW7A 4AW5A 2O8YA 3QCXA 5A6NA 1SNUA 4AQCA 2CPKE 3I7BA 4M7IA 2WPAA 3H9RA 4MQ2A 3UDBA 5IH5A 3R6XA 1W84A 1JAMA 2XNNA 4G5JA 5K9IA 5AP5A 3CGOA 5KHXA 5DHJA 4R78A 4FV7A 2F7ZE 3Q53A 3DKCA 4CQEA 1TFFA 4RIWB 5G6VA 4BTKA 3BYOA 5FEDA 4EEVA 2ZJWA 2Y8OA 3W2OA 1YWRA 4CFMA 3PVGA 5FXRA 3BX5A 4PX6A 5E92A 4BR3A 5EFQA 4BDDA 3ORMA 4TN6A 3OEZA 2QOFA 2F57A 2VTHA 4JDJA 3ZO1A 4BTJA 3GQLA 1I44A 1WBSA 4K77A 4F9CA 4HGLA 3HRFA 2PUUA 2XEZA 4PNKA 4FL3A 1FOTA 4DEIA 3PXZA 4BDGA 1J1CA 3FHRA 1E9HA 2C69A 1SYKA 2F7EE 4ZSEA 5HGIA 4DG0E 1W2FA 3EQBA 4OT6A 4XH6A 4DFYA 3TV6A 2VTRA 4TTHB 2R3IA 4FEVA 5EOBA 4ORKA 2BROA 2FYSA 3R8PA 3E7VA 4UXLA 4RSSA 5CYIA 4EQMA 2NYAA 2Y9QA 1R1WA 4BDEA 4LRKA 5FP5A 4NM5A 4ZLYA 4J98A 2W1IA 1PXOA 2OIQA 4DGGA 3KXGA 3M1SA 2VTMA 3Q5ZA 5I9UA 1H8FA 3DJ5A 2JDTA 2YWVA 3KXZA 4UWBA 4BTFA 4ZSAA 3BL7A 4OTIA 3QCQA 4UMRA 1O6YA 1BUHA 1Q62A 4AZVA 3MWUA 4QMNA 1PYXA 2QNJA 2LGCA 2PVLA 2IVVA 3ANQA 1PXIA 1XH5A 5EKNA 5IQHA 1VYWA 4MWHA 4Y8DA 3VUDA 3MH2A 5CVHA 1JPAA 1WVWA 3D5UA 4I5HA 4DDGA 3WF7A 3CIKA 3EFKA 3KRRA 4KIKA 5DIAA 3GU6A 4GH2A 2G01A 4ZK5A 2C6IA 3TACA 4PMMA 3ZLXA 1BLXA 4IDTA 4I6QA 4R1YA 5DN3A 2SRCA 4DLIA 5JSMA 3G6GA 3H9OA 3PWDA 5AUXA 4FTKA 2VTNA 4WUNA 4MBLA 3FI8A 3Q32A 3OTUA 3TDWA 3QF9A 5EW8A 3MPAA 3DZOA 4I24A 3GXLA 4WG5A 3BQCA 3FZTA 4ANMA 2VO3A 2JD5A 2WQOA 4C4IA 4EUUA 2YDJA 5JGBA 4BBMA 2ZAZA 3OXIA 1ZY5A 4ASDA 5A4EA 4C0TA 1E1XA 2QR7A 2UZNA 4LL0A 4YPSA 4K33A 4ASZA 1UNHA 2YABA 2IPXA 5EYKA 1YI3A 3WYYA 1L8TA 5ICPA 4FGRA 4O0WA 2YZLA 4O27B 3FE3A 4Z7HA 2UVXA 3W2RA 4FG9A 4HVSA 2XK8A 3B8RA 3R28A 3GFEA 5HIDA 4DH8A 1DAWA 4EORA 3SG9A 1YQJA 4RWKA 2JDSA 3KRWA 2XF0A 3D5VA 2B55A 2QOIA 3ZO3A 2PVMA 5KMJA 4BZNA 4X6QC 4WBOA 5EHLA 4LOOA 3A61A 3NZ0A 4CFUA 3TL8A 1LEWA 4M0YA 4NKAA 3ORNA 1AD5A 1DAYA 2YM8A 3UC4A 2W4KA 2PE2A 2WMTA 1O6KA 4Y85A 1TQIA 2C1AA 2ONLC 2VO6A 4ZLZA 4GU6A 3RPYA 5LWMA 2OK1A 5L2SA 2BFXA 2J4ZA 3I5NA 1OIUA 5AV4A 2WNTA 2YAAA 4CZYB 5M53A 5M09A 2A98A 4KKEA 3FLNC 5CU2A 5HNGA 1GZNA 3R9RA 1CDKA 3GOPA 3NRMA 4BN1A 3GU8A 3KK9A 2R3LA 2X2MA 4B4LA 4E73A 4O7SA 2YM5A 5I4NA 4FSWA 5AA8A 4DYMA 3K2LA 5JRQA 3TKUA 5DT0A 3ROYA 1XH9A 2QCSA 2R3MA 3FC1X 3BQRA 1QL6A 3C13A 3EIDA 4WD5A 3S2PA 5CSXA 4RIYA 3LZBA 4D9TA 4EK8A 1YOMA 4RT7A 4TYEA 5TOZA 3VS0A 4J95A 4NW5A 3PJ2A 4I6BA 4F6WA 2QOCA 3NNXA 4XP2A 2PZ5A 1S9JA 5AV0A 3LXNA 5HNIX 4F7LA 3D83A 1J7UA 3QRUA 4RWJA 5IA5A 3FXZA 5M4FA 3R21A 3ZRMA 4CLJA 3SA0A 3NUUA 3FDNA 3HMOA 4MXAA 4F9AA 1GZ8A 4M3QA 4CZUA 4YJNA 2OXYA 4AFEA 4L3JA 4RGJA 2OXXA 1YHVA 3IW4A 2QOLA 5CSVA 1VYZA 4IX5A 3R7VA 1YOLA 2Y4IB 3OWJA 4X2KA 3KY2A 3LE6A 4FZDB 4IH8A 4X2NA 4RLKA 5CF5A 2XNEA 1U54B 3F88A 3ZTXA 2R3QA 4DGLC 4RVKA 5IEYA 1ZYSA 2ZDTA 2IZTA 5D12A 5HG7A 3QBNA 3DY7A 4S2ZA 2R5TA 3MTLA 4FV0A 3VUGA 1H01A 1URCA 3R9HA 4C4GA 4RIYB 5DR2A 4ENYA 2YDIA 2VZ6A 4FTJA 3A7GA 4FTIA 3W0RA 2ONLA 4AFJA 3R02A 3HYHA 4FGBA 3BLHA 2W9ZB 4KBCA 3Q5IA 2G2IA 3E62A 5JMSA 5LMAA 5CWZA 5AIRA 5DT4A 2PPQA 3SXRA 1WCCA 4FK3A 4JXFA 4KSPA 4M14A 2ZMCA 5ACKA 2XBAA 3H9FA 3IONA 2B53A 2HXQA 2Z02A 5H8EA 3OF0A 4KWPA 3ZFYA 3O8PA 4ARKA 4X3FB 3ZRLA 2XNBA 3LCKA 2YM4A 3KULB 3NCGA 2C0TA 3HGKA 3OOGA 3RCJA 3NDMA 4ZIMA 4D2VA 3HMPA 2X8IA 4MQ1A 1PKGA 2F49A 3L8VA 2V0DA 3MPMA 2PE1A 2UZOA 3VUIA 4WSQA 5KO1A 3BRBA 3NLBA 3L8XA 2QQ7A 4BYIA 4O81A 5C8KA 3A7IA 4FVRA 4H39A 2OBJA 4LV8A 5FTOA 4EQUA 5IQDA 3AMAA 4F09A 4HPUE 3UQGA 2G15A 4AUAA 4TYGA 3RAWA 3QZIA 4AOIA 4RX5A 1Q5KA 5HCZA 1FGKA 4BDFA 5AAEA 4E4LA 4YSMA 2OI4X 2XIZA 4G1WA 2QI8A 4R3CA 1K3AA 4FTNA 2E9VA 2UVZA 3ORXA 4DDIA 4AU8A 4V0GA 5BYYA 4BIDA 5IH6A 4HYHA 4X2GA 2UUEA 2E9OA 3RHKA 3F69A 3VS3A 3UOLA 4EHZA 1UU7A 1NVSA 4ZSGA 4YP8A 5JK3A 3ZRKA 2XK4A 1H1RA 1XH7A 2XUUA 5L2IA 3HUBA 4FIFA 2EU9A 2G1TA 3AT2A 3PP1A 5E9EA 2JFLA 3SC1A 4I6HA 5M4IA 3QZGA 4YBJA 4YHFA 1VZOA 3E8DA 4JR3A 5EDQA 5CEMA 2WIPA 2HENA 3JYAA 3BHTA 5M51A 1B6CB 5C8NA 5BVKA 4CMUA 1RQQA 3BEAA 2X39A 4CFXA 3PFYA 2GQSA 3LQ3A 3QQUA 4HNFA 3BPRA 4EHGA 3REPA 3NW6A 4L7SA 3OD6X 2J51A 4OTWA 1W8CA 2UZUE 4BCKA 3VAPA 3QD3A 4H05A 3CQUA 3RZBA 2IVTA 4C37A 1HCKA 1M2PA 4XLVA 5HBEA 3ZCLA 3MW1A 4FTMA 5IA3A 5IG1A 4NM7A 2VN9A 5CEPA 4ZZOA 5EM5A 4ZJVA 2R0IA 3OWKA 3RINA 3SW7A 4O84A 4G3FA 3DBFA 5IMEA 4IAKA 4O2ZA 2BDWA 3G9NA 5E8VA 4FV5A 2W1EA 4UMQA 3ELJA 3CPCA 4TL0A 1ZXEA 3DS6A 2QOBA 3ZBXA 5IISA 3C1XA 2YEXA 3DXQA 4ZZNA 3FAAA 1WAKA 1URWA 5KX8A 2WOTA 3VS5A 1YOJA 2WQEA 3A2CA 4B9DA 5FM2A 2XK6A 3EFJA 2WMXA 1M17A 4L01A 1DS5A 1OIQA 4IVAA 4JX3A 3UMWA 3HAVA 4O0SA 3D7ZA 1UKIA 3GUBA 4JAJA 2QURA 4DTKA 3HV7A 4IVBA 4L00A 3AC3A 1PXLA 3AC8A 4GUEA 4JIKA 3ORTA 4S33A 4MXOA 5F94A 4IAAA 4G9CA 3NEWA 2ITYA 4J8MA 2P0CA 4RIXA 3JS2A 3G33A 2H96A 3E3PA 3FZSA 3MH0A 3UC3A 4E7WA 3QQGA 4BYJA 3PY0A 1PXJA 4RPVA 2B9HA 3GNIB 2PSQA 3QC4A 4R3PA 4DINA 3RMFA 3C0IA 2I0VA 2PL0A 3E8EA 5FLFA 4BBEA 3FHIA 4XNEA 4CFFA 2F4JA 2J90A 1SVEA 5LOHA 4JDKA 5EW3A 3PWYA 3FKOA 2X0PA 3CQWA 2P3GX 3BHYA 3QD4A 3Q9YA 4FIJA 4L44A 4WT6A 1XQZA 3PDTA 1WBWA 3D5WA 3H0YA 3HZTA 3NNVA 4ENXA 2UZVA 4JBOA 1VLRA 4WNOA 3E92A 5AUYA 3QRTA 2YIYA 3OTVA 2W99B 3GT8A 3QUEA 2C6OA 5GHVA 4GG5A 3MV5A 4OBPA 4WIHA 3VWAA 1UKHA 3E64A 1NVRA 3EQDA 4L6QA 2WHBA 4DBXA 3IKAA 3QRIA 3UOJA 3VBXA 3LFEA 1VR2A 2XJ1A 1BX6A 4FICA 1REJA 2Q0NA 3PSBA 5KMLA 5D9HA 5JGDA 2PYWA 3BCEA 4QQTA 4IB1A 3R71A 1FPUA 2YHVA 4HVIA 2WMVA 3CTQA 3HUCA 5CLPA 4RIXB 5T68A 4QTAA 4JAIA 4D55A 4YPDA 4Y5HA 5LCJA 4E8AA 1ZZ2A 2XKEA 4CFVA 2REIA 2JKKA 2WFYA 2YDKA 3HMMA 4PDSA 3RBWA 4IZAA 5B2MA 3PSDA 5HIEA 3ULIA 4BDKA 4FTQA 5K5NA 5HVYA 1PYEA 1G5SA 5DRDA 4BI0A 3IDBA 5EI6A 2GTNA 3EOCA 1ZOHA 3LM0A 4K1BA 1W83A 4U43A 3FMNA 1IASA 3T9TA 4NM3A 4XJ0A 3FKNA 5JFWA 5BYLA 4FZFB 2YIWA 1W7HA 3K5VA 2YITA 3AKKA 2OZOA 3QL8A 2W0JA 4XYFA 4QNAA 3ZDUA 4CMTA 1XHAA 4YJSA 1FMKA 1OL1A 2X9EA 2J5EA 2YIRA 3OZ6A 4H1MA 4RFYA 4GT4A 5LVOA 4YHJA 4IW0A 2I6LA 2R4BA 4G6LA 4K18A 4U42A 4QTDA 5J9ZA 4UWCA 4L68A 4FT0A 4Y5QA 3HV4A 4CKJA 3Q96A 3W8QA 5AP2A 3RPOA 4BCIA 4G2FA 5L8LA 2A2AA 3DJ7A 5TR6A 3NYOA 3KXMA 5E1EA 4IC7A 4LV5A 2WMRA 4BDBA 4JBQA 3A60A 4BWKA 4GS6A 2ETRA 4G5PA 3R7UA 1BMKA 2ACXA 3QKKA 4RQVA 2XVDA 3QXPA 4D5KA 4U79A 4FV1A 4D2TA 4FNXA 3UMXA 4FTAA 4CFWA 4DTBA 4EZ3A 4EKKA 4BKZA 4WHZA 5GJGA 3AGLA 3KXXA 4BGQA 4HYSA 5BVWA 4AGCA 5A9UA 2W4JA 2WOUA 4ZZMA 5BQ0A 5CAPA 4ZTNA 3G51A 4OW8A 3PXRA 1H1WA 1PW2A 3F3VA 1W82A 2BKKA 3QKMA 4EQCA 5J79A 2FO0A 3EMGA 3QLGA 4QMXA 4O7ZA 2HWOA 4OT5A 3RNYA 2BHHA 3PRIA 2QG5A 4N0SA 3JR1A 3C4EA 3EZRA 4HGTA 1STCE 4DEHA 5GIOE 4Z55A 2YISA 3MH3A 3QUPA 4YZNA 4CMOA 4CXAA 4DEGA 4O2PA 3KMUA 2PMOX 4FSRA 2VTLA 4PUZA 3FMLA 4C3FA 2Q83A 3QAME 3F2RA 3QYZA 3ORLA 2A1AB 2YERA 3MY0A 4TWNA 4CTCA 5M4UA 2CNVA 3EB0A 4DHJA 3W0OA 1MRUA 2IG7A 2X7FA 4I5PA 2GPHA 4AA4A 2XANA 5KZ0A 4IACA 4IM3A 3ALNA 3NPCA 3W2SA 2XKFA 4AT3A 2OIBA 2OSCA 3A4OX 2OH0E 3I1AA 3TWJA 2WIHA 1Q41A 4QMUA 3V51A 5CTPA 1OKVA 2QO7A 2OKRA 2PTKA 5A3XA 3FMJA 4PP9A 3BELA 4YJTA 5ANEA 3VRYA 2NPQA 3C50A 4I0TA 1V0PA 3DK7A 4MF0A 4K0YA 3IECA 1Y91A 3LCTA 3TN8A 4DFNA 3HL7A 3UPXA 5KCVA 2HY81 3HDMA 4F7JA 1YXVA 3IGOA 1R78A 5H9BA 4AGDA 4QP3A 5IQFA 3LPBA 2UW9A 1GNGA 4CLIA 5B2LA 1ZARA 4CEGA 3I7CA 4WNPA 5J9LA 4O1PA 2WTJA 3G15A 4BCQA 4AN2A 3DXNA 1Q8ZA 2O3PA 4XV2A 3P0MA 4QYEA 2J0IA 4I93A 4PPBA 4WA9A 3UP7A 3LVPA 3UG1A 1M14A 2RGPA 2ZDUA 4O7YA 2XAOA 3WOWA 3FYKX 4AAAA 5DBXA 4DEDA 1Y8GA 4J96A 3CTHA 5LMBA 1A9UA 2YM6A 4NYEA 4TYHA 5E7RA 4F70A 2Z7SA 3W2QA 4NEUA 4R5YA 3DAEA 4J99A 3EQPA 5DR9A 4UZHA 4EH6A 4KUJA 4FTLA 3NWWA 4X7QA 5C9CA 5BMSA 3TDVA 1XH6A 1IA9A 1WBTA 4ACGA 2IWIA 3ROCA 4DF3A