2VUWA

Structure of human haspin kinase domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
329
Chain Sequence
KGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
publication title Structure and Functional Characterization of the Atypical Human Kinase Haspin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 329
sequence length 329
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vuwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vuwA01
3EN9A 3FI8A 2VWBA 3ZM9A 4GVJA 4S32A 5H9BA 3BELA 5IMEA 1VJYA 3UMXA 2I0VA 3PUPA 2FUMA 3AC1A 3VBYA 4AUAA 3W16A 4XBRA 5AFVA 2WQOA 1ZXEA 3OY3A 3D5WA 3QYWA 1Q62A 2HXQA 3PJ8A 2OO8X 3HV4A 3BX5A 3S4QA 2OH0E 4KB8A 3VF8A 4Z16A 4CRSA 4B4LA 2KULA 3R7OA 1FOTA 4QNAA 4F6SA 4O7RA 4NK9A 4ZOGA 1WMKA 4U40A 1H1PA 3BWFA 5A6NA 1UU3A 5DMZA 1JBPE 4FKTA 5T68A 2E9PA 2ZVAA 2GNHA 3CBLA 2BRHA 1H00A 3OTUA 5DEYA 3NPCA 4NIFB 2F4JA 4RJ3A 3RK9A 2YITA 5L2QA 3BKBA 4AG8A 4G6LA 2R3LA 3F61A 4KS7A 3CQUA 3ZO4A 3ZZEA 3FLZA 4PL3A 4A9RA 2BDJA 4F7NA 3W8LA 3QQLA 5KBRA 2VTPA 5JN2A 5GHVA 2PZPA 1ZMWA 4DYMA 5I4NA 3CD8A 3DNDA 5AIRA 1STCE 4B7TA 3RM6A 4EUUA 1JKKA 2XNBA 3VS7A 4NU1A 3Q2MA 3LVPA 3OCBA 3RCDA 3MYGA 3K54A 3W55A 1JKTA 4I22A 2F49A 4QYFA 4IAAA 4JRVA 1H24A 2XK8A 3QYZA 3BCEA 4IX3A 5M08A 3PJ3A 1WBVA 2QHMA 3E8CA 2J51A 2YDIA 4WNKA 1PXIA 3OT8A 4J7BA 2BHHA 2FB8A 2QLQA 4OTGA 3O2MA 4BBEA 3DTCA 4W4XA 1P5EA 4X3FC 4YR8A 1H8FA 4UXLA 5IDNA 3ET7A 4IDTA 4C2VA 5CEPA 3MTLA 5AWMA 5HGIA 2V22A 2ZV2A 3Q5ZA 4DTKA 2XEZA 3NMUF 2X2MA 5GJGA 3EQHA 3UIBA 1BKXA 3MVMA 4MBIA 4MXOA 4L8MA 4FVQA 3VUGA 3VQHA 5IQFA 1QPEA 1W7HA 4DFYA 5AUVA 2O8YA 4I6BA 4YP8A 2X7FA 1T46A 5CAOA 2E2BA 5J95A 3G2FA 4FICA 3VS6A 2OWBA 3FLNC 3BQCA 3MA6A 3M11A 4IC8A 3Q3BA 4QOXA 4BDIA 4ITIA 2PVNA 1Y6AA 4MVFA 3LMGA 4M14A 3FE3A 2EB2A 2X6EA 4N6ZA 2PMLX 3EFWA 3V8TA 3EQBA 2GMXA 4H36A 2Y4IC 3KXGA 3DBDA 3E64A 3LXLA 3QD4A 4HCTA 3DBEA 1GOLA 4W8EA 4W9XA 3W2PA 4ANNA 5KMNA 3ORZA 5IUIA 2BRGA 4AN9A 3PDTA 3PE2A 4XLVA 4OR5A 4RA4A 3WE8A 2Q0BA 4F65A 3FMHA 2YWVA 4B6LA 3V5TA 4CQEA 5JT2A 3W32A 1LEZA 2I0EA 2PMOX 2R7IA 1JQHA 3TIYA 4PNKA 4ZSJA 4L01A 3R83A 3E8EA 3D9VA 4JRNA 4FNYA 2BIYA 5EW3A 4G5PA 3DJ7A 3OWLA 5KX8A 2ITUA 3PY0A 1J91A 4R6VA 2C69A 4GUBA 2VTAA 1OIYA 4DGNA 3EIDA 5JK3A 5GJFA 3WYXA 4FZDB 2ZOQA 2ONLA 3DJ6A 4L52A 5EM8A 4XMOA 4BWPA 2QOKA 3G0EA 3UOHA 3RWPA 3NVMB 5FGKA 4PPAA 4PMSA 5HVJA 4XG8A 5HO8A 5M06A 3OEZA 4EEVA 4YJSA 3DK7A 4I6QA 1MRYA 3K5UA 1JPAA 4TYHA 5EHYA 2YHVA 4ZIMA 3R2YA 3UNKA 4ZSAA 3IOKA 1X8BA 3BGPA 5BVDA 3ROYA 4AA5A 1XQZA 3L9NA 4MEDA 5FBNC 2XRUA 3NR9A 4YJNA 5AP1A 3PRFA 4S33A 5M51A 5FDXA 2XEYA 3UOJA 2BIKB 2H96A 1U5RA 2V55A 3HV5A 3MH0A 3O8TA 3DJ5A 4FVRA 4LYNA 4ORKA 3IQ7A 2O2UA 1RJBA 5EHOA 2GFSA 5CVHA 3HEGA 3I7BA 4U44A 5TE0A 4EBWA 1Y6BA 4G3FA 5TF9A 5E8VA 1Q41A 5HE1A 3UYSA 1QL6A 4F0GA 2WMSA 2LAVA 4JX3A 4QYEA 1IA8A 1XH5A 2BVAA 1MQBA 2XS0A 2QLUA 5E7RA 3H10A 4ZLZA 4HGSA 2YM7A 1PHKA 2DQ7X 3JVSA 3ZFXA 5LVNA 3PWYA 4FTRA 3ENMA 1V1KA 4OTPA 3ALNA 2YDJA 4RRVA 4YLJA 5E8ZA 3SC1A 4FTNA 4EH8A 1U54A 2UW0A 2R3FA 4J71A 3T3VA 4DN5A 3MESA 1A06A 3DV3A 4R5SA 3WZJA 3BU6A 1U5QA 5BMSA 3QAME 4YZNA 2F7ZE 3ZLXA 5AIKA 4OTWA 3BIZA 4YC3A 4DH7A 4XEYA 4Q9SA 3V5WA 3GCUA 2G2IA 2VTOA 3FWQA 3UVPA 4G5JA 4C4GA 5LQFA 5EKOA 4BCNA 2W1EA 3FL5A 2NPQA 3QLGA 2GU8A 4E4LA 4EOLA 3QF9A 1Q99A 4FV4A 1CMKE 2WMUA 3I81A 4FSQA 3RHXA 4CXAA 4NWMA 2PK9A 4JT3A 3GFWA 1U4DA 5E90A 3JR1A 2E9VA 3RP9A 3U55A 2CN8A 4NM3A 2XK7A 3GU6A 3VIDA 3SXRA 4LGGA 5AV1A 4L53A 1H08A 3F3WA 5TOZA 1B6CB 4FT7A 3QHRA 2PUIA 1ZY4A 4GW8A 5AAGA 4KABA 4MWIA 1P4FA 1W98A 5F4NA 5AUXA 5LXMA 1IR3A 1XKKA 2PE0A 3VS1A 4BIEA 4RIYA 3ANQA 2ZV8A 3RK7A 3TZ8A 5JFWA 5J1VA 2BROA 1FVVA 4J99A 5A4CA 4BDBA 1QPCA 3G6GA 5CQUA 3QCQA 4D2TA 1GNGA 4FSNA 1QCFA 4XG7A 4EI4A 4EC8A 5LVPA 3VNTA 3HUBA 3OW3A 3FPMA 4YJQA 2BFYA 4NEUA 3OROA 3ZC5A 4CRLA 4QMOA 3U6IA 2EB3A 4B0GA 5CF5A 1Y8YA 1YDTE 5A6OA 4IZAA 5H2UA 1R0PA 3D14A 4N0SA 5D1JA 4C2WA 4DFUA 3Q6WA 4WIHA 5J79A 2J6MA 2A4LA 4IIRA 4I6HA 3F5PA 3HYHA 5KMIA 1NVQA 2LGCA 1M7NA 5L2SA 4BI0A 4E6QA 1GZKA 2R3MA 3MJ1A 4HYUA 4O6LA 4ZTQA 4EJNA 5J9LA 4AACA 5DI1A 4YJVA 5IH4A 4XG6A 3MIAA 4GJ2A 1GIJA 4B8MA 3PJCA 4RLLA 4FEVA 3PRIA 3BYUA 3UIMA 5KKRC 3QC4A 3ZTXA 1JAMA 4QTAA 4MNEA 5IA4A 5H3QA 2GPHA 4OBPA 4V0GA 1BI8A 4Y83A 4ZEGA 3EMGA 4AW2A 3U6JA 3C51A 4AFEA 1H28A 2UZTA 3Q32A 4FTAA 4OT6A 2UZVA 4GT4A 2QOBA 4GUEA 5DT3A 2VUWA 3UOKA 3PY3A 3QGWA 1SVEA 2QD9A 3O50A 3T3UA 2PZ5A 3QUDA 5LCKA 5I3OA 2OJIA 1WBNA 4NKAA 5IH6A 1NW1A 1CKPA 1Q8YA 2OIDA 3OCTA 2RIOA 4BDHA 4JJRA 2VX3A 2RFDA 1XH9A 1RQQA 3V5JA 5HD4A 4BICA 2H34A 4OT5A 3WE4A 3SRVB 1MRUA 5IDPA 3CP9A 5KUPA 4C7TA 4O38A 2AUHA 4BTKA 5ICPA 5J9ZA 4FL3A 2XJ0A 3ITZA 3Q04A 3D15A 5CEKA 5KHXA 1SNXA 2XIKA 3P4KA 4GL9A 2B1PA 1H0WA 2JIIA 3QTRA 5EM5A 4PMPA 2RGPA 1V0BA 1H1WA 3BBTB 4PDPA 3U51A 4I21A 5CNNA 3TUBA 3GXLA 5KO1A 2WIPA 5HD7A 3M1SA 3MY0A 4EH5A 4Y8DA 3UP7A 4BKYA 1Q8ZA 3DZOA 2F57A 4RWJA 3FC1X 4IX5A 5CAUA 4AOJA 5L8LA 4FNXA 3BGZA 4HYIA 3GCVA 3MVJA 2YM6A 3RAIA 4EK8A 4K0YA 4ZZOA 4II5A 3R8PA 1OL1A 4NFNA 3QTSA 1SVGA 3NX8A 4MBJA 4MHAA 5CSWA 4D4RA 4EHZA 2CKEA 5J9YA 4M69A 2CMWA 3LIJA 4FOBA 4GFOA 3THBA 3LXPA 4UX9A 2HZ0A 3PZHA 1YI6A 3B2WA 4PPCA 3F5UA 4FV7A 4BTMA 3L8SA 1QPDA 4F70A 2P2HA 2ONLC 5FTQA 4PUZA 3SD0A 1H1RA 4FEQA 2JFMA 3P9JA 2YCSA 3R8MA 4C4JA 3OD6X 1CKIA 2DWBA 2OIBA 4J98A 4O0RA 3UC3A 4W9WA 3V01A 3LCOA 3R71A 4CEGA 5BVEA 5B2LA 1KV1A 4BF2A 3O51A 3BHHA 4X0MA 5D41A 5IA0A 3EN6A 3GU5A 3ANRA 3CJFA 3HV7A 3QUPA 4FT0A 2H8HA 2E9NA 4Y85A 3I6UA 4Z7GA 1Q61A 3C4WA 3BEGA 4U43A 3U9NA 1URCA 3NNXA 4E3CA 2F7EE 4EQUA 3NS9A 4EQMA 3COIA 4FODA 4ASZA 3UO6A 2QO2A 3Q6UA 4HGEA 5EDPA 1A9UA 4ZY4A 3PIXA 5TKDA 4TWPA 5LMBA 3SHEA 3F5XA 3PJ1A 4E6DA 5LMAA 5DNRA 4GEOA 4K2RA 3A2CA 4LRKA 3H30A 2Q0NA 4JDHA 1NXKA 3DU8A 3GENA 4WUNA 5AP7A 4DGMA 5AUTA 4GVAA 4LOOA 2BILB 4GU9A 3ZRKA 4EOOA 2I0HA 2ITZA 2WQNA 1BYGA 5HNBA 5K0KA 2JIUA 4IM2A 4FKIA 3RHKA 4EOQA 4S34A 2F2CB 4D58A 4CKIA 2EXCX 4LUEA 5M53A 2WTKC 4YMJA 1PXNA 4NM0A 3RM7A 3AMYA 3ZUTA 5H8BA 2XRWA 3FI4A 2OLCA 1T45A 2ZM1A 3BV2A 3UVRA 3R04A 2BR1A 4RFYA 4RPVA 1PXPA 4IZ5A 2CNUA 4USDA 4AGWA 2YIWA 4IB0A 1QPJA 4MXXA 4WA9A 4Z3VA 2C5OA 2ZM3A 3Q4CA 4Y72A 4NW6A 3BHVA 5AP6A 3MVHA 3WOWA 5FDPA 1NA7A 1RDQE 2BHEA 2G9XA 3FYJX 4FGRA 2BKKA 5B0XA 2PHKA 3SGCA 4MKCA 3WF7A 4W4VA 4C8BA 4F63A 1J1CA 5CXZA 5TT7A 2B4SB 2O0UA 3A7FA 3FLSA 4YLKA 5CVFA 4D0WA 3C7QA 4X2KA 1ND4A 2R3HA 4EZ5A 4YBJA 3F2RA 3WF9A 2VTIA 3PVUA 4PNIA 5IA3A 2HY0A 2QOQA 3R1YA 5IKWA 2QOHA 4DEGA 2PVLA 3QQHA 3CC6A 3PTGA 4AX8A 5CU0A 3UG1A 1JOWB 5JGAA 5DGZA 4IWDA 3FYKX 4PX6A 3OXTA 5ANDA 2HWPA 4RVMA 4XOYA 2OF2A 5K4JA 4JVGA 2JEDA 1OM1A 2O3PA 3DKGA 5A14A 4FKOA 4RFMA 2G2HA 4OTHA 2IG7A 3GCQA 3UQCA 2XB7A 2XIRA 3LM5A 4D55A 2WELA 1YOMA 4MXAA 5AUWA 3ZHPC 5EOBA 4DF3A 3Q4TA 4U80A 3NWWA 2WHBA 2BAQA 3C5UA 1Q4LA 2UZBA 4K33A 5CTPA 3DY7A 3KXNA 2JLDA 3Q9WA 4TTHB 3PA4A 4IB1A 4D4YA 4TT7A 2UZOA 5LWMA 3UQFA 3MBLA 3IECA 2PE1A 4I0RA 2R0UA 4K8AA 4L44A 5K3YA 2R5TA 4YTIA 4LL0A 2YLEA 4U79A 2WMRA 5IQAA 3KN6A 1CSNA 4FV5A 5DRDA 2FGIA 2Y4PA 4LI5A 3V8SA 3ZLSA 3R8UA 3VAPA 3ZUUA 1U54B 4L43A 2BRBA 3POOA 3IKAA 3DB8A 3R9DA 4FNWA 2XP2A 3ALOA 4FV6A 4EH4A 3AXWA 4S30A 2PULA 2VGOA 4IDVA 2PVHA 5C03A 4C62A 4DFBA 3GQLA 5BMMA 3N4UA 5IQBA 4JAJA 4EHGA 3MFSA 3QCXA 4WNPA 3TV7A 3SA0A 4F9YA 2XNGA 4RX9A 2ITVA 5E1EA 5F95A 3I79A 3QWKA 5L8JA 3ZLWA 3LAUA 2BUJA 3KB7A 4O0WA 3ETAA 4YSMA 3VUTA 2BAJA 3UZRA 4DEIA 4GH2A 2ZMCA 3FKNA 2GNFA 4FV8A 4DH1A 1KV2A 4JIKA 4M7IA 2XKDA 3LFBA 5KMOA 4G6NA 4XRLA 2R3GA 3NZ0A 1YWRA 1QMZA 2C1BA 3DGKA 3PIYA 3FKLA 4AP7A 4EYMA 3RK5A 2J2IB 4QQTA 3OTVA 5JQ8A 3WZDA 3U6HA 4PDOA 4QQJA 4AZVA 4WSQA 5F1ZA 3HX4A 5LVOA 1TKIA 3PVGA 4L00A 2YIRA 5TR6A 4HVDA 3OWPA 4FT3A 3KRJA 4IH8A 4TYGA 4ZTSA 4DEEA 1YDRE 3BYVA 3KULB 4EJ7A 4IAFA 5DE2A 4QMWA 2WMWA 3EN4A 3GGFA 4XHKB 3W33A 4QTDA 4APCA 5HG9A 3HMIA 1XO2B 3IO7A 3TWJA 2YIYA 1ERKA 3EQGA 4FZ7A 4Y5QA 3CS9A 3SQQA 4F09A 2CSNA 4V01A 3ZXZA 4F4PA 3P78A 3QKMA 4XYFA 5CWZA 4Y95A 4BFMA 3CY2A 2OH4A 2J50A 4FTOA 4AFJA 1HOWA 3R63A 4FKLA 3NNUA 3OOMA 2H6DA 2JC6A 4UMTA 4QTEA 3NLBA 2WMBA 1R1WA 3RPVA 4EK5A 4B9DA 5I0BA 3OVVA 3GC8A 1A48A 2DS1A 3JYAA 2XJ1A 3R1SA 5DA3A 3W8QA 2WMTA 3RNYA 1XJDA 2OZAA 3KVWA 2XNPA 4ERKA 4MCVA 2YEXA 3K3JA 5HQ0A 5L6PA 1YXSA 1VZOA 2ETMA 5CEOA 1Q8TA 3VC4A 5A4TA 5AP4A 3P5KA 4JR3A 1JSVA 4PY1A 4FTKA 1P4OA 4ZY6A 3LFCA 1B39A 2C4GA 2XKFA 4IAZA 4QMSA 1Q97A 3HLLA 3NYOA 4JOAA 1K3AA 5M4UA 4U3ZA 2XIZA 5AUYA 4N57A 5IEXA 1AD5A 3QZHA 4Q5EA 4JNWA 2BZJA 4P5QA 5HESA 1YXXA 2GNLA 3S3IA 3TACA 4G3GA 2FYSA 4DCEA 2Z60A 3DLZA 4RX8A 2UW9A 2XKCA 2GNIA 3R0TA 2ETRA 4LRMA 3PP1A 4ANMA 3FZTA 5AM6A 4FKPA 1JWHA 1S9JA 3DA6A 3I1AA 3MPTA 5GZAA 4ONAA 4YU2A 2C6DA 3MB6A 3Q96A 2W05A 2X8IA 4GYGA 3OZ6A 3W2SA 3PVBA 4EOMA 5JGDA 4G34A 3FXZA 1I09A 2CJMA 5BVFA 4IFCA 3I0OA 4I0TA 3H9OA 4DFZE 4CFMA 4HCUA 5AP0A 5CANA 3VHEA 4FZFB 5IUGA 3IGOA 4YHJA 3VQUA 1OUYA 2PE2A 4KA3A 2ZMDA 3ID6C 3H3CA 4C4IA 4MK0A 1KE6A 4QNYA 2ITYA 3GEQA 4A9SA 2JDVA 5D7AA 2B9IA 2B9HA 4USFA 3R22A 4D2VA 2ZM4A 2C0IA 3FQSA 5L6OA 3DXPA 1ZY5A 4HW7A 3PXQA 3ENHA 3QCSA 4LRJA 2QKWB 2OFUA 3OUKA 4E5WA 3ZLYA 2FSOX 4MXCA 4BDCA 1ZYDA 3I60A 4YBKA 4FIIA 2C0OA 4JAIA 5AR5A 5GZ9A 2BMCA 3CKXA 3W2CA 2WQMA 3C1XA 3ORTA 4AT5A 3PPZA 3M42A 3BHYA 4OTDA 3OC1A 2X8EA 4EORA 3RMFA 3LCTA 1OECA 2HOGA 5IUHA 1WFCA 3G15A 5AR2A 4O1OA 3VN9A 1R0EA 2YCRA 4CG8A 2ERZE 2J4ZA 2Z02A 2V62A 3A99A 2HY81 4ACHA 2GNJA 2CLQA 4RQKA 3PLAE 4FTIA 4GT5A 2QOIA 2XK9A 4J53A 4C4HA 3QX4A 3GBZA 3NUXA 2Y0AA 4IZYA 4AT4A 4E73A 4UZHA 4AGDA 2C6KA 3JVRA 3VUHA 4BDJA 4UWBA 2RFNA 2WU7A 3G5DA 2RSVA 4KKHA 3MSSA 1LPUA 3AMBA 5EDRA 5LVLA 4J97A 5D10A 2I6LA 4CFFA 1OPJA 1U59A 3DT1A 3NVKI 2ZV9A 4OTFA 5E8SA 1H27A 4OLIA 3TZMA 3VBXA 3N51A 3W10A 3AGMA 2C3LA 4A4XA 3GC0A 2BPMA 2X0GA 3NEWA 5EYKA 5CU4A 2NP8A 5FXSA 3F3ZA 4EYJA 1SVHA 2I1MA 4FIFA 2J0IA 2UZNA 3LFAA 3UQGA 4AZSA 2HAKA 3SG8A 3TNHA 3GOKA 2XMYA 4FKJA 4PP9A 4I5CA 5FRIA 4A7CA 4FOCA 5EK7A 1NVSA 2O64A 1R39A 2CGWA 2UZUE 3V3VA 3ZO2A 3NYXA 3D4QA 4FNZA 3MPAA 4FGBA 4O1PA 3PXZA 4R7IA 2DYLA 4D5KA 3OCSA 4EBVA 4X6RA 3HV6A 3UP2A 4GMYA 3VULA 3I7CA 1FPUA 3OF0A 4C3RA 4IVCA 5C4LA 2VO0A 2OU7A 3BHUA 4HGTA 2OXXA 4W4YA 4WSYA 3NUSA 4KBAA 4JG6A 4NTSA 5EFQA 2W1DA 4QMXA 4MD9E 4BZOA 3B2TA 3GT8A 3UVQA 5HCZA 3KRLA 4BYJA 4CMUA 4ANQA 4KRDA 2IZUA 1HCKA 3V51A 2WQEA 4MAOA 4ERWA 3AG9A 4MF1A 1E1VA 2PL0A 5IQEA 1BMKA 5HVKA 5I9VA 4O7VA 2ERKA 4LMUA 4RX5A 2PUNA 3LE6A 5IA2A 4KINA 1W82A 2YA9A 1H0VA 5G6VA 4CT1A 4BVUA 1NT2A 4PDYA 3SOAA 3QRIA 2OKRA 1APME 2UZWE 4QQ5A 4E1ZA 5KMKA 4DAWA 4RLKA 4EH2A 4Y73A 3F9NA 3ZSHA 2IZRA 2R3OA 4CYJA 4ID7A 1WBWA 2YN8A 4AF3A 4M0ZA 5CZHA 5B2KA 2ZDUA 3NUNA 4DFLA 1Z57A 4C59A 3R8VA 5CAVA 3P86A 1M17A 1Z5MA 4RIWA 5K5XA 1ZZLA 3IW4A 4CTCA 5AV4A 1R3CA 2VWVA 2ITNA 3AT2A 1ZAOA 4QQCA 5EKNA 3EYHA 3QD2B 3ORNA 3NCZA 3Q9YA 3QWJA 2W9ZB 3OFMA 4Z9LA 1W83A 3SLSA 3RPYA 5AAFA 2J0MB 3DLSA 3MWUA 3GOPA 4EOKA 2XNOA 3D7ZA 3T9IA 3ZS5A 3D7TB 1M52A 4BIBA 3VUIA 5E8XA 3V5LA 2CPKE 5HI2A 3D5XA 3GU4A 3LPBA 4C3PA 1G5SA 2GS6A 4B8LA 3BBWA 2GTNA 5AR7A 3PG3A 4CFVA 2R3QA 4EZ7A 4GKIA 5DRBA 1WBSA 4YURA 4Q2AA 3HL7A 2QURA 2EXMA 1ZOEA 2IZSA 4X3FB 4C58A 3R1QA 4KAOA 4M12A 3E8NA 5KNJA 2ETKA 4RC2A 5JFXA 5AP5A 2WEIA 4FKWA 4BKZA 2FSLX 5BUEA 5HIEA 4YZBA 2PVFA 3LJ0A 4IVBA 5CSVA 1IRKA 3W2OA 4C57A 1J7UA 2XYUA 3NNWA 5EI2A 3BLQA 4BZDA 1OITA 2OIQA 3OY1A 1Z9XA 5DT0A 1JSUA 2C6OA 2IVSA 2PVYA 4AE9A 3TDWA 3KMMA 3PG1A 3KXMA 5AV2A 4OBQA 3QTWA 1GY3A 2G1TA 3HDNA 5HE2A 4EZ3A 3K3IA 3G90X 5CZIA 2IN6A 3ZRMA 4IW0A 3SXSA 4E26A 5BVNA 4YGAA 1J1BA 2VGPA 2UW7A 4ASEA 5BVOA 4BN1A 3HMOA 4BCQA 4IVAA 3TT0A 4GIIA 4YO6A 1WZYA 2W1CA 5FM2A 3UZPA 4ZJVA 2UW5A 4HZSA 2XNNA 3Q4UA 2UZEA 3F66A 3CPCA 3DBFA 3ORMA 4QT1A 1OUKA 3QTZA 4FUXA 4IWPA 5T6KA 4BL1A 3IG7A 4X6QC 4UY9A 4WO5A 4PL5A 3RGFA 2PVKA 4EOSA 4XH6A 1BL6A 3MY5A 4D9UA 4DG0E 2PTKA 4K9YA 3RPRA 2XKEA 4GS6A 4AZTA 3QTIA 3VRYA 3FI2A 2XIXA 2R7BA 5DR2A 3ZXTA 5A54A 3RAWA 4ZLYA 2WD1A 3FC2A 4JLCA 3DXNA 4BY9E 4J95A 2J0LA 3OBGA 4X2FA 3OWKA 3E7VA 4W8DA 2X9EA 4FT5A 1KUTA 3S95A 3EFKA 2WXVA 2UVZA 1YOJA 5AJQA 5DEWA 3WARA 3V5PA 2YZAA 5C1QB 3EOCA 4TY1A 3UE4A 3BRBA 4OW8A 4NCTA 3AQVA 2F2UA 3MB7A 1YWNA 4A4OA 4EWQA 5BYYA 3IDPA 3QA0A 4QP2A 4GIHA 5I5ZA 1YVJA 1W0XC 5ACBC 4DG2E 4WNOA 4IB5A 4AZWA 3GB2A 3RAHA 4GK4A 4L7SA 4FA2A 4DT8A 4ZTRA 3R1NA 3L9LA 3DS6A 2WQBA 3TUCA 1UKHA 5FEDA 4QP8A 5HHWA 4FX3A 3T9TA 2VX1A 5KCVA 4ZY5A 5JEBA 4O2PA 4U0IA 2OF4A 4D2WA 2X2LA 3ZSIA 4CSVA 2VWIA 4LFIA 1O6KA 3R9OA 1KSWA 2R3JA 3HRFA 3PZEA 1GIIA 5HCXA 3R9NA 1ZOHA 2BKZA 4BZNA 3ZH8A 3GC9A 3OWJA 1R78A 1YXUA 2YACA 4HGLA 4OGRA 3KREA 5LOHA 2HCKA 3RVGA 5C9CA 3NYNA 2IVUA 4GFMA 3SKCA 2ZB0A 3BYOA 3JY0A 5M4FA 1UWJA 2YM8A 4YTHA 4ZZMA 2WOTA 5ITAA 4RJ4A 5FP6A 4OBOA 3DNEA 2B0QA 5EYMA 3F5GA 3A4PA 4I5MA 4CKRA 5DPVA 3EL7A 1XHAA 4AXAA 5DVRA 2GTMA 5LARA 1XH8A 2NRYA 4I4FA 4YPDA 2IPXA 3N4TA 3RTPA 2P2IA 3PP0A 5E1SA 4R5YA 3W1FA 4GSBA 1JKSA 2ZV7A 4DTBA 2PSQA 3RJCA 5J1WA 3UO4A 4QTCA 1Y57A 4AW0A 4CT2A 2W9FB 3FPQA 4BIDA 2YABA 3ZCLA 3NW5A 1PRYA 4FTTA 2ZDTA 4CZTA 2XVDA 3DZQA 2C1AA 2C3IB 2VTLA 2O65A 2BFXA 2Y9QA 3DQXA 3QX2A 3ATTA 4NTTA 4DC2A 3GU8A 5ETCA 4XP0A 3KXHA 4AAAA 2JDRA 1Y8GA 5CSXA 3I4BA 4F1OA 5ETAA 4BBMA 2W4JA 4KS8A 3AGLA 4FTUA 3CSVA 1OKZA 4MYGA 4IAIA 3F69A 2ITQA 2X9FA 3LLTA 4F9CA 3E62A 4M66A 2A0CX 3P7AA 3PLSA 4RC3A 4FE2A 4TWNA 3QTXA 4R1VA 2YJRA 1GIHA 4AZEA 5DG5A 1ZMVA 4DLIA 1OL2A 3I5NA 4FKRA 3SXFA 3KCKA 5JRSA 2O63A 4HZRA 4FT9A 3VBQA 4O84A 2XIYA 5IQCA 4QMLA 2E9OA 1ZYJA 2WTDA 2XK4A 4DITA 4IM0A 4QP6A 2QO7A 2RFEA 3HP5A 3KK8A 5CENA 2W4OA 4DBNA 2HZNA 5DIAA 3PJ2A 4AE6A 4GV1A 1FMKA 5HG5A 4MD7E 4MTAA 1K9AA 4WNMA 3EHAA 3LXNA 3MPMA 1V0OA 3QL8A 3DKCA 4QPSA 4O6EA 3C13A 4ZS0A 4UXQA 3BEAA 4F08A 3KA0A 3COMA 3P1AA 3AMAA 4MNFA 5AM7A 2XUUA 4FBXA 1PF8A 3LOKA 4MF0A 5HNGA 4FYNA 1PJKA 4PQNA 1PMEA 4F1TA 4JDJA 2XJ2A 2OBJA 4F7LA 2HENA 3W2QA 4H3PA 3QQKA 5CLPA 3VBVA 5BPYA 4A9YA 5KKRB 2GHGA 2UW8A 2OXYA 3CTJA 4D5HA 4L45A 4J8NA 4UN0C 4F1MA 5E9EA 3BHTA 4DEBA 3NW7A 4CZUA 4RT7A 1I44A 2BRNA 2EWAA 1H4LA 4O0XA 4C3FA 3KMUA 2QI8A 4CFUA 3ULIA 3FAAA 2VWZA 3ROCA 4O81A 4F9WA 5LWNA 1YXTA 4O7LA 4WRSA 3VW6A 4BBFA 3BU5A 3FMLA 4G1WA 4X2NA 2ITXA 2UVXA 4P4CA 4E6CA 2OGVA 2XA4A 2ZAZA 1F0QA 4JQEA 1XH6A 4PMMA 2WAJA 3FV8A 4K1BA 4C61A 1OKVA 1W8CA 4M3QA 2PVMA 5BVKA 3A8XA 1DAWA 3FKOA 4UEUA 2NNWB 3G9NA 2UW6A 4BDKA 2VX0A 5J5TA 3VHKA 3ZOSA 4IC7A 1KWPA 2X2KA 1UU8A 4H1MA 1Q24A 2IVVA 3DBCA 1ZYCA 5CU6A 4EUTA 4P7EA 2PVJA 4R3PA 3MFUA 2W1GA 4HPUE 5ANIA 1XR1A 2BDWA 3KU2A 3QLFA 4BHNA 4DGLC 2VO3A 1OIUA 2C5YA 4I6FA 4Y46A 4BB4A 4UMRA 5K0XA 5GJDA 4FKVA 4TZRA 5FUTA 3O8UA 2WZJA 4RIWB 4N6YA 4G17A 4AZFA 2XZSA 5E92A 2P33A 4KRCA 5JMSA 1PMNA 5L3AA 4O7YA 2CGVA 4BI2A 4NYEA 3BI6A 1IG1A 3BZ3A 1Q8WA 1TQMA 1YHSA 3QXPA 4N70A 4UYNA 5FQDC 4DA5A 2B9JA 1ZYLA 1WBTA 2JKMA 3GCSA 4YZ9A 1Y91A 5EOLA 2VV9A 3QRUA 5HE0A 4PPBA 2C3KA 2QU5A 4MD8E 4RJ8A 4FEWA 2RFSA 4TWCA 4HJOA 4UV0A 5JZJA 5FP5A 2JBPA 5LJJA 2B7AA 4NIFA 2C0TA 4WG3A 2GDOA 4DEDA 3MFTA 2YLFA 1WVWA 4HYSA 1OPKA 4FV0A 4AT3A 2ESMA 2C68A 3U4UA 4BCJA 1ZYSA 2UZDA 3GUBA 4EHEA 1DM2A 4QMYA 5TO8A 2E9UA 3R73A 2RKUA 3CGOA 3HKOA 4UALA 4BDGA 1XBCA 4NCTC 3RINA 3ELJA 1OKWA 3QHWA 5CU2A 1F5QA 3BQRA 4ZK5A 4JS8A 3LHJA 4ARKA 1GAGA 3R02A 4ZMFA 1CTPE 3QZFA 5A46A 1S9IA 3DAEA 2QNJA 4L3PA 4TYHB 3OT3A 2RG6A 4G3CA 3ZFMA 4P5ZA 3EJ1A 4L7FA 5CALA 4M8TA 4K77A 2OJGA 5CY3A 3KXZA 4QYGA 3TL8A 3FZRA 5AR3A 4C4FA 3FHIA 2C5XA 2VWYA 2B54A 3JPVA 2IW9A 4JDIA 5BX0A 3BE9A 2OW3A 4RZVA 2XNEA 4GCJA 2UW4A 2BZKB 1TVOA 5KZIA 2PMNX 2RF9A 2IJMA 3MV5A 1UNLA 4IFGA 3FBVA 3GNIB 4FI1A 4L3LA 4C0TA 3PA3A 5A3XA 5EDQA 3MY1A 4TRLA 3FMDA 4HNFA 4I4EA 4HVSA 2R3RA 1Q8UA 3CD3A 3DFAA 3PE1A 2WTKB 5HBEA 2R4BA 3QA8A 3NYVA 4ANLA 4FG7A 2J90A 2C47A 4RWIA 3TCPA 2OK1A 2YIQA 3S00A 2BCJA 1KE5A 2ZJWA 2VTHA 3KRWA 3QQUA 5CS6A 4MWHA 5E8YA 2VTRA 1AGWA 4EC9A 4EOPA 5DBXA 4UWYA 2C6TA 3Q53A 2ACXA 2XBAA 5AX3A 4IJPA 1H07A 4ASXA 3KKVA 5HLNA 1BUHA 2PYWA 4FIJA 3UC4A 5DT4A 2QOLA 1IAHA 1VYWA 4YC8A 4YLLA 2JKQA 3GP0A 5IU2A 5A4QA 4BRXA 4E6AA 4R7HA 4TXCA 2IW6A 4ZJIA 4EOIA 1JKLA 2VU3A 2VRXA 3TJDA 2B9FA 2Z7QA 4M15A 2WIHA 3QKLA 2WGJA 4MQ1A 2UUEA 3FMNA 3WZUA 3IDBA 4YC6A 2HZIA 4K11A 4A06A 4U6RA 2PMIA 5JKGA 2QODA 3POZA 2CNVA 4C33A 1WBPA 1CKJA 1PXKA 4NT4A 4RGJA 2QVSE 2YAAA 3ORLA 4FYOA 4G2FA 4YPSA 4DG3E 3UJGA 4ZAUA 3FLWA 3KCFA 3MS9A 4QD6A 5C8KA 3U8WA 4P2KA 4FSWA 3KN5A 3W2RA 4IADA 1GZOA 3UTOA 4DLJA 3R01A 3IPHA 3GVUA 3R7VA 4KIOA 2FVDA 5IPJA 4O7TA 1AQ1A 3HUCA 4ACGA 4PTCA 2H9VA 4EH9A 3MVLA 4LL5A 4D1XA 1YOLA 3TJCA 1BX6A 4RIYB 3WBLA 3QKKA 4QPMA 4APPA 4XJ0A 2Z8CA 5HORA 1KOAA 3C4FA 3FQHA 3IGGA 3L9MA 4IX6A 3GU7A 3IDCA 4G3DA 3BLRA 3L1SA 3PSCA 5EQPA 3NAXA 1URWA 2X39A 3QTQA 2B55A 4TYIA 3ODZX 1GZ8A 4BCOA 4AW1A 4E7WA 5GINE 3DXQA 2OSCA 4OTRA 3U9CA 2YM4A 4ZTMA 3LCDA 4O83A 4KD1A 5IEVA 3Q2JA 4U7ZA 5JRQA 3VS2A 4FSUA 4I5PA 4X21A 1UA2A 1G8AA 3P79A 4NL0A 1WBOA 3VUMA 5L2WA 5EW9A 2VO6A 2WTIA 5CF4A 4HOKA 3ZSGA 2Z7LA 2VTSA 3LLAA 1LEWA 5AV0A 2WMAA 3TV6A 1BL7A 4PMTA 4F0FA 4FMQA 3KY2A 4JBPA 3A7IA 3G0FA 4MNEB 3K5VA 3ZEPA 1DAYA 2I40A 4V0GB 3NUAA 4G16A 1MQ4A 2A1AB 2JFLA 5AR4A 4BTFA 5DOSA 3U54A 4CKJA 2IWIA 2WNTA 3ZYAA 1ZZ2A 2C5NA 4M97A 5KMJA 5AV3A 4NW5A 4A07A 1OMWA 3HNGA 2OFVA 1OIQA 2WO6A 3VW8A 2HYYA 3HRCA 2V7OA 3EFLA 3EKNA 2HZ4A 2VZ6A 3B8RA 3TTIA 4D1SA 4TKSA 3R9HA 4IQ6A 3GC7A 4G31A 1CM8A 2HXLA 3CQEA 5ETIA 1SYKA 3FI3A 2EU9A 4LG4A 4S31A 2W1IA 3ZDIA 2Q83A 3CR0A 3H0YA 5J87A 4IBMA 3AC2A 3R7IA 3F3UA 3DB6A 2XCKA 4V04A 5HTBA 3QUEA 2IO6A 4IB3A 4L6QA 5HG7A 3MJ2A 3ZMMA 3II5A 4I3ZA 1JNKA 4NKSA 1FMOE 4QMVA 2JKOA 3O7LD 5F94A 3VUDA 4O7ZA 4MXZA 3RZFA 3UO5A 2HW6A 4KIKA 2ZB1A 3E63A 2XBJA 2KTYA 4TN6A 4BGGA 5HNIX 4IWOA 2WTWA 4LUDA 2EUFB 4F6WA 4PTEA 3LFSA 4E93A 3TG1A 3E88A 3RWQA 4JR7A 4ZZNA 2GHLA 4U42A 4CCBA 4YTFA 5M57A 1KE9A 3UGCA 5FXQA 3OCGA 4J8MA 3DAKA 3TKUA 2F7XE 1PMVA 4DTAA 4M69B 4NM7A 4ITJA 1M2RA 2OJ9A 4D2SA 5EI8A 5HU9A 4G9CA 4E20A 3BE2A 3UIUA 5KMLA 4F0IA 5DR9A 3UPXA 2G15A 3LZBA 3TNQB 1PXLA 4WBBB 4CTBA 1OKYA 4FKUA 5D11A 4AGCA 4G9RA 1M2QA 2XNMA 4A4LA 3QC9A 5J7BA 3FUPA 5HO6A 4GKHA 4FSMA 4CV9A 2PZIA 2CGXA 3EQIA 4KNBA 2V5QA 4FTLA 4RJ7A 3EN5A 2JDSA 3JXWA 3MDYA 3O8PA 3UIXA 3CIKA 4BHZA 3UMWA 3C4XA 4FSYA 3FSFA 1PXMA 3D83A 3A8WA 3DKOA 2W1FA 4TNDA 1JSTA 4IXPA 4A9UA 3KFAA 3P0MA 4NJDA 3QQFA 2QG7A 3D5VA 4AA0A 5E91A 4QMTA 4U45A 3VBTA 5E8TA 3O96A 5I9XA 3FZSA 3IONA 5HE3A 1Q3DA 2UVYA 5AA8A 3HA6A 3S1HA 4WG4A 3BU3A 5EQEA 4XRJA 5CAQA 2IW8A 5B7VA 2YDKA 3R8ZA 4U97A 4CFXA 3ACJA 3KRRA 5I9UA 5I9ZA 3VJNA 3UBDA 2PUUA 4PWNA 5C27A 4I23A 1OPLA 5KMMA 3SRVA 4H39A 4IAKA 2R9SA 1SMHA 2X6DA 3A4OX 3R8LA 3ACKA 4X7QA 4EOJA 3PXFA 4QMQA 1PMUA 2JAVA 3PXKA 4FL2A 2AC3A 3RPOA 2HIWA 3LFQA 5M4IA 1WCCA 2YCFA 4X3JA 3ORPA 3R28A 1SNUA 2JD5A 2VAGA 4P90A 1FVTA 1B38A 4DCAA 2QONA 3CTHA 3WIGA 5FG8A 5M55A 4NH1A 3E87A 3DCVA 4O0YA 3DOGA 2ZYBA 4RWLA 4Z7HA 4M68A 5L2TA 2HELA 3OG7A 4FV1A 1YI3A 4FIGA 4FZAB 4UMUA 3HAVA 1XH7A 2YM3A 4FZ6A 3C9WA 3EZVA 4O2ZA 5HOAA 5E4HA 5IQDA 2BRMA 5CVGA 2QKRA 5D7VA 2WMVA 2QOOA 3R7UA 4YNEA 4IACA 2JIVA 5CT0A 4FK6A 3DK3A 3F2AA 1OL6A 3U4WA 4EWHA 3AC5A 2GQRA 4TWOA 3MH2A 4B99A 4L68A 2XYNA 3DPKA 4UZDA 4CLJA 5EYDA 4RX7A 3SG9A 5FM3A 4Z55A 2YERA 4O21A 5M44A 4FEXA 4ZXTA 4UYAA 2B53A 5FEEA 3HAMA 5BYLA 5HX6A 3AD6A 5M4CA 1UVRA 5J5SA 4C34A 5JH6A 3R7EA 1OL5A 3CLYA 3NDMA 4DH8A 3R6XA 2Y6OA 3NSZA 4XP3A 2C3JA 4CV8A 2ITOA 4J52A 5LVMA 2CKQA 2W1ZA 4I20A 3WILA 3NNVA 5JGBA 2WKMA 3C0GA 5BNJA 4DE4A 5ETFA 2X8DA 3L8XA 1FQ1B 4ACDA 5D9HA 2PVRA 4O0UA 5DH3A 4O22A 3I0QA 4ZS4A 4G6OA 5DWRA 3VO3A 3OHTA 5JQ5A 4AOIA 5CEIA 3QALE 4RVLA 4FKQA 5E8UA 2P3GX 3D94A 3ZEWA 4KWPA 1M2PA 4YUQA 3BV3A 4JQ7A 4ZP5A 3DDQA 4XG4A 2C6EA 4RJ6A 3E5AA 3LQ3A 4KIQA 5FBOA 1Q5KA 2YJSA 2RG5A 1M7QA 3FMJA 1UKIA 3O71A 3EFJA 3ZBXA 3OXIA 2CKOA 2WPAA 1KE7A 3JUHA 2IVTA 4IX4A 3RBWA 1CDKA 5EW8A 1ZWSA 3DDPA 3IW6A 3LFEA 4BCKA 3VVHA 3LFNA 3A61A 5C8MA 2R3IA 4I94A 4JL9A 5I9WA 4YHTA 3A7HA 4IHPA 2R64A 5ANKA 3LFDA 5EI6A 5KE0A 3OP5A 4BR3A 4CZYB 1BI7A 3E3PA 3MN3A 4WT6A 4LMNA 3S2PA 1HCLA 5C01A 4CMTA 4GG5A 3QXOA 3Q9ZA 4LV8A 4TW9A 4BCPA 2RL5A 1ZARA 2C5VA 4WD5A 3CY3A 3E7OA 5HBJA 2QO9A 4RG0A 2X7OA 2Y6MA 4UMPA 4I5HA 2FA2A 4RFZA 5IA5A 2X4ZA 2VTMA 2VTTA 2Y4IB 4YZCA 4GK3A 2Y8OA 3R7YA 1OIRA 5BUIA 2X1NA 3PWDA 1FINA 5JFVA 3HV3A 2Z7SA 4EL9A 4ZJJA 1KE8A 1OBGA 4OAVB 4J1RA 4BTJA 3CPBA 4QP3A 5BQ0A 3LKMA 3VS3A 3CEKA 3DBQA 4M13A 4F9BA 3LCKA 3V6RA 4O0TA 4F6UA 1IAJA 2QC6A 3C4CA 2FH9A 2AYPA 4S2ZA 4YJRA 4FR4A 4H3QA 4RC4A 3EQDA 4KKEA 4M0YA 2UW3A 3TI1A 2C6MA 4CVAA 3OUNB 2ITPA 3R7GA 4RA5A 4F7SA 2EXEA 2X7GA 1FGKA 3AT4A 3FSKA 3PSBA 4NM5A 2W17A 4BCFA 1VEBA 4XG3A 4PF4A 3R9RA 2GSFA 2BTRA 2GS7A 4KIPA 3MTFA 4ITHA 4KSPA 5CF6A 3NAYA 3RI1A 2W06A 3KF4A 4C35A 5HO7A 4TYEA 1YRPA 3FY0A 3HMNA 4M67A 4USEA 3C4EA 4W4WA 1XWSA 3BGQA 4BC6A 4PP7A 4XBUA 2OZAB 3G33A 5CXHA 3PPJA 5H8GA 5HZNA 4CG9A 3HZTA 5M09A 5AP2A 1RW8A 2GHMA 3OBJA 5FEQA 3TM0A 3MW1A 2V0DA 3VBWA 3Q5IA 4QMUA 1W84A 3F2NA 3KL8A 5ANGA 2HK5A 3O17A 2CKPA 2OXDA 1RE8A 3RALA 4DFXE 2OZOA 3EYGA 4JBOA 5HTCA 5CNOA 3FJQE 5CU3A 3SW4A 2P4IA 3N9XA 4KKGA 1XBBA 1ZMUA 4BGQA 3F7WA 1OGUA 3AD5A 1Q3WA 4LM5A 1SM2A 4NJ3A 4F9AA 3UYTA 4ALWA 3SOCA 3HDMA 3LQ5A 3PYYA 5IH5A 3MFRA 3FZPA 2YM5A 5ANJA 2BAKA 1MRVA 4RIOA 3B8QA 4ACMA 4O7NA 3V04A 3RNIA 5HICA 3P7CA 3ODYX 4QTBA 3FHRA 5DN3A 2G2FA 5DLSA 5JSMA 4CCUA 2A19B 4YJPA 3FMKA 3PXRA 1FBNA 3DQWA 2DUVA 2XM8A 1J3HA 4GJ3A 4BDDA 3KK9A 4AU8A 4D9TA 5L8KA 4XV3A 4L3JA 3ORKA 5C8NA 3BLHA 4RMZA 2JAMA 4KIKB 3VS5A 2WTCA 3NUYA 4MQ2A 2GFCA 2QR7A 4JI9A 4JG7A 3S0OA 5KZ0A 3ZRLA 3KULA 1J7IA 1G8SA 3NIEA 4QYYA 4BCIA 2WFYA 4MH7A 4WRGA 4WHZA 5GIOE 3TXOA 1WAKA 4I0SA 3LFFA 2O5KA 4RQVA 4XLIA 4XNEA 5C4KA 2QQ7A 5BVWA 2I7QA 2R3NA 3RPSA 4RIXA 4RJ5A 3HRBA 4FG9A 4GYIA 2P55A 3G9LX 5AMNA 5HKMA 1PYXA 2W5HA 4ASDA 2C30A 4HYHA 1E9HA 1PY5A 5HEZA 5M07A 2Y7JA 1TQPA 1UU7A 2CCIA 3QRKA 5C26A 3UG2A 3U87A 5LMKA 1IEPA 2X4FA 1E1XA 3DTWA 3QRJA 4JG8A 5IQGA 3CGFA 4XCUA 4QPAA 5CSPA 3PA5A 4JIAA 2W4KA 5EHLA 1KOBA 4FIHA 3L9PA 5FD2A 4JBQA 3WF5A 2CN5A 3CQWA 4YJTA 4MXYA 3FZOA 3T8OA 2PWLA 3HGKA 4AQCA 1MUOA 1O6YA 3IW8A 5JFSA 3A7GA 1P2AA 3BYMA 4GFGA 2QOCA 4OAUC 3PY1A 4C37A 4FSZA 3KF7A 3ZO1A 1PYEA 1DI9A 4AN3A 4CMOA 2J7TA 1XH4A 2SRCA 4IEBA 5HVYA 5FXRA 4O82A 5GNKA 1OVEA 4D4SA 3F7ZA 4FTJA 3KEXA 2J0KA 2CCHA 3ERKA 3OS3A 4WOVA 4XG2A 1YKRA 4DEAA 4TL0A 5IQIA 5AX9A 2G01A 2YCQA 3RAKA 2YFXA 4DT9A 3AOXA 3WI6A 3ZBFA 2OI4X 3CCNA 3SAYA 4F99A 4O27B 3DKFA 3V6SA 3AT3A 2JBOA 4O0SA 5HLPA 1H26A 5LCJA 4TYJA 5HBHA 4D2RA 3GCPA 3ZFYA 5L6WL 4KSQA 5K5NA 1PXOA 2J0JA 3GI3A 2XK3A 1O9UA 3F88A 1LUFA 3ORXA 3FZ1A 3R30A 3WZEA 2GQGA 4BWXA 4LGHA 2XK6A 4CD0A 2R3KA 4PTGA 4R78A 1UV5A 4E5BA 4H58A 4BI1A 1YDSE 4MBLA 4E4XA 3CJGA 4IM3A 2V7AA 5CASA 3VWAA 3CKWA 4EH6A 4WBOA 3EB0A 5E8WA 3TNWA 2I0YA 5IG1A 2BDFA 3M2WA 3O23A 4LOPA 3TEIA 4BWKA 4BDEA 1FGIA 2VNWA 5M56A 5D12A 3LMIA 2VWXA 2JDOA 2W1HA 3TUDA 4A9TA 4PV0A 3G51A 2J9MA 3IK3A 2YZLA 4HNIA 3EWHA 1IASA 2GS2A 2BTSA 4CFNA 3UNZA 5EYCA 4TPTA 1ZLTA 1GJOA 3OEFX 3VF9A 3WIKA 4OTIA 3VS0A 3I6WA 1M14A 1SZMA 4C4EA 3IS5A 5EQYA 4PDSA 5IEYA 4RSSA 4F7JA 4O91A 3NRMA 4YO4A 4FV2A 1OL7A 3MGYA 4AW5A 5KHWA 3ZUVA 5A9UA 2GCDA 2JDTA 3EN7A 3RCJA 3FMEA 3EQCA 2C6LA 4IMYA 2VWUA 3MA3A 1WVYA 2R3PA 4C38A 3E93A 1BLXA 3HECA 1L8TA 1REJA 5CT7A 1VYZA 2OG8A 5BUJA 5EG3A 2R0IA 4FUYA 2BALA 4IANA 2VNYA 3FY2A 1P14A 4I93A 3C5IA 3COKA 4WKQA 1J7LA 2BZHB 4U81A 4ZTHA 5AUUA 3QFVA 3CTQA 1K2PA 3L8VA 4NUSA 3ZC6A 5FLFA 4NZWB 3SDJA 5HX8A 5K4IA 3O0GA 1IA9A 4N4SA 1OB3A 4L42A 4YNOA 4ACCA 2A2AA 4D1ZA 5F9EA 3HMPA 1LR4A 1YWVA 3KVXA 3QZGA 3E92A 3LM0A 3FLQA 4XV1A 3H9RA 2PY3A 4XX9A 4YZMA 4ANOA 4HPTE 5L4QA 1NY3A 4YJUA 4EK3A 4I41A 2W99B 5AR8A 3V5QA 2W96B 3C0IA 4BCMA 4NFMA 5CYIA 5AADA 4KBKA 1YI4A 3TV4A 3N4VA 1MP8A 3UOLA 1REKA 5K9IA 4BDFA 4LV5A 4O7WA 3SW7A 5AA9A 2B52A 3NUPA 4FSTA 4QP1A 4DINA 4FKSA 3NCGA 5CEMA 5DYJA 5HTIA 2HW7A 4K6ZA 4QP7A 1YHWA 5IISA 3PXYA 4FK3A 4L67A 5T3QA 3QD0A 3E3BX 3FQEA 3HA8A 4U3YA 4JBVA 4E4NA 5CAPA 3HVCA 3CE3A 3JS2A 4V05A 3KRXA 1PXJA 5HIDA 3PSDA 4FSRA 3ZU7A 1L3RE 4CFWA 4HCVA 4FTQA 4KUJA 4I24A 5CEQA 2J5EA 1YW2A 4IZ7A 4JX7A 3KQ7A 4KBCA 2EVAA 4D0XA 3FXWA 4AOTA 5IF1A 1ZRZA 2CHLA 2PPQA 4NSTA 5AUZA 4XS2A 4XP2A 4EKLA 5L2IA 3H4JA 4GT3A 3D5UA 4IJ9A 5EM7A 4D2PA 4ZLOA 3TIZA 3BYSA 3LCSA 3QCYA 2CLXA 4FEUA 2NO3A 2WOUA 5AEPA 3PVWA 4IVDA 3NUUA 4R1YA 2UZLA 3F3VA 1PKDA 1YQJA 4AA4A 5CQWA 2PZYA 2W7XA 2BZIB 4ENXA 3LMHA 1PKGA 5AP3A 3H9FA 4C36A 4JXFA 3FLYA 3NGAA 4X2GA 4FVPA 1WVXA 3DK6A 3Q60A 3OXZA 2ITWA 3TNPC 4R3RA 3ZZWA 2J5FA 3GFEA 4ALUA 3QQJA 4FC0A 2A27A 5CF8A 1F3MC 1YHVA 2FSTX 4QMMA 5KBQA 5CSHA 1OBDA 3LJ2A 3D7TA 3KMWA 2XF0A 4GRBA 4H3BA 4QO9A 4ZTNA 4OTQA 4G3EA 4TNBA 5IZFA 4QMPA 5GIPE 4EK6A 2YWPA 3PPKA 4Q5HA 1PW2A 3C50A 1G3NA 5IQHA 5DR6A 4ALVA 4RVKA 4XUFA 3W18A 4YSJA 3EH9A 4AGUA 2VN9A 4MX9A 3NW6A 2CGUA 4U5JA 4UWCA 4X3FA 5AAEA 3MH3A 2PUPA 3D2KA 1UWHA 4FL1A 5ANEA 1H1SA 1OZ1A 1UNHA 1OI9A 4E8AA 2UV2A 4UMQA 5G1XA 3ZM4A 2FO0A 4L46A 5LMKC 2NRUA 2WMQA 3WYYA 3OMVA 4D4VA 4FTMA 1V0PA 2QU6A 4L9IA 2CDZA 4DH5A 3FXXA 1EH4A 4EK4A 3R21A 1XBAA 4DHFA 5FTOA 4Y5HA 3WF6A 3TN8A 3ULZA 4GK2A 2OJFE 2X81A 3P7BA 2GQSA 4K18A 2C6IA 4FKGA 2P0CA 5DHJA 3FDNA 1FVRA 3ORIA 3PIZA 4JDKA 2ITTA 2WTVA 4WUAA 4RZWA 4XV9A 5B2MA 3ATSA 4BDAA 4ENYA 4BKJA 3OOGA 3QBNA 4CYIA 4DGOA 3LJ1A 3PFQA 1H1QA 4FIEA 4FF8A 3QD3A 4BCHA 3QTUA 2WEVA 3KGAA 4BGHA 3FL4A 5I9YA 4O7SA 1LP4A 3L8PA 4R3CA 2VD5A 4DFNA 5J7HA 3IOPA 5I3RA 5J8IA 4Q9ZA 3ZDUA 4UBAA 3FMMA 5BYZA 2VWWA 3I5ZA 3REPA 4AS0A 4LQMA 2AC5A 4RVTA 3SVVA 3TNIA 3EKKA 5JZNA 3QU0A 3UNJA 4FG8A 3P08A 4O0VA 5A4LA 3TKHA 3QQGA 3SX9A 1YXVA 2JKKA 3AD4A 1UU9A 3QGYA 5A4EA 4RIXB 3QRTA 3CXWA 4ZSLA 4ANSA 2HWOA 2GNGA 1VR2A 4QP4A 4R8QA 5EH0A 2XM9A 3E8DA 5CX9A 3ZONA 4QYHA 4EONA 4I1ZA 3FEGA 1O6LA 4EH7A 1UNGA 3LW0A 4OUCA 4EQCA 4ZMEA 4RBLA 3ZO3A 3EQPA 4GU6A 2PZRA 4J96A 4QP9A 3EL8A 4CGAA 3HP2A 4CNHA 2Z2WA 3AC4A 1DS5A 4HVIA 3DFCB 5FWKK 2W5BA 3DAJA 5CI6A 2WU6A 4AWIA 4DH3A 3RZBA 4C02A 1JVPP 4FV9A 4CLIA 3C0HA 4I92A 4M84A 4E5AX 3AC3A 4FTCA 4XOZA 3LXKA 2CNQA 4ZSEA 3TZ9A 2QHNA 5HU3A 4YJOA 3SV0A 3R2BA 3P23A 3F6XA 4BCGA 3R00A 1H01A 2Z7RA 4ZSGA 4HVGA 4PRJA 2YISA 3GQIA 5DFPA 4R77A 3RKBA 4EKKA 4FV3A 2FSMX 3LQ8A 3F3TA 2YIXA 2W5AA 3G6HA 2WB8A 4UB7A 2WTJA 2OJJA 3EZRA 5HLWA 3D0EA 3Q4ZA 4U9AA 5CI7A 1NVRA 3TTJA 3MI9A 3UPZA 4YZDA 5FTGA 3O7LB 4QMNA 2W0JA 4DBXA 2F9GA 1TQIA 2IZTA 2XCHA 3EQFA 3IW7A 4QMZA 3K2LA 5F20A 3UODA 4CQGA 4YTCA 4QRCA 4X2JA 5IA1A 5IMXA 1H25A 3UDBA 4ANBA 3KXXA 2REIA 3AC8A 1U46A 4E4MA 4R7BA 4DEHA 3A7JA 4XG9A 3VRZA 5HCYA 4U8ZA 1DI8A 4O96A 4XV2A 3VS4A 4HVHA 2OICA 3F82A 4PL4A 3V8WA 4F64A 3TDVA 3QZIA 3VUKA 3Q52A 3WF8A 4EH3A 2XH5A 3OW4A 3BWJA 3COHA 5HIBA 3UZTA 3TZ7A 4EHVA 4O86A 3VJOA 5ACKA 3IW5A 3H0ZA 4AN2A 2WMXA 3JY9A 4H05A 3A62A 2JITA 2YAKA 1GZNA 3MH1A 4ZTLA 4IAYA 4WG5A 4DGGA 2PU8A 4D28A 4GG7A 2VO7A 4LOQA 2VTJA 4RWKA 3D2IA 4U41A 2R2PA 3C4ZA 1ZOGA 3HMMA 4IE9A 4JQ8A 5ANOA 4H1JA 3A60A 2QR8A 4YHFA 2QCSA 5GZ8A 2VTNA 3Q9XA 1ATPE 2JGZA 4LGDA 1JLUE 3EQRA 4IWQA 5HG8A 2VTQA 3TKIA 3WZKA 2QOFA 3NIZA 4BYIA 3MIYA 5EM6A 3KC3A 2QG5A 3BPRA 5H8EA
chains in the Genus database with same CATH superfamily
3EN9A 3FI8A 2VWBA 3ZM9A 4GVJA 4S32A 5H9BA 3BELA 5IMEA 1VJYA 3UMXA 2I0VA 3PUPA 2FUMA 3AC1A 3VBYA 4AUAA 3W16A 4XBRA 5AFVA 2WQOA 1ZXEA 3OY3A 3D5WA 3QYWA 1Q62A 2HXQA 3PJ8A 2OO8X 3HV4A 3BX5A 3S4QA 2OH0E 4KB8A 3VF8A 4Z16A 4CRSA 4B4LA 2KULA 3R7OA 1FOTA 4QNAA 4F6SA 4O7RA 4NK9A 4ZOGA 1WMKA 4U40A 1H1PA 3BWFA 5A6NA 1UU3A 5DMZA 1JBPE 4FKTA 5T68A 2E9PA 2ZVAA 2GNHA 3CBLA 2BRHA 1H00A 3UDTA 3OTUA 5DEYA 3NPCA 4NIFB 2F4JA 4RJ3A 3RK9A 2YITA 5L2QA 3BKBA 4AG8A 4G6LA 2R3LA 3F61A 4KS7A 3CQUA 3ZO4A 3ZZEA 3FLZA 4PL3A 4A9RA 2BDJA 4F7NA 3W8LA 3QQLA 5KBRA 2VTPA 5JN2A 5GHVA 2PZPA 1ZMWA 4DYMA 5I4NA 3CD8A 3DNDA 5AIRA 1STCE 4B7TA 3RM6A 4EUUA 1JKKA 2XNBA 3VS7A 4NU1A 3Q2MA 3LVPA 3OCBA 1W2FA 3MYGA 3K54A 3RCDA 1JKTA 4I22A 2F49A 4QYFA 4IAAA 3W55A 4JRVA 1H24A 2XK8A 3QYZA 3BCEA 4IX3A 5M08A 3PJ3A 1WBVA 2QHMA 3E8CA 2J51A 2YDIA 4WNKA 1PXIA 3OT8A 4J7BA 2BHHA 2FB8A 2QLQA 4OTGA 3O2MA 4BBEA 3DTCA 4W4XA 1P5EA 4X3FC 4YR8A 1H8FA 4UXLA 5IDNA 3ET7A 4IDTA 4C2VA 5CEPA 3MTLA 5AWMA 5HGIA 2V22A 2ZV2A 3Q5ZA 4DTKA 2XEZA 3NMUF 2X2MA 5GJGA 3EQHA 3UIBA 1BKXA 3MVMA 4MBIA 4MXOA 4L8MA 4FVQA 3VUGA 3VQHA 5IQFA 1QPEA 1W7HA 4DFYA 5AUVA 2O8YA 4I6BA 4YP8A 2X7FA 1T46A 5CAOA 2E2BA 5J95A 3G2FA 4FICA 4O4CA 3VS6A 2OWBA 3FLNC 3BQCA 3MA6A 3M11A 4IC8A 3Q3BA 4QOXA 4BDIA 4ITIA 2PVNA 3BL9A 1Y6AA 4MVFA 3LMGA 4M14A 3FE3A 2EB2A 2X6EA 4N6ZA 2PMLX 3EFWA 3V8TA 3EQBA 2GMXA 4H36A 2Y4IC 3KXGA 3DBDA 3E64A 3LXLA 3QD4A 4HCTA 3DBEA 1GOLA 4W8EA 4W9XA 3W2PA 4ANNA 5KMNA 3ORZA 5IUIA 2BRGA 4AN9A 3PDTA 3PE2A 4XLVA 4OR5A 4RA4A 3WE8A 2Q0BA 4F65A 3FMHA 2YWVA 4B6LA 3V5TA 4CQEA 5JT2A 3W32A 1LEZA 2I0EA 2PMOX 2R7IA 1JQHA 3TIYA 4PNKA 2XANA 4ZSJA 4L01A 3R83A 3E8EA 3D9VA 4JRNA 4FNYA 2BIYA 5EW3A 4G5PA 3DJ7A 3OWLA 5KX8A 2ITUA 3PY0A 1J91A 4R6VA 2C69A 4GUBA 2VTAA 1OIYA 4DGNA 3EIDA 5JK3A 5GJFA 3W0MA 3WYXA 4FZDB 2ZOQA 2ONLA 3DJ6A 4L52A 5EM8A 4XMOA 4BWPA 2QOKA 3G0EA 3UOHA 3RWPA 3NVMB 5FGKA 4PPAA 4PMSA 5HVJA 4XG8A 5HO8A 5M06A 3OEZA 4EEVA 4YJSA 3DK7A 4I6QA 1MRYA 3K5UA 1JPAA 4TYHA 5EHYA 2YHVA 4ZIMA 3R2YA 3UNKA 4ZSAA 3IOKA 1X8BA 3BGPA 5BVDA 3ROYA 4AA5A 1XQZA 3L9NA 4MEDA 5FBNC 2XRUA 3NR9A 4YJNA 5AP1A 3PRFA 4S33A 5M51A 5FDXA 2XEYA 3UOJA 2BIKB 2H96A 1U5RA 2V55A 3HV5A 3MH0A 3O8TA 1OGYA 3DJ5A 4FVRA 4LYNA 4ORKA 3IQ7A 2O2UA 1RJBA 5EHOA 2GFSA 5CVHA 3HEGA 3I7BA 4XV1A 4U44A 5TE0A 4EBWA 1Y6BA 4G3FA 5TF9A 5E8VA 1Q41A 5HE1A 3UYSA 1QL6A 4F0GA 2WMSA 2LAVA 4JX3A 4QYEA 1IA8A 1XH5A 2BVAA 1MQBA 2XS0A 2QLUA 5E7RA 3H10A 4ZLZA 4HGSA 2YM7A 1PHKA 2DQ7X 3JVSA 3ZFXA 5LVNA 3PWYA 4FTRA 3ENMA 1V1KA 4OTPA 3ALNA 2YDJA 4RRVA 4YLJA 5E8ZA 3SC1A 4FTNA 4EH8A 1U54A 2UW0A 2R3FA 4J71A 3T3VA 4DN5A 3MESA 1A06A 3DV3A 4R5SA 3WZJA 3BU6A 1U5QA 5BMSA 3QAME 4YZNA 2F7ZE 3ZLXA 5AIKA 4OTWA 3BIZA 4YC3A 4DH7A 4XEYA 4Q9SA 3V5WA 3GCUA 2G2IA 2VTOA 3FWQA 3UVPA 4G5JA 4C4GA 5LQFA 5EKOA 4BCNA 2W1EA 3FL5A 2NPQA 3QLGA 2GU8A 4E4LA 4EOLA 3QF9A 1Q99A 4FV4A 1CMKE 2WMUA 3I81A 4FSQA 3RHXA 4CXAA 4NWMA 2PK9A 4JT3A 3GFWA 1U4DA 5E90A 3JR1A 2E9VA 3RP9A 3U55A 2CN8A 4NM3A 2XK7A 3GU6A 3VIDA 3SXRA 4LGGA 5AV1A 4L53A 1H08A 3F3WA 5TOZA 1B6CB 4FT7A 3QHRA 2PUIA 1ZY4A 4GW8A 5AAGA 4KABA 4MWIA 1P4FA 1W98A 5F4NA 5AUXA 5LXMA 1IR3A 1XKKA 2PE0A 3VS1A 4BIEA 4RIYA 3ANQA 2ZV8A 3RK7A 3TZ8A 5JFWA 5J1VA 2BROA 1FVVA 4J99A 5A4CA 4BDBA 1QPCA 3G6GA 5CQUA 3QCQA 4D2TA 1GNGA 4FSNA 1QCFA 4XG7A 4EI4A 4EC8A 5LVPA 3VNTA 3HUBA 3OW3A 3FPMA 4YJQA 2BFYA 4NEUA 3OROA 3ZC5A 4CRLA 4QMOA 3U6IA 2EB3A 4B0GA 5CF5A 1Y8YA 1YDTE 5A6OA 4IZAA 5H2UA 1R0PA 3D14A 4N0SA 5D1JA 4C2WA 4DFUA 3Q6WA 4WIHA 5J79A 2J6MA 2A4LA 4IIRA 4I6HA 3F5PA 3HYHA 5KMIA 1NVQA 2LGCA 1M7NA 3AKKA 5L2SA 4BI0A 4E6QA 1GZKA 2R3MA 3MJ1A 4HYUA 4O6LA 4ZTQA 4EJNA 5J9LA 4AACA 5DI1A 4YJVA 5IH4A 4XG6A 3MIAA 4GJ2A 1GIJA 4B8MA 3PJCA 4RLLA 4FEVA 3PRIA 3BYUA 3UIMA 5KKRC 3W0SA 3QC4A 3ZTXA 1JAMA 4QTAA 4MNEA 5IA4A 5H3QA 2GPHA 4OBPA 4V0GA 1BI8A 4Y83A 4ZEGA 3EMGA 4AW2A 3U6JA 3C51A 4AFEA 1H28A 2UZTA 3Q32A 4FTAA 4OT6A 2UZVA 4GT4A 2QOBA 4GUEA 5DT3A 2VUWA 3UOKA 3PY3A 3QGWA 1SVEA 2QD9A 3O50A 2AEGA 3T3UA 2PZ5A 3QUDA 5LCKA 5I3OA 2OJIA 1WBNA 4NKAA 5IH6A 1NW1A 1CKPA 1Q8YA 2OIDA 3OCTA 2RIOA 4BDHA 4JJRA 2VX3A 2RFDA 1XH9A 1RQQA 3V5JA 5HD4A 4BICA 2H34A 4OT5A 4DDGA 3WE4A 3SRVB 1MRUA 5IDPA 3CP9A 5KUPA 4C7TA 4O38A 2AUHA 4BTKA 5ICPA 5J9ZA 1ST0A 4FL3A 2XJ0A 3ITZA 3Q04A 3D15A 5CEKA 5KHXA 1SNXA 2XIKA 3P4KA 4GL9A 2B1PA 1H0WA 2JIIA 3QTRA 5EM5A 4PMPA 2RGPA 4O4DA 1V0BA 1H1WA 3BBTB 4PDPA 3U51A 4I21A 5CNNA 3TUBA 3GXLA 5KO1A 2WIPA 5HD7A 3M1SA 3MY0A 4EH5A 4Y8DA 3UP7A 4BKYA 1Q8ZA 3DZOA 2F57A 4RWJA 3FC1X 4IX5A 5CAUA 4AOJA 5L8LA 4FNXA 3BGZA 4HYIA 3GCVA 3MVJA 2YM6A 3RAIA 4EK8A 4K0YA 4ZZOA 4II5A 3R8PA 1OL1A 4NFNA 3QTSA 1SVGA 3NX8A 4MBJA 4MHAA 5CSWA 4D4RA 4EHZA 2CKEA 5J9YA 4M69A 3P5JC 2CMWA 1G8KA 4LDTA 3LIJA 4FOBA 4GFOA 3THBA 3LXPA 4UX9A 2HZ0A 3PZHA 1YI6A 3B2WA 4PPCA 3F5UA 4FV7A 4BTMA 3L8SA 1QPDA 2ZFYA 4F70A 2P2HA 2ONLC 5FTQA 4PUZA 3SD0A 1H1RA 4FEQA 2JFMA 3P9JA 4AXDA 2YCSA 3R8MA 4C4JA 3OD6X 1CKIA 2DWBA 2OIBA 4J98A 4O0RA 3UC3A 4W9WA 3V01A 3LCOA 3R71A 4CEGA 5BVEA 5B2LA 1KV1A 4BF2A 3O51A 3BHHA 4X0MA 5D41A 5IA0A 3EN6A 3GU5A 3ANRA 3CJFA 3HV7A 3QUPA 4FT0A 2H8HA 2E9NA 4Y85A 3I6UA 4Z7GA 1Q61A 3C4WA 3BEGA 3NFGB 4U43A 3U9NA 1URCA 3NNXA 4E3CA 2F7EE 4EQUA 3NS9A 4EQMA 3COIA 4FODA 4ASZA 3UO6A 2QO2A 3Q6UA 4HGEA 5EDPA 1A9UA 4ZY4A 3PIXA 5TKDA 4TWPA 5LMBA 3SHEA 3F5XA 3PJ1A 4E6DA 5LMAA 5DNRA 4GEOA 4K2RA 3A2CA 4LRKA 3H30A 2Q0NA 4JDHA 1NXKA 3DU8A 3GENA 4WUNA 5AP7A 4DGMA 5AUTA 4GVAA 4LOOA 2BILB 4GU9A 3ZRKA 4EOOA 2I0HA 2ITZA 2WQNA 1BYGA 5HNBA 5K0KA 2JIUA 4IM2A 4FKIA 3RHKA 4EOQA 4S34A 2F2CB 4D58A 4CKIA 2EXCX 4LUEA 5M53A 2WTKC 4YMJA 1PXNA 4NM0A 3RM7A 3AMYA 3ZUTA 5H8BA 2XRWA 3FI4A 2OLCA 1T45A 2ZM1A 3BV2A 3UVRA 3R04A 2BR1A 4RFYA 4RPVA 1PXPA 4IZ5A 2CNUA 4USDA 4AGWA 2YIWA 4IB0A 1QPJA 4MXXA 4WA9A 4Z3VA 2C5OA 2ZM3A 3Q4CA 4Y72A 4NW6A 3BHVA 5AP6A 3MVHA 3WOWA 5FDPA 1NA7A 1RDQE 2BHEA 2G9XA 3FYJX 4FGRA 2BKKA 5B0XA 2PHKA 3SGCA 4MKCA 3WF7A 4W4VA 4C8BA 4F63A 1J1CA 5CXZA 5TT7A 2B4SB 2O0UA 3A7FA 3FLSA 4YLKA 5CVFA 4D0WA 3C7QA 4X2KA 1ND4A 2R3HA 4EZ5A 4YBJA 3F2RA 3WF9A 2VTIA 3PVUA 4PNIA 5IA3A 2HY0A 2QOQA 3R1YA 5IKWA 2QOHA 4DEGA 2PVLA 3QQHA 3CC6A 3PTGA 4AX8A 5CU0A 3UG1A 1JOWB 5JGAA 5DGZA 4IWDA 3FYKX 4PX6A 3OXTA 5ANDA 2HWPA 4RVMA 4XOYA 2OF2A 5K4JA 4JVGA 2JEDA 1OM1A 2O3PA 3DKGA 3TMOA 5A14A 4FKOA 4RFMA 2G2HA 4OTHA 2IG7A 4AXFA 3GCQA 3UQCA 2XB7A 2XIRA 3LM5A 4D55A 4QDVA 2WELA 1YOMA 4MXAA 5AUWA 3ZHPC 5EOBA 1TFFA 4DF3A 3Q4TA 4U80A 3NWWA 2WHBA 2BAQA 3C5UA 1Q4LA 2UZBA 4K33A 5CTPA 3DY7A 3KXNA 2JLDA 3Q9WA 4TTHB 3PA4A 4IB1A 4D4YA 4TT7A 2UZOA 5LWMA 3UQFA 3MBLA 3IECA 2PE1A 4I0RA 2R0UA 4K8AA 4L44A 5K3YA 2R5TA 4YTIA 4LL0A 2YLEA 4U79A 2WMRA 5IQAA 3KN6A 1CSNA 4FV5A 5DRDA 2FGIA 2Y4PA 4LI5A 3V8SA 3ZLSA 3R8UA 3VAPA 3ZUUA 1U54B 4L43A 2BRBA 3POOA 3IKAA 3DB8A 3R9DA 4FNWA 2XP2A 3ALOA 4FV6A 4EH4A 3AXWA 4S30A 2PULA 2VGOA 4IDVA 2PVHA 5C03A 4C62A 4DFBA 3GQLA 5BMMA 3N4UA 5IQBA 4JAJA 4EHGA 3MFSA 3QCXA 4WNPA 3TV7A 3SA0A 4F9YA 2XNGA 4RX9A 2ITVA 5E1EA 5F95A 3I79A 3QWKA 5L8JA 3ZLWA 3LAUA 2BUJA 3KB7A 4O0WA 3ETAA 4YSMA 3VUTA 2BAJA 3UZRA 4DEIA 4GH2A 2ZMCA 3FKNA 2GNFA 4FV8A 4DH1A 1KV2A 4JIKA 4M7IA 2XKDA 3LFBA 5KMOA 4G6NA 4XRLA 2R3GA 3NZ0A 1YWRA 1QMZA 2C1BA 3DGKA 3PIYA 3FKLA 4AP7A 4EYMA 3RK5A 2J2IB 4QQTA 3OTVA 5JQ8A 3W0PA 3WZDA 3U6HA 4PDOA 4QQJA 4AZVA 4WSQA 5F1ZA 3HX4A 5LVOA 1TKIA 3PVGA 4L00A 2YIRA 5TR6A 4HVDA 3OWPA 4FT3A 3KRJA 4IH8A 4TYGA 4ZTSA 4DEEA 3NFFB 1YDRE 3BYVA 4AXCA 3KULB 4EJ7A 4IAFA 5DE2A 4QMWA 2WMWA 3EN4A 3GGFA 4XHKB 3W33A 4QTDA 4APCA 5HG9A 3HMIA 1XO2B 3IO7A 3TWJA 2YIYA 1ERKA 3EQGA 4FZ7A 4Y5QA 3CS9A 3SQQA 4F09A 2CSNA 4V01A 3ZXZA 4F4PA 3P78A 3QKMA 4FRFA 4XYFA 4Y95A 5CWZA 4BFMA 3CY2A 2OH4A 2J50A 4FTOA 4AFJA 1HOWA 3R63A 4FKLA 3NNUA 3OOMA 2H6DA 2JC6A 4UMTA 4QTEA 3NLBA 2WMBA 1R1WA 3RPVA 4EK5A 4B9DA 5I0BA 3OVVA 3GC8A 1A48A 2DS1A 3JYAA 2XJ1A 3R1SA 5DA3A 3W8QA 2WMTA 3RNYA 1XJDA 2OZAA 3KVWA 2XNPA 4ERKA 4MCVA 2YEXA 3K3JA 5HQ0A 5L6PA 1YXSA 1VZOA 2ETMA 5CEOA 1Q8TA 2A98A 3VC4A 5A4TA 5AP4A 3P5KA 4JR3A 1JSVA 4PY1A 4FTKA 1P4OA 4ZY6A 3LFCA 2XAMA 1B39A 2C4GA 2XKFA 4IAZA 4QMSA 1Q97A 3HLLA 3NYOA 4JOAA 1K3AA 5M4UA 4U3ZA 2XIZA 5AUYA 4N57A 5IEXA 1AD5A 3QZHA 4Q5EA 4JNWA 2BZJA 4P5QA 5HESA 1YXXA 2GNLA 3S3IA 3TACA 4G3GA 2FYSA 4DCEA 2Z60A 3DLZA 4RX8A 2UW9A 2XKCA 2GNIA 3R0TA 2ETRA 4LRMA 3PP1A 4ANMA 3FZTA 5AM6A 4FKPA 1JWHA 1S9JA 3KIOC 3DA6A 3I1AA 3MPTA 5GZAA 4ONAA 4YU2A 2C6DA 3MB6A 3Q96A 2W05A 2X8IA 4GYGA 3OZ6A 3W2SA 3PVBA 4EOMA 5JGDA 4G34A 3FXZA 1I09A 2CJMA 5BVFA 4IFCA 3I0OA 4I0TA 3H9OA 4DFZE 4CFMA 4HCUA 5AP0A 5CANA 3VHEA 4FZFB 5IUGA 3IGOA 4YHJA 3VQUA 1OUYA 2PE2A 4KA3A 2ZMDA 3ID6C 3H3CA 4C4IA 4MK0A 1KE6A 4QNYA 2ITYA 3GEQA 4A9SA 2JDVA 5D7AA 2B9IA 2B9HA 4USFA 3R22A 4D2VA 2ZM4A 2C0IA 3FQSA 5L6OA 3DXPA 1ZY5A 4HW7A 3PXQA 3ENHA 3QCSA 4LRJA 4AXEA 2QKWB 2OFUA 3OUKA 4E5WA 3ZLYA 2FSOX 4MXCA 4BDCA 1ZYDA 3I60A 4YBKA 4FIIA 2C0OA 4JAIA 2IEWA 5AR5A 5GZ9A 2BMCA 3CKXA 3W2CA 2WQMA 3C1XA 3ORTA 4AT5A 3PPZA 3M42A 3BHYA 4OTDA 3W0QA 3OC1A 2X8EA 4EORA 3RMFA 3LCTA 1OECA 2HOGA 5IUHA 1WFCA 3G15A 5AR2A 4O1OA 3VN9A 1R0EA 2YCRA 4CG8A 2ERZE 2J4ZA 2Z02A 2V62A 3A99A 2HY81 4ACHA 2GNJA 2CLQA 4RQKA 3PLAE 4FTIA 4GT5A 2QOIA 2XK9A 4J53A 4C4HA 3QX4A 3GBZA 3NUXA 2Y0AA 4IZYA 4AT4A 4E73A 4UZHA 4AGDA 2C6KA 3JVRA 3VUHA 4BDJA 4UWBA 1G8JA 2RFNA 2WU7A 3G5DA 2RSVA 4KKHA 3MSSA 1LPUA 3AMBA 5EDRA 5LVLA 4J97A 5D10A 2I6LA 4CFFA 1OPJA 1U59A 3DT1A 3NVKI 2ZV9A 4OTFA 5E8SA 1H27A 4OLIA 3TZMA 3VBXA 3N51A 3W10A 3AGMA 2C3LA 4A4XA 3GC0A 2BPMA 2X0GA 3NEWA 4BJJA 5EYKA 5CU4A 2NP8A 5FXSA 3F3ZA 4EYJA 1SVHA 2I1MA 4FIFA 2J0IA 2UZNA 3LFAA 3UQGA 4AZSA 2HAKA 3SG8A 3TNHA 3GOKA 2XMYA 4FKJA 4PP9A 4I5CA 5FRIA 4A7CA 4FOCA 5EK7A 1NVSA 2O64A 1R39A 2CGWA 2UZUE 3V3VA 3ZO2A 3NYXA 3D4QA 4FNZA 3MPAA 4FGBA 4O1PA 3PXZA 4R7IA 2DYLA 4D5KA 3OCSA 4EBVA 5BV3A 4X6RA 3HV6A 3UP2A 4GMYA 3VULA 3I7CA 1FPUA 3OF0A 4C3RA 4IVCA 5C4LA 2VO0A 2OU7A 3BHUA 4HGTA 2OXXA 4W4YA 4WSYA 3NUSA 4KBAA 4JG6A 4NTSA 5EFQA 2W1DA 4QMXA 4MD9E 4BZOA 3B2TA 3GT8A 3UVQA 5HCZA 3KRLA 4BYJA 4CMUA 4ANQA 4KRDA 2IZUA 1HCKA 3V51A 2WQEA 4MAOA 4ERWA 3AG9A 4MF1A 1E1VA 2PL0A 4DDIA 5IQEA 1BMKA 5HVKA 5I9VA 4O7VA 2ERKA 4LMUA 4LV7A 4RX5A 2PUNA 3LE6A 5IA2A 4KINA 1W82A 2YA9A 1H0VA 5G6VA 4CT1A 4BVUA 1NT2A 4PDYA 3SOAA 3QRIA 2OKRA 1APME 2UZWE 4QQ5A 4E1ZA 5KMKA 4DAWA 4RLKA 4EH2A 4Y73A 3F9NA 3ZSHA 2IZRA 2R3OA 4CYJA 4ID7A 1WBWA 2YN8A 4AF3A 4M0ZA 5CZHA 5B2KA 2ZDUA 3NUNA 4DFLA 1Z57A 4C59A 3R8VA 5CAVA 3P86A 1M17A 1Z5MA 4RIWA 5K5XA 1ZZLA 3IW4A 4CTCA 5AV4A 1R3CA 2VWVA 2ITNA 3AT2A 1ZAOA 4QQCA 4JMQA 5EKNA 3EYHA 3QD2B 3ORNA 3NCZA 3Q9YA 3QWJA 2W9ZB 3OFMA 4Z9LA 1W83A 3SLSA 3RPYA 5AAFA 2J0MB 3DLSA 3MWUA 3GOPA 4EOKA 2XNOA 3D7ZA 3T9IA 3ZS5A 3D7TB 1M52A 4BIBA 3VUIA 5E8XA 3V5LA 2CPKE 5HI2A 3D5XA 3GU4A 3LPBA 4C3PA 1G5SA 2GS6A 4B8LA 3BBWA 2GTNA 5AR7A 3PG3A 4CFVA 2R3QA 4EZ7A 4GKIA 5DRBA 1WBSA 4YURA 4Q2AA 3HL7A 2QURA 2EXMA 1ZOEA 2IZSA 4X3FB 4C58A 4QDEA 3R1QA 4KAOA 4M12A 3E8NA 5KNJA 2ETKA 4RC2A 5JFXA 5AP5A 2WEIA 4FKWA 4BKZA 2FSLX 5BUEA 5HIEA 4YZBA 2PVFA 3LJ0A 4IVBA 5CSVA 1IRKA 3W2OA 4C57A 1J7UA 2NYAA 3W0NA 2XYUA 3NNWA 5EI2A 3BLQA 4BZDA 1OITA 2OIQA 3OY1A 1Z9XA 5DT0A 1JSUA 2C6OA 2IVSA 2PVYA 4AE9A 3TDWA 3KMMA 3PG1A 3KXMA 5AV2A 4OBQA 3QTWA 1GY3A 2G1TA 3HDNA 5HE2A 4EZ3A 3K3IA 3G90X 5CZIA 2IN6A 3ZRMA 4IW0A 3SXSA 4E26A 5BVNA 4YGAA 2XALA 1J1BA 2VGPA 2UW7A 4ASEA 5BVOA 4BN1A 3HMOA 4BCQA 4IVAA 3TT0A 4GIIA 4YO6A 1WZYA 2W1CA 5FM2A 3UZPA 4ZJVA 2UW5A 4HZSA 2XNNA 3Q4UA 2UZEA 3F66A 3CPCA 3DBFA 3ORMA 4QT1A 1OUKA 3QTZA 4FUXA 4IWPA 5T6KA 4BL1A 3IG7A 4X6QC 4UY9A 4WO5A 4PL5A 3RGFA 2PVKA 4EOSA 4XH6A 1BL6A 3MY5A 4D9UA 4DG0E 2PTKA 4K9YA 3RPRA 2XKEA 4GS6A 4AZTA 3QTIA 3VRYA 3FI2A 2XIXA 2R7BA 2X0QA 5DR2A 3ZXTA 5A54A 3RAWA 4ZLYA 2WD1A 3FC2A 4JLCA 3DXNA 4BY9E 4J95A 2J0LA 3OBGA 4X2FA 3OWKA 3E7VA 4W8DA 2X9EA 4FT5A 1KUTA 3S95A 3EFKA 2WXVA 2UVZA 1YOJA 5AJQA 5DEWA 3WARA 3V5PA 2YZAA 5C1QB 3EOCA 4TY1A 3UE4A 3BRBA 4OW8A 4NCTA 3AQVA 2F2UA 3MB7A 1YWNA 4A4OA 4EWQA 5BYYA 3IDPA 3QA0A 4QP2A 4GIHA 5I5ZA 1YVJA 1W0XC 5ACBC 4DG2E 4O4BB 4WNOA 1TZDA 4IB5A 4AZWA 3GB2A 3RAHA 4GK4A 4L7SA 4FA2A 4DT8A 4ZTRA 3R1NA 3L9LA 3DS6A 2WQBA 3TUCA 1UKHA 5FEDA 4QP8A 5HHWA 4FX3A 3T9TA 2VX1A 5KCVA 4ZY5A 5JEBA 4O2PA 4U0IA 2OF4A 4D2WA 2X2LA 3ZSIA 4CSVA 2VWIA 4LFIA 1O6KA 3R9OA 1KSWA 2R3JA 3HRFA 3PZEA 1GIIA 5HCXA 3R9NA 1ZOHA 2BKZA 4BZNA 3ZH8A 3GC9A 3OWJA 1R78A 1YXUA 2YACA 4HGLA 4OGRA 3KREA 5LOHA 2HCKA 3RVGA 5C9CA 3NYNA 2IVUA 4GFMA 3SKCA 2ZB0A 3BYOA 3JY0A 5M4FA 1UWJA 2YM8A 4YTHA 4ZZMA 2WOTA 5ITAA 4RJ4A 5FP6A 4OBOA 3DNEA 2B0QA 5EYMA 3F5GA 3A4PA 4I5MA 4CKRA 5DPVA 3EL7A 1XHAA 4AXAA 5DVRA 2GTMA 5LARA 1XH8A 2NRYA 4I4FA 4YPDA 2IPXA 3N4TA 3RTPA 2P2IA 3PP0A 4QEBA 4DHIB 5E1SA 4R5YA 3W1FA 4GSBA 1JKSA 2ZV7A 4DTBA 2PSQA 3RJCA 5J1WA 3UO4A 4QTCA 1Y57A 4AW0A 4CT2A 2W9FB 3FPQA 4BIDA 2YABA 3ZCLA 3NW5A 1PRYA 4FTTA 2ZDTA 4CZTA 2XVDA 3DZQA 2C1AA 2C3IB 2VTLA 2O65A 2BFXA 2Y9QA 3DQXA 3QX2A 3ATTA 4NTTA 4DC2A 3GU8A 5ETCA 4XP0A 3KXHA 4AAAA 2JDRA 1Y8GA 5CSXA 3I4BA 4F1OA 5ETAA 4BBMA 2W4JA 4KS8A 3AGLA 4FTUA 3CSVA 1OKZA 4MYGA 4IAIA 3F69A 2ITQA 2X9FA 3LLTA 4F9CA 3E62A 4M66A 2A0CX 3P7AA 3PLSA 4RC3A 4FE2A 4TWNA 3QTXA 4R1VA 1XMLA 2YJRA 1GIHA 4AZEA 5DG5A 1ZMVA 4DLIA 1OL2A 3I5NA 4FKRA 3SXFA 3KCKA 5JRSA 2O63A 4HZRA 4FT9A 3VBQA 4FJVA 4O84A 2XIYA 5IQCA 4QMLA 2E9OA 1ZYJA 2WTDA 2XK4A 4DITA 4IM0A 4QP6A 2QO7A 2RFEA 3HP5A 3KK8A 5CENA 2W4OA 4DBNA 2HZNA 5DIAA 3PJ2A 4AE6A 4GV1A 1FMKA 5HG5A 4MD7E 4MTAA 1K9AA 4WNMA 3EHAA 3LXNA 3MPMA 1V0OA 3QL8A 3DKCA 4QPSA 4O6EA 3C13A 4ZS0A 4UXQA 3BEAA 4F08A 3KA0A 3COMA 3P1AA 3AMAA 4MNFA 5AM7A 2XUUA 4FBXA 1PF8A 3LOKA 4MF0A 5HNGA 4FYNA 1PJKA 4PQNA 1PMEA 4F1TA 4JDJA 2XJ2A 2OBJA 4F7LA 2HENA 3W2QA 4H3PA 3QQKA 5CLPA 3VBVA 5BPYA 4A9YA 5KKRB 2GHGA 2UW8A 2OXYA 3CTJA 4D5HA 4L45A 4J8NA 4UN0C 4F1MA 5E9EA 3BHTA 4DEBA 3NW7A 3TYKA 4CZUA 4RT7A 1I44A 2BRNA 2EWAA 1H4LA 4O0XA 4C3FA 3KMUA 2QI8A 4CFUA 3ULIA 3FAAA