2VUWA

Structure of human haspin kinase domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
329
Chain Sequence
KGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
publication title Structure and Functional Characterization of the Atypical Human Kinase Haspin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 329
sequence length 329
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vuwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vuwA01
1OI9A 2BZJA 3QZHA 3SD0A 2BDJA 4QOXA 5AUVA 3OS3A 2QURA 4XG4A 3RM6A 3D7ZA 4PMTA 4D2WA 4YP8A 2WTVA 3PZEA 4LFIA 4UEUA 1JWHA 2VTOA 3AMYA 5TOZA 4A9RA 3CTHA 4FT5A 4RBLA 3AMBA 4O84A 4CKIA 5DPVA 4YJSA 4WD5A 3R22A 3BBTB 3KXGA 3ORTA 3RKBA 2A1AB 3F3ZA 4WNOA 4EOJA 4P90A 4YTIA 1WVYA 4C61A 2Z02A 1VYZA 2Y4IB 3CTJA 3PYYA 5D11A 5DYJA 5FEEA 4Z16A 3DA6A 1O6KA 3TNQB 5DR9A 3V6SA 3F5UA 2HW7A 3QTUA 2C5OA 2XNEA 4R6VA 5AUYA 3C7QA 5GIOE 1DI8A 3F66A 1RJBA 2PZIA 4MNFA 3PIZA 2BTSA 4KS8A 4DLJA 2ONLA 2OICA 3KCKA 5I9XA 4P2KA 4WNKA 2XS0A 3GFWA 3H10A 4V01A 4EBWA 3PVBA 5AP2A 4D2TA 3HV6A 2R3PA 4RC2A 1H8FA 1ZOGA 4HYUA 4CV9A 2CMWA 5LCJA 4IFGA 5CF4A 5B2LA 2E9UA 2PZYA 2CJMA 3FSKA 4X3FA 2PMLX 3CQUA 4A9SA 4AN3A 3GC0A 3DTCA 2ACXA 3A7HA 3VS6A 4FBXA 4MHAA 3WBLA 3H9FA 3VN9A 5EDRA 3MFSA 2XH5A 3ORLA 4F9CA 5E8VA 1KSWA 4FKWA 3B8QA 3QTXA 5HLPA 2J7TA 3ZLYA 4B6LA 3BGPA 3REPA 4F99A 2ESMA 2X2MA 1VR2A 3ZYAA 2ZM3A 4L45A 4O7SA 4ZTQA 4G16A 2UW8A 2BIKB 1U54B 3COMA 2P0CA 4RZVA 5D41A 4HGTA 3DKGA 4XG8A 3K2LA 3MV5A 3PUPA 2O2UA 5EM7A 1WBWA 1UA2A 1U54A 3G51A 5BMMA 2GNFA 3FZRA 3GCSA 2BVAA 1GY3A 4HOKA 4FOCA 4MTAA 2VTTA 3BU5A 3R63A 4C37A 4BI1A 4CLJA 2B7AA 5I5ZA 4QNAA 5HLNA 4O82A 4FTLA 1IAJA 4U79A 3LFAA 3DJ5A 2W1CA 5BVEA 4D4VA 3HP2A 4Y85A 1HCLA 1LEWA 2WTWA 1ZAOA 3AC3A 4MF1A 3Q32A 5LMBA 3HDMA 5J5TA 4FMQA 4ACDA 1P4FA 4IZYA 3TNHA 3ZTXA 4FKPA 2B9JA 4MQ2A 3KRJA 3F3VA 2XF0A 2UW5A 3MSSA 3AGMA 4CYIA 4QRCA 3TUDA 4LV8A 2QOCA 2C6IA 3Q04A 5M56A 5IA4A 3ORIA 3OCTA 1WVWA 4W4YA 1FMOE 4I21A 4KABA 5ANOA 4NIFB 5M4UA 1T45A 4YPSA 4DGNA 2XNPA 3F2RA 2RIOA 4K8AA 5A4LA 4YLKA 4D1ZA 1JSTA 5HBEA 5I9VA 1FINA 3O7LD 4NIFA 1ZWSA 5JN2A 4LOOA 4PNIA 2ETMA 5DNRA 4AFEA 3R7EA 3EB0A 2W7XA 3MTFA 3R9OA 4FKSA 1M2QA 3WE4A 2X2KA 3UNKA 4QMZA 4CZTA 1XKKA 3EYGA 3EKNA 5AIKA 2JAVA 4UALA 1LPUA 2UZLA 4GJ3A 4PY1A 2VTHA 3VIDA 4I92A 3VUHA 4C4HA 3UOJA 3QD2B 3V01A 3ZSGA 4BWPA 4FIFA 4IAIA 4YO6A 3QLFA 1G3NA 4U3YA 2QOKA 4APCA 4ASZA 4IX5A 5HO8A 4E6DA 1Q62A 3C0HA 4BTJA 3GVUA 3ZUTA 4DFXE 4OTFA 5FM3A 4GCJA 5HIEA 4I6HA 5M07A 2EU9A 2RGPA 4XV9A 4QMMA 1W0XC 3OY3A 3F88A 5A6OA 1LP4A 3U51A 4G17A 1KE6A 3QUPA 3PE1A 2OKRA 4LRJA 3R02A 4ARKA 5CEMA 3BPRA 2NRYA 3KXHA 3TV6A 4DAWA 4E5WA 4DEAA 3Q2JA 2WQEA 4R78A 3QCXA 3ODZX 1OM1A 4NW5A 4YBJA 4P5QA 3ODYX 3ITZA 4O22A 2JFMA 4TYHB 2OU7A 3S00A 1U59A 3VW6A 5AUXA 2F7EE 2WMVA 4JG6A 5IQBA 3NGAA 4U6RA 2J0IA 4L52A 4OGRA 3OFMA 4YJQA 4NCTC 4E4NA 2PZRA 3K3JA 2CN5A 4FTUA 2VTRA 4M14A 1Q8WA 4IM0A 3UBDA 4QMPA 3PZHA 3R1NA 2QKRA 3ATSA 1PHKA 1GZOA 5HIDA 5M09A 4MD7E 3QWJA 4JIAA 4MWHA 5IA3A 4A07A 4G6LA 5EKOA 4TYEA 2HZ0A 4A7CA 4KRDA 2ERZE 2V7OA 3V5PA 4N6ZA 2WFYA 4Q9SA 4Z7HA 3VBVA 2IN6A 3A8XA 5LARA 1JQHA 4AE6A 2R2PA 3EQFA 3A7GA 3RAWA 2GS2A 1XR1A 2YDIA 3H0ZA 4BICA 3S95A 2DUVA 5AIRA 3H9RA 3GI3A 4HVGA 3SGCA 3IDPA 3H4JA 3MI9A 3DKFA 4QP8A 4M84A 5AX3A 1P4OA 5HESA 1LEZA 3QHRA 4L9IA 3BE9A 4Q9ZA 1ZY5A 5D10A 4R8QA 3HV7A 2W4JA 2X81A 2BDWA 2P33A 3I6UA 3ROYA 4FT9A 4N4SA 4QTCA 4IJ9A 2F2CB 3UZRA 5TR6A 1YW2A 3R7IA 3L8PA 2FSTX 3FUPA 4IDVA 3P9JA 4RJ8A 5CSVA 5I3RA 4CVAA 2OH0E 5DR2A 3UQFA 5DEYA 2XBJA 4AOJA 4R7IA 5IKWA 3JYAA 2WOUA 4EZ5A 4KWPA 4QYFA 2H9VA 3PA5A 4IXPA 3TL8A 4AW1A 3CC6A 4D28A 1KE5A 3WARA 4FNWA 4G34A 3W32A 3NUXA 3I79A 3R73A 4QQJA 3DXPA 3LPBA 4F7SA 4UWYA 3W2SA 4TWCA 2XKDA 5HTIA 1H01A 5LVMA 3W2QA 1E1VA 4M3QA 2OZAB 3ZXTA 2OJFE 3TI1A 2C4GA 5E1SA 3C13A 4FV1A 3C4XA 3IW4A 3IK3A 5M57A 5FDPA 3A2CA 4FKTA 4O2PA 4QP7A 3VHEA 1MRYA 2HK5A 2OZAA 2REIA 3E7VA 4XG7A 2BKKA 2Z7RA 5E8SA 3SRVB 1HOWA 2QO9A 1XJDA 3F3TA 4Y8DA 1JKTA 2XNBA 1ZYCA 1P14A 4RX7A 3SRVA 3RPRA 1O6YA 4U3ZA 2ITUA 2RG5A 1G8AA 2GMXA 4GU6A 2UW0A 4BDBA 2UZDA 2WPAA 5G6VA 4RJ5A 4EOIA 3R8MA 5ICPA 4O7LA 4LRMA 3CTQA 5DRDA 3RPYA 2DQ7X 2H8HA 2VWWA 4QYYA 3UOLA 4C33A 2WMQA 2W1DA 3AT3A 3MVMA 4O0YA 3KRRA 1Q8TA 4GFGA 4QMSA 4F6SA 2C30A 2H6DA 3ENMA 2HWPA 4IW0A 3Q5ZA 3MW1A 4NCTA 3BX5A 4ZY4A 2X8DA 4DH1A 1FVVA 4ZAUA 4FEVA 5HE1A 1PF8A 5M55A 4ZIMA 4ACCA 3R8ZA 2FO0A 2VX1A 3OEFX 3Q60A 2QD9A 4ITHA 4FV3A 5AJQA 1PJKA 3BHVA 3GCVA 2SRCA 2Y6MA 5D7VA 4GKIA 2BHEA 2VV9A 5EHOA 4AGWA 3EQDA 2C6EA 4AZWA 4CFUA 4F09A 4CEGA 2PU8A 3T8OA 3V5QA 4F0IA 3BBWA 4FTNA 3ZRLA 4KA3A 3LJ1A 4WG4A 1TQPA 3BWFA 5EOLA 3F69A 5BMSA 5HQ0A 4LYNA 2X8IA 4JAIA 3BHUA 3C0IA 5BX0A 1GZKA 3FJQE 3RPOA 2GNGA 3LJ0A 4NKAA 4OTIA 1M52A 4RJ6A 3FXZA 3DNDA 3QYWA 3R9DA 4BTKA 4EOQA 2VWIA 4HGLA 2VN9A 2W17A 4FZ7A 4R7BA 5BVOA 3IW6A 4IWDA 4WKQA 4GW8A 1YI6A 2QO2A 4PTCA 4R1YA 4LQMA 1PXJA 2F7XE 5IQAA 2HZ4A 3TDWA 4ALUA 2G15A 1JKLA 3E64A 5JFXA 3QAME 5JGBA 5EI8A 4ZS0A 5LWMA 1UVRA 4O21A 3LXLA 3DLSA 3BIZA 4CKJA 3BE2A 4FNZA 1YDSE 4F9BA 3TUCA 4E5AX 4RA4A 1OL7A 5CU6A 4B7TA 4BTMA 5BVFA 3I60A 3HVCA 1Q5KA 4QMUA 3MDYA 2R3GA 4NM7A 5AV3A 2FSLX 2IO6A 5DR6A 4BGHA 4C4EA 3LJ2A 5M44A 4XV3A 5K3YA 4NTTA 3MJ1A 5TE0A 5HG9A 4DITA 3E87A 4DG2E 2XK9A 5JRQA 3VJNA 5CAPA 2J51A 3R71A 4XX9A 3D5WA 3JXWA 1MP8A 4O27B 1KV2A 4G3GA 5DWRA 3WI6A 4ACGA 1OPLA 5CQWA 4XS2A 4K18A 4QPSA 4U9AA 3BEAA 4MYGA 1CTPE 3FLSA 3NS9A 4AE9A 3KFAA 2BILB 1W7HA 1KE7A 3FLZA 4RT7A 4YZMA 5EG3A 4AZSA 1UWHA 2XP2A 2PUNA 3PWDA 5FBNC 1YXVA 3JPVA 1FOTA 4C38A 4L44A 1PMVA 1J1BA 3A60A 3R30A 4FSNA 2JKQA 5EFQA 4W4XA 5JQ5A 3PDTA 4KKHA 4CRLA 3SQQA 4W9WA 5LOHA 4X2KA 3R7YA 3RZBA 2BRNA 3BI6A 3BYUA 2X4FA 4RGJA 2GS7A 2J9MA 2YM6A 2YEXA 5HOAA 3PRIA 4MXCA 2W06A 5KBQA 4KIQA 3LLAA 2F49A 2WQNA 4ZSGA 2XK4A 3ZHPC 4CLIA 4LMUA 2IVUA 2PVLA 4L7FA 3UPZA 3DXQA 5L2TA 4RIYA 4YC8A 4ZOGA 2XK3A 3BYOA 1V0PA 3IGGA 3L9PA 4JI9A 4I1ZA 3QLGA 2AC3A 2GCDA 5DE2A 2WIPA 2CGXA 1H26A 3PLSA 1SVEA 4LG4A 2HYYA 4FKOA 3UMXA 3ZCLA 2YIRA 3QTWA 3L9NA 5DOSA 4BB4A 2X9EA 3PY1A 3TZ7A 2YZAA 1WBVA 4DCAA 1JBPE 3WZKA 4AA5A 1WBPA 2FVDA 4NWMA 2EVAA 5KZIA 2W9ZB 4D1SA 3V5LA 3DZOA 1YWRA 3OW3A 4ZSLA 4IVBA 5C03A 3OC1A 5EQPA 3R8PA 1MRUA 1Q41A 5ANGA 1XH4A 4K77A 2QG5A 4FIEA 5CSPA 5EI6A 5TT7A 3AGLA 3DGKA 2P4IA 2WMTA 2PK9A 3DK3A 3FHIA 3VS3A 5HNIX 3FXWA 3SW7A 4ZP5A 2C0TA 2YIWA 1FBNA 3D0EA 3EKKA 4JLCA 4OBOA 4GEOA 4Z3VA 2UZNA 4GIHA 5HI2A 4PRJA 4ANNA 3O50A 1M7NA 3Q4ZA 3C4FA 4I5HA 1URWA 3KVXA 5JZNA 2VTNA 4XP2A 2OIQA 3O17A 4EOMA 3QRTA 4S30A 4YZBA 4A06A 4A4OA 5IQCA 1E9HA 4Y95A 4FEQA 3W2RA 4F1MA 3ATTA 4YC6A 4QQ5A 5I9ZA 3QZIA 5HVJA 4UWCA 4XV1A 3NUAA 4BI0A 1Q4LA 3MWUA 4TYJA 2KULA 3FQSA 5EM6A 3HV3A 3TTIA 3V3VA 3FMLA 2YZLA 4QYHA 3R00A 2BKZA 2GHGA 4XMOA 3IW5A 3E8EA 4DGGA 2EXMA 1OL2A 4AACA 1XBCA 3CEKA 3CJFA 5EW8A 5DHJA 4LI5A 4I93A 2R3LA 2J2IB 4LV5A 4XNEA 3ID6C 3LXPA 4ITIA 4I6QA 4KINA 4DH8A 3UC3A 4RWJA 5E8UA 4FG7A 5GHVA 5CF6A 2VZ6A 4PPCA 3KF4A 2WMSA 1NA7A 4XG2A 3DQXA 5A54A 3R7OA 5AEPA 1GJOA 3DPKA 2VTPA 5F9EA 5H3QA 3PXQA 4GT5A 3OCGA 4BDJA 5BVNA 2EUFB 4IDTA 4EORA 5KHWA 1FVRA 4B99A 3AXWA 4FZDB 4BZNA 5IG1A 4FTRA 4O86A 3VS4A 3P1AA 4FTIA 2YDJA 1GNGA 2R3HA 2OI4X 3L9LA 5D7AA 5IA1A 4CYJA 4FVPA 4XJ0A 4GFOA 3JVRA 3FKLA 2UW4A 5CXZA 2R7BA 4TKSA 4CMUA 4W8DA 3ANRA 5LMKC 3T9TA 1PXMA 3B2WA 4HVSA 3VWAA 2CSNA 3R1SA 2QOOA 3HMMA 4IX4A 3LQ3A 2AUHA 4CNHA 4Z9LA 3R04A 1ZLTA 2GU8A 2HCKA 4BL1A 4QMQA 4M8TA 3PY0A 3WF6A 4CMOA 1YI3A 1STCE 2I40A 3WIKA 4B8MA 4EOOA 1NY3A 5HE3A 4IX3A 4DF3A 1Q3DA 3FI4A 1TVOA 2GTNA 1QPEA 3HRCA 3LCOA 4L42A 4RVLA 3W2CA 3UIUA 2VO7A 3DBCA 5DIAA 5KBRA 4UYNA 3R1QA 2B0QA 3I0QA 2YISA 4H3BA 1YOMA 3O71A 4QMWA 4DFNA 1H00A 2JDRA 2BMCA 3NNWA 4OW8A 4UV0A 2X6EA 3EJ1A 2YWPA 4J1RA 3E8CA 5JEBA 4DT8A 2FA2A 3R1YA 3ZO2A 2WOTA 1YI4A 4FV9A 5AV2A 2CGWA 2RL5A 4JR7A 5AV4A 4NFMA 3BGQA 4FICA 5GZAA 5IF1A 2YFXA 2BHHA 5L8JA 3RCDA 1UU8A 3CKWA 4BIEA 1XH7A 2B53A 3K5VA 2RFSA 3VRYA 3U6JA 4GK3A 4EC8A 5B2KA 3FE3A 3E62A 5A9UA 4ZTHA 3ORNA 3TKHA 2IW8A 1CMKE 3G15A 2CLXA 4LOQA 5J95A 3I6WA 3LE6A 3I81A 3NW7A 4L7SA 4EH6A 2R3IA 4BKZA 4TWPA 5GIPE 2E9OA 2OK1A 2CPKE 4L68A 4FKRA 3FQHA 4EYJA 4AS0A 4IWPA 4QP6A 4G9RA 1SYKA 4MEDA 3T9IA 5JFVA 3GENA 4NW6A 5EHYA 4FTMA 4FZ6A 2YM7A 4JAJA 4MX9A 2FYSA 1KE8A 2ITYA 5FTOA 4AQCA 3KRWA 5CF5A 3NEWA 1ZOHA 3OY1A 4BVUA 3O2MA 2NP8A 4IVCA 5AP4A 3FL4A 2V0DA 3HKOA 4XG3A 5AUTA 4X2NA 1SZMA 3LFBA 4M68A 3QTZA 3F61A 1O6LA 1J7LA 3DXNA 3MVJA 3PG3A 3CE3A 3FZOA 5HGIA 3R8VA 5C8NA 1PRYA 2EWAA 3FC1X 3NUNA 3UO5A 5ETIA 4RX9A 3WIGA 3A4PA 2PMNX 2R9SA 2B9FA 3AQVA 3F5GA 2I6LA 4YNOA 4YHTA 4DGLC 5HBHA 4KS7A 1NVSA 2OO8X 5CZIA 3IONA 2V62A 3BLQA 3G0EA 2Y8OA 3KY2A 3TNIA 5LMKA 5M4FA 2PULA 3ZEPA 3PXFA 5CU3A 3C4EA 3KN5A 3BRBA 4GG5A 5CXHA 1JPAA 4BDEA 4BR3A 4X3FC 5B2MA 4FSMA 4DHFA 5HE0A 5KX8A 3M1SA 3UGCA 4PP9A 5L8LA 2QOIA 4A9YA 3PJ2A 3RWQA 4MBIA 2VWVA 3UE4A 3W33A 2JDTA 1EH4A 2UVZA 3MTLA 4RC4A 4Y73A 5CWZA 4HZRA 3MVLA 3FKNA 4C34A 2CNQA 3ELJA 3ORKA 5M08A 2C5VA 1SM2A 4H1JA 4AFJA 3DT1A 3I7BA 2W9FB 3R9HA 4DFZE 2OBJA 3CP9A 3ZRMA 4RJ4A 4ZMEA 2BPMA 4PDSA 5ANKA 2JC6A 4U97A 4BCNA 1F0QA 2Z7LA 3GB2A 5H2UA 2X4ZA 2G9XA 4H36A 5HIBA 3ZZWA 5HD4A 3EN6A 3QTQA 5T3QA 3E3PA 2WEIA 1WFCA 4DEDA 2Z8CA 3PXKA 3U6IA 1WBNA 3IG7A 5AX9A 1H0VA 2WTKC 3A99A 4EOLA 2X1NA 4K9YA 5K5XA 4QP4A 4AGDA 4X6RA 4OTRA 3MH2A 4BBFA 4JS8A 5LVOA 1VYWA 3A4OX 4L01A 5KMKA 3QQLA 4JRNA 3IDBA 5FWKK 1PYEA 4FYOA 4BKJA 2QQ7A 1YXUA 3QKLA 5EOBA 4A4LA 4AOTA 5IUHA 4PNKA 3POZA 3OCBA 3RALA 4RWKA 1BI8A 4W4VA 2JLDA 4O96A 4UXLA 3ZFYA 4EUTA 1R0EA 4D2SA 3AC5A 3CJGA 1SNUA 5K0KA 1V0OA 3NW6A 3HMNA 4BHNA 2YABA 4C3PA 5AP7A 3PJ1A 2UZTA 3GC8A 5BUEA 4J97A 1B6CB 1AQ1A 1QCFA 2BRGA 5ACKA 4QMNA 3QKKA 3VQUA 5M51A 4EZ7A 1P2AA 2V55A 2XZSA 3QCYA 1W83A 4BCQA 2C6OA 4NJ3A 5E90A 5AA9A 5E9EA 3NVKI 3W10A 4O1OA 3W16A 5CAVA 3LM0A 4BBEA 3LHJA 3OBGA 4X2GA 4EHGA 4ANMA 3PXZA 1ZYDA 3NIZA 5B7VA 5HORA 5EM5A 5LCKA 3VUIA 3OVVA 5L2IA 5AV0A 4CMTA 4OBQA 4GV1A 3D14A 3NAXA 2X7OA 4AU8A 2G1TA 4M0ZA 2C3LA 5L2QA 4EWHA 2IVTA 5EM8A 4OAUC 3D83A 3GP0A 3JY0A 3N4UA 2W1GA 2WMAA 3EOCA 4X3FB 1GIIA 2UW6A 2WGJA 3EIDA 3LOKA 4E5BA 3EFLA 4KIPA 3VHKA 2WXVA 3D5VA 3ZM4A 5EH0A 4EZ3A 4DTAA 4OT6A 3GU5A 3RK5A 5M4IA 1BMKA 2R3KA 4OTDA 4PMMA 5DMZA 4IZ7A 3UNJA 5GINE 4NYEA 2PMOX 4DG0E 5A4CA 4PUZA 2QHNA 5FD2A 5FTGA 2VUWA 3OUNB 4G5JA 2Y9QA 4IANA 4J99A 3BKBA 4RWIA 5F4NA 4YJRA 5JSMA 2PUIA 4U44A 5CF8A 1A48A 5FEDA 3PPJA 5HG7A 2WAJA 4E26A 1XHAA 5HCXA 3ZMMA 5HNGA 3IO7A 3FQEA 4S34A 2ITTA 3PWYA 4KKGA 1MRVA 3O8UA 4R5YA 1W84A 2A0CX 3BCEA 4RLLA 1Q97A 4YBKA 5I3OA 2JD5A 2Y7JA 2BAKA 2YJRA 3AG9A 2WTKB 3UP7A 3H0YA 3TEIA 1Q8ZA 3FLQA 2W1HA 5HG8A 4FGBA 4AT3A 4B9DA 4E73A 3RPVA 4PPAA 5AP1A 3G9LX 2GQSA 4FSTA 4E6AA 3RM7A 3BYMA 4HZSA 4XG6A 4J8MA 2QONA 3L8VA 3RZFA 3LIJA 1CM8A 3QFVA 3VW8A 2XRWA 4WRGA 4RIXB 2ITNA 3E63A 3MH1A 5BNJA 1O9UA 1B39A 2BAQA 3LFSA 2HAKA 3SA0A 4FSRA 4YLLA 4ANOA 2GS6A 4KD1A 2RKUA 4RIXA 5LMAA 5HVYA 1OVEA 2ITXA 2J0LA 4FNXA 3HYHA 4H3QA 1IR3A 2PVJA 3AC8A 4ZTLA 1R3CA 3BV2A 3MS9A 4E93A 4XBUA 4QMXA 3O23A 1H24A 2YM4A 2X8EA 2XYNA 5HHWA 3E8NA 5J8IA 2X2LA 1UKHA 4RQVA 5KHXA 5L6PA 4U45A 1JVPP 2XJ1A 5A3XA 3KMMA 4FZAB 4RMZA 3HEGA 4G3CA 1WVXA 1ZMUA 2BFYA 2BCJA 4DEGA 5FTQA 3R8UA 3MFUA 2F57A 2OJIA 3L9MA 1GZ8A 4FK6A 3OZ6A 3QU0A 4BC6A 3I5ZA 5F20A 4JG8A 2PY3A 4ZSEA 4BCIA 2PVYA 3GC7A 4EHZA 4FKVA 5LVLA 2DYLA 2VWZA 3R7VA 2O63A 3L8XA 2Q83A 4D5KA 2R3NA 3NYVA 3UOHA 3MFTA 4J95A 4AF3A 4NK9A 3ZFXA 4YMJA 3KULB 4PMPA 3D2KA 4F0FA 4BGQA 3H9OA 3LAUA 3FZPA 3OTUA 3TJCA 4C4FA 3JS2A 3KULA 5JGDA 3R9RA 2OJ9A 4F64A 4FG9A 5E7RA 2X9FA 2YM8A 4HGEA 4X2JA 2PPQA 3NPCA 3QXPA 1ZYLA 3LKMA 2UZBA 1E1XA 4IIRA 3QQHA 4A9TA 3EQCA 4O0UA 4PP7A 3U4WA 3ZBFA 3PA4A 2QI8A 4YLJA 4ALVA 3EQIA 4GT3A 3OWKA 4CSVA 4D4SA 3VS0A 5AR7A 4D9UA 5DBXA 4Q2AA 5KKRC 4YURA 4EH4A 4JDJA 2PE2A 3V04A 5AA8A 1XO2B 4F9WA 3WYXA 3TZ9A 1NVQA 1YKRA 4YZ9A 4LRKA 4QO9A 4CFVA 4QMYA 5CU4A 3SKCA 2ETRA 3PVWA 5CTPA 3E92A 3UO6A 2Z2WA 1VZOA 4EOKA 1H25A 2I0YA 4YTFA 3KQ7A 4QYEA 3VQHA 3TUBA 2JFLA 5EW3A 4S33A 1PYXA 3DB8A 4AW0A 1PXOA 5CAOA 2R3QA 5AAGA 1URCA 1FVTA 4G3DA 4L8MA 5CYIA 3LCKA 4CFXA 3EQRA 4GG7A 4Y83A 5AWMA 3H30A 3ZM9A 1J7IA 3MY1A 1QPCA 4AZTA 3G5DA 2OJGA 4JJRA 4ERWA 2A2AA 2WU6A 4E4XA 2RFEA 3E88A 4O7WA 2VO3A 1OIYA 4MK0A 4CXAA 4EH7A 3TKIA 3CY3A 3K5UA 2OGVA 4QQCA 4YJTA 4XEYA 4E6CA 4ZSAA 3RAIA 3SW4A 2CNUA 4UMQA 4FVQA 5CY3A 2UZEA 4JBPA 2XKFA 3FMMA 3Q9YA 4M13A 4RC3A 4FEWA 3VUMA 4F7JA 2VRXA 3PXYA 5FRIA 2IG7A 5KNJA 2IW6A 3QC4A 2GFSA 3W55A 2ITPA 3BHTA 3QQUA 2C0OA 3EH9A 4NM3A 5CNOA 3GU7A 3T3UA 1XQZA 1PKGA 4BDAA 4GYGA 5E8XA 3G6HA 4TXCA 1G5SA 2YM5A 2IW9A 2QLQA 3DBEA 4ZK5A 2VAGA 3ORZA 3OBJA 4C4JA 3ZLXA 3D94A 3O8TA 3FMKA 2VTMA 3D5UA 4FSUA 2VGOA 2UVXA 5CSHA 5L8KA 4K6ZA 4BY9E 1WAKA 5EK7A 4FV6A 4QYGA 5C01A 4ANQA 5HU3A 1L3RE 5LJJA 4AZFA 4I24A 1YXXA 3UODA 3Q2MA 2IZSA 3CIKA 5CZHA 4GS6A 2J6MA 1CKIA 4R3PA 5CU2A 2X7GA 4NT4A 4XHKB 2O65A 1IG1A 2QOBA 3W18A 4F65A 3DBFA 1ZARA 3NVMB 4RFZA 4GUBA 4ALWA 1OUKA 3UNZA 3AC1A 4O38A 5KKRB 5C4KA 3QALE 3LVPA 4CT2A 2QOQA 5IISA 3TJDA 4O0WA 3OCSA 5E8YA 5H8GA 4CZUA 3MH3A 3OXIA 2RSVA 4I0RA 3GNIB 4J71A 2XNMA 4C8BA 5IDPA 4NU1A 4C35A 5EYDA 4KUJA 5HG5A 1H07A 4QMTA 5TKDA 3EHAA 4O0SA 2GNIA 1H1PA 2AC5A 3Q9XA 1U4DA 4IB5A 4RVMA 4ZLYA 4DFYA 3UQCA 5HKMA 2VWXA 4XV2A 3MA3A 3NUUA 5C8MA 5HTBA 4M69A 4A4XA 2BUJA 3FI8A 4AW2A 5AM6A 1NW1A 4B4LA 5I4NA 4L3LA 2W0JA 5HD7A 4D5HA 4NM0A 3SG9A 4OT5A 3AC2A 5I0BA 4C62A 5BYLA 2F4JA 4JDKA 2GSFA 3A8WA 4IMYA 4ZJIA 3R2YA 3G90X 3NR9A 4B0GA 4YTHA 5ANJA 4DG3E 3F5PA 2XA4A 2WQBA 2CGVA 4FTKA 5JFSA 2ZOQA 4KB8A 3O0GA 4X2FA 1IRKA 2QOLA 4IAZA 5IH6A 5JMSA 5CEPA 3CD8A 2ZDTA 5K9IA 1JLUE 3OG7A 1YOLA 2PTKA 4I5PA 4XP0A 3C9WA 1XH8A 2J5FA 2W96B 1JKKA 1PXIA 4XUFA 3DJ7A 3UG2A 4BCHA 2YA9A 3E8DA 1Y8GA 3GCUA 4R3RA 5E91A 3HRFA 3UP2A 3F7ZA 5AADA 4AZVA 4BDFA 2E9NA 2UZOA 1MQBA 5IEXA 3CKXA 3F2AA 4W8EA 2WD1A 3UPXA 1H08A 3NRMA 4FSWA 5T6KA 4DFBA 4KRCA 4RSSA 2V7AA 4DLIA 5AAEA 4DEEA 3NMUF 3HUBA 3NCGA 3VS5A 4D2RA 4C3FA 2A19B 4WOVA 3IQ7A 3G9NA 1SVGA 1W82A 4EQMA 1K3AA 2W4OA 3FYJX 3MPAA 3DB6A 3QD4A 3VS2A 1GZNA 1T46A 2ZB1A 4E8AA 5FP5A 4YJOA 2E9PA 3BU6A 4YR8A 3JUHA 4O7RA 4DE4A 3DQWA 1TQIA 3Q53A 3SG8A 2V5QA 3QCQA 4PDYA 2J0JA 2OWBA 2PWLA 5K5NA 1PXLA 3Q52A 3QTRA 2XEZA 2WKMA 5LXMA 4ORKA 4YZDA 3IOKA 3HDNA 4QQTA 5J9LA 4HNIA 3OXZA 2JAMA 2JKOA 3C51A 4AA0A 3COKA 1L8TA 5FEQA 1ERKA 1ZZLA 3F7WA 3UJGA 1Q24A 3SX9A 4IFCA 4FSQA 1X8BA 3FYKX 3ROCA 3NSZA 4IACA 3Q4UA 4FSZA 5IZFA 2I7QA 4UB7A 3DAJA 1OPKA 3D7TB 4XP3A 4EKKA 5H8EA 3DCVA 2WNTA 5AAFA 2OSCA 4CCUA 3D7TA 4ERKA 4RIYB 3FSFA 5DT3A 4EONA 4F1OA 1WZYA 2QODA 3UZTA 3PA3A 4O6LA 3I5NA 4OTGA 1FQ1B 1YWNA 2XUUA 2PVFA 2ZVAA 4MAOA 1Q99A 3BHYA 4C4GA 5DEWA 4TTHB 1PMEA 4FEXA 4JR3A 4HCVA 3DKCA 3NIEA 3KXMA 3ORPA 2JIIA 5E8WA 3QF9A 4L3JA 3WZUA 4OLIA 3LM5A 4E1ZA 2Q0NA 2HELA 3R0TA 3OT3A 3C50A 3QX2A 4BCPA 3CPCA 3KMWA 4I5MA 4F7LA 4WUNA 4CFWA 2XB7A 4FT7A 2XCHA 5J1VA 2WQOA 3D5XA 3OWLA 3PE2A 4HCTA 5AR4A 4RVKA 3PSDA 4E4LA 3KGAA 3UO4A 5BPYA 5DFPA 3LZBA 5D9HA 2GHMA 4XLIA 5IEVA 2P2HA 3ETAA 2YACA 2WU7A 3NYNA 4IHPA 5AP5A 4DEIA 1REKA 4TYIA 5KMJA 4C36A 4BCKA 2BRMA 4E4MA 2Y4PA 3FMNA 3SC1A 5FXQA 2QO7A 2I0EA 4FKQA 4IZ5A 4Y5QA 3U4UA 5AP6A 4NFNA 5J9ZA 2HZIA 4XRJA 3U9CA 4II5A 1ZMWA 5C1QB 3QUDA 4WRSA 4AXAA 4CQEA 4M0YA 4MCVA 2W1IA 2YDKA 3PP0A 4J53A 2QG7A 3MBLA 1I09A 3EN9A 3EQGA 2ZYBA 3GT8A 3PPZA 4QTAA 5CS6A 5AP3A 3V8WA 4TL0A 3QD0A 4O7TA 4EHEA 3NYXA 1OBGA 1IASA 2WB8A 3F3UA 2IVSA 4FI1A 3CLYA 5IA2A 4QTEA 4BZOA 1DS5A 2E2BA 3FI3A 3PJ8A 5HICA 3EFWA 5IA5A 2YN8A 5CSXA 3F9NA 5TF9A 5BYYA 4D58A 3W8LA 4AGCA 4PQNA 4RLKA 3RNYA 1J3HA 4D2VA 4ZLOA 1Z5MA 5FXRA 3IOPA 3VBQA 2UZWE 4YC3A 3KKVA 3KRXA 2CKOA 3RTPA 1XH5A 2W1EA 4I4FA 4ASXA 1VJYA 4FL1A 2VTAA 3DV3A 5GJGA 3FPMA 4RJ7A 3FLYA 4RWLA 2I0VA 2R0UA 4F9AA 3DBQA 4UWBA 1LUFA 3DKOA 3LQ5A 3N51A 4FZFB 1WCCA 4BTFA 3RINA 4KSQA 2HENA 3HV4A 3TM0A 1Y8YA 4P4CA 5DRBA 4ZEGA 3E5AA 5AP0A 4M12A 1CSNA 3PIXA 4TNBA 3R83A 3V51A 4AAAA 5K4IA 1OMWA 4K1BA 2VU3A 4H39A 1LR4A 1UU3A 3FI2A 3A7JA 3ZLSA 4IADA 4H05A 4M66A 3RMFA 4FC0A 3LLTA 3GFEA 2W5BA 4IX6A 4DEBA 2GNHA 4EJNA 1A9UA 4RX5A 2H34A 5IEYA 5KO1A 4ZS4A 4NM5A 2R3JA 2Q0BA 2GFCA 3UZPA 4CV8A 4DT9A 1DAWA 3DAKA 3FC2A 4U43A 3LW0A 1ZYSA 4ZZOA 4DC2A 4YSMA 5E92A 4FKUA 4FGRA 2J4ZA 4AT4A 5J1WA 4FK3A 5D12A 4ZTMA 1Y57A 2PE0A 5HBJA 5BVWA 3FZSA 4WA9A 2H96A 4GT4A 4QP3A 2LAVA 4KKEA 2WMXA 4JL9A 3ALOA 4MKCA 1UNGA 1OECA 5BUJA 3FKOA 2UW7A 4APPA 5AR5A 3EFKA 5CI7A 1R39A 5I9YA 3DJ6A 3ZSHA 2WELA 2BRBA 4P5ZA 4IWQA 3ZU7A 2FSMX 2YAAA 1ZRZA 4EK3A 5A6NA 3UTOA 2C1BA 4H1MA 4FV8A 3ZC5A 4WNPA 2VWUA 3LCDA 3FMEA 4IVAA 5CI6A 3LFCA 2QKWB 2V22A 5DGZA 1Q61A 1RQQA 3MESA 1V0BA 4JRVA 3TIZA 4E6QA 1JOWB 5C9CA 3QA8A 2JIVA 4D4RA 5C26A 4U0IA 2AYPA 1JAMA 4YHFA 5M06A 3AT2A 3ZONA 2IZRA 2PVHA 3BLHA 2C6LA 3ULZA 1XH6A 2BZHB 3B8RA 4F6WA 1XBBA 1YHWA 2XNNA 3DDPA 4AG8A 3UVRA 3L8SA 2Z7SA 4JOAA 4QMVA 5CQUA 3HGKA 4RJ3A 4UXQA 2QC6A 3BZ3A 3EWHA 3TKUA 2YJSA 3I1AA 2QCSA 5CVGA 1OPJA 4O7ZA 3DS6A 2CKQA 3C4CA 3D2IA 1YDRE 1H0WA 4BDCA 4U81A 4BZDA 4MH7A 4FVRA 2XKCA 3VJOA 4D9TA 4EOSA 5T68A 1GIJA 1Z9XA 5EHLA 4C2VA 2GHLA 3MH0A 1ZOEA 5DI1A 3U55A 1JNKA 4O1PA 3QA0A 1M7QA 4YNEA 2G2IA 1BI7A 1YHSA 3O8PA 4IBMA 2PVNA 4KIKB 3QC9A 4XYFA 5IQGA 3QZFA 4FL2A 4KBAA 2QR8A 3BLRA 3DY7A 3V5TA 5DLSA 3W2PA 1KUTA 5ETFA 4BCJA 4KIKA 4JDIA 2JDSA 3MYGA 3C4ZA 2O8YA 5IQIA 1BYGA 1OB3A 3QRIA 3U6HA 1YQJA 2VO6A 3ZH8A 2J0MB 4NSTA 4Q5EA 5IMEA 5AMNA 2B1PA 2WIHA 4G9CA 3ZSIA 1RE8A 3LXNA 3P78A 4N0SA 2FSOX 3DAEA 1QMZA 3Q4CA 3A7FA 5ANDA 5L6OA 4RG0A 4XOYA 2QNJA 4GU9A 5CEQA 3BV3A 4PL5A 2ITVA 3BQRA 4V05A 5HE2A 3E93A 2Y4IC 5DT0A 5LWNA 4FL3A 2F2UA 1ZMVA 2WTDA 3W1FA 3TTJA 3NUSA 3PSCA 2R3MA 3QQFA 4MXOA 4NEUA 2G01A 4UZHA 2PYWA 4O7NA 4PL3A 5E8TA 3OD6X 4Y72A 4Z7GA 1OBDA 3UQGA 3SXFA 3V5JA 4EK4A 5AUUA 3LMIA 3FY2A 3Q5IA 3SV0A 4TPTA 3QBNA 2FGIA 3KXZA 2BR1A 4YU2A 4BWXA 3P5KA 4HVIA 3TNPC 4FNYA 3WZJA 3MGYA 4DA5A 2XK7A 4F70A 4F9YA 2WMBA 3HUCA 1AD5A 3QZGA 3UVQA 1OKWA 3EL8A 2ZJWA 4DBNA 4O7VA 3NCZA 4X3JA 4G2FA 2W05A 4UN0C 4ITJA 2C69A 2BZIB 3TWJA 4G5PA 3BGZA 4MWIA 4QPMA 1VEBA 3BU3A 5FXSA 2VNYA 4UZDA 2ZMCA 1OZ1A 1OUYA 4HPUE 3F3WA 3GC9A 4WO5A 4YUQA 3W2OA 4IAYA 4UX9A 2E9VA 2XIXA 3VUDA 3RWPA 3GQLA 1Q8UA 1UU7A 4X7QA 4YJPA 4LGGA 5J7BA 3Q96A 4CG9A 2CCIA 2BTRA 1BL6A 3T3VA 2YITA 1UV5A 2CLQA 4IC7A 4JDHA 3DU8A 1OGUA 2EXEA 3BWJA 2JBOA 3KL8A 2G2HA 4XRLA 2QOHA 4CFMA 4E3CA 5JH6A 4IVDA 3QCSA 5AR3A 3QUEA 2VGPA 2UW9A 3QWKA 1KOBA 2HOGA 4NH1A 3GQIA 2YM3A 4YJNA 3OT8A 3UIXA 4ID7A 1OITA 3OWJA 3C5IA 2A27A 3TNWA 4BKYA 5JRSA 3EZVA 2GTMA 4FE2A 4HYIA 2PZPA 3KU2A 3KMUA 4OTHA 4XH6A 4HVDA 2WMWA 3AT4A 2OW3A 3SHEA 3VBXA 3F2NA 3RCJA 4EWQA 3KF7A 2XBAA 3FL5A 2YCSA 4O0RA 3DK7A 4IM2A 4FTAA 3VF9A 3RBWA 4G31A 4JXFA 3WF9A 4CGAA 3CQWA 4YGAA 2C6MA 2A4LA 1M2PA 4GVAA 4HPTE 4TRLA 3GOKA 3V8SA 2XIKA 3RK9A 5KCVA 4GUEA 4QPAA 4TWNA 2B4SB 5EQEA 1TKIA 2B9IA 3WILA 1KWPA 3KEXA 4D0XA 5IH4A 3QXOA 2XIRA 4K0YA 3ZS5A 4BGGA 4UMUA 4GJ2A 5DT4A 4ENXA 3Q4TA 4I6FA 4NL0A 3PY3A 2HWOA 2UZUE 3Q9WA 3DBDA 4MD8E 4BI2A 3CSVA 4JQEA 2WQMA 2G2FA 3FLWA 3FZ1A 1P5EA 3SOAA 4AN2A 2J5EA 4FX3A 3VC4A 5H8BA 4DH7A 3RAKA 3WF7A 4EKLA 4AN9A 3PSBA 3K54A 4L6QA 3V6RA 3C1XA 2EB3A 4LOPA 5J9YA 5DA3A 1W98A 3HMPA 3GU8A 5IQHA 4FODA 4ZZNA 2VTIA 3OUKA 5L4QA 2WZJA 3UC4A 3F5XA 2C3KA 2JDVA 2ERKA 1IAHA 2C5XA 2PE1A 3R01A 3UDBA 3E3BX 4O0XA 4E7WA 4XG9A 3HZTA 4I0SA 3FHRA 2HY81 4U41A 4C4IA 3M42A 4IC8A 4KSPA 3GXLA 3P0MA 3IPHA 4IQ6A 3MB7A 4ACHA 5FGKA 4F1TA 4FIGA 5HX8A 2GQRA 3MFRA 2EB2A 2FUMA 3WZDA 4F0GA 5M53A 2HXLA 2FH9A 4BYJA 4K11A 4IB1A 3L1SA 2BDFA 4I41A 4P7EA 4BDKA 4J7BA 3UMWA 3QTIA 1APME 4WG5A 5ITAA 4CKRA 3VRZA 2Z60A 4B8LA 1UU9A 3P7BA 2YIYA 2NO3A 3NYOA 4AT5A 1WBOA 1FMKA 5JZJA 1XH9A 2C3IB 4J98A 3EFJA 3RAHA 4C58A 2HZNA 2C3JA 3RP9A 3HX4A 2WTCA 4ZTNA 3P86A 5HCZA 2CDZA 4RRVA 4JX3A 2RG6A 3NAYA 1ND4A 4FTTA 4ENYA 4FA2A 2XEYA 1KOAA 3DTWA 3VBYA 4R7HA 3GCPA 4OTWA 5CT7A 4BCGA 1H1WA 2XK6A 1JKSA 4U5JA 5JK3A 2UW3A 2IZTA 3P4KA 4GVJA 2DWBA 2GQGA 3MVHA 5FG8A 2ZV9A 3PXRA 4L3PA 3AMAA 4KBKA 5AV1A 5FUTA 2XVDA 2JKKA 3AD6A 3LXKA 4PDOA 2CGUA 3POOA 2PUPA 2XCKA 5E1EA 4RA5A 4UYAA 4DYMA 3PVGA 4BFMA 4EH5A 5L3AA 2CKPA 4C2WA 3PP1A 4JVGA 2Z7QA 4FV5A 2O3PA 2QU5A 3ZBXA 1CKPA 4FT0A 5L6WL 1H4LA 3HP5A 4DTBA 5FBOA 4OAVB 4QMLA 5HCYA 3ULIA 3I0OA 3ZO4A 2OLCA 1BLXA 1RW8A 3IGOA 4G3EA 2BAJA 5K0XA 5HVKA 1SNXA 4DEHA 4NTSA 2FB8A 5EDPA 5IU2A 2QVSE 2OG8A 4RIOA 3FMDA 3KXNA 3VO3A 3FV8A 3JVSA 4IB0A 5IQEA 4EYMA 2O5KA 4EJ7A 3EL7A 4OR5A 3QQGA 3V5WA 4ZTRA 4ZY6A 1QPDA 3OOMA 2VWBA 3QTSA 5LQFA 3PLAE 1BL7A 4MVFA 4CD0A 4CFFA 5CVHA 5FM2A 4DBXA 2C68A 2XM8A 1OKZA 5EDQA 4MF0A 4AP7A 3ORMA 3MIAA 4RFYA 3EZRA 5DN3A 4EH9A 4ZJVA 4ACMA 4ZY5A 4DFUA 4O0VA 3R8LA 2CN8A 3GU6A 5EKNA 2JEDA 3DFCB 2C1AA 2B54A 4FUXA 2PVRA 2YCFA 1UWJA 4IWOA 1RDQE 3LFNA 1IEPA 3KB7A 3MA6A 2NNWB 2XM9A 3GU4A 4N6YA 3I7CA 2XJ2A 2VTJA 4F63A 2BFXA 3KXXA 5GJDA 4AX8A 5AM7A 3ZDUA 4ZLZA 4EQUA 4EK6A 2W5AA 1J7UA 1A06A 3LMGA 3GCQA 3ET7A 4TYHA 3LFDA 1DAYA 3NW5A 4L46A 4O81A 4O2ZA 1PXPA 5IQFA 3JY9A 4I5CA 4RZWA 4MD9E 5CAUA 3A7IA 3RPSA 3OROA 5CNNA 4PDPA 5KE0A 3QQJA 4EH8A 2OH4A 3ANQA 3THBA 2XIZA 4RPVA 4FTCA 4FR4A 4FIIA 4AA4A 3KK9A 2XNGA 4Z55A 1FPUA 1OL6A 1M14A 4BRXA 1H27A 4FV4A 4EH3A 5F94A 3FBVA 5J79A 5KMMA 3DFAA 4EL9A 3QL8A 3QRJA 3IW7A 3NWWA 4U8ZA 3QRKA 4HYHA 4D4YA 5A14A 5HO7A 1F5QA 1IA8A 3AC4A 5AUWA 4O91A 5ETCA 4FUYA 2XYUA 4WT6A 1YXSA 2IVVA 2YLEA 3CCNA 3OHTA 2R4BA 5CSWA 3QQKA 3TV4A 4F08A 4USEA 4JBVA 4BDGA 4JG7A 4O0TA 3M2WA 3NZ0A 4FT3A 5ACBC 4ZSJA 2B55A 4Y46A 4AGUA 3RHKA 5GZ9A 3ZO1A 1S9JA 4YTCA 2ITZA 4I20A 3SVVA 4WNMA 2X39A 3QRUA 2PVKA 4GK2A 2J50A 5GZ8A 4J96A 3WF5A 4RX8A 3ZRKA 1YVJA 4GFMA 4CTBA 5F95A 1NT2A 3OW4A 3D15A 4R3CA 1M17A 3U54A 4RFMA 3CBLA 3LCTA 5D1JA 2KTYA 1M2RA 4QP1A 3FY0A 3K3IA 4GH2A 4USDA 4DTKA 3VS7A 1YXTA 5BVKA 3U87A 1BX6A 1ZXEA 4S31A 2YERA 2WHBA 2BRHA 3N9XA 4BDHA 3P23A 2DS1A 1MUOA 2ZM1A 4YO4A 4JQ7A 3KVWA 3OP5A 5KZ0A 4G6NA 3EYHA 3FWQA 4DCEA 3NNXA 4DH5A 4LM5A 3IS5A 3RHXA 3A61A 3S4QA 4CTCA 3QGWA 3FMJA 4O6EA 3PJCA 3WYYA 1PMNA 3KC3A 4MBLA 4R5SA 1S9IA 4ANLA 4M69B 4C7TA 1REJA 1J1CA 3CR0A 4IZAA 4QTDA 4RQKA 3UYSA 5CAQA 1Y6AA 2OIDA 4MXYA 2RF9A 4FF8A 3D9VA 4KBCA 1FGIA 2ZMDA 4PWNA 1IA9A 1MQ4A 3LMHA 2R5TA 3FZTA 2C6DA 3NUPA 4TWOA 5HZNA 4CG8A 4IJPA 5CEIA 4GK4A 2VTQA 4PX6A 5CVFA 4E20A 2IPXA 1PY5A 1QPJA 3CPBA 4FV0A 1I44A 4MQ1A 4FV2A 2GPHA 5DH3A 4N70A 3PTGA 5BYZA 1H1SA 3ZUUA 3CXWA 5BQ0A 4FTJA 2YHVA 3DK6A 2WMRA 5A4QA 3IKAA 3LFEA 4S2ZA 2QHMA 3IDCA 5C4LA 4D55A 5IDNA 4NZWB 3R7GA 4CCBA 2C47A 1YOJA 1PXNA 4TT7A 3OOGA 3GOPA 2GNJA 1NXKA 2C0IA 4FEUA 4WUAA 3FXXA 2YAKA 5AR2A 3KA0A 4FKLA 3TN8A 5A46A 4J8NA 4MXAA 1JSVA 3UOKA 3DNEA 3O51A 3PRFA 5EYCA 1U46A 4HGSA 2J90A 5KMOA 4FSYA 2ITQA 2QR7A 3PG1A 4GL9A 5CEOA 4CRSA 1KE9A 1GIHA 3NNVA 5CANA 4W4WA 2OFUA 1WMKA 2WMUA 4BDDA 2ITWA 2UUEA 5JKGA 3SXSA 3LQ8A 2F9GA 4IH8A 4QTBA 3QX4A 3UYTA 4QP9A 5L2SA 4YZNA 4WHZA 5HO6A 3QGYA 3FMHA 4BHZA 5C8KA 3VAPA 4DFLA 1PW2A 2B52A 4WIHA 4H58A 3SAYA 2F7ZE 2YCQA 4AUAA 5J5SA 4YHJA 4CQGA 4C3RA 3FAAA 3PFQA 4YJVA 4Q5HA 1UNHA 4CFNA 4DH3A 4U42A 2OIBA 2R3FA 3ALNA 3FDNA 3GGFA 4CZYB 1Q3WA 3CGFA 5I9UA 3RJCA 3BQCA 3BYSA 4NUSA 4UMTA 5E8ZA 3EN4A 3G0FA 5HX6A 2HY0A 5CALA 3MY0A 2NRUA 1NVRA 2PZ5A 1Y6BA 3COIA 3HMOA 1R0PA 3H3CA 3P79A 2ZV8A 2XIYA 3HMIA 3QYZA 4L67A 5C27A 1J91A 4U80A 2P2IA 1OKVA 3G6GA 4F7NA 4ONAA 4FIHA 3BEGA 3KN6A 5G1XA 3EN7A 4WSQA 5DG5A 2JGZA 4FKJA 1OIUA 5TO8A 5IA0A 4BF2A 3OF0A 4M15A 2C6TA 3ENHA 3HAMA 3KREA 2OXDA 5A4EA 5KMNA 2O64A 2PUUA 1GOLA 5LVNA 2R3OA 2R64A 3RI1A 4TZRA 3ZZEA 2I1MA 3O7LB 3D4QA 4EQCA 3HV5A 1WBTA 4X21A 4H3PA 3JR1A 3FPQA 4EHVA 4EI4A 4TYGA 4YSJA 4FKIA 1YWVA 3FLNC 5EW9A 4EBVA 3MPMA 3EQHA 1SMHA 3ORXA 5EQYA 3VBTA 3MY5A 2UZVA 5BVDA 4CT1A 3VF8A 2ZM4A 4LL5A 5E4HA 5DVRA 4X0MA 4I23A 4HYSA 2OJJA 3PVUA 3GBZA 4FKGA 4GIIA 2XKEA 4F4PA 3SXRA 1TQMA 4HNFA 2JKMA 5CX9A 2JITA 2W99B 4DGMA 1ZY4A 2XJ0A 3GEQA 3BYVA 5AFVA 4USFA 5HTCA 5EYKA 5BUIA 3IW8A 4V04A 5HLWA 3KRLA 2CHLA 2OXXA 4GSBA 2QU6A 3AD4A 4M7IA 1ZZ2A 4UMRA 3II5A 3C0GA 2ETKA 3ACKA 2WO6A 3OXTA 5GNKA 4G6OA 4EK5A 1QL6A 3N4TA 5CU0A 2CKEA 4AOIA 5JFWA 3TZMA 3R7UA 3MB6A 3WE8A 1BKXA 5IUIA 3CGOA 4GRBA 3ZLWA 1SVHA 2GNLA 4M67A 4C02A 4ZZMA 2YIQA 4BCMA 5JT2A 4PPBA 2HXQA 3M11A 1OL5A 3Q3BA 4QD6A 4D2PA 2VX3A 2VX0A 4RIWB 3VBWA 2O0UA 4IEBA 4XLVA 3UIMA 2YWVA 4DGOA 5IQDA 3RNIA 4PV0A 1OKYA 3R2BA 4XOZA 4L43A 4BN1A 3TACA 4I22A 5ETAA 4RIWA 3VS1A 5IH5A 5IMXA 3P08A 2RFDA 4MXZA 4QNYA 1R78A 2P3GX 4MBJA 2C5NA 2ZV2A 5FLFA 4HVHA 4BBMA 5A4TA 3HA8A 3ZC6A 3EMGA 3ZXZA 2IJMA 2VO0A 2W5HA 1UKIA 3F6XA 3LCSA 3NUYA 2NPQA 4OTQA 4ZJJA 3ACJA 4EOPA 4EK8A 4XCUA 2R3RA 3RGFA 4C57A 1PXKA 3G2FA 4JT3A 2C5YA 3MPTA 3OMVA 2XNOA 2X6DA 3C4WA 3HL7A 3NNUA 2WEVA 3PPKA 5EYMA 3CY2A 4PTGA 4UMPA 2YCRA 4ANBA 4NKSA 4GKHA 4OUCA 3DLZA 1FGKA 1UNLA 3G33A 2RFNA 2R0IA 3OTVA 4V0GB 4BWKA 4FYNA 1KV1A 1OL1A 4LL0A 2CNVA 3TCPA 3P7AA 4I3ZA 1R1WA 2HW6A 4V0GA 3SDJA 3EQBA 4R77A 4X6QC 1ATPE 2HIWA 2CCHA 1DI9A 2PVMA 2Y0AA 3EN5A 3KCFA 3R9NA 1WBSA 5ANEA 5HU9A 4TY1A 4ASEA 1YRPA 2OZOA 4M97A 4IAKA 2VD5A 3QHWA 5K4JA 4F6UA 3C5UA 2PSQA 1K9AA 1H1QA 3UVPA 3F82A 4O83A 3HA6A 4ASDA 3TV7A 3R6XA 4MNEB 1HCKA 4UY9A 4N57A 4LMNA 4BCOA 1XWSA 3I4BA 4LUEA 3S3IA 3AD5A 5IPJA 3AOXA 2BZKB 3V8TA 2EXCX 2W4KA 3KK8A 4MNEA 3ZO3A 3QKMA 4BIBA 2BALA 4K2RA 3MIYA 4QT1A 4U40A 3RVGA 5H9BA 3A62A 3DOGA 1Y91A 3TDVA 4I4EA 4AWIA 2X7FA 3E7OA 3GUBA 5LVPA 3N4VA 3W8QA 2X0GA 2WTIA 4OBPA 3S2PA 3FEGA 4LGHA 2QLUA 5ANIA 2BIYA 3WF8A 3SLSA 4R1VA 4PTEA 5KMIA 4HJOA 2VNWA 3Q6UA 2PL0A 4FTQA 2Y6OA 5HEZA 3Q6WA 4QMOA 1W8CA 5B0XA 4I6BA 3TIYA 3ZOSA 4JQ8A 1H28A 5L2WA 5FQDC 1V1KA 4L53A 4QP2A 3S0OA 5CT0A 4WG3A 4Y5HA 5J87A 4O7YA 3SOCA 2IWIA 3COHA 4ZMFA 2ZB0A 2W1ZA 3WZEA 4TNDA 3UIBA 4KIOA 1U5QA 2VWYA 1GAGA 4PMSA 3NLBA 4YPDA 4EUUA 1H1RA 4FTOA 4TW9A 2JIUA 3VNTA 4EEVA 5CENA 2BROA 4IAAA 2C6KA 4ZTSA 3HRBA 4D1XA 1U5RA 5GJFA 2ZAZA 2W1FA 4JIKA 2VTLA 2YIXA 3Q9ZA 1DM2A 1CDKA 2VTSA 4XBRA 2XK8A 3VUGA 4FG8A 1Q8YA 5M4CA 4NJDA 5EI2A 3S1HA 4YJUA 3VVHA 2GDOA 5AUZA 3TXOA 4TN6A 2UVYA 2ZDUA 4D0WA 4UBAA 5J7HA 3ERKA 4I0TA 2R7IA 4BYIA 3HAVA 3BELA 1K2PA 3OWPA 4FOBA 3VUTA 3HNGA 2WTJA 4GMYA 4U7ZA 2PHKA 3WOWA 5JGAA 3RK7A 3PIYA 4KAOA 4A9UA 2IZUA 4K33A 4PL4A 1BUHA 1G8SA 2YLFA 4I94A 4G3FA 3MJ2A 4IE9A 4BDIA 2UV2A 4WBOA 2QOFA 2I0HA 3R21A 4ANSA 1PMUA 3U8WA 3ZEWA 5JQ8A 4WSYA 5F1ZA 1YHVA 1F3MC 3UG1A 2J0KA 1ZYJA 3TZ8A 2ONLC 2XMYA 3DZQA 5I9WA 4GYIA 4HCUA 5IUGA 3R28A 4JBOA 3ZFMA 4BCFA 4KNBA 4OTPA 3B2TA 5FP6A 4G1WA 4IB3A 2P55A 2OF2A 3ZDIA 2ITOA 3MN3A 3NX8A 5AR8A 3VULA 4BIDA 2OF4A 1OIQA 1Z57A 3TT0A 5HNBA 3BHHA 3NDMA 1B38A 1PKDA 3OEZA 4YZCA 2OXYA 4DN5A 4J52A 2JDOA 4HW7A 3LFQA 4PF4A 2LGCA 4IAFA 4L00A 5KUPA 4IM3A 1JSUA 4S32A 3P7CA 3CS9A 2XRUA 4EC9A 2B9HA 3EQPA 4LGDA 4AW5A 5CASA 2JBPA 3HLLA 4WBBB 3ZUVA 4RVTA 4JX7A 3TG1A 1AGWA 3PJ3A 3CQEA 1XBAA 2ZV7A 5KMLA 4DINA 4W9XA 4JBQA 1YDTE 3DDQA 3HECA 5FDXA 1OIRA 4C0TA 5CEKA 4EH2A 3IECA 5CLPA 4LUDA 4AZEA 3U9NA 1CKJA 2OFVA 3VUKA 3LFFA 3O96A 3QD3A 4FIJA 4MXXA 4C59A 4ZXTA 2PMIA 3CD3A 4FV7A 4JNWA
chains in the Genus database with same CATH superfamily
1OI9A 2BZJA 3QZHA 3SD0A 2BDJA 3W0QA 4QOXA 5AUVA 3OS3A 2QURA 4XG4A 3RM6A 3D7ZA 4PMTA 4D2WA 4YP8A 2WTVA 3PZEA 4LFIA 4UEUA 1JWHA 2VTOA 3AMYA 5TOZA 4A9RA 3CTHA 4FT5A 4RBLA 3AMBA 4O84A 4CKIA 5DPVA 4YJSA 4WD5A 3R22A 3BBTB 3KXGA 3ORTA 3RKBA 2A1AB 3F3ZA 4WNOA 4EOJA 4P90A 4YTIA 1WVYA 4C61A 2Z02A 1VYZA 2Y4IB 3CTJA 3PYYA 5D11A 5DYJA 5FEEA 4Z16A 3DA6A 1O6KA 3TNQB 5DR9A 3V6SA 3F5UA 2HW7A 3QTUA 2C5OA 2XNEA 4R6VA 5AUYA 3C7QA 5GIOE 1DI8A 3F66A 1RJBA 2PZIA 4MNFA 3PIZA 2BTSA 4KS8A 4DLJA 2ONLA 2OICA 3KCKA 5I9XA 4P2KA 4WNKA 2XS0A 3GFWA 3H10A 4V01A 4EBWA 3PVBA 5AP2A 4D2TA 3HV6A 2R3PA 4RC2A 1H8FA 1ZOGA 4HYUA 4CV9A 2CMWA 5LCJA 4IFGA 5CF4A 5B2LA 2E9UA 2PZYA 2CJMA 3FSKA 4X3FA 2PMLX 3CQUA 4A9SA 4AN3A 3GC0A 3DTCA 2ACXA 3A7HA 3VS6A 4FBXA 4MHAA 3WBLA 3H9FA 3VN9A 5EDRA 3MFSA 2XH5A 3ORLA 4F9CA 5E8VA 1KSWA 4FKWA 3B8QA 3QTXA 5HLPA 2J7TA 3ZLYA 4B6LA 3BGPA 3REPA 4F99A 2ESMA 2X2MA 1VR2A 3ZYAA 2ZM3A 4L45A 4O4CA 4O7SA 4ZTQA 4G16A 2UW8A 2BIKB 1U54B 3COMA 2P0CA 4RZVA 5D41A 4HGTA 3DKGA 4XG8A 3K2LA 3MV5A 3PUPA 2O2UA 5EM7A 1WBWA 1UA2A 1U54A 3G51A 5BMMA 2GNFA 3FZRA 3GCSA 2BVAA 1GY3A 4HOKA 4FOCA 4MTAA 2VTTA 3BU5A 3R63A 4C37A 4BI1A 4CLJA 2B7AA 5I5ZA 4QNAA 5HLNA 4O82A 4FTLA 1IAJA 4U79A 3LFAA 3DJ5A 2W1CA 5BVEA 4D4VA 3HP2A 4Y85A 1HCLA 1LEWA 2WTWA 1ZAOA 3AC3A 4MF1A 3Q32A 5LMBA 3HDMA 5J5TA 4FMQA 4ACDA 1P4FA 4IZYA 3TNHA 3ZTXA 4FKPA 2B9JA 4MQ2A 3KRJA 3F3VA 2XF0A 2ZFYA 2UW5A 3MSSA 3AGMA 4CYIA 4QRCA 3TUDA 4LV8A 2QOCA 2C6IA 3Q04A 5M56A 5IA4A 3ORIA 3OCTA 1WVWA 4W4YA 1FMOE 4I21A 4KABA 5ANOA 4NIFB 5M4UA 1T45A 4YPSA 4DGNA 2XNPA 3F2RA 2RIOA 4K8AA 5A4LA 4YLKA 4D1ZA 1JSTA 5HBEA 3W0PA 5I9VA 1FINA 3O7LD 4NIFA 3UDTA 1ZWSA 5JN2A 4LOOA 4PNIA 2ETMA 5DNRA 4AFEA 3R7EA 3EB0A 2W7XA 3MTFA 3R9OA 4FKSA 1M2QA 3WE4A 2X2KA 3UNKA 4QMZA 4CZTA 1XKKA 3EYGA 3EKNA 5AIKA 2JAVA 4UALA 1LPUA 2UZLA 4GJ3A 4PY1A 2VTHA 3VIDA 4I92A 3VUHA 4C4HA 3UOJA 3QD2B 3V01A 3ZSGA 4BWPA 4FIFA 4IAIA 4YO6A 3QLFA 1G3NA 4U3YA 2QOKA 4APCA 4ASZA 4IX5A 5HO8A 4E6DA 1Q62A 3C0HA 4BTJA 3GVUA 3ZUTA 4DFXE 4OTFA 5FM3A 4GCJA 5HIEA 4I6HA 5M07A 2EU9A 2RGPA 4XV9A 4QMMA 1W0XC 3OY3A 3F88A 5A6OA 1LP4A 3U51A 4G17A 1KE6A 3QUPA 3PE1A 2OKRA 4LRJA 3R02A 4ARKA 5CEMA 3BPRA 2NRYA 3KXHA 4O4BB 3TV6A 4DAWA 4DEAA 4E5WA 3Q2JA 2WQEA 4R78A 3QCXA 3ODZX 1OM1A 4NW5A 4YBJA 4P5QA 3ODYX 3ITZA 4O22A 2JFMA 4TYHB 2OU7A 3S00A 1U59A 3VW6A 5AUXA 2F7EE 2WMVA 4JG6A 5IQBA 3NGAA 4U6RA 2J0IA 4L52A 4OGRA 3OFMA 4YJQA 4NCTC 4E4NA 2PZRA 3K3JA 3W0MA 2CN5A 4FTUA 2VTRA 4M14A 1Q8WA 4IM0A 3UBDA 4QMPA 3PZHA 3R1NA 2QKRA 3ATSA 4BJJB 1PHKA 1GZOA 5HIDA 5M09A 4MD7E 3QWJA 4JIAA 4MWHA 5IA3A 4A07A 4G6LA 5EKOA 4TYEA 2HZ0A 4A7CA 4KRDA 2ERZE 2V7OA 3V5PA 4N6ZA 2WFYA 4Q9SA 4Z7HA 3VBVA 2IN6A 3A8XA 5LARA 1JQHA 4AE6A 2R2PA 3EQFA 3A7GA 3RAWA 2GS2A 1XR1A 2YDIA 3H0ZA 4BICA 3S95A 2DUVA 5AIRA 3H9RA 3GI3A 4HVGA 3SGCA 3IDPA 3H4JA 3MI9A 3DKFA 4QP8A 4M84A 5AX3A 1P4OA 5HESA 1LEZA 3QHRA 4L9IA 3BE9A 4Q9ZA 1ZY5A 5D10A 4R8QA 3HV7A 2W4JA 2X81A 2BDWA 2P33A 3I6UA 3ROYA 4FT9A 4N4SA 4QTCA 4IJ9A 2F2CB 3UZRA 5TR6A 1YW2A 3R7IA 3L8PA 2FSTX 3FUPA 4IDVA 3P9JA 4RJ8A 5CSVA 5I3RA 4CVAA 2OH0E 5DR2A 3UQFA 5DEYA 2XBJA 4AOJA 4R7IA 5IKWA 3JYAA 2WOUA 4EZ5A 4KWPA 4QYFA 2H9VA 3PA5A 4IXPA 3TL8A 4AW1A 3CC6A 4D28A 1KE5A 3WARA 4FNWA 4G34A 3W32A 3NUXA 3I79A 3R73A 4QQJA 3DXPA 3LPBA 4F7SA 4UWYA 3W2SA 4TWCA 2XKDA 5HTIA 1H01A 5LVMA 3W2QA 1E1VA 4M3QA 2OZAB 3ZXTA 2OJFE 3TI1A 2C4GA 5E1SA 3C13A 4FV1A 3C4XA 3IW4A 3IK3A 5M57A 5FDPA 3A2CA 4FKTA 4O2PA 4QP7A 3VHEA 1MRYA 2HK5A 2OZAA 2REIA 3E7VA 4XG7A 2BKKA 2Z7RA 5E8SA 3SRVB 1HOWA 2QO9A 1XJDA 3F3TA 4Y8DA 1JKTA 2XNBA 4DHZA 1ZYCA 1P14A 4RX7A 3SRVA 3RPRA 1O6YA 4U3ZA 2ITUA 2RG5A 1G8AA 2GMXA 4GU6A 2UW0A 4BDBA 2UZDA 2WPAA 5G6VA 4RJ5A 4EOIA 3R8MA 5ICPA 4O7LA 4LRMA 3CTQA 5DRDA 3RPYA 2DQ7X 2H8HA 2VWWA 4QYYA 3UOLA 4C33A 2WMQA 2W1DA 3AT3A 3MVMA 4O0YA 3KRRA 1Q8TA 4GFGA 4QMSA 4F6SA 2C30A 2H6DA 3ENMA 2HWPA 4IW0A 3Q5ZA 3MW1A 4NCTA 3BX5A 4ZY4A 2X8DA 4DH1A 1FVVA 4ZAUA 4FEVA 5HE1A 1PF8A 5M55A 4ZIMA 4ACCA 3R8ZA 2FO0A 2VX1A 3OEFX 3Q60A 2QD9A 4ITHA 4FV3A 5AJQA 1PJKA 3BHVA 3GCVA 2SRCA 2Y6MA 5D7VA 2XAMA 4GKIA 2BHEA 2VV9A 5EHOA 4AGWA 3EQDA 2C6EA 4AZWA 4CFUA 4F09A 4CEGA 2PU8A 3T8OA 3V5QA 4F0IA 3BBWA 4FTNA 3ZRLA 4KA3A 3LJ1A 4WG4A 1TQPA 3BWFA 5EOLA 3F69A 5BMSA 5HQ0A 4LYNA 2X8IA 4JAIA 3BHUA 3C0IA 5BX0A 1GZKA 3FJQE 3RPOA 2GNGA 3LJ0A 4NKAA 4OTIA 1M52A 4RJ6A 3FXZA 3DNDA 3QYWA 3R9DA 4BTKA 4EOQA 4QEBA 2VWIA 4HGLA 2VN9A 2W17A 4FZ7A 4R7BA 5BVOA 3IW6A 4IWDA 4WKQA 4GW8A 1YI6A 2QO2A 4PTCA 3BL7A 4R1YA 4LQMA 1PXJA 2F7XE 5IQAA 2HZ4A 3TDWA 4ALUA 2G15A 1JKLA 3E64A 5JFXA 3QAME 5JGBA 5EI8A 4ZS0A 5LWMA 1UVRA 4O21A 3LXLA 3DLSA 3BIZA 4CKJA 3BE2A 4FNZA 1YDSE 4F9BA 3TUCA 4E5AX 4RA4A 1OL7A 5CU6A 4B7TA 4BTMA 5BVFA 3I60A 3HVCA 1Q5KA 4QMUA 3MDYA 2R3GA 4NM7A 5AV3A 2FSLX 2IO6A 5DR6A 4BGHA 4C4EA 3LJ2A 5M44A 4XV3A 5K3YA 4NTTA 3MJ1A 5TE0A 5HG9A 4DITA 3E87A 4DG2E 2XK9A 5JRQA 3VJNA 5CAPA 2J51A 3R71A 4XX9A 3D5WA 3JXWA 1MP8A 4O27B 1KV2A 4G3GA 5DWRA 3WI6A 4ACGA 1OPLA 5CQWA 4XS2A 4K18A 4QPSA 4U9AA 3BEAA 4MYGA 1CTPE 3FLSA 3NS9A 4AE9A 3KFAA 2BILB 1W7HA 1KE7A 3FLZA 4RT7A 4YZMA 2X0PA 5EG3A 4AZSA 1UWHA 2XP2A 2PUNA 3PWDA 5FBNC 1YXVA 3JPVA 1FOTA 4C38A 4L44A 1PMVA 1J1BA 3A60A 3R30A 4FSNA 2JKQA 5EFQA 4W4XA 5JQ5A 3PDTA 4KKHA 4CRLA 3SQQA 4W9WA 5LOHA 4X2KA 3R7YA 3RZBA 2BRNA 3BI6A 3BYUA 2X4FA 4RGJA 2GS7A 2J9MA 2YM6A 2YEXA 5HOAA 3PRIA 4MXCA 2W06A 5KBQA 4KIQA 3LLAA 2F49A 2WQNA 4ZSGA 2XK4A 3ZHPC 4CLIA 4LMUA 2IVUA 2PVLA 4L7FA 3UPZA 3DXQA 5L2TA 4RIYA 4YC8A 4ZOGA 2XK3A 3BYOA 1V0PA 3IGGA 3L9PA 4JI9A 4I1ZA 3QLGA 2AC3A 2GCDA 5DE2A 2WIPA 2CGXA 1H26A 3PLSA 1SVEA 4LG4A 2HYYA 4FKOA 3UMXA 3ZCLA 2YIRA 3QTWA 3L9NA 5DOSA 4BB4A 2X9EA 3PY1A 3TZ7A 2YZAA 1WBVA 4DCAA 1JBPE 3WZKA 4AA5A 1WBPA 2FVDA 4NWMA 2EVAA 5KZIA 2W9ZB 4D1SA 3V5LA 3DZOA 1YWRA 3OW3A 4ZSLA 4IVBA 5C03A 3OC1A 5EQPA 3R8PA 1MRUA 1Q41A 5ANGA 1XH4A 4K77A 2QG5A 4FIEA 5CSPA 5EI6A 5TT7A 3AGLA 3DGKA 2P4IA 2WMTA 2PK9A 3DK3A 3FHIA 3VS3A 5HNIX 3FXWA 3SW7A 4ZP5A 2C0TA 2YIWA 1FBNA 3D0EA 3EKKA 4JLCA 4OBOA 4GEOA 4Z3VA 2UZNA 4GIHA 5HI2A 4PRJA 4ANNA 3O50A 1M7NA 3Q4ZA 3C4FA 4I5HA 1URWA 3KVXA 5JZNA 1TZDA 2VTNA 4XP2A 2OIQA 3O17A 4EOMA 3QRTA 4S30A 4YZBA 4A06A 4A4OA 5IQCA 1E9HA 3PUFC 4Y95A 4FEQA 3W2RA 4F1MA 3ATTA 4YC6A 4QQ5A 5I9ZA 3QZIA 5HVJA 4UWCA 4XV1A 3NUAA 4BI0A 1Q4LA 3MWUA 4TYJA 2KULA 3FQSA 5EM6A 3HV3A 3TTIA 3V3VA 3FMLA 2YZLA 4QYHA 3R00A 2BKZA 2GHGA 4XMOA 3IW5A 3E8EA 4DGGA 4AAYA 2EXMA 1OL2A 4AACA 1XBCA 3CEKA 3CJFA 5EW8A 5DHJA 4LI5A 4I93A 2R3LA 2J2IB 4LV5A 4XNEA 3ID6C 3LXPA 4ITIA 4I6QA 4KINA 4DH8A 3UC3A 4RWJA 5E8UA 4FG7A 5GHVA 5CF6A 2VZ6A 4PPCA 3KF4A 2WMSA 1NA7A 4XG2A 3DQXA 5A54A 3R7OA 5AEPA 1GJOA 3DPKA 2VTPA 5F9EA 5H3QA 3PXQA 4GT5A 3OCGA 4BDJA 5BVNA 2EUFB 4IDTA 4EORA 5KHWA 1FVRA 4B99A 3AXWA 4FZDB 4BZNA 5IG1A 4FTRA 4O86A 3VS4A 3UDZA 3P1AA 4FTIA 2YDJA 1GNGA 2R3HA 2OI4X 3L9LA 5D7AA 5IA1A 4CYJA 4FVPA 4XJ0A 4GFOA 3JVRA 3FKLA 2UW4A 4AQKA 5CXZA 2R7BA 4TKSA 4CMUA 3PFYA 4W8DA 3ANRA 5LMKC 3T9TA 1PXMA 3B2WA 4HVSA 3VWAA 2CSNA 3R1SA 2QOOA 3HMMA 4IX4A 3LQ3A 2AUHA 4CNHA 4Z9LA 3R04A 1ZLTA 2GU8A 2HCKA 4BL1A 4QMQA 4M8TA 3PY0A 3WF6A 4CMOA 1YI3A 1STCE 2I40A 3WIKA 4B8MA 4EOOA 1NY3A 5HE3A 4IX3A 4DF3A 1Q3DA 3FI4A 1TVOA 2GTNA 1QPEA 3HRCA 3LCOA 4L42A 4RVLA 3W2CA 3UIUA 2VO7A 3DBCA 5DIAA 5KBRA 4UYNA 3R1QA 2B0QA 3I0QA 2YISA 4H3BA 1YOMA 3O71A 4QMWA 4DFNA 1H00A 2JDRA 2BMCA 3NNWA 4OW8A 4UV0A 2X6EA 3EJ1A 2YWPA 4J1RA 3E8CA 3W0OA 5JEBA 4DT8A 2FA2A 3R1YA 3ZO2A 2WOTA 1YI4A 4FV9A 5AV2A 2CGWA 2RL5A 4JR7A 5AV4A 4NFMA 3BGQA 4FICA 5GZAA 5IF1A 2YFXA 2BHHA 5L8JA 3RCDA 1UU8A 3CKWA 4BIEA 1XH7A 2B53A 3K5VA 2RFSA 3VRYA 3U6JA 4GK3A 4EC8A 5B2KA 3FE3A 3E62A 5A9UA 4ZTHA 3ORNA 3TKHA 2IW8A 1CMKE 3G15A 2CLXA 4LOQA 5J95A 3I6WA 3LE6A 3I81A 3NW7A 4L7SA 4EH6A 2R3IA 4BKZA 4TWPA 5GIPE 2E9OA 2OK1A 2CPKE 4L68A 4FKRA 3FQHA 4EYJA 4AS0A 4IWPA 4QP6A 4G9RA 1SYKA 4MEDA 3T9IA 5JFVA 3GENA 4NW6A 5EHYA 4FTMA 4FZ6A 2YM7A 4JAJA 4MX9A 2FYSA 1KE8A 2ITYA 5FTOA 4AQCA 3KRWA 5CF5A 3NEWA 1ZOHA 3OY1A 4BVUA 3O2MA 2NP8A 4IVCA 5AP4A 3FL4A 2V0DA 3HKOA 4XG3A 5AUTA 4X2NA 1SZMA 3LFBA 2X0QA 4M68A 3QTZA 3F61A 1O6LA 1J7LA 3DXNA 3MVJA 3PG3A 3CE3A 3FZOA 5HGIA 3R8VA 5C8NA 1PRYA 2EWAA 3FC1X 3NUNA 3UO5A 5ETIA 4RX9A 3WIGA 3A4PA 2PMNX 2R9SA 2B9FA 3AQVA 3F5GA 2I6LA 4YNOA 4YHTA 4DGLC 5HBHA 4KS7A 1NVSA 2OO8X 5CZIA 3IONA 2V62A 3BLQA 3G0EA 2Y8OA 3KY2A 3TNIA 5LMKA 5M4FA 2PULA 3ZEPA 3PXFA 5CU3A 3C4EA 3KN5A 3BRBA 4GG5A 5CXHA 1JPAA 4BDEA 4MUQA 4BR3A 4X3FC 5B2MA 4FSMA 4DHFA 5HE0A 5KX8A 3M1SA 3UGCA 4PP9A 5L8LA 2QOIA 4A9YA 3PJ2A 3RWQA 4MBIA 2VWVA 3UE4A 3W33A 2JDTA 1EH4A 2UVZA 3MTLA 4RC4A 4Y73A 5CWZA 4HZRA 3MVLA 3FKNA 4C34A 2CNQA 3ELJA 3ORKA 5M08A 2C5VA 1SM2A 4H1JA 4AFJA 3DT1A 3I7BA 2W9FB 3R9HA 4DFZE 2OBJA 3CP9A 3ZRMA 4RJ4A 4ZMEA 2BPMA 4PDSA 5ANKA 2JC6A 4U97A 4BCNA 1F0QA 2Z7LA 3GB2A 5H2UA 2X4ZA 2G9XA 4H36A 5HIBA 3ZZWA 5HD4A 3EN6A 3QTQA 5T3QA 3E3PA 2WEIA 1WFCA 4DEDA 2Z8CA 3PXKA 3U6IA 1WBNA 3IG7A 5AX9A 1H0VA 2WTKC 3A99A 4EOLA 4FJVA 2X1NA 4K9YA 5K5XA 4QP4A 4AGDA 4X6RA 4OTRA 3MH2A 4BBFA 4JS8A 5LVOA 1VYWA 3A4OX 4L01A 5KMKA 3QQLA 4JRNA 3IDBA 5FWKK 1PYEA 4FYOA 4BKJA 2QQ7A 1YXUA 3QKLA 5EOBA 4A4LA 4AOTA 5IUHA 4PNKA 3POZA 3OCBA 3RALA 4RWKA 1BI8A 4W4VA 2JLDA 4DDGA 4O96A 4UXLA 3ZFYA 4EUTA 1R0EA 4D2SA 3AC5A 3CJGA 1SNUA 5K0KA 1V0OA 3NW6A 3HMNA 4BHNA 2YABA 4C3PA 5AP7A 3PJ1A 2UZTA 3GC8A 5BUEA 1G8JA 4J97A 1B6CB 1AQ1A 1QCFA 2BRGA 5ACKA 4QMNA 3QKKA 3VQUA 5M51A 4EZ7A 1P2AA 2V55A 2XZSA 3QCYA 1W83A 4BCQA 2C6OA 4NJ3A 5E90A 5AA9A 5E9EA 3NVKI 3W10A 4O1OA 3W16A 5CAVA 3LM0A 4BBEA 3LHJA 3OBGA 4X2GA 4EHGA 4ANMA 4O4FA 3PXZA 1ZYDA 3NIZA 5B7VA 5HORA 5EM5A 5LCKA 3VUIA 3OVVA 5L2IA 5AV0A 4CMTA 4OBQA 4GV1A 3D14A 3NAXA 2X7OA 4AU8A 2G1TA 4M0ZA 2C3LA 5L2QA 4EWHA 2IVTA 3P5JC 5EM8A 4OAUC 3D83A 3GP0A 3JY0A 3N4UA 2W1GA 2WMAA 3EOCA 4X3FB 1GIIA 2UW6A 2WGJA 3EIDA 3LOKA 4E5BA 3EFLA 4KIPA 3VHKA 2WXVA 3D5VA 3ZM4A 5EH0A 4EZ3A 4DTAA 4OT6A 3GU5A 3RK5A 5M4IA 1BMKA 2R3KA 4OTDA 4PMMA 5DMZA 4IZ7A 3UNJA 3TMOA 5GINE 4NYEA 2PMOX 4DG0E 5A4CA 4PUZA 2QHNA 5FD2A 5FTGA 2VUWA 3OUNB 4G5JA 2Y9QA 4IANA 4J99A 3BKBA 2A98A 4RWIA 4YJRA 5F4NA 5JSMA 4U44A 5CF8A 2PUIA 1A48A 5FEDA 3PPJA 5HG7A 2WAJA 4E26A 1XHAA 5HCXA 3ZMMA 5HNGA 3IO7A 3FQEA 4S34A 2ITTA 3PWYA 4KKGA 1MRVA 3O8UA 4R5YA 1W84A 2A0CX 3BCEA 4RLLA 1Q97A 4YBKA 5I3OA 2JD5A 4AXEA 2Y7JA 2BAKA 2YJRA 3AG9A 2WTKB 3UP7A 3H0YA 3TEIA 1Q8ZA 3FLQA 2W1HA 5HG8A 4FGBA 4AT3A 4B9DA 4E73A 3RPVA 4PPAA 5AP1A 3G9LX 2GQSA 4FSTA 4E6AA 3RM7A 3BYMA 4HZSA 4XG6A 4J8MA 2QONA 3L8VA 3RZFA 3LIJA 1CM8A 3QFVA 3VW8A 2XRWA 4WRGA 4RIXB 2ITNA 3E63A 3MH1A 5BNJA 1O9UA 1B39A 2BAQA 3LFSA 2HAKA 3SA0A 4FSRA 4YLLA 4ANOA 2GS6A 4KD1A 2RKUA 4RIXA 5LMAA 5HVYA 1OVEA 2ITXA 2J0LA 4FNXA 3HYHA 4H3QA 1IR3A 2PVJA 3AC8A 4ZTLA 1R3CA 3BV2A 3MS9A 4E93A 4XBUA 4QMXA 3O23A 1H24A 2YM4A 2X8EA 2XYNA 5HHWA 3E8NA 5J8IA 2X2LA 1UKHA 4RQVA 5KHXA 2IF8A 5L6PA 4U45A 1JVPP 2XJ1A 5A3XA 3KMMA 4FZAB 4RMZA 1OGYA 3HEGA 4G3CA 1WVXA 1ZMUA 2BFYA 2BCJA 4DEGA 5FTQA 3R8UA 3MFUA 2F57A 2OJIA 3L9MA 1GZ8A 4FK6A 3OZ6A 3QU0A 4BC6A 3I5ZA 5F20A 4JG8A 2PY3A 4ZSEA 4BCIA 2PVYA 3GC7A 4EHZA 4FKVA 5LVLA 2DYLA 2VWZA 3R7VA 2O63A 3L8XA 2Q83A 4D5KA 2R3NA 3NYVA 3UOHA 3MFTA 4J95A 4AF3A 4NK9A 3ZFXA 4YMJA 3KULB 4PMPA 3D2KA 4F0FA 4BGQA 3H9OA 3LAUA 3FZPA 3OTUA 3TJCA 4C4FA 3JS2A 3KULA 5JGDA 3R9RA 2OJ9A 4F64A 4FG9A 3AKKA 5E7RA 4F78A 2X9FA 2YM8A 4HGEA 4X2JA 2PPQA 3NPCA 3QXPA 1ZYLA 3LKMA 2UZBA 1E1XA 4IIRA 3QQHA 4A9TA 3EQCA 4O0UA 4PP7A 3U4WA 3ZBFA 3PA4A 2QI8A 4YLJA 4ALVA 3EQIA 4GT3A 3OWKA 4CSVA 4D4SA 3VS0A 5AR7A 4D9UA 5DBXA 4Q2AA 5KKRC 4YURA 4EH4A 4JDJA 2PE2A 3V04A 5AA8A 1XO2B 4F9WA 3WYXA 3TZ9A 1NVQA 1YKRA 4YZ9A 4LRKA 4QO9A 4CFVA 4QMYA 5CU4A 3SKCA 2ETRA 3PVWA 5CTPA 3E92A 3UO6A 2Z2WA 1VZOA 4EOKA 1H25A 2I0YA 4YTFA 3KQ7A 4QYEA 3VQHA 3TUBA 2JFLA 5EW3A 4S33A 1PYXA 3DB8A 4AW0A 1PXOA 5CAOA 2R3QA 5AAGA 1URCA 1FVTA 4G3DA 4L8MA 5CYIA 3LCKA 4CFXA 3EQRA 4GG7A 4Y83A 5AWMA 3H30A 3ZM9A 1J7IA 3MY1A 1QPCA 4AZTA 3G5DA 2OJGA 4JJRA 4ERWA 2A2AA 2WU6A 4E4XA 2RFEA 3E88A 4O7WA 2VO3A 1OIYA 4MK0A 4CXAA 4EH7A 3TKIA 3CY3A 3K5UA 2OGVA 4QQCA 4YJTA 4XEYA 4E6CA 4ZSAA 3RAIA 3SW4A 2CNUA 4UMQA 4FVQA 2AQXA 5CY3A 2UZEA 4JBPA 2XKFA 3FMMA 3Q9YA 4M13A 4RC3A 4FEWA 3VUMA 4F7JA 2VRXA 3PXYA 5FRIA 2IG7A 5KNJA 2IW6A 3QC4A 2GFSA 3W55A 2ITPA 3BHTA 3QQUA 2C0OA 3EH9A 4NM3A 5CNOA 1W2CA 3GU7A 3T3UA 1XQZA 1PKGA 4BDAA 4GYGA 5E8XA 3G6HA 4TXCA 1G5SA 2YM5A 2IW9A 2QLQA 3DBEA 4ZK5A 2VAGA 3ORZA 3OBJA 4C4JA 3ZLXA 3D94A 3O8TA 3FMKA 2VTMA 3D5UA 4FSUA 2VGOA 2UVXA 5CSHA 5L8KA 4K6ZA 4BY9E 1WAKA 5EK7A 4FV6A 4QYGA 5C01A 4ANQA 5HU3A 1L3RE 5LJJA 4AZFA 4I24A 1YXXA 3UODA 3Q2MA 2IZSA 3CIKA 5CZHA 4GS6A 2J6MA 1CKIA 4R3PA 5CU2A 2X7GA 4NT4A 4XHKB 2O65A 1IG1A 2QOBA 3W18A 4F65A 3TYKA 3DBFA 1ZARA 3NVMB 4RFZA 4GUBA 4ALWA 1OUKA 3UNZA 3AC1A 4O38A 5KKRB 5C4KA 3QALE 3LVPA 1ST4A 4CT2A 2QOQA 5IISA 3TJDA 4O0WA 3OCSA 5E8YA 5H8GA 4CZUA 3MH3A 3OXIA 2RSVA 4I0RA 3GNIB 4J71A 2XNMA 4C8BA 5IDPA 4NU1A 4C35A 5EYDA 4KUJA 5HG5A 1H07A 4QMTA 5TKDA 3EHAA 4O0SA 2GNIA 1H1PA 4AXFA 4AXCA 2AC5A 3Q9XA 1U4DA 4IB5A 4RVMA 4ZLYA 4DFYA 3UQCA 5HKMA 2VWXA 4XV2A 3MA3A 3NUUA 5C8MA 5HTBA 4M69A 4A4XA 2BUJA 3FI8A 4AW2A 5AM6A 1NW1A 4B4LA 5I4NA 4L3LA 2W0JA 5HD7A 4DDIA 4D5HA 4NM0A 3SG9A 4OT5A 3AC2A 5I0BA 4C62A 5BYLA 2F4JA 4JDKA 2GSFA 3A8WA 4IMYA 4ZJIA 3R2YA 3G90X 3NR9A 4B0GA 4YTHA 5ANJA 4DG3E 3F5PA 2XA4A 2WQBA 2CGVA 4FTKA 5JFSA 3AKJA 2ZOQA 4KB8A 3O0GA 4X2FA 1IRKA 2QOLA 4IAZA 5IH6A 5JMSA 5CEPA 3CD8A 2ZDTA 5K9IA 1JLUE 3OG7A 1YOLA 2PTKA 4I5PA 4XP0A 3C9WA 1XH8A 2J5FA 2W96B 1JKKA 1PXIA 4XUFA 3DJ7A 3UG2A 4BCHA 2YA9A 3E8DA 1Y8GA 3GCUA 4R3RA 5E91A 3HRFA 3UP2A 3F7ZA 5AADA 4AZVA 4BDFA 2E9NA 2UZOA 1MQBA 5IEXA 3CKXA 3F2AA 4W8EA 2WD1A 3UPXA 1H08A 3NRMA 4FSWA 5T6KA 4DFBA 4KRCA 4RSSA 2V7AA 4DLIA 5AAEA 4DEEA 3NMUF 3HUBA 3NCGA 3VS5A 4D2RA 4C3FA 2A19B 4WOVA 3IQ7A 3G9NA 1SVGA 1W82A 4EQMA 3ML1A 1K3AA 2W4OA 3FYJX 3MPAA 3DB6A 3QD4A 3VS2A