2VUWA

Structure of human haspin kinase domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
329
Chain Sequence
KGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
publication title Structure and Functional Characterization of the Atypical Human Kinase Haspin.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 329
sequence length 329
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vuwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vuwA01
3Q04A 3R9RA 2RL5A 4QTAA 1Q99A 2QC6A 1NW1A 4CFXA 1PKDA 3BWJA 2E2BA 3FLNC 3FQEA 3PRIA 4IACA 5FTOA 5BQ0A 2O63A 4YHFA 1J3HA 2OW3A 3HA6A 2ESMA 1OBGA 2PVMA 3PJ2A 4QQJA 4E6CA 3MIYA 3GGFA 4O7NA 1UNHA 2GNGA 2VAGA 3MFRA 4MK0A 4WO5A 2JAVA 2WQMA 2XK9A 3VN9A 1XR1A 5A46A 4HVSA 4FNWA 4IANA 1H4LA 2C6MA 5EI2A 1SYKA 3WZJA 5CS6A 2FSTX 5J79A 3HEGA 5ETCA 4EHVA 3LMIA 4IX5A 4BICA 3FMKA 2WTDA 3R8LA 2FGIA 3ACJA 5J7HA 5FBNC 3MA3A 3D5VA 3O8PA 5CAOA 4FT5A 3I6WA 2P55A 3KKVA 3JXWA 4ZSJA 4QP6A 4XBUA 1HOWA 4D58A 3PLAE 5TT7A 3UIXA 2GPHA 4RSSA 2CDZA 2PE2A 4USEA 1PXMA 4I21A 3A4OX 4C33A 4FEVA 3P7AA 4M14A 3E88A 4RA4A 4D4VA 3Q60A 4ZSAA 4PTGA 3ZH8A 4PRJA 1UV5A 4P7EA 1E9HA 3V3VA 3ZYAA 4UZHA 1VYWA 1Q24A 2C5OA 3PIZA 2C6LA 1U5QA 4MD9E 3SW4A 2X39A 4RC4A 2IVVA 3ANQA 4UALA 3RKBA 3VUGA 4OTPA 2FSOX 2W1HA 5AM7A 1SVGA 5DEYA 4E5BA 5F94A 1YRPA 3LFFA 4I22A 4TTHB 1ATPE 2CN8A 4AWIA 4QP2A 1GJOA 1WVWA 2QLQA 2GDOA 2PY3A 4NM0A 3FLZA 4M68A 5EYMA 2CMWA 4UX9A 3R0TA 2C1AA 2P0CA 5GZ8A 2C6KA 4BTFA 3OCTA 1Q3DA 2W17A 3V5LA 5HU3A 2XMYA 2QLUA 3ZO3A 2HXLA 5C26A 4K77A 1OL5A 2J7TA 2OH0E 2EXEA 3R28A 2R3FA 1YOJA 2VTMA 4A9TA 5A4QA 1Y6AA 4CCBA 3TNQB 4JJRA 1ZRZA 2X2KA 4BR3A 2HENA 3UJGA 1ZYLA 3ORTA 1XBAA 4FTUA 4IH8A 5AV0A 4B9DA 3R1SA 1FVTA 1SVHA 2WOUA 4HVIA 1FOTA 3C1XA 3R83A 2H34A 3KF7A 5AP6A 3WILA 3HNGA 4H1JA 3V8TA 4V04A 3PE2A 5D12A 4CRLA 4WT6A 4FKJA 1SMHA 2WTKB 3Q4CA 5AIRA 3RBWA 5J1VA 2ZYBA 3TNWA 2JIUA 3V6SA 4GV1A 5LVLA 2G2IA 5KMLA 2WB8A 3DK6A 3NNUA 2A0CX 1IG1A 3TACA 3IGOA 3HAVA 1OL6A 2OG8A 2NPQA 4RZVA 4OTWA 1F5QA 4EOIA 3ZFYA 2GHGA 4DGMA 3G33A 5E8WA 2J0LA 2WTCA 2PVLA 5ANIA 5IF1A 4DFUA 3F7ZA 2WAJA 3DS6A 3I7BA 5BYLA 2ZV7A 1VZOA 3AT4A 3FI2A 2XRUA 2CKQA 3JR1A 2EXCX 4BZDA 4EQCA 3R02A 3UOKA 4DEEA 3R21A 3DJ5A 3TKIA 3S1HA 5IQAA 5J9LA 4DH7A 3PPKA 4DBXA 4LOOA 2JIVA 2GQRA 4S34A 1HCKA 4L44A 4PDPA 4I3ZA 5IEXA 4OLIA 5JGBA 3GT8A 1M2RA 4YO4A 3EZVA 3FLQA 5I9XA 2C3IB 3TT0A 2VTQA 1WVXA 3ULZA 3VS2A 3FKLA 1J1BA 2ZJWA 4FKIA 4IAAA 5LQFA 3TZ9A 4D0WA 2CKOA 3R73A 2WFYA 4RJ4A 4C4FA 1OL1A 3KY2A 3FDNA 3Q6WA 5DH3A 3R8ZA 2XVDA 2WEIA 5IQGA 1GAGA 3KULA 5CF6A 1OIUA 2BR1A 3LJ0A 4N6ZA 4KSPA 3LKMA 4AW0A 4CYJA 3KXGA 1XH7A 2VN9A 1I09A 1OPKA 3AMBA 2XNEA 3KXMA 4K9YA 4M15A 4FI1A 4PMMA 1M7NA 4X0MA 3PVWA 3SXRA 1WBVA 1ZYDA 3EH9A 3A7JA 5L6PA 5BYZA 3ID6C 4ZP5A 5D41A 2PVHA 1W0XC 4D4YA 3TTIA 4DBNA 2H9VA 2QOQA 4FX3A 4XOYA 4OTRA 4J7BA 1YXSA 2WMQA 3GQIA 4QYYA 4RIYA 4A4OA 5A4TA 1L3RE 3HDMA 4MQ2A 3DLSA 2WU7A 3E8NA 3ZFXA 4F9YA 4FYOA 5CI7A 4LG4A 5M57A 4QMZA 2YZAA 3D83A 3KA0A 2ZV9A 4TN6A 4O7VA 2PZ5A 3EL7A 4FUYA 5IUGA 5DOSA 3HV4A 2A27A 4RVLA 3A7FA 5LMKA 2XB7A 5HTIA 4U44A 5I5ZA 3MIAA 2OXYA 4DHFA 3BEGA 2EVAA 2OLCA 1LP4A 3DXNA 3ENMA 3WIKA 4O7YA 4QQCA 5GHVA 1QPDA 2Z7LA 4IM2A 3BLHA 3GP0A 4NM5A 1Q3WA 5TKDA 4OAUC 3KC3A 2OKRA 5CNOA 1FVVA 3VHEA 4Y72A 3QRKA 4YJNA 2G2HA 1OITA 5K3YA 2J5FA 3FQSA 4WG5A 5EKOA 3QGWA 3P0MA 4KIOA 3NW5A 3DGKA 2C5YA 1PXLA 2CLQA 3MVLA 2QOOA 3BYUA 3PG3A 3Q2MA 3C9WA 4XG3A 5H9BA 3WF5A 4FIGA 2XCKA 3PWDA 3ZRKA 1RE8A 3CS9A 3QFVA 5BUIA 4NCTA 3FJQE 1KE5A 4ACGA 3ZEPA 2EWAA 3E7VA 3B8QA 3FMMA 3PWYA 4FIIA 4N4SA 4QQ5A 4EK5A 2HOGA 4NWMA 1GZOA 1TQPA 2UZBA 3HMPA 4YLKA 3FYKX 4M3QA 3I6UA 4NIFA 4BKYA 5EDPA 2B9HA 4Y85A 1SNXA 2V0DA 3R2BA 4TWPA 3P23A 4DAWA 3OCSA 3KULB 5CTPA 3MVMA 5ANDA 5JFXA 4QMUA 1TVOA 5AAFA 3ZO2A 4ACCA 4AZEA 2CHLA 3BKBA 4O0XA 4E7WA 3R7YA 5FM2A 1OIRA 1OI9A 1Y6BA 5C1QB 4O84A 3UZTA 2HWOA 2XKEA 4KIPA 4FKPA 4BHNA 3EHAA 4EH9A 5LWNA 3WOWA 3MB7A 5B2MA 1Q8YA 5DLSA 3FI4A 2ZM4A 3G51A 1UU3A 2PUUA 4QYEA 5DRBA 2GU8A 4C37A 2JFMA 2O5KA 2R3KA 2B55A 2YM6A 4FKSA 4KWPA 2C4GA 4R7HA 1H26A 4RIXA 3ZM4A 1TQMA 3BELA 4DH8A 4RRVA 5I3RA 4DEBA 3R1YA 4FSTA 4G6LA 2CCIA 3GOPA 5E8YA 3UYTA 5GZ9A 3DLZA 2WQEA 3MPAA 3R7GA 4KS8A 1J7IA 3PFQA 2IJMA 5D9HA 5EI8A 4ZTSA 4O7SA 3UZRA 3GEQA 1WBWA 5H8EA 5JFSA 2W4KA 3UPXA 2XK4A 4IWOA 3OEZA 3VS6A 5F4NA 1REKA 3LCSA 4FICA 3HKOA 3P1AA 2OJFE 1P14A 3CEKA 2WQOA 4RIWB 4KRCA 4WHZA 4ORKA 1M17A 4Z9LA 3Q4UA 1J91A 4DEHA 4O7LA 2UZLA 4M84A 3FQHA 3U4UA 4CZUA 2X9EA 2BCJA 2XM9A 3OF0A 2XRWA 2OICA 3EOCA 4JDKA 4KD1A 4HOKA 4MF1A 4PQNA 2UW3A 2PMLX 3CJGA 4FL3A 4CEGA 2JBPA 4N70A 3QALE 3BI6A 1Y57A 1YI4A 3QRJA 4I6FA 4KKHA 4L43A 5HIBA 5C8KA 3FHRA 3D0EA 4YBJA 2WOTA 5FEEA 5IZFA 2O8YA 5F1ZA 2WKMA 5DRDA 4IM3A 4W8EA 3SA0A 2CJMA 2Q0NA 4NEUA 4JXFA 2YACA 5FQDC 5EKNA 1BLXA 2DS1A 4BCKA 3COKA 3OXIA 4EH7A 4R7BA 3HV3A 1WBOA 3LXNA 4UY9A 1ZY5A 4FYNA 3FHIA 3KN6A 4FKRA 1Z5MA 3BE2A 5AP4A 3KL8A 3EQBA 3IQ7A 1M2PA 2F49A 4GK3A 4XG7A 4E3CA 5HCYA 3AC5A 2UZNA 4XV3A 4MBJA 4EH3A 5JH6A 2QQ7A 3AGLA 3DAJA 1CKJA 1O6YA 3SV0A 4F9AA 2OI4X 5I9WA 4JDJA 2R4BA 5FXSA 2VTJA 3QU0A 1A48A 3UPZA 2YAKA 3ENHA 1J1CA 3NUSA 3QQJA 4ZJIA 2RFNA 5HVKA 5IA1A 4DC2A 4H3QA 2F7XE 5CI6A 3FC2A 4K11A 2WGJA 2IZSA 2W1CA 2YIRA 2IPXA 4ZSEA 4AXAA 3SRVA 4R3RA 1ZY4A 3NZ0A 3DBCA 4FV7A 2J4ZA 2V62A 1VYZA 3CXWA 4RIOA 4ONAA 3UVRA 2O2UA 2DWBA 2C3JA 3GUBA 3W2PA 3QQKA 3R1NA 3VUHA 3CBLA 4BB4A 2WMRA 4S33A 3TEIA 1UA2A 2BUJA 2HELA 3FE3A 4YZBA 4C4EA 4F0GA 3OW4A 3SG9A 5CWZA 4U79A 2VWWA 1HCLA 3GFEA 1JSVA 2C5NA 2X8EA 3QTIA 4HVDA 1XO2B 2B53A 3QD0A 3SKCA 4R3PA 3TG1A 1JWHA 3SDJA 5IPJA 4ERWA 1LEWA 2WPAA 2G01A 2ITXA 3Q9WA 4L68A 3TJCA 1KV2A 3OWKA 3Q3BA 2WTIA 3RWPA 3WF7A 2VTRA 2VX0A 5AUWA 4IIRA 3FXWA 5HGIA 3HVCA 2VO3A 4A9RA 4OT6A 4ANQA 4D2SA 3O51A 2C5VA 4FEQA 3NLBA 3OVVA 4NM3A 2A2AA 5CXZA 2PL0A 3BGZA 4QP4A 1UU9A 3ZLYA 4ACDA 4O6EA 3U6HA 3BEAA 3TI1A 1U54B 5CSVA 3H30A 1UKHA 2BDWA 3UQGA 4E4XA 5D10A 3QTXA 3UODA 4IVCA 4ANOA 3QCQA 4YNOA 4JR3A 3BQCA 3ZSGA 3U8WA 4JQ7A 2R7IA 4YHJA 3E92A 2PWLA 4N0SA 4EK4A 4EJ7A 3VVHA 1S9JA 3RM6A 4Q9SA 5D11A 4CMTA 3L8XA 2W5HA 2YCFA 4X3JA 1QPEA 4G6NA 2R3LA 3MN3A 3OWPA 4FZDB 4NW5A 3VO3A 2OZOA 2QO7A 4V05A 5LCJA 3W1FA 4JX7A 4RG0A 2HW6A 2BZJA 4NKAA 1RDQE 2PUPA 3DAKA 4BCQA 4GVJA 4EQUA 3ZTXA 2FYSA 1YHSA 2UW4A 3K3IA 4YGAA 3G0EA 4BIEA 4GUEA 2XYUA 3NNVA 3NWWA 4C3RA 3RNIA 2Y9QA 3A99A 4RJ6A 4O7WA 4RX7A 3GU6A 1IA8A 1ZAOA 2W9FB 4L3LA 5CENA 3CP9A 4ZTMA 3NAXA 4EEVA 2ERKA 2VX1A 4Q5HA 3CQWA 3UO6A 4C02A 4LGDA 3V01A 3IOKA 2X6DA 4FR4A 4BFMA 3PIXA 2J5EA 1OZ1A 5J1WA 4JAIA 3LQ8A 2PULA 4ZS4A 3MI9A 3EZRA 1PF8A 4EH5A 1YXTA 4BKZA 4F7NA 5I9UA 3PZHA 3D14A 3N4VA 3HA8A 1BKXA 5D1JA 5E8XA 2ZM1A 5EM7A 2LGCA 2R3QA 4XH6A 3R30A 4I4EA 1H0WA 5FUTA 5E90A 3UO4A 3QQFA 4BBFA 2E9VA 3GI3A 2R5TA 3LXLA 3QLGA 3VUIA 3ANRA 2YM8A 1PW2A 4X6QC 2GNJA 4O0SA 3NYVA 3VUDA 5C01A 3LHJA 3II5A 4E73A 1OIQA 3F3WA 2CNVA 4ZK5A 4F6SA 4JBPA 5CZIA 3GU7A 2I7QA 4GIIA 2VWIA 3PPZA 5EW9A 4DFBA 3SGCA 4ACHA 4X3FB 4QD6A 2GMXA 3OZ6A 1R78A 5M51A 4J8NA 2G15A 4MNEA 2YAAA 4PMSA 2B9FA 1KOAA 2BZHB 4J98A 4TL0A 4DTAA 1W8CA 4HYIA 3ZLSA 3DKOA 4GYIA 1G3NA 2YERA 3FKOA 3LCKA 3Q96A 4OUCA 3RZBA 4ANBA 4EQMA 5BVNA 4DEGA 4FTOA 4ASXA 4BF2A 3OMVA 3LFSA 2BHEA 3E8EA 4LRMA 3MPMA 2HXQA 5EM5A 3ATSA 4I94A 3ZUTA 4NL0A 3O8TA 3FPMA 1VEBA 4A07A 4I92A 2Z7SA 5AFVA 2YN8A 3B2TA 4U42A 4U8ZA 3REPA 2V7AA 3G0FA 1M7QA 3HRCA 5CAQA 4FNXA 4BCJA 1FPUA 2JDRA 4IDVA 4OTQA 5A4EA 1IAJA 4ZJVA 1V1KA 3MY0A 3VJOA 2VTIA 4ITJA 5E9EA 5CEPA 2PVRA 3D7TB 3QTRA 3ORKA 5CASA 3QCYA 5AUUA 5DI1A 1O6KA 3VF8A 2VO7A 3F7WA 4HVHA 2Y4IB 4Y5QA 3MY1A 3V5QA 1JQHA 3ORLA 1GIHA 3E8CA 4U6RA 4AN3A 3I0OA 2H8HA 3QXPA 4TWCA 3EFKA 3UMXA 5HVYA 2R3PA 4DG2E 3MYGA 1B38A 5AA9A 2BVAA 2X4FA 4QMNA 4O27B 4ZJJA 3R7UA 4DYMA 1OKVA 2O65A 3IDBA 4J99A 1G8SA 4W4VA 4XG4A 3A4PA 4LI5A 4O7RA 3EN4A 2XA4A 4O86A 3VULA 4BCHA 1XQZA 4MCVA 4I41A 4BCNA 5E8SA 3RAIA 4CZYB 2B1PA 4MBLA 5DYJA 3FMDA 2W5BA 1PY5A 4MWIA 4X2KA 4LRKA 3U87A 5IQFA 2YM5A 2NP8A 4KA3A 5HG8A 5ANJA 1SM2A 2QODA 4DFYA 5L2WA 2Q83A 3V6RA 4HCVA 4USFA 3H0ZA 1AQ1A 3CD8A 3F88A 3Q32A 2FUMA 3FAAA 2QCSA 3QC4A 4D9UA 4NYEA 1G5SA 2OU7A 3AGMA 3D5UA 4PTCA 3TNHA 2QVSE 3VRYA 3HX4A 2KULA 2ERZE 3VBVA 5JGDA 3QWKA 3I60A 3KXNA 3OS3A 4TWNA 4F7SA 5M07A 2C6IA 3EYGA 2F57A 4DGNA 4C3FA 4NM7A 2GNFA 4RJ3A 1ZMWA 3GU5A 4QTCA 5AP3A 5H8BA 4BBEA 4BGGA 2XNNA 3ZXTA 4PMPA 3VS4A 3L8PA 2G9XA 2VTNA 4PNKA 4FKTA 3H10A 3HGKA 4FSQA 3V8WA 4O2ZA 3ZU7A 4ZAUA 1H00A 3EQDA 3TKUA 2ITWA 4GMYA 3PA4A 4FSMA 3SXFA 4AW5A 2W06A 4JOAA 2FO0A 5D7AA 2OJIA 4RVMA 5EDQA 5CEMA 4FEXA 4IVDA 1XKKA 3U4WA 5A6NA 1GZ8A 4CTBA 2VU3A 3OOGA 2F2UA 2C0IA 2WMTA 3HMNA 5BUJA 2B52A 4U80A 4C2WA 1JAMA 3M1SA 4E4LA 4D4RA 4EZ7A 2BPMA 4XOZA 2IW6A 3C5IA 3O7LB 2Y4IC 4MXZA 4U3YA 1BMKA 3TWJA 5A4CA 1YWVA 2CN5A 2PVFA 3FZRA 4QRCA 5BYYA 2NO3A 1Y91A 1YWNA 3R9NA 1LUFA 2XEZA 4ZXTA 1ZXEA 5AR8A 2W9ZB 3AXWA 3FLYA 4YC8A 5L3AA 2IO6A 2YLEA 2UVXA 3EFLA 4FV4A 4EORA 3K3JA 2HZIA 2WIHA 4J95A 3DKCA 5ACKA 4DCEA 3KXZA 1WAKA 3E93A 5EQYA 2XP2A 4AZFA 2SRCA 3RCJA 5L6OA 3BHYA 4O2PA 2VO6A 5JFVA 3GNIB 5TE0A 5C4LA 1M52A 2R3JA 3ZDUA 4TYIA 4D2PA 4EKLA 3BU3A 4O0RA 1OVEA 4BDKA 3KU2A 4LOQA 4M66A 5FDXA 5CVHA 4BY9E 3WARA 5LVPA 1OKYA 4OTHA 1GIIA 3R7IA 3ZBXA 4GCJA 5CEOA 3N4UA 5AP2A 2QO9A 3OD6X 2B4SB 5FEQA 3DQWA 1OUKA 4FL2A 3G90X 4TYGA 4IBMA 4CV8A 2BTRA 3A8WA 4KIQA 2PMNX 3F2RA 4QO9A 3CD3A 4QMOA 4QT1A 5IDPA 4I23A 5E8TA 3V5PA 4BYIA 5JQ5A 2BIKB 2BZIB 3FMHA 3BHTA 1ZLTA 2VWYA 3PY0A 4JNWA 5KZIA 4MD8E 4I5CA 3A7HA 5HNGA 2GQSA 4FKGA 1AD5A 4FGRA 5IKWA 4BGHA 4DCAA 3U9CA 4F99A 5KMJA 5LCKA 4BCMA 3NPCA 4EZ5A 4M0ZA 4HGEA 3PIYA 4BIDA 4ASDA 1OKWA 3QCXA 4AGWA 3KRXA 4UWBA 4IWPA 2OFUA 3DZQA 3W16A 4Y46A 4FTIA 4C38A 2EXMA 3QX4A 4YURA 4HGTA 2ONLC 3Q5IA 2JFLA 2HYYA 4LL0A 4H39A 4MXCA 2WMSA 1KWPA 2J0IA 5LJJA 5JN2A 1QPJA 4XRLA 2QD9A 3OY3A 2GCDA 2HZNA 3HMMA 4OW8A 3AC8A 1IAHA 4L42A 2UW6A 4AGDA 4MX9A 1EH4A 3O96A 4KBAA 3IW7A 3RTPA 1AGWA 5EOBA 3IO7A 3RGFA 4ARKA 4C4HA 3Q9YA 3AC2A 2QOHA 4V0GB 3PA5A 1VJYA 4GJ3A 3HP2A 4NFMA 3LXKA 1DM2A 2RF9A 3QTWA 4QMYA 4C61A 2Z7RA 4A4LA 4BCPA 4XUFA 2FVDA 3S0OA 5AUTA 5KMOA 3ZFMA 4X2GA 4WBBB 3SXSA 3UYSA 1QMZA 3E87A 3QTZA 4H3PA 4BI1A 2XYNA 5IQDA 5CEIA 5ETFA 5IQHA 4FTAA 5JSMA 4EL9A 1V0BA 3TIZA 3PZEA 3U55A 4GL9A 3MGYA 5CSXA 3S3IA 3LIJA 5LVMA 4RWIA 1O6LA 3O23A 3WZDA 5M53A 2XNMA 2BZKB 3ZXZA 2R0IA 4EI4A 2P3GX 4M7IA 2R7BA 5A4LA 3IW6A 2O3PA 4BDJA 2BRBA 4BI2A 3O8UA 3R1QA 2OIBA 4HYUA 4JBOA 5K0XA 5LMBA 2XK3A 5CF8A 3UMWA 5AM6A 3BE9A 3D9VA 3RHKA 2BHHA 4XHKB 5HVJA 4E93A 4F63A 4F9WA 4DITA 3BYOA 4FV2A 4D2WA 2B9JA 2VV9A 1PMVA 3COIA 3ODYX 3EQPA 4UN0C 3ERKA 4C0TA 3EIDA 4YZ9A 2XJ0A 4IM0A 4RX8A 3E7OA 5L2QA 4A9SA 3GQLA 4L46A 3WF6A 3V5JA 3RP9A 4R7IA 4GIHA 4QMQA 3SVVA 4YJTA 3QLFA 4MAOA 4X2FA 4GKHA 3G2FA 3D5XA 3GC9A 4IX6A 4FIHA 3TV7A 4PP9A 3BCEA 2FB8A 2VO0A 2WHBA 4BKJA 4L67A 5HTCA 2HY81 3MS9A 3HV7A 3RPOA 3IOPA 4WRSA 3NDMA 4WNKA 2XIRA 3D15A 5T6KA 4O1PA 2CGXA 2VWXA 3HL7A 3MH0A 4AE6A 4MXAA 1PRYA 5CEKA 5HX8A 2P2IA 2QO2A 2XUUA 4GG5A 4G3FA 1JSUA 4YTCA 4F65A 2WTJA 5CSWA 1M14A 3LM0A 3BLQA 1CKPA 4AE9A 3QBNA 3DU8A 4BGQA 1YXXA 3UGCA 5M4FA 2ITVA 3QA0A 4PPAA 4ANLA 3RK9A 3WYXA 1ZYCA 4RJ8A 1Q8TA 3GENA 4FNYA 5HESA 3F66A 4BCGA 5EM8A 4DGGA 1BUHA 4BHZA 2VUWA 4BWPA 4PX6A 1YDSE 3TCPA 4C2VA 5EQPA 2OXXA 2F9GA 2PPQA 3EN9A 1MRYA 4QNAA 3K2LA 1WBTA 2VTOA 3LCDA 2C47A 3TDWA 4I5PA 5AV1A 1URWA 3KRWA 3KFAA 4LMUA 2C6EA 4CV9A 4D2TA 2UZDA 1DS5A 4KIKB 5DG5A 2YDJA 4L3JA 5HHWA 3UIUA 2WQNA 2BROA 4ZS0A 4RLKA 4FKUA 3RNYA 1PYXA 3BIZA 3PPJA 3PXFA 4EJNA 3HV6A 2PVKA 4YLLA 4UMRA 2VGPA 5M4IA 5HO7A 4E4NA 3VQUA 5B7VA 3GOKA 4ASZA 3GCQA 4TYJA 5M4UA 5AR3A 2CLXA 4YJOA 4XRJA 5GIPE 2J0KA 2WD1A 3I79A 3NRMA 5JQ8A 4OTDA 5HBEA 3FZTA 3E3BX 4BYJA 2QOCA 1Y8YA 3RINA 4P5QA 5B0XA 1KE8A 4BDIA 3O50A 3KGAA 2BAQA 2UV2A 3L8SA 5HE0A 4J1RA 1H1WA 2W1FA 3G9LX 2WXVA 4CG8A 3DBFA 4GU6A 4D1ZA 3IPHA 1Q41A 3VUMA 3C5UA 4WKQA 3P9JA 1F3MC 2VZ6A 3BYSA 3T9TA 5BVDA 3DBDA 5FXQA 2H6DA 3FLWA 4GFGA 2XNBA 4S2ZA 4O0UA 4X7QA 5GJFA 1DI9A 5HG5A 4RIWA 1KE6A 4J96A 5AADA 4MQ1A 3SG8A 4O0WA 4K8AA 4BDBA 4FOCA 4FTQA 2F7EE 4APPA 4IWQA 3PXRA 4ZSGA 5AAEA 4PP7A 4G34A 3TDVA 3OROA 1XH4A 4K33A 5DMZA 5JMSA 4J8MA 1PHKA 3F6XA 2NRUA 1WBNA 1RJBA 2ZB1A 3G5DA 3QHWA 5AV2A 4AOJA 2AYPA 4JG6A 4FGBA 5CQWA 4AN9A 4ENYA 3EFJA 4EZ3A 3OY1A 1U4DA 5AP5A 5HE1A 5HNBA 4TW9A 3EQGA 3PXYA 2W96B 3R01A 3AQVA 4OGRA 3ALNA 4PPCA 3WYYA 4OTGA 1J7LA 3R7VA 1FMOE 2GS2A 5KZ0A 4AG8A 3H9FA 3CQUA 4K18A 5C9CA 2Z7QA 4PL3A 3NIEA 4RA5A 4TNBA 3RAKA 3LJ2A 2FA2A 4I5HA 1LR4A 1P4FA 3MFTA 4MXXA 5AUXA 4FKLA 1NA7A 4EK8A 3NUUA 4PDOA 2AUHA 3VBWA 4EOMA 2UW7A 1STCE 4YR8A 1H8FA 1X8BA 3NSZA 3QXOA 5HZNA 4WSQA 2PZIA 4EH2A 4RX9A 2QOBA 4MWHA 4G9RA 4KB8A 3CJFA 1CM8A 3U9NA 3F5UA 2ITUA 5LVNA 2WZJA 4MYGA 5J95A 2X9FA 3PDTA 3EWHA 2QHMA 4BN1A 1H1QA 3VIDA 3EYHA 5KHXA 5IQEA 3DCVA 2QR8A 3MH3A 3E64A 1FVRA 4FK3A 4IHPA 2PHKA 5HIDA 4CRSA 3RVGA 1SNUA 2QU5A 5KHWA 4UXQA 2W1GA 2IN6A 2C5XA 5HBJA 5DEWA 4RWLA 5LARA 3IONA 3ZEWA 4ZEGA 1XBCA 4DN5A 3FKNA 4UMTA 4YJRA 1YXUA 3KEXA 1KV1A 1YW2A 3KF4A 4WBOA 1H28A 4F7JA 5EH0A 1LEZA 3OC1A 1XHAA 1JKLA 4FTKA 5CF5A 2BRNA 1OPJA 5BVFA 3EFWA 4I1ZA 5TF9A 4E5AX 3MH2A 2BALA 4DT8A 3GU4A 3UO5A 3FC1X 3NYOA 2VTHA 2R64A 4MXOA 4CYIA 5K4IA 1PXPA 1IA9A 4O82A 2DUVA 4YHTA 5HBHA 3OP5A 4ZMEA 5GINE 1YOMA 4TY1A 2C1BA 4JLCA 5AP0A 4UV0A 2X6EA 1OMWA 4H05A 3VUTA 3R6XA 4FSNA 4YZNA 2WMBA 5IG1A 3PVBA 4UBAA 4GSBA 4BRXA 3PXKA 1U54A 5CU2A 3A61A 3TV4A 4BI0A 3IW5A 4MKCA 4DLIA 4ZZNA 4O7ZA 2PVJA 4EUUA 2XNPA 5HICA 2VTSA 4FG7A 4DGLC 4GKIA 3DDQA 3MJ1A 2NRYA 1DAYA 4LL5A 4F0FA 1YOLA 3EMGA 5HE3A 3PJ8A 3R2YA 2WMWA 3RWQA 2VWVA 4IFCA 2WEVA 4J53A 1ERKA 4WUNA 5ANEA 2GQGA 4QMPA 3A7GA 4LV8A 2C0OA 3F5GA 3PY1A 3BWFA 3CTJA 2A4LA 2UVYA 4BL1A 2JDTA 2RFSA 4HW7A 2PMIA 2VTAA 4IVAA 4FVRA 4XJ0A 4F9BA 3QL8A 3P4KA 4LV5A 5HEZA 3OXZA 5HKMA 4IZ5A 3O7LD 3DK7A 3QAME 4F1OA 5CAVA 1L8TA 4USDA 2IVUA 2X8IA 4G31A 2W1ZA 3DQXA 1MUOA 5ITAA 3LFEA 4CFFA 1B39A 3ZO1A 2YM7A 3VAPA 4AOTA 3AC4A 2GFCA 1PXNA 1JPAA 2AC5A 4R5YA 4G17A 4BC6A 2CGUA 3T3UA 4BVUA 2ETMA 3OUKA 2IZRA 3QYWA 2RG6A 2OK1A 4E6DA 3F61A 4EOSA 5JKGA 3FBVA 4KKEA 5CY3A 4FV6A 5CU6A 5DA3A 4RT7A 3QZGA 2VTTA 5EHYA 3ORIA 3W55A 4HYSA 3R04A 4XP2A 5I9ZA 5E1EA 2ZVAA 4AZTA 4HPTE 3TN8A 4U43A 3P79A 2EUFB 1UU8A 2JLDA 3D5WA 3H9RA 4G9CA 4XP3A 4BWKA 5EK7A 2XCHA 4Z55A 3QWJA 4HCUA 5E1SA 3THBA 3UBDA 5H8GA 2X2LA 4H58A 4IEBA 2GTMA 3C0HA 4DLJA 1JKTA 2HK5A 3CY3A 3PYYA 4CMOA 4AQCA 2YDIA 1MQBA 3A7IA 2ZAZA 3AMYA 3VS7A 2XH5A 3KRLA 2I0HA 4M67A 3Q9ZA 3GVUA 3EKNA 5IH4A 4R78A 4LM5A 3RPSA 4EC8A 2JDOA 3W2RA 5LWMA 4C3PA 2Y6MA 3LFQA 4NTSA 1YQJA 4EBVA 4X3FA 3QUEA 4O81A 4ZLZA 2UZOA 3QA8A 4FZ7A 2R3GA 5K0KA 4D0XA 2CKPA 4QYFA 2PVNA 2YWPA 3CTHA 4UXLA 4DFZE 2UW8A 3ORMA 3NUAA 3MW1A 4TRLA 3BU6A 3KRRA 3QTSA 3CY2A 3K5UA 5CT0A 1B6CB 3BQRA 2BDFA 2CNQA 1YVJA 4P4CA 3V8SA 3IECA 5EYCA 2OWBA 2CGWA 3COMA 5IU2A 3PTGA 4I24A 3TM0A 1YDRE 3WIGA 4IVBA 4EUTA 4F7LA 2J2IB 3OBJA 1YHVA 3AT3A 5BMSA 1PMUA 3OW3A 2JKOA 3FZ1A 5KE0A 2WMUA 2PU8A 3ORXA 4G3EA 3P7BA 3QRUA 4B7TA 3HZTA 2H96A 4Y83A 5EOLA 2ITTA 4CFMA 4CFUA 3NMUF 3FYJX 1IRKA 4L8MA 4RBLA 4PL5A 3UDBA 4D5KA 2Y4PA 4WOVA 1LPUA 3FZPA 4AW1A 3QKLA 2YLFA 3L9LA 1R0PA 4ANMA 4C4GA 2ACXA 3JVSA 3MVHA 4G5PA 4JX3A 4RJ5A 3D7TA 4IX3A 3KCFA 1UKIA 4L3PA 3C7QA 4M12A 4RGJA 5CVFA 4Z7GA 2OXDA 1CDKA 4NFNA 4YU2A 4FTNA 3RAWA 3ZRLA 4D2VA 4IB3A 2R3NA 2QOFA 3EQIA 2QNJA 3FLSA 5HG7A 5EQEA 3KMWA 2C6TA 2Y0AA 4II5A 4GRBA 3N9XA 3DY7A 5AR2A 5KUPA 3S4QA 3PG1A 4LUDA 4ANSA 4RC3A 4D9TA 5F95A 5FTGA 4KABA 3NEWA 5BX0A 3E62A 5DT3A 3ZONA 4CZTA 3ULIA 3ZBFA 4EH4A 2JKMA 4PDSA 3SQQA 5EYDA 3LM5A 1FMKA 3OCGA 4HNIA 2JDVA 3ZUUA 2V22A 3L8VA 5B2LA 5HX6A 4IZ7A 4YPSA 2RFEA 3QZIA 1W84A 4M97A 5KO1A 3JPVA 1R3CA 4RX5A 4YTHA 3VJNA 3DZOA 1RQQA 3L9NA 4L7SA 3SLSA 4FT7A 3P78A 4LUEA 3ROYA 4X2JA 1MP8A 2PE1A 3L9PA 1Q5KA 3AC1A 4IB0A 2WTVA 5EHLA 4BDEA 4D4SA 4FT9A 3KXHA 4G16A 1JKSA 1Z57A 4ITHA 3ZC5A 2BTSA 3AD5A 5C8NA 2ZOQA 3SOAA 5DIAA 4K0YA 4LRJA 1KE7A 4O38A 5JT2A 4TYEA 2QG5A 5KMNA 2IG7A 4UMUA 3QQUA 5DT4A 2XM8A 4KS7A 4QMWA 4EWHA 4QQTA 3RALA 3KREA 5HLWA 3MA6A 1OGUA 1OPLA 1MQ4A 4EOJA 5JK3A 2ZMCA 4TWOA 3QF9A 2HW7A 4M69B 4GU9A 1H24A 4PL4A 2OJGA 4IJ9A 4ZTNA 3TNPC 4FV8A 1CMKE 3LPBA 3P7CA 3JVRA 4J52A 4W8DA 3QGYA 4PWNA 4PY1A 1R1WA 5A9UA 3I81A 1WZYA 2OBJA 4M0YA 2IW8A 4CKRA 3LXPA 3ET7A 1M2QA 2WIPA 2X0GA 4FBXA 5FRIA 3ETAA 1Z9XA 4IAYA 5K9IA 2JKKA 4XCUA 5KKRB 2ONLA 3C13A 4WG3A 2J90A 3QUDA 5AA8A 1K2PA 3HMIA 5HIEA 1PMEA 3F3UA 5HG9A 4AZSA 2W4JA 4ZTHA 3Q2JA 4NT4A 3RMFA 3SOCA 5E8ZA 5HD4A 2OJ9A 4L52A 4QYGA 3EN6A 5IH5A 2BMCA 4NZWB 4RQKA 5F20A 3VS5A 2RFDA 3ATTA 3MTLA 1J7UA 2BILB 2JKQA 2VTLA 4FIJA 3DBQA 4FL1A 5FWKK 2OIDA 5M56A 3V5TA 4U40A 4DH1A 1H08A 4AX8A 4XNEA 3LCOA 2B7AA 4AGUA 4RC2A 4B8LA 2YEXA 4BWXA 2XBAA 4FEWA 1KOBA 5FLFA 2GNHA 1XWSA 3LZBA 4FOBA 4FG8A 4I20A 3EQFA 1O9UA 3OWLA 4W4XA 5T68A 4CD0A 3ZSIA 3N4TA 2UZTA 2VGOA 4ZZMA 4OBOA 5AX3A 3LMGA 3UQFA 5DGZA 3CLYA 5CEQA 2PZYA 3HUCA 2QOLA 4JBQA 3FZSA 4YZMA 5IA0A 3GCPA 4R77A 1WBSA 1T45A 3PJ3A 4F64A 3RCDA 5CU4A 5HQ0A 5DVRA 2OGVA 4TKSA 3FI8A 3GBZA 4W4YA 4XG2A 3GC8A 3VRZA 3DFAA 3ZDIA 5FTQA 4NTTA 5ANGA 4IW0A 3HUBA 4FMQA 4XV9A 3R63A 5KNJA 4I6HA 3JY9A 4IWDA 2YFXA 3F9NA 2X1NA 1I44A 3R8MA 3UIBA 4IB5A 5EI6A 1QPCA 4CTCA 2ZB0A 3UQCA 3CCNA 4F6UA 4BTMA 1JLUE 5JFWA 3DA6A 4QMLA 3WF8A 2YIWA 3MH1A 3PE1A 4EC9A 2OZAA 3OTVA 3NNWA 4DF3A 3NCZA 2YCSA 4R6VA 3LAUA 4CNHA 2NNWB 3ZOSA 4AZWA 4Y73A 4YZCA 5KKRC 3NGAA 5E8VA 3NIZA 4R5SA 4V01A 4O1OA 3ITZA 2E9OA 4LQMA 4ZSLA 4OR5A 3V04A 2X7GA 4GT3A 3ZM9A 1PKGA 3PA3A 4JDIA 4WSYA 5CU3A 3P08A 5HTBA 5CF4A 4QMSA 2RGPA 4BCFA 4B8MA 2J0JA 3OT8A 4JQEA 5CXHA 4K6ZA 4AACA 2I0YA 2Z02A 1KSWA 2XIKA 2J50A 4IAIA 4F9CA 3W8LA 3UZPA 2F4JA 4YPDA 5L2SA 4RQVA 3QQHA 4V0GA 3E3PA 4FVQA 1OL2A 4JT3A 4IXPA 3KVXA 3CR0A 2QG7A 3ALOA 5J5SA 3NVKI 3W2QA 3EQCA 3Q4ZA 4Q5EA 4D1SA 4CVAA 4YLJA 3DTWA 3E5AA 1R39A 4NJ3A 5J7BA 3NAYA 3NVMB 3ODZX 4UEUA 4BCIA 2X7OA 2GNIA 3VWAA 4BDDA 2Z8CA 3NUXA 4RZWA 5HI2A 4UWYA 4YC6A 2GNLA 4X6RA 4ALWA 4HZRA 4NU1A 4FTRA 4QNYA 1UWHA 2WELA 5KX8A 4MHAA 2CPKE 2Y6OA 3NUPA 3C4WA 4NUSA 4ZY6A 3T8OA 2W1IA 4GK4A 4DFNA 2YIQA 2IVTA 4FSWA 4Y8DA 5J87A 1JBPE 1OM1A 2UW9A 2V55A 4G3DA 4KRDA 4RFMA 2GS7A 3O71A 1H1SA 4FT0A 4HNFA 1JSTA 3FMLA 2OZAB 3G6HA 2Y7JA 2W1DA 3ZHPC 3QRTA 4GUBA 3LLAA 1YKRA 2W99B 4UWCA 2HY0A 2P4IA 3BHUA 3EJ1A 4ZMFA 1PJKA 3K54A 4RLLA 3MPTA 3TIYA 4IFGA 2A19B 3UP2A 4MXYA 4XS2A 3GB2A 4CFNA 4C62A 3IW4A 1GZKA 1H27A 3N51A 5HNIX 2V7OA 5JGAA 2QI8A 2Y8OA 3MESA 1YWRA 4NJDA 5L2TA 1FQ1B 4A4XA 3I5ZA 2YITA 2C6OA 2OF4A 4WUAA 5TOZA 5BPYA 1NVRA 5IQBA 4UYNA 3P5KA 3TUDA 4NKSA 3TL8A 3COHA 4E8AA 4L01A 1Q97A 2R3MA 2QKWB 2PZPA 1OECA 3JY0A 4WRGA 3IGGA 2HAKA 5FP5A 5JRSA 2JEDA 2UZVA 4FTLA 4RFZA 5AUYA 5EDRA 5IEVA 5E8UA 3MFSA 5CNNA 4ACMA 4APCA 4QTDA 3B2WA 2QURA 4F6WA 4FVPA 4TT7A 3DTCA 3R8PA 1W82A 4AT4A 4BIBA 5AIKA 5L4QA 1ZWSA 3FSFA 3R8VA 4W4WA 4H1MA 4FKVA 2C3KA 5L8JA 4ZOGA 3WI6A 2XF0A 4AU8A 3GC0A 4I93A 4GT4A 2XKFA 3ZUVA 3VS0A 4U7ZA 2RSVA 1GIJA 5GIOE 4LOPA 2JBOA 2VD5A 2WQBA 5LVOA 3ZSHA 4MVFA 4ENXA 3RPVA 2UUEA 3NW6A 3UNKA 3PVGA 3UVQA 2GHMA 2IW9A 4YNEA 5DT0A 2PMOX 3Q4TA 3Q5ZA 4FODA 4AW2A 1OUYA 4QP7A 2ITYA 5GNKA 1BX6A 1PMNA 3BBWA 3FMNA 3LE6A 4QYHA 5C03A 3UNZA 2B0QA 2W5AA 3F2AA 4KBCA 4KIKA 1GY3A 4EHGA 4YJSA 5LMAA 4ITIA 3LLTA 4QPAA 3W2SA 4C59A 4QPMA 3LFAA 1JVPP 4R1YA 5IUHA 4KKGA 3GFWA 4GYGA 3OTUA 4JIKA 4HZSA 5I3OA 4CFWA 4NH1A 4R3CA 3ZO4A 2C69A 4S31A 3G6GA 1UNGA 4AGCA 2ZM3A 3KXXA 4RJ7A 3RK7A 3TKHA 3W8QA 1V0PA 2WU6A 3ORNA 4H3BA 5K5NA 5HO6A 5HE2A 2EB2A 3RAHA 5FDPA 3LJ1A 3D2IA 1P5EA 1YXVA 3O17A 3RPRA 2VRXA 1BI8A 4XV1A 3OG7A 2Q0BA 3DXQA 2UW0A 4M8TA 5AR7A 4KNBA 3R8UA 3S95A 4YJQA 4BBMA 2WMVA 3CC6A 5J8IA 5J9YA 1K9AA 4AZVA 1T46A 3LQ3A 2ETRA 3Q6UA 2J0MB 2ZV2A 5J9ZA 4QPSA 1JKKA 4PDYA 5HLPA 3EN5A 3CGFA 4GJ2A 5DR9A 3VUKA 5BVWA 1CSNA 3OEFX 3DB8A 5A6OA 4DT9A 1F0QA 3BGQA 4ZTQA 3PXZA 3TNIA 2PTKA 4BZOA 3F69A 4YJUA 5HO8A 4IAKA 2YA9A 4BDGA 4P5ZA 3DJ6A 4EOKA 4QMMA 3SW7A 3HDNA 2OFVA 4FTCA 5DBXA 5DN3A 4K1BA 4YBKA 3VQHA 1G8AA 3EQRA 3C4FA 3PVUA 4FSYA 3TV6A 3BBTB 1NXKA 4I0RA 1NY3A 3H4JA 5AUVA 4TXCA 4LMNA 4WD5A 4C34A 2OO8X 4AAAA 1U5RA 3R9OA 2PUIA 1REJA 2BDJA 4FKQA 5G1XA 3ORZA 4DTKA 5AV3A 5JEBA 1ND4A 3NR9A 4FTMA 3ZLXA 5BUEA 3M42A 4MNFA 3TUCA 3MTFA 5IA5A 2JD5A 1WVYA 4C36A 2G1TA 3GXLA 4DEDA 2BKZA 2IVSA 2W0JA 2HWPA 2QOKA 1XH8A 2VX3A 3WE8A 5EHOA 4CCUA 1A9UA 4E5WA 3UP7A 5DFPA 2QR7A 5K5XA 5DPVA 5AMNA 3TXOA 3T3VA 3MVJA 5TO8A 2R3IA 1FGIA 3AOXA 4A7CA 3LFNA 4L53A 5AP7A 4CKJA 2HIWA 3BZ3A 1S9IA 3DB6A 4EHEA 3W2CA 4IC7A 5FG8A 4DG0E 1E1VA 4WIHA 4M13A 5BMMA 3UC4A 4GFOA 2AC3A 4FZFB 3U6IA 1UNLA 2I0EA 2XK7A 4ZLYA 1TQIA 2IZTA 3VBQA 2FSMX 4XG6A 1PXKA 4XP0A 4CFVA 4EWQA 2XKDA 2LAVA 2WTKC 5EW8A 4YJPA 3RM7A 2C30A 3QZFA 4EKKA 2W4OA 1Y8GA 3OXTA 3CPCA 4L45A 1U59A 5EG3A 4Z7HA 4GG7A 3S2PA 3MV5A 1OB3A 3DNEA 3UIMA 3BV3A 5ANOA 3QUPA 4RFYA 2E9NA 4CG9A 4FA2A 4FG9A 5AR5A 3LMHA 4UB7A 3A62A 1CKIA 1OBDA 3VHKA 4JG7A 3R00A 4GH2A 1URCA 4IB1A 4DFLA 4RWKA 2ZMDA 4HGLA 1WBPA 4IDTA 5H2UA 4F0IA 2XS0A 4HYHA 4DTBA 4JIAA 3W10A 4U45A 5I9VA 3EL8A 2GSFA 3O2MA 5ETIA 1XJDA 2B54A 2QOIA 1BYGA 2GFSA 4JQ8A 3LQ5A 5TR6A 1U46A 4JG8A 4YMJA 2R0UA 3R7OA 4AP7A 5HCXA 3F3ZA 4IAZA 3HECA 2J9MA 5KBQA 3DDPA 2XEYA 3DPKA 3I5NA 2BAJA 3BX5A 4W9XA 3WF9A 5AWMA 4YZDA 4EOOA 3B8RA 2QKRA 5HU9A 5I9YA 3CSVA 2IZUA 1K3AA 2WNTA 4OAVB 4CLIA 4CSVA 2YISA 5HLNA 2ITOA 3QX2A 4WG4A 4ZTLA 3UOJA 2I40A 4FE2A 4PPBA 4ZZOA 4YO6A 4IE9A 4OTFA 3OHTA 2R3HA 3DKGA 3JUHA 5CQUA 2HZ4A 3C4ZA 3OBGA 2BKKA 4UMPA 4J97A 3POZA 4DFXE 2JC6A 1PXIA 3JS2A 3LOKA 2C6DA 4RVKA 4TYHA 1NT2A 2VWUA 2I6LA 1Q8UA 2XIXA 1H07A 1Q62A 3WZUA 4B6LA 5M06A 3QCSA 2WMAA 2UW5A 2E9PA 4QP3A 3PJCA 4S30A 4FEUA 5BVEA 4A9YA 3GC7A 4RIYB 5CVGA 1WCCA 3F5XA 4GFMA 3PSCA 4MBIA 4AFEA 2YJSA 2PZRA 3IG7A 4FNZA 3P86A 4XX9A 1UWJA 3MB6A 5JZNA 4QMVA 3BYVA 4B4LA 5AEPA 4LGGA 3ZS5A 4XLVA 4D55A 4Q9ZA 1SVEA 3I0QA 4F1TA 2IWIA 5H3QA 3F3VA 1YHWA 3F2NA 5AV4A 3HAMA 4IC8A 4PTEA 4MH7A 2C68A 3BU5A 5HCZA 1PXOA 3IW8A 5C8MA 3VBYA 4CGAA 1H01A 5IQIA 5DR6A 5FEDA 2ZDUA 5IDNA 5GJGA 3EN7A 3BHHA 1RW8A 2CSNA 3BGPA 5IQCA 1Q4LA 3DOGA 4O7TA 5IH6A 4YUQA 4O83A 3IK3A 4BCOA 3FXXA 4O96A 4U5JA 4GS6A 3C51A 3QD2B 4P90A 1IR3A 2EU9A 3OUNB 4MEDA 4W9WA 3RK5A 3W32A 3NUYA 4AOIA 4P2KA 5FM3A 5G6VA 2R2PA 3BPRA 5EFQA 2W05A 2RG5A 4WNPA 3U51A 3HMOA 4RMZA 3I4BA 3PY3A 4AN2A 5I0BA 3A60A 5A14A 3L9MA 4YTFA 2J6MA 4NIFB 2XBJA 2XNOA 4JRNA 4AF3A 1E1XA 5E7RA 3LFBA 4MD7E 4GW8A 4F70A 3AD6A 5KBRA 1OIYA 1H0VA 4E6QA 5AP1A 5KCVA 1FGKA 1DI8A 4DH5A 4EK3A 3PUPA 4G3GA 4I6BA 2CKEA 3QTQA 5CAPA 4JRVA 2X81A 4FZAB 4RWJA 4TYHB 3KVWA 3KN5A 4IX4A 4XMOA 5BNJA 2XJ2A 3C0GA 2FH9A 3LFCA 2R3OA 2C3LA 3PP1A 4X2NA 2FSLX 4HPUE 4R8QA 2UZEA 4YC3A 5C27A 5M09A 5AUZA 3QTUA 4ZIMA 4AUAA 2P2HA 1P4OA 2GHLA 3QKKA 4RIXB 2UZWE 4CKIA 4CQGA 5CALA 4L7FA 2HCKA 4FV3A 3MWUA 5CYIA 1FBNA 4BDCA 5JZJA 1IEPA 4O21A 1WFCA 3DV3A 5DE2A 4U41A 1W83A 3QYZA 3Q53A 4ANNA 4DGOA 3HRBA 2VWZA 5IISA 3QQGA 3DNDA 4LFIA 4U0IA 1JNKA 2UVZA 1BL6A 1Q8WA 3SAYA 5LMKC 5LOHA 4ASEA 2V5QA 2ITNA 5FP6A 3AC3A 3RJCA 4G3CA 3BYMA 4FF8A 4JBVA 2YIYA 5FD2A 3OT3A 3QRIA 3W18A 3DBEA 1P2AA 3D7ZA 3VF9A 2WO6A 3V5WA 4G1WA 3V51A 5F9EA 5A54A 1BI7A 4HVGA 3FY0A 3I1AA 3E63A 5AJQA 4O91A 4LGHA 3FSKA 4D2RA 1MRUA 2X4ZA 4BTKA 4JVGA 5DHJA 5AAGA 3O0GA 2GS6A 3A2CA 4EK6A 5BVKA 4N6YA 1DAWA 5IA3A 4EH6A 3AMAA 4D5HA 4EOQA 2JIIA 3NYNA 3HRFA 3Q9XA 2OF2A 2JAMA 3IS5A 3H3CA 4IZYA 4NCTC 1APME 1Q8ZA 2YIXA 4EH8A 5C4KA 3R7EA 4I4FA 4C35A 2F2CB 4WNOA 3R9HA 5LXMA 2P33A 5L8KA 2JDSA 1QL6A 4FTJA 5M44A 3NYXA 3C4CA 5E4HA 4Y95A 3BLRA 3GCSA 2R9SA 4ZY5A 4GVAA 4PF4A 2G2FA 3LCTA 3FWQA 4QMTA 3HLLA 3M11A 4AT3A 3ZZEA 1ZYSA 3IDPA 3UE4A 2Z60A 4FSRA 4B99A 4FKOA 4QP9A 5IMEA 3CKWA 5DWRA 4AT5A 5E92A 2OJJA 3QHRA 3F3TA 3H9OA 4OBPA 3RI1A 3TTJA 5HOAA 4R1VA 4OTIA 4ALUA 4CXAA 4DH3A 2B9IA 3UOHA 4FIEA 4GK2A 3OFMA 4AA4A 4M69A 1FINA 3GCUA 2BFYA 3NNXA 4FK6A 5FBOA 3SRVB 3S00A 5IEYA 4S32A 3VW6A 4YP8A 4XLIA 1WMKA 2I0VA 3FZOA 3KB7A 2XZSA 2PUNA 5EYKA 4N57A 4X21A 5CLPA 3TZ7A 3R22A 2OH4A 3OOMA 5B2KA 5IUIA 5T3QA 3W2OA 4CLJA 5JRQA 2PYWA 5M55A 3Q52A 3NW7A 3NUNA 3HYHA 2F7ZE 4DINA 3E8DA 3DFCB 4O0YA 3DJ7A 1GOLA 2YZLA 2JGZA 4FZ6A 3VBTA 4IADA 5CT7A 5K4JA 5KMIA 3DKFA 1ZZ2A 4YJVA 2JITA 4BDAA 4JL9A 3MFUA 4BTJA 1H1PA 4DEAA 2EB3A 3CTQA 3DK3A 1VR2A 3F82A 2C0TA 3PSBA 4Y5HA 3CPBA 3VBXA 4A06A 4F4PA 3KK8A 4L9IA 4RVTA 4U3ZA 2YM3A 5A3XA 3FY2A 3FL4A 4ERKA 3WBLA 1YDTE 3CQEA 1OL7A 4FKWA 2CGVA 3AT2A 5BVOA 4GEOA 3VW8A 3RPYA 2RKUA 3K5VA 2XK6A 4I0SA 4KSQA 3C50A 4UZDA 4B0GA 2ITZA 4H36A 4XG9A 4L00A 3KRJA 5EM6A 3KCKA 4XV2A 3SHEA 3W33A 3H0YA 2XK8A 2O64A 4EONA 4OT5A 2ETKA 1ZYJA 4IMYA 3RHXA 3WE4A 4C57A 5M08A 3PLSA 4KBKA 5E91A 2ZDTA 3LW0A 2PVYA 1OKZA 3FPQA 3TZ8A 1W98A 3WZEA 5ACBC 3MY5A 4XG8A 1BL7A 1JOWB 5GJDA 2VNYA 3R9DA 5CSPA 4G5JA 3TZMA 5CSHA 4KINA 2BAKA 2QONA 4YSJA 4I5MA 3NS9A 4FV0A 3FXZA 3PJ1A 5ANKA 4NSTA 3FL5A 3T9IA 3UTOA 4FUXA 4QP1A 2YABA 3G9NA 2YJRA 4C4JA 5L8LA 4UYAA 2XKCA 4AA0A 4DA5A 4JAJA 4E4MA 1IASA 3I7CA 1ZZLA 1YI3A 3OWJA 1GZNA 4ZY4A 2X2MA 4PV0A 2X8DA 4O0VA 4O0TA 4CT2A 2UZUE 4EBWA 2XIYA 3POOA 4CQEA 3UVPA 1ZOHA 4PMTA 5EW3A 5CAUA 4HJOA 3FUPA 2XNGA 3TJDA 3D4QA 4CT1A 4EHZA 2X7FA 5IA4A 4JI9A 4IZAA 3GU8A 3DXPA 5M4CA 1R0EA 5IMXA 4WA9A 2E9UA 4JS8A 4JDHA 1ZMVA 2DQ7X 2YHVA 3SX9A 3VNTA 1KE9A 4G2FA 4AA5A 1PYEA 2OIQA 3QD4A 4AS0A 4F1MA 2CCHA 4EOPA 3PRFA 4TPTA 2YCRA 3ELJA 4NW6A 2PE0A 4F08A 4G6OA 4QOXA 5AX9A 2BRHA 1NVQA 2ZV8A 4RPVA 5HORA 3QC9A 3LVPA 3DT1A 3R71A 5CX9A 4BDHA 4DEIA 2YDKA 3PP0A 1TKIA 3M2WA 4UMQA 4IJPA 3WZKA 5J5TA 4C8BA 4D1XA 4E1ZA 5KMKA 4QTBA 5GZAA 3UNJA 3FMEA 3NCGA 1QCFA 1KUTA 3D94A 4MNEB 4FV9A 4FTTA 3SD0A 5DNRA 4A9UA 5L2IA 5AR4A 3GCVA 4EYMA 4ID7A 4MTAA 4NK9A 4X3FC 4YSMA 5IA2A 1ZARA 4FV1A 4FC0A 3VS3A 4KAOA 4ALVA 3G15A 4KUJA 1XH9A 2BFXA 3KK9A 3MSSA 1V0OA 1XBBA 2VNWA 3FMJA 3QZHA 4Q2AA 4DG3E 2REIA 4ZLOA 3AG9A 3HV5A 3FV8A 1SZMA 3ZLWA 2O0UA 4EOLA 3UG2A 4HCTA 4QMXA 3IDCA 5DR2A 1NVSA 4U97A 2QU6A 4K2RA 3VS1A 2CNUA 4GT5A 4PUZA 1YI6A 4FV5A 3C4XA 5L6WL 3KQ7A 4F09A 3PXQA 4Z16A 3KMUA 4OBQA 1ZOGA 2GTNA 2W1EA 3UOLA 4I0TA 4C7TA 5HD7A 3QQLA 2BIYA 3ACKA 3VC4A 5CANA 3EKKA 3ZC6A 2BRGA 4HGSA 3CE3A 4LYNA 3F5PA 3QD3A 4XYFA 3ZCLA 4C58A 3EQHA 3AD4A 3IKAA 4FIFA 4CMUA 5I4NA 1A06A 1XH6A 2HZ0A 2BRMA 5FXRA 3EB0A 2KTYA 3JYAA 3ZMMA 4D28A 3MBLA 3CIKA 1Q61A 2PSQA 2YM4A 1XH5A 4XEYA 4BDFA 3ORPA 2VWBA 4TZRA 2OSCA 3RZFA 4DE4A 1MRVA 4C4IA 2WTWA 4E20A 4O6LA 4FT3A 2I1MA 2XJ1A 4QP8A 5FGKA 3UC3A 4E6AA 3U54A 1UU7A 2QHNA 2WMXA 3L1SA 3OCBA 1ZOEA 3FEGA 1GNGA 3MJ2A 4IAFA 1PXJA 3BV2A 3BHVA 4EYJA 3MDYA 4FSZA 3LFDA 1UVRA 4FSUA 4WNMA 2XIZA 5D7VA 4BZNA 4O22A 4U81A 4IQ6A 3U6JA 2J51A 3C4EA 2ITQA 3CGOA 3ZRMA 4TNDA 2A1AB 4MF0A 2Z2WA 4J71A 4XBRA 4YTIA 2W7XA 5CU0A 3CKXA 3ZZWA 2VTPA 2YCQA 3UG1A 3HP5A 4PNIA 5CZHA 4ZTRA 5ICPA 5KMMA 3PSDA 3DAEA 3SC1A 3ROCA 4E26A 3A8XA 1ZMUA 3NX8A 4L6QA 4U9AA 2RIOA 5ETAA 2DYLA 4AFJA 3TUBA 1W7HA 2PK9A 1CTPE 1H25A 4JR7A 3BRBA 3FI3A 4Z3VA 2YWVA 2ITPA 2R3RA 3D2KA 1H1RA 4QTEA 3QKMA 4I6QA 3KMMA 3C0IA
chains in the Genus database with same CATH superfamily
3Q04A 3R9RA 2RL5A 4QTAA 1Q99A 2QC6A 1NW1A 4CFXA 1PKDA 3BWJA 2E2BA 3FLNC 3FQEA 3PRIA 4IACA 5FTOA 5BQ0A 2O63A 4YHFA 1J3HA 2OW3A 3HA6A 2ESMA 1OBGA 2PVMA 3PJ2A 4QQJA 4E6CA 3MIYA 3GGFA 4O7NA 1UNHA 2GNGA 2VAGA 3MFRA 4MK0A 4WO5A 2JAVA 2WQMA 2XK9A 3VN9A 1XR1A 5A46A 4HVSA 4FNWA 4IANA 1H4LA 2C6MA 5EI2A 1SYKA 3WZJA 5CS6A 2FSTX 5J79A 3HEGA 5ETCA 4EHVA 3LMIA 4IX5A 4BICA 3FMKA 2WTDA 3R8LA 2FGIA 3ACJA 5J7HA 5FBNC 3MA3A 3D5VA 3O8PA 5CAOA 4FT5A 3I6WA 2P55A 3KKVA 3JXWA 4ZSJA 4QP6A 4XBUA 1HOWA 4D58A 3PLAE 5TT7A 3UIXA 2GPHA 4RSSA 3W0NA 2CDZA 2PE2A 4USEA 1PXMA 2X0PA 3A4OX 4I21A 4C33A 4FEVA 3P7AA 4M14A 3E88A 4RA4A 4D4VA 3Q60A 4ZSAA 4PTGA 3ZH8A 4PRJA 1UV5A 4P7EA 1E9HA 3UDSA 3V3VA 3ZYAA 4UZHA 1VYWA 1Q24A 2C5OA 3PIZA 2C6LA 1U5QA 4MD9E 3SW4A 2X39A 4RC4A 2IVVA 3ANQA 4UALA 3RKBA 3VUGA 4OTPA 2FSOX 2W1HA 5AM7A 1SVGA 5DEYA 4E5BA 5F94A 1YRPA 3LFFA 4I22A 4TTHB 1ATPE 2CN8A 4AWIA 4QP2A 1GJOA 1WVWA 2QLQA 2GDOA 2PY3A 4NM0A 3FLZA 4M68A 5EYMA 2CMWA 4UX9A 3R0TA 2C1AA 2P0CA 5GZ8A 2C6KA 4BTFA 3OCTA 1Q3DA 2W17A 3V5LA 5HU3A 2XMYA 2QLUA 3ZO3A 2HXLA 5C26A 4K77A 1OL5A 2J7TA 2OH0E 2EXEA 3R28A 2R3FA 1YOJA 2VTMA 4A9TA 5A4QA 1Y6AA 4CCBA 3TNQB 4JJRA 1ZRZA 2X2KA 4BR3A 2HENA 3UJGA 1ZYLA 3ORTA 1XBAA 4FTUA 4IH8A 5AV0A 4B9DA 3R1SA 1FVTA 1SVHA 2WOUA 4HVIA 1FOTA 3C1XA 3R83A 2H34A 3KF7A 5AP6A 3WILA 3HNGA 4H1JA 3V8TA 4V04A 3PE2A 5D12A 4CRLA 4WT6A 4FKJA 1SMHA 2WTKB 3Q4CA 5AIRA 3RBWA 5J1VA 2ZYBA 3TNWA 2JIUA 3V6SA 4GV1A 5LVLA 2G2IA 5KMLA 2WB8A 3DK6A 3NNUA 2A0CX 1IG1A 3TACA 3IGOA 3HAVA 4F78A 1OL6A 2OG8A 2NPQA 4RZVA 4OTWA 1F5QA 4EOIA 3ZFYA 2GHGA 4DGMA 3G33A 5E8WA 2J0LA 2WTCA 2PVLA 5ANIA 5IF1A 4DFUA 3F7ZA 2WAJA 3DS6A 3I7BA 5BYLA 2ZV7A 1VZOA 3AT4A 3FI2A 2XRUA 2CKQA 3JR1A 2EXCX 4BZDA 4EQCA 3R02A 3UOKA 4DEEA 3R21A 3DJ5A 3TKIA 3S1HA 5IQAA 5J9LA 4DH7A 3PPKA 4DBXA 4LOOA 2JIVA 2GQRA 4S34A 1HCKA 4L44A 4PDPA 4I3ZA 5IEXA 4OLIA 5JGBA 3GT8A 1M2RA 4YO4A 3EZVA 3FLQA 5I9XA 2C3IB 3TT0A 2VTQA 1WVXA 3ULZA 3VS2A 3FKLA 1J1BA 2ZJWA 4FKIA 4IAAA 5LQFA 3TZ9A 4D0WA 2CKOA 3R73A 2WFYA 4RJ4A 4C4FA 1OL1A 3KY2A 3FDNA 3Q6WA 5DH3A 3R8ZA 2XVDA 2WEIA 4QEBA 1GAGA 3KULA 5IQGA 5CF6A 1OIUA 2BR1A 3LJ0A 4N6ZA 4KSPA 3LKMA 4AW0A 4CYJA 3KXGA 1XH7A 2VN9A 1I09A 1OPKA 3AMBA 2XNEA 3KXMA 4K9YA 4M15A 4FI1A 4PMMA 1M7NA 4X0MA 3PVWA 3SXRA 1WBVA 1ZYDA 3EH9A 3A7JA 5L6PA 5BYZA 3ID6C 4ZP5A 5D41A 2PVHA 1W0XC 4D4YA 3TTIA 4DBNA 2H9VA 2QOQA 4FX3A 4XOYA 4OTRA 4J7BA 1YXSA 2WMQA 3GQIA 4QYYA 4RIYA 4A4OA 5A4TA 1L3RE 3HDMA 4MQ2A 4I6LA 3DLSA 2WU7A 3E8NA 3ZFXA 4F9YA 4FYOA 5CI7A 4LG4A 5M57A 4QMZA 2YZAA 3D83A 3KA0A 2ZV9A 4TN6A 4O7VA 2PZ5A 3EL7A 4FUYA 5IUGA 5DOSA 3HV4A 2A27A 2X0QA 3A7FA 4RVLA 2XB7A 5HTIA 4U44A 5I5ZA 5LMKA 3MIAA 2OXYA 4DHFA 3BEGA 2EVAA 2OLCA 1LP4A 3DXNA 3ENMA 3WIKA 4O7YA 4QQCA 5GHVA 1QPDA 2Z7LA 4IM2A 3BLHA 3GP0A 4NM5A 1Q3WA 5TKDA 4OAUC 3KC3A 2OKRA 5CNOA 1FVVA 3VHEA 4Y72A 3QRKA 4YJNA 2G2HA 1OITA 5K3YA 2J5FA 3FQSA 4WG5A 5EKOA 3QGWA 3P0MA 4KIOA 3NW5A 3DGKA 2C5YA 1PXLA 2CLQA 3MVLA 2QOOA 3BYUA 3PG3A 3Q2MA 3C9WA 4XG3A 5H9BA 3WF5A 4FIGA 2XCKA 3PWDA 3ZRKA 1RE8A 3CS9A 3QFVA 5BUIA 4NCTA 3FJQE 1KE5A 4ACGA 3ZEPA 2EWAA 3E7VA 3B8QA 3FMMA 3PWYA 4FIIA 4N4SA 4QQ5A 4EK5A 2HOGA 4NWMA 1GZOA 1TQPA 2UZBA 3HMPA 4YLKA 3FYKX 4M3QA 3I6UA 4NIFA 4BKYA 5EDPA 2B9HA 4Y85A 1SNXA 2V0DA 3R2BA 4TWPA 3P23A 4DAWA 3OCSA 3KULB 5CTPA 3MVMA 5ANDA 5JFXA 4QMUA 1TVOA 5AAFA 3ZO2A 4ACCA 4AZEA 2CHLA 3BKBA 4O0XA 4E7WA 3R7YA 5FM2A 1OIRA 1OI9A 1Y6BA 5C1QB 4O84A 3UZTA 2HWOA 2XKEA 4KIPA 4FKPA 4BHNA 3EHAA 4EH9A 5LWNA 3WOWA 3MB7A 5B2MA 1Q8YA 5DLSA 3FI4A 2ZM4A 3G51A 1UU3A 2PUUA 4QYEA 5DRBA 2GU8A 4C37A 2JFMA 2O5KA 2R3KA 2B55A 2YM6A 4FKSA 4KWPA 2C4GA 4R7HA 1H26A 4RIXA 3ZM4A 1TQMA 3BELA 4DH8A 4RRVA 5I3RA 4DEBA 3R1YA 4FSTA 4G6LA 2CCIA 3GOPA 5E8YA 3UYTA 5GZ9A 3DLZA 2WQEA 3MPAA 3R7GA 4KS8A 1J7IA 3PFQA 2IJMA 5D9HA 5EI8A 4ZTSA 4O7SA 3UZRA 3GEQA 1WBWA 5H8EA 5JFSA 2W4KA 3UPXA 2XK4A 4IWOA 3OEZA 3VS6A 5F4NA 1REKA 3LCSA 4FICA 3HKOA 3P1AA 2OJFE 1P14A 3CEKA 2WQOA 4DHJA 4RIWB 4KRCA 4WHZA 4ORKA 1M17A 4Z9LA 3Q4UA 1J91A 4DEHA 4O7LA 2UZLA 4M84A 3FQHA 3U4UA 4CZUA 2X9EA 2BCJA 2XM9A 3OF0A 2XRWA 2OICA 3EOCA 4JDKA 4KD1A 4HOKA 4MF1A 4PQNA 2UW3A 2PMLX 3CJGA 4FL3A 4CEGA 2JBPA 4N70A 3QALE 3BI6A 3VONA 1Y57A 1YI4A 3QRJA 4I6FA 4KKHA 4L43A 5HIBA 5C8KA 3FHRA 3D0EA 4YBJA 2WOTA 5FEEA 5IZFA 2O8YA 5F1ZA 2WKMA 5DRDA 4IM3A 4W8EA 3SA0A 2CJMA 2Q0NA 4NEUA 4JXFA 2YACA 5FQDC 5EKNA 1BLXA 1XMLA 2DS1A 4BCKA 3COKA 3OXIA 4EH7A 3TMOA 4R7BA 3HV3A 1WBOA 3LXNA 4UY9A 1ZY5A 4FYNA 1VLRA 3FHIA 3KN6A 4FKRA 1Z5MA 3BE2A 5AP4A 3KL8A 3EQBA 3IQ7A 1M2PA 2F49A 4GK3A 4XG7A 4E3CA 5HCYA 3AC5A 2UZNA 4XV3A 4MBJA 4EH3A 5JH6A 2QQ7A 3AGLA 3DAJA 1CKJA 1O6YA 3SV0A 4F9AA 2OI4X 5I9WA 4JDJA 2R4BA 5FXSA 2VTJA 3QU0A 1A48A 3UPZA 2YAKA 3ENHA 1J1CA 3NUSA 3QQJA 4ZJIA 2RFNA 5HVKA 5IA1A 4DC2A 4H3QA 2F7XE 5CI6A 3FC2A 4K11A 2WGJA 2IZSA 2W1CA 2YIRA 4O4BB 2IPXA 4ZSEA 4AXAA 3SRVA 4R3RA 1ZY4A 3NZ0A 3DBCA 4FV7A 2J4ZA 2V62A 1VYZA 3CXWA 4RIOA 4ONAA 3UVRA 2O2UA 2DWBA 2C3JA 3GUBA 3W2PA 3QQKA 3R1NA 3VUHA 3CBLA 4BB4A 2WMRA 4S33A 3TEIA 1UA2A 2BUJA 2HELA 3FE3A 4YZBA 4C4EA 4F0GA 3OW4A 3SG9A 5CWZA 4U79A 2VWWA 1OGYA 1HCLA 3GFEA 2XARA 1JSVA 2C5NA 2X8EA 3QTIA 4HVDA 1XO2B 2B53A 3QD0A 3SKCA 4R3PA 3TG1A 1JWHA 3SDJA 5IPJA 4ERWA 1LEWA 2WPAA 2G01A 2ITXA 3Q9WA 4L68A 3TJCA 1KV2A 3OWKA 3Q3BA 2WTIA 3RWPA 3WF7A 2VTRA 2VX0A 5AUWA 4IIRA 3FXWA 5HGIA 3HVCA 2VO3A 4A9RA 4OT6A 2AEGA 4ANQA 4D2SA 3O51A 2C5VA 4FEQA 3NLBA 3OVVA 4NM3A 2A2AA 5CXZA 3W0PA 2PL0A 3BGZA 4QP4A 1UU9A 3ZLYA 4ACDA 4O6EA 3U6HA 3BEAA 3TI1A 1U54B 5CSVA 3H30A 2XAMA 1UKHA 2BDWA 3UQGA 4E4XA 5D10A 3QTXA 3UODA 4IVCA 4ANOA 3QCQA 4YNOA 4JR3A 3BQCA 3ZSGA 3U8WA 4JQ7A 2R7IA 4YHJA 3E92A 2PWLA 4N0SA 4EK4A 4EJ7A 3VVHA 1S9JA 3RM6A 4Q9SA 5D11A 4CMTA 3L8XA 2W5HA 2YCFA 4X3JA 1QPEA 4G6NA 2R3LA 3MN3A 3OWPA 4FZDB 4NW5A 3VO3A 2OZOA 2QO7A 4V05A 5LCJA 3W1FA 4JX7A 4RG0A 3W0OA 2HW6A 2BZJA 4NKAA 1RDQE 2PUPA 3DAKA 4BCQA 4GVJA 4EQUA 3ZTXA 2FYSA 1YHSA 2UW4A 3K3IA 4YGAA 3G0EA 4BIEA 4GUEA 2XYUA 3NNVA 3NWWA 4C3RA 3RNIA 2Y9QA 3A99A 4RJ6A 4O7WA 4RX7A 3GU6A 1IA8A 1ZAOA 2W9FB 4L3LA 5CENA 3CP9A 4ZTMA 3NAXA 4EEVA 2ERKA 2VX1A 4Q5HA 3CQWA 3UO6A 4C02A 4LGDA 3V01A 3IOKA 2X6DA 4FR4A 4BFMA 3PIXA 2J5EA 1OZ1A 5J1WA 4JAIA 3LQ8A 2PULA 4ZS4A 3MI9A 3EZRA 1PF8A 4EH5A 1YXTA 4BKZA 4F7NA 5I9UA 3PZHA 3D14A 3N4VA 3HA8A 1BKXA 5D1JA 5E8XA 2ZM1A 5EM7A 2LGCA 2R3QA 4XH6A 4BJJA 3R30A 4I4EA 1H0WA 5FUTA 5E90A 3UO4A 3QQFA 4BBFA 2E9VA 3GI3A 2R5TA 3LXLA 3QLGA 3VUIA 3ANRA 2YM8A 1PW2A 4X6QC 2GNJA 4O0SA 3NYVA 3VUDA 5C01A 3LHJA 3II5A 4E73A 1OIQA 3F3WA 2CNVA 4ZK5A 4F6SA 4JBPA 5CZIA 3PUFC 3GU7A 2I7QA 4GIIA 2VWIA 3PPZA 5EW9A 4DFBA 3SGCA 4ACHA 4X3FB 4QD6A 2GMXA 3OZ6A 1R78A 5M51A 4J8NA 2G15A 4MNEA 2YAAA 4PMSA 2B9FA 1KOAA 2BZHB 4J98A 4TL0A 4DTAA 1W8CA 4HYIA 3ZLSA 3DKOA 4GYIA 1G3NA 2YERA 3FKOA 3LCKA 3Q96A 4OUCA 3RZBA 4ANBA 4EQMA 5BVNA 4DEGA 4FTOA 4ASXA 4BF2A 3OMVA 3LFSA 2BHEA 3E8EA 4LRMA 3MPMA 2HXQA 5EM5A 3ATSA 4I94A 3ZUTA 4NL0A 3O8TA 3FPMA 1VEBA 4A07A 4I92A 2Z7SA 5AFVA 2YN8A 3B2TA 4U42A 4U8ZA 3REPA 2V7AA 3G0FA 1M7QA 3HRCA 5CAQA 4FNXA 4BCJA 1FPUA 2JDRA 4IDVA 4OTQA 5A4EA 1IAJA 4ZJVA 1V1KA 3MY0A 3VJOA 2VTIA 4ITJA 5E9EA 5CEPA 2PVRA 3D7TB 3QTRA 3ORKA 5CASA 3QCYA 5AUUA 5DI1A 1O6KA 3VF8A 2VO7A 3F7WA 4HVHA 2Y4IB 4Y5QA 3MY1A 3V5QA 1JQHA 3ORLA 1GIHA 3E8CA 4U6RA 4AN3A 3I0OA 2H8HA 3QXPA 4TWCA 3EFKA 3UMXA 5HVYA 2R3PA 4DG2E 3MYGA 1B38A 5AA9A 2BVAA 2X4FA 4QMNA 4O27B 4ZJJA 3R7UA 4DYMA 1OKVA 2O65A 3IDBA 4J99A 1G8SA 4W4VA 4XG4A 3A4PA 4LI5A 4O7RA 3EN4A 2XA4A 1TFFA 4O86A 3VULA 4BCHA 1XQZA 4MCVA 4I41A 4BCNA 5E8SA 3RAIA 4CZYB 2B1PA 4MBLA 5DYJA 3FMDA 2W5BA 1PY5A 4MWIA 4X2KA 4LRKA 3U87A 5IQFA 2YM5A 2NP8A 4KA3A 5HG8A 5ANJA 1SM2A 2QODA 4DFYA 5L2WA 2Q83A 3V6RA 4HCVA 3TYKA 4USFA 3H0ZA 1AQ1A 3CD8A 3F88A 3Q32A 2FUMA 3FAAA 2QCSA 3QC4A 4D9UA 4NYEA 1G5SA 2OU7A 3AGMA 3D5UA 4PTCA 3TNHA 2QVSE 3VRYA 3HX4A 2KULA 2ERZE 3VBVA 5JGDA 3QWKA 3I60A 3KXNA 3OS3A 4TWNA 4F7SA 5M07A 2C6IA 3EYGA 2F57A 4DGNA 4C3FA 4NM7A 2GNFA 4RJ3A 1ZMWA 3GU5A 4QTCA 5AP3A 5H8BA 4BBEA 4BGGA 2XNNA 3ZXTA 4PMPA 3VS4A 3L8PA 2G9XA 2VTNA 4PNKA 4FKTA 3H10A 3HGKA 4FSQA 3V8WA 4O2ZA 3ZU7A 4ZAUA 1H00A 3EQDA 3TKUA 2ITWA 4GMYA 3PA4A 4FSMA 3SXFA 4AW5A 2W06A 4JOAA 2FO0A 5D7AA 2OJIA 4RVMA 5EDQA 5CEMA 4FEXA 4IVDA 1XKKA 3U4WA 5A6NA 1GZ8A 4CTBA 2VU3A 3OOGA 2F2UA 2C0IA 2WMTA 3HMNA 5BUJA 2B52A 4U80A 4C2WA 1JAMA 3M1SA 4E4LA 4D4RA 4EZ7A 2BPMA 4DHIB 4XOZA 2IW6A 3C5IA 3O7LB 2Y4IC 4MXZA 4U3YA 1BMKA 3TWJA 5A4CA 1YWVA 2CN5A 2PVFA 3FZRA 4QRCA 5BYYA 2NO3A 1Y91A 1YWNA 3R9NA 1LUFA 2XEZA 4ZXTA 1ZXEA 5AR8A 2W9ZB 3AXWA 3FLYA 4YC8A 5L3AA 2IO6A 2YLEA 2UVXA 3EFLA 4FV4A 4EORA 3NFFB 3K3JA 2HZIA 2WIHA 4J95A 3DKCA 5ACKA 4DCEA 3KXZA 1WAKA 3E93A 5EQYA 2XP2A 4AZFA 2SRCA 3RCJA 5L6OA 3BHYA 4O2PA 2VO6A 5JFVA 3GNIB 5TE0A 5C4LA 1M52A 2R3JA 3ZDUA 2IEWA 4TYIA 4D2PA 4EKLA 3BU3A 4O0RA 1OVEA 4BDKA 3KU2A 4LOQA 4M66A 5FDXA 5CVHA 4BY9E 3WARA 5LVPA 1OKYA 4OTHA 1GIIA 3R7IA 3ZBXA 4AQKA 4GCJA 5CEOA 3N4UA 5AP2A 2QO9A 3OD6X 2B4SB 5FEQA 3DQWA 1OUKA 4FL2A 3G90X 4TYGA 4IBMA 4CV8A 2BTRA 3A8WA 4KIQA 2PMNX 3F2RA 4QO9A 3CD3A 4QMOA 4QT1A 5IDPA 4I23A 5E8TA 3V5PA 4BYIA 5JQ5A 2BIKB 2BZIB 3FMHA 3BHTA 1ZLTA 2VWYA 3PY0A 4JNWA 5KZIA 4MD8E 4I5CA 3A7HA 5HNGA 2GQSA 4FKGA 1AD5A 4FGRA 5IKWA 4BGHA 4DCAA 3U9CA 4F99A 5KMJA 5LCKA 4BCMA 3NPCA 4EZ5A 4M0ZA 4HGEA 3PIYA 4BIDA 4ASDA 1OKWA 3QCXA 4AGWA 3KRXA 1G8JA 4UWBA 4IWPA 2OFUA 3DZQA 3W16A 2XAOA 4Y46A 4FTIA 4C38A 2EXMA 3QX4A 4YURA 4HGTA 2ONLC 3Q5IA 2JFLA 2HYYA 4LL0A 4H39A 4MXCA 2WMSA 1KWPA 2J0IA 5LJJA 5JN2A 1QPJA 4XRLA 2QD9A 3OY3A 2GCDA 2HZNA 3HMMA 4OW8A 3AC8A 1IAHA 4L42A 2UW6A 4AGDA 4MX9A 1EH4A 3O96A 4KBAA 3IW7A 3RTPA 1AGWA 5EOBA 3IO7A 3RGFA 4ARKA 4C4HA 3Q9YA 3AC2A 2QOHA 4V0GB 3PA5A 1VJYA 4GJ3A 3HP2A 4NFMA 3LXKA 1DM2A 2RF9A 3QTWA 4QMYA 4C61A 2Z7RA 3AKLA 4A4LA 4BCPA 4XUFA 2FVDA 3S0OA 5AUTA 5KMOA 3ZFMA 4X2GA 4WBBB 3SXSA 3UYSA 1QMZA 3E87A 3QTZA 4H3PA 4BI1A 2XYNA 5IQDA 5CEIA 5ETFA 5IQHA 4FTAA 5JSMA 4EL9A 1V0BA 3TIZA 3PZEA 3U55A 4GL9A 3MGYA 5CSXA 3S3IA 3LIJA 5LVMA 4RWIA 1O6LA 3O23A 3WZDA 5M53A 2XNMA 2BZKB 3ZXZA 2R0IA 4EI4A 2P3GX 4M7IA 2R7BA 5A4LA 3IW6A 2O3PA 4BDJA 2BRBA 4BI2A 3O8UA 3R1QA 2OIBA 4HYUA 4JBOA 5K0XA 5LMBA 2XK3A 5CF8A 3UMWA 5AM6A 3BE9A 3D9VA 3RHKA 2BHHA 4XHKB 5HVJA 4E93A 4F63A 4F9WA 4DITA 3BYOA 4FV2A 4D2WA 2B9JA 2VV9A 1PMVA 3COIA 3ODYX 3EQPA 4UN0C 3ERKA 4C0TA 3EIDA 4YZ9A 2XJ0A 4IM0A 4RX8A 3E7OA 5L2QA 4A9SA 3GQLA 4L46A 3WF6A 3V5JA 3RP9A 4R7IA 4GIHA 4QMQA 3SVVA 4YJTA 3QLFA 4MAOA 4X2FA 4GKHA 3G2FA 3D5XA 3GC9A 4IX6A 4FIHA 3TV7A 4PP9A 3BCEA 2FB8A 2VO0A 2WHBA 4BKJA 4L67A 3UDZA 5HTCA 2HY81 3MS9A 3HV7A 3RPOA 3IOPA 4WRSA 3W0SA 3NDMA 4WNKA 2XIRA 3D15A 5T6KA 4O1PA 2CGXA 2VWXA 3HL7A 3MH0A 4AE6A 4MXAA 1PRYA 5CEKA 5HX8A 2P2IA 2QO2A 2XUUA 4GG5A 4G3FA 1JSUA 4YTCA 4F65A 2WTJA 5CSWA 1M14A 3LM0A 3BLQA 1CKPA 4AE9A 3QBNA 3DU8A 4BGQA 1YXXA 3UGCA 5M4FA 2ITVA 3QA0A 4PPAA 4ANLA 3RK9A 3WYXA 1ZYCA 4RJ8A 1Q8TA 3GENA 4FNYA 5HESA 3F66A 4BCGA 5EM8A 4DGGA 1BUHA 4BHZA 2VUWA 4BWPA 4PX6A 1YDSE 3TCPA 4C2VA 5EQPA 2OXXA 2F9GA 2PPQA 3EN9A 1MRYA 4QNAA 3K2LA 1WBTA 2VTOA 3LCDA 2C47A 3TDWA 4I5PA 5AV1A 1URWA 3KRWA 3KFAA 4LMUA 2C6EA 4CV9A 4D2TA 2UZDA 1DS5A 4KIKB 5DG5A 2YDJA 4L3JA 5HHWA 3UIUA 2WQNA 2BROA 4ZS0A 4RLKA 4FKUA 3RNYA 1PYXA 3BIZA 3PPJA 3PXFA 4EJNA 3HV6A 2PVKA 4YLLA 4UMRA 2VGPA 5M4IA 5HO7A 4E4NA 3VQUA 5B7VA 3GOKA 4ASZA 3GCQA 4TYJA 5M4UA 5AR3A 2CLXA 4YJOA 4XRJA 5GIPE 2J0KA 2WD1A 3I79A 3NRMA 5JQ8A 4OTDA 5HBEA 3FZTA 3E3BX 4BYJA 2QOCA 1Y8YA 3RINA 4P5QA 5B0XA 1KE8A 4BDIA 3O50A 3KGAA 2BAQA 2UV2A 3L8SA 5HE0A 4J1RA 1H1WA 2W1FA 3G9LX 2WXVA 2AQXA 3DBFA 4CG8A 4GU6A 4D1ZA 3IPHA 4O4FA 1Q41A 3VUMA 3C5UA 4WKQA 3P9JA 1F3MC 2VZ6A 3BYSA 3T9TA 5BVDA 3AKJA 3DBDA 5FXQA 2H6DA 3FLWA 4GFGA 2XNBA 4S2ZA 4O0UA 4X7QA 5GJFA 1DI9A 5HG5A 4RIWA 1KE6A 4J96A 5AADA 4MQ1A 3NFGB 3SG8A 4O0WA 4K8AA 4BDBA 4FOCA 4FTQA 2F7EE 4APPA 4IWQA 3PXRA 4ZSGA 5AAEA 4PP7A 4G34A 3TDVA 3OROA 1XH4A 4K33A 3W0RA 5DMZA 5JMSA 4J8MA 1PHKA 3F6XA 2NRUA 1WBNA 1RJBA 2ZB1A 3G5DA 3QHWA 5AV2A 4AOJA 2AYPA 4JG6A 4FGBA 5CQWA 4AN9A 4ENYA 3EFJA 4EZ3A 3OY1A 1U4DA 5AP5A 5HE1A 5HNBA 4TW9A 3EQGA 3PXYA 2W96B 3R01A 3AQVA 3O5AA 4OGRA 3ALNA 4PPCA 3WYYA 4OTGA 1J7LA 3R7VA 1FMOE 2GS2A 5KZ0A 4AG8A 3H9FA 3CQUA 4K18A 5C9CA 2Z7QA 4PL3A 3NIEA 4RA5A 4TNBA 3RAKA 3LJ2A 2FA2A 4I5HA 1LR4A 1P4FA 3MFTA 4MXXA 5AUXA 4FKLA 1NA7A 4EK8A 3NUUA 4PDOA 2AUHA 3VBWA 4EOMA 2UW7A 1STCE 4YR8A 1H8FA 1X8BA 3NSZA 3QXOA 5HZNA 4WSQA 2PZIA 4EH2A 4RX9A 2QOBA 4MWHA 4G9RA 4KB8A 3CJFA 1CM8A 3U9NA 3F5UA 2ITUA 5LVNA 2WZJA 4MYGA 5J95A 2X9FA 3PDTA 3EWHA 4AXCA 2QHMA 4BN1A 1H1QA 3VIDA 3EYHA 5KHXA 5IQEA 3DCVA 2QR8A 3MH3A 3E64A 1FVRA 4FK3A 4IHPA 2PHKA 5HIDA 4CRSA 3RVGA 1SNUA 2QU5A 5KHWA 4UXQA 2W1GA 2IN6A 2C5XA 5HBJA 5DEWA 4RWLA 5LARA 3IONA 3ZEWA 4ZEGA 1XBCA 4DN5A 3FKNA 4UMTA 4YJRA 1YXUA 3KEXA 1KV1A 1YW2A 3KF4A 4WBOA 1H28A 4F7JA 5EH0A 1LEZA 3OC1A 1XHAA 4LV7A 1JKLA 4FTKA 5CF5A 2BRNA 1OPJA 5BVFA 3EFWA 4I1ZA 5TF9A 4E5AX 3MH2A 2BALA 4DT8A 3GU4A 3UO5A 3FC1X 3NYOA 2VTHA 2R64A 4MXOA 4CYIA 5K4IA 1PXPA 1IA9A 4O82A 2DUVA 4YHTA 5HBHA 3ML1A 3OP5A 4ZMEA 5GINE 1YOMA 4TY1A 2C1BA 4JLCA 5AP0A 4UV0A 2X6EA 1OMWA 4H05A 3VUTA 3R6XA 4FSNA 4YZNA 2WMBA 5IG1A 3PVBA 4UBAA 4GSBA 4BRXA 3PXKA 1U54A 5CU2A 3A61A 3TV4A 4BI0A 2IF8A 3IW5A 4MKCA 4DLIA 4ZZNA 2PVJA 4EUUA 4O7ZA 2XNPA 5HICA 2VTSA 4FG7A 4DGLC 4GKIA 3DDQA 3MJ1A 2NRYA 1DAYA 4LL5A 4F0FA 1YOLA 3EMGA 5HE3A 3PJ8A 3R2YA 2WMWA 3RWQA 2VWVA 4IFCA 2WEVA 4J53A 1ERKA 4WUNA 5ANEA 2GQGA 4QMPA 3A7GA 4LV8A 2C0OA 3F5GA 3PY1A 3BWFA 3CTJA 2NYAA 2A4LA 2UVYA 4BL1A 2JDTA 2RFSA 4HW7A 2PMIA 2VTAA 4IVAA 4FVRA 4XJ0A 4F9BA 3QL8A 3P4KA 4LV5A 5HEZA 3OXZA 5HKMA 4IZ5A 3O7LD 3DK7A 3QAME 4F1OA 5CAVA 1L8TA 4USDA 2IVUA 2X8IA 4AXFA 4G31A 2W1ZA 3DQXA 1MUOA 5ITAA 3LFEA 4CFFA 1B39A 3ZO1A 2YM7A 3VAPA 4AOTA 3AC4A 2GFCA 1PXNA 1JPAA 2AC5A 4R5YA 4G17A 4BC6A 2CGUA 3T3UA 4BVUA 2ETMA 3OUKA 2IZRA 3QYWA 2RG6A