5HLWA

Crystal structure of c-met mutant y1230h in complex with compound 14
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
299
structure length
284
Chain Sequence
ALNPELVQAVQHVVIGSSLIVHFNEVIGRHFGCVYHGTLLDGKKIHCAVKSLNRIDIGEVSQFLTEGIIMKDFSHPNVLSLLGICSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMHDKEYYSVAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Hepatocyte growth factor receptor
publication title Discovery and Pharmacokinetic and Pharmacological Properties of the Potent and Selective MET Kinase Inhibitor 1-{6-[6-(4-Fluorophenyl)-[1,2,4]triazolo[4,3-b]pyridazin-3-ylsulfanyl]benzothiazol-2-yl}-3-(2-morpholin-4-ylethyl)urea (SAR125844).
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 284
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hlwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hlwA01
2X4FA 2BR1A 3DBDA 1ZZLA 3E93A 4BHNA 3O7LD 4MNFA 5ITAA 5HGIA 5JGBA 2QI8A 3NNXA 2YJRA 4IACA 3A60A 3G6HA 3W2RA 4DC2A 3CKXA 5J7HA 5FM3A 5FXRA 1YQJA 4FE2A 3WF7A 4O7WA 4WG3A 4RFYA 3TUCA 1YWRA 3PE2A 5AP1A 3UVQA 3QQKA 2C6KA 3KVXA 3BYSA 4WNOA 3IW6A 3QD0A 4ENXA 4FKSA 1Y57A 4O86A 3DJ7A 5DR9A 1TQIA 4JS8A 5CVFA 4KS8A 1SNUA 3VJOA 4D9UA 2GNFA 4UZDA 2JGZA 3JYAA 3C0IA 3MFUA 4YJOA 5KUPA 4IB1A 4DT9A 2PZ5A 5EYKA 3EIDA 4GT3A 1U46A 1OGUA 2LAVA 2UZNA 2XJ2A 4NJDA 3UODA 2VZ6A 4BTJA 5I9XA 3AG9A 3JUHA 3IPHA 3DCVA 5ETFA 1Q97A 3VS5A 2YFXA 4F0GA 2J2IB 4CD0A 1PXKA 3TNIA 2XK7A 2UZOA 3T3UA 5EI2A 5KBQA 4D0XA 4ORKA 2GQSA 2UW5A 3KCFA 2BZJA 2UW0A 4JG8A 4CLIA 2Z7QA 4IVDA 4E7WA 2QO7A 5DT3A 4BCMA 4EQUA 3ORNA 5KO1A 4EUTA 1J91A 3LJ0A 3ZLWA 3MESA 3NUNA 5HVYA 4U79A 3GP0A 3RPYA 1NVSA 4E5WA 1M2QA 3IW8A 4MXYA 5DBXA 4ANBA 5H8EA 5BVOA 1PW2A 4DTAA 3HA6A 4AN2A 3U54A 5J5SA 4EHEA 4GEOA 1ZYLA 1XO2B 2C6LA 2IW9A 4TWCA 4QMUA 2Z60A 3LCKA 3SOAA 3V04A 2YWVA 3W55A 4EH9A 3RGFA 3QHWA 3SG8A 5L8KA 5AP0A 4GK4A 4UWYA 2XJ1A 5HTBA 1PXLA 4ID7A 5EI8A 4UALA 3DAJA 2HXLA 4NJ3A 3QQUA 4CSVA 4QMMA 2YIYA 3LMHA 1TKIA 3BWFA 5B2KA 5IQEA 4CFVA 2QLQA 2BDFA 1GAGA 5FQDC 4DLJA 2VTLA 4GKHA 5LVOA 4XG4A 2PE0A 5M44A 4KRDA 2PHKA 3E7OA 2NP8A 4EHVA 3MB7A 3QX2A 1Z9XA 2AYPA 4EI4A 3ZM9A 4CG9A 3PP0A 3F88A 3UJGA 4PPCA 1I44A 3W2CA 4A06A 1OECA 4J1RA 5HQ0A 5HOAA 4I5CA 2BRBA 2UW4A 4PL3A 4FVQA 4F0IA 3KU2A 4IX6A 4O2PA 3R1NA 3MVJA 2F2CB 4YTIA 5A54A 4RT7A 5JSMA 1UNHA 1H1WA 2EXEA 2O5KA 3MJ1A 3ODZX 2QURA 5CVGA 4EQMA 2PUPA 4HNIA 3TT0A 4HVIA 2G1TA 5FDXA 4HGSA 4AACA 5K5XA 3NAXA 3TTJA 4FIJA 4NM5A 5GJDA 5A4EA 3WF6A 1YDRE 4CLJA 5HO6A 4DBXA 3PY1A 4J71A 3ZYAA 3FMLA 2VO3A 2WMSA 1SMHA 4JDHA 5DT0A 3SA0A 5CNNA 2Y4IC 3HDNA 2WU7A 3T9TA 4IDTA 2XK6A 2KULA 1V0OA 4H3QA 1P4OA 5L6PA 1ZWSA 1NVQA 3DKOA 2YLFA 3V5QA 3GVUA 3O23A 4I23A 3DK6A 4LGHA 3G2FA 3NMUF 4YHTA 1FINA 2UZEA 2XEYA 1R1WA 1WVWA 1ZMWA 4RIXB 5K4IA 3UO5A 4IW0A 3PRFA 1YHSA 3V01A 3H10A 4D9TA 2WMUA 2J9MA 1KWPA 1XH4A 3QA0A 4QMTA 5AAFA 2OJIA 2DQ7X 2GS7A 2YCRA 2UW9A 3HA8A 4FKGA 4FGRA 2IZUA 5DG5A 3MYGA 4E8AA 4AOIA 4UMTA 4YTCA 3EFWA 5HIBA 4QTDA 3VN9A 4CKJA 4QTEA 2W9ZB 4IAIA 4BDAA 2PL0A 2QVSE 3DPKA 4IJ9A 4DFZE 3R9OA 1URCA 2I40A 4OBQA 3W1FA 5C01A 1BLXA 4N6ZA 4U80A 5EM5A 4GJ3A 4UN0C 4WKQA 4NFMA 4G2FA 2P33A 1JQHA 1YWVA 3ZU7A 2XA4A 4AZVA 1H26A 4C61A 4YR8A 5C1QB 2XUUA 5K0KA 1ZYSA 4PTGA 3OC1A 5CZHA 1Q8WA 5JZNA 3PA4A 2OJJA 1HOWA 4FK6A 5EDQA 4ALWA 4FNXA 4YJTA 2IW8A 3DB8A 4P4CA 2QOFA 3HGKA 2XKDA 5E4HA 4IEBA 5CYIA 2VV9A 3O50A 4LUEA 5K3YA 1T45A 3ZZEA 4JBVA 3RAHA 3OCTA 4Y72A 4M15A 2RFDA 4NKAA 4WG4A 3RCJA 4E4XA 5J95A 4EK3A 3WYYA 3VUGA 4DH5A 2WGJA 3R8VA 3JS2A 2YM3A 4M97A 2X0GA 4ANOA 3OCSA 3UZPA 2XJ0A 5EHLA 4BBEA 3HECA 3QLFA 3KXXA 2ZM4A 1PMVA 3MV5A 2B9HA 3LOKA 4GFMA 2OF4A 1H1SA 2IPXA 3MIAA 2WQOA 2WNTA 4CT1A 3EN7A 2PMNX 3ET7A 1XR1A 5J9YA 1OIUA 3E92A 4GUEA 3EQPA 3I60A 5HCXA 1VEBA 2QU6A 5JKGA 4BC6A 4YZBA 5AR7A 3A4OX 3BQCA 2V62A 4MXOA 2A0CX 4YZMA 2Y4PA 4TNBA 3VHEA 4EKLA 3S1HA 3ATSA 1P2AA 5A4QA 5L6WL 2OK1A 3EQBA 3Q04A 4XLIA 4E6CA 3WF5A 4BCOA 3QD3A 1W7HA 3E88A 2Q83A 4CZUA 3VBYA 4A9UA 5BVNA 1WBSA 1CKJA 4AP7A 3VUMA 2BIYA 4ZTMA 3UMXA 4FV1A 5JRQA 2CHLA 3AC2A 3OTVA 3OY3A 3IW7A 4M12A 3LJ1A 4FTLA 4F9AA 4GS6A 4GMYA 2X9FA 5E8WA 5H2UA 3SC1A 3WZKA 3VF8A 3ZBXA 1A06A 1XH7A 4U8ZA 4IAAA 4YJUA 4ZSLA 4EOPA 5BUIA 3O51A 4DF3A 3GC0A 1OKWA 2B9JA 3IDBA 5EOLA 3C4CA 5AV4A 4C4FA 4TTHB 2JD5A 5CAVA 1M17A 4IADA 4XCUA 4FKQA 3QX4A 2ZB1A 3NR9A 4JG7A 5HNBA 4ACHA 4CYJA 4MCVA 5EDPA 4AW2A 1NXKA 5FUTA 4C2VA 2X6EA 4F9CA 3JPVA 4C4GA 4DFBA 2H96A 3CPCA 3MH2A 3QC4A 2Z02A 1VJYA 1REJA 4RJ8A 2VUWA 4YC3A 3F3TA 3LFQA 2F2UA 5AR2A 4NZWB 2JIVA 4IHPA 5IEYA 3BGZA 2WTIA 1H27A 4AOTA 3CE3A 3KXZA 1OIRA 2P0CA 3P79A 4IWDA 2BDWA 3L9PA 2WIHA 3OD6X 3ANQA 1SVEA 5HLPA 1PKDA 2JDTA 5DOSA 4XP3A 3DKGA 3RWPA 2C5OA 2RG6A 2WEIA 3FMHA 3IO7A 4GT4A 5F1ZA 3UBDA 3NVMB 2OFVA 3MFRA 2QQ7A 1E9HA 4G3DA 4EK6A 4DGGA 5EI6A 5GHVA 3NLBA 3TCPA 3F7ZA 1DAWA 2BIKB 3GC9A 3QAME 5KE0A 4OTIA 4QPAA 4ASEA 4YLKA 3SGCA 2FUMA 1P5EA 2OH0E 4GG5A 4EOMA 4MYGA 2GU8A 2R3RA 2W1ZA 3R1YA 4FEVA 4NWMA 3BYVA 2VTTA 4O81A 4LM5A 3V6SA 3QUEA 5CSWA 3C4FA 5BVDA 1PMEA 5AR3A 2C3JA 4FKLA 3KRWA 4ENYA 3OUNB 4PF4A 3P5KA 1DAYA 2XRWA 2OO8X 2GNLA 4L45A 4CKIA 4EONA 2W0JA 2YM6A 4QNAA 4ASDA 3F5XA 5CALA 3VC4A 3C5UA 1F3MC 3Q60A 4L3PA 5LVMA 5BQ0A 3DT1A 3R7EA 1G8SA 2PUIA 4IVBA 4F65A 1ERKA 3PP1A 5CF4A 1M52A 4FSYA 4IFCA 1IEPA 4NEUA 5HIDA 5CEQA 5A3XA 4H1JA 5M51A 4O7ZA 2QOLA 2XBAA 3FMNA 3EH9A 4QYYA 4O21A 4Z55A 2WMXA 3LFDA 3COKA 4NM0A 3TKUA 4NCTC 4FZAB 1BMKA 3UP2A 1ZOEA 3R9HA 3U55A 1GIJA 3DZQA 3OXIA 5DR2A 4QQ5A 5FBOA 4FVPA 2ETMA 2YDIA 3DFCB 5KX8A 1H25A 2R5TA 3PSDA 2XKCA 1Q5KA 3Q9XA 2YM5A 3VUTA 1VYZA 3VVHA 3CLYA 4BCNA 4FEWA 3R04A 5H8GA 3WF8A 2OICA 3BLHA 5KMJA 4YJNA 3VBVA 3PXKA 3I0QA 1A48A 3FKLA 2O2UA 3EQIA 4FODA 2PMLX 3BU3A 3ZFXA 2ERKA 2FVDA 4KS7A 4OTGA 1YVJA 4GU9A 4HOKA 4UMQA 2R0IA 4XEYA 1FBNA 3HRFA 5CEOA 2CCHA 3D5VA 2RG5A 3ZRKA 5CS6A 4I3ZA 3WZDA 2YM8A 1FGKA 4RIWB 1LP4A 4JDIA 1JPAA 4Q9SA 3OZ6A 4GU6A 4BWKA 1Y8GA 1OB3A 2C47A 2ZM3A 3P7AA 3PXRA 4FZFB 4ZSJA 3TZ7A 4KSQA 5CNOA 1YOMA 3COMA 4AT4A 1PXOA 2YITA 3BRBA 2CN8A 4DH8A 3FY0A 2OU7A 4QP2A 1R0PA 3MH0A 3W16A 2OXYA 1W98A 3NWWA 4O0VA 2GCDA 5T68A 4YZCA 5HORA 4OR5A 1XJDA 3CTQA 4KIKB 3ZSHA 3DLZA 2R2PA 3GXLA 3FDNA 3C4XA 2W1IA 4ZXTA 4WG5A 4U44A 2CNVA 1OKZA 3ERKA 3FMKA 3FAAA 3QCXA 4FTJA 4ZY5A 3N9XA 3QKKA 3VBQA 1Q41A 3G5DA 3W8QA 2HK5A 4FZ7A 4WUNA 4F7LA 3NYNA 5ANIA 3RPRA 4MTAA 3HP5A 3GNIB 4RJ7A 3TG1A 4JQEA 5LXMA 3TUDA 4RIWA 3PUPA 4HVSA 5A46A 3NEWA 4FTOA 3ZRMA 3HV7A 3WZEA 4WD5A 3ZDUA 3C13A 5EM7A 2V7OA 1HCLA 4BKYA 2C6IA 3Q2JA 3NNWA 5D7AA 3F2NA 5EOBA 3LCDA 4U3ZA 1R0EA 2I0VA 2W05A 4LV5A 2WMBA 2C5XA 2XKEA 3QQGA 4R3PA 3NRMA 2GSFA 5EH0A 1W84A 4K2RA 4KIKA 3D0EA 2R3GA 2YIRA 3AXWA 3ZDIA 3UNKA 4KB8A 4CKRA 2RF9A 2BZHB 3GFWA 2VWUA 3L1SA 3R2YA 3V8TA 5IUGA 3EHAA 4HPUE 4LG4A 4O96A 3FC2A 2QG5A 4BWPA 4L00A 4EBVA 4OGRA 1SVHA 4ZTLA 4Y5HA 5IA0A 1B38A 1XBAA 2UW7A 4I22A 4O0TA 4DGLC 2IVVA 4BTKA 4D2PA 4R3CA 3KK8A 4M3QA 2CPKE 4FICA 4U5JA 2C4GA 5EK7A 4ZK5A 3TZ8A 4E6DA 3ZM4A 4O27B 2W1HA 3K2LA 5B7VA 5I0BA 4GUBA 5L4QA 5DH3A 3TV6A 3SD0A 2W96B 4PL5A 1Q4LA 4XV2A 5M4UA 5I9UA 4FTRA 4RWIA 3PJ3A 4AGWA 2HW7A 2Z2WA 4ZS0A 3I0OA 3G90X 3E5AA 2GNJA 2HAKA 1G8AA 3HUCA 5CEIA 4C0TA 4XHKB 4C58A 2C3IB 4U9AA 5DN3A 5HE3A 2XNMA 3FXZA 5GZAA 2EXMA 3P0MA 1KE8A 3ALNA 4L68A 4TNDA 2VN9A 5JT2A 4V01A 3LXLA 4HW7A 5IF1A 4O0WA 5CLPA 4BGGA 1YOJA 2X2KA 5IISA 2CGVA 5E9EA 3ENHA 4MD7E 4RC3A 4FEQA 4IX5A 4CCUA 4E4LA 2Z8CA 4ZLYA 5B2MA 4LFIA 4NM7A 3UZTA 2ZV8A 5KZ0A 1UV5A 3BELA 3EJ1A 3EN5A 4D4YA 5AIKA 4ZMFA 3HRBA 4AF3A 5LWNA 2GS6A 4BY9E 3MI9A 3EWHA 2B7AA 4WOVA 4RJ6A 2WEVA 4NSTA 4U6RA 1ZAOA 3C0GA 4FV5A 5CEKA 4CNHA 3U4WA 2C1BA 2OXXA 4MHAA 2QU5A 3VS4A 3QZHA 4NKSA 3V5LA 4C4IA 2XIXA 2J0LA 1YXUA 3RPOA 4ZMEA 4MD9E 2CSNA 3A7IA 1MUOA 3VS0A 4RIOA 4OAVB 3AMYA 1PXMA 2YIQA 3LW0A 4D2VA 3H9RA 1KE5A 3LLTA 1Q61A 3F61A 2ITNA 3MY5A 3MY0A 2CNQA 2VTQA 4FIGA 4D0WA 4RC4A 4DEAA 5K9IA 5GINE 1JLUE 2EU9A 3IKAA 5AMNA 2QO2A 5D41A 3UIMA 4K77A 3VQHA 4R78A 1YXTA 3D5UA 3VW6A 2ZDTA 1Q8ZA 4FKJA 1RQQA 5CVHA 3W2OA 3MH3A 3DS6A 2UVXA 2SRCA 3E64A 4KIPA 1DI8A 1O6YA 5KCVA 1CTPE 3P78A 1M2RA 4GG7A 4XRLA 5DEWA 3L9LA 4MD8E 4FSZA 4IZAA 4IZYA 3QCQA 4AGDA 4G5PA 3DQWA 3I7CA 3FJQE 5F4NA 3GU8A 2YIWA 3LQ5A 1Q8UA 5GIPE 4HNFA 3MH1A 3GC7A 5FRIA 1FMOE 2W1DA 4RBLA 4YO6A 5ANJA 3TZMA 3ROCA 4WRSA 3FPMA 4KBKA 5AP4A 4C33A 2J50A 2P2IA 3FLSA 4LRKA 5E1SA 4X2FA 3Q9ZA 4M84A 4RC2A 4TXCA 5DWRA 4ACGA 4AW1A 5JZJA 4BFMA 2VWBA 3JY0A 5JQ8A 4FF8A 3FV8A 2WB8A 4UX9A 4CG8A 3F6XA 1OIYA 2JDRA 3FLNC 5EKNA 4ZSAA 3E8CA 1OMWA 4AE6A 4GV1A 1KE7A 2RFEA 3LFEA 1PMNA 3HP2A 4LI5A 3K3IA 1H00A 5CEMA 3PE1A 3CGFA 4ZY6A 3D2IA 4C7TA 2OIBA 4AT3A 2Y0AA 1Q3DA 3PPZA 3AD4A 3Q6WA 4YZDA 3NPCA 5E8YA 4G17A 3ZSGA 1DS5A 5KMIA 5IQGA 2WIPA 2OSCA 5EG3A 4L01A 4RFZA 2QR7A 3VJNA 2C5NA 5IEXA 4GYIA 3CCNA 1HCKA 3W18A 3GU4A 1KOAA 2B54A 2B4SB 2JFMA 3HLLA 4QQCA 5C8MA 4CCBA 1J1BA 1J7UA 5IA4A 4E1ZA 5EQYA 5I9WA 3FC1X 3R00A 2YERA 4IANA 3LCOA 1BX6A 1PXNA 4L7FA 5CQWA 2F49A 2LGCA 4H36A 4DT8A 4JDJA 4FYOA 2HY81 3F82A 4GW8A 2CGWA 3WE8A 3Q4TA 4MBLA 5LVLA 1GOLA 3QWKA 5M06A 4P5QA 5JH6A 2PPQA 2W4OA 2RFNA 3VRZA 3EQGA 1T46A 2ZB0A 3FLWA 3M1SA 3ZXTA 4BCPA 2IVUA 4AU8A 3QUDA 1DI9A 2VTRA 3BBTB 4MWHA 3UZRA 5M57A 1OUKA 2VGPA 5M53A 2ZMCA 3R7VA 1Q3WA 3SXRA 2Z7SA 3CIKA 3DJ6A 4DEDA 4QMLA 1URWA 4TZRA 5HG9A 5IQCA 2R3IA 4EH3A 4G3EA 4C59A 4FIEA 5AAEA 4EC9A 5EM6A 2C6TA 3QTSA 4D5KA 2IG7A 4QNYA 3LFCA 2G2HA 4BBMA 4PP7A 4ZJIA 3DGKA 1YDTE 1M14A 4IC8A 4F9WA 2O0UA 4BI2A 3BU5A 4I6QA 5KMKA 1UKHA 2UZVA 4YZ9A 2W1EA 5JFVA 3DFAA 3RNYA 2W4JA 1UA2A 2UV2A 4DCAA 1GY3A 1Q24A 3QHRA 1ZMUA 4FSTA 5DRBA 3ZH8A 4NYEA 4FOCA 4IM2A 4YNEA 1OI9A 5CANA 5IA3A 3BGQA 4O0RA 5A9UA 4FKVA 5IMXA 5EHOA 4CTCA 3KF4A 4BIBA 1R78A 5IG1A 4O6LA 3G9LX 4D1XA 2OLCA 3HV6A 4EH2A 4EOQA 1Q8TA 2R3LA 3A7HA 3IOKA 3L8SA 1ZARA 2XYNA 5HLWA 2R3NA 2VTAA 5JN2A 5FEQA 3ZOSA 1FMKA 4HCTA 3ACKA 4YGAA 2GHGA 3TDVA 4BDJA 3BYMA 3LE6A 3VUIA 4OTDA 3ETAA 4J7BA 4JRNA 3D5XA 4QYEA 3T9IA 4LRMA 3RK9A 1GZNA 5HG5A 1IASA 5LMBA 4AZTA 3IGGA 4O82A 4TYEA 1H01A 3SRVB 1B6CB 3LIJA 3QKMA 4JX3A 5HI2A 4EJ7A 4RX7A 2RFSA 3RINA 5KZIA 4YNOA 4PWNA 5L2SA 5HG7A 4F4PA 2O64A 2HY0A 1Q8YA 5BYYA 2VWXA 3RI1A 3BV3A 4O83A 4O7VA 4BCKA 2GQRA 4V0GB 2VTOA 3UVPA 2VTPA 5M08A 3GI3A 4M67A 2PE1A 3Q3BA 2C69A 1OM1A 3BLRA 3REPA 3R22A 3LCTA 4IZ7A 1J3HA 2C0OA 1U54B 3R21A 4JRVA 3ZO1A 3OW4A 1OL5A 3Q9WA 5DVRA 3SV0A 5AA9A 2X2LA 1YHWA 3KCKA 4UZHA 3P7CA 4O22A 2JDVA 1FPUA 2GTNA 5EW8A 3LXPA 2VAGA 3ENMA 1FOTA 1CSNA 4PUZA 3C1XA 5AP6A 3SRVA 3TNWA 3KULB 3VS2A 4Z16A 3MWUA 2GFSA 3LXNA 2WTKC 3KY2A 3EN6A 3QD2B 3QD4A 4I5MA 1BL6A 2C3KA 4OTQA 4JDKA 5J9ZA 4M0ZA 4WRGA 4D4VA 2G2FA 3QTZA 4FTNA 4AQCA 5E8ZA 4L3LA 3PXQA 3MA6A 4QP8A 2C5VA 4XNEA 4AZWA 5M4IA 3BPRA 2ERZE 3FQEA 2ITPA 1WFCA 4WHZA 5CT7A 3FMDA 5D12A 4OLIA 3V51A 1U54A 4BCJA 1OUYA 5HEZA 4BIDA 2Z7LA 3TV7A 5I4NA 2WQEA 2QHMA 1G5SA 4G9CA 3R9NA 3NUAA 5AWMA 1WCCA 4YP8A 5LMAA 4I4FA 3WI6A 3DK7A 4LRJA 4TW9A 2JC6A 4MXAA 3H3CA 3D9VA 2C0IA 4XJ0A 3BBWA 4PTCA 5LCJA 3KULA 3S3IA 3RK5A 3JVRA 5TOZA 1GIHA 1XWSA 4TKSA 4DHFA 1DM2A 3DNEA 3RKBA 3TACA 4RG0A 1UU3A 2WZJA 3ZXZA 4BICA 3PFQA 2WD1A 2C6DA 4NT4A 2J5EA 4CRLA 2W1FA 3P4KA 4OW8A 4IX4A 3OW3A 2G9XA 2WU6A 5IQIA 3HEGA 5BYLA 3OVVA 4U41A 5AUTA 4X3FC 5LARA 4JVGA 1B39A 1UNGA 3TIYA 4CZTA 4DFNA 2PVJA 4F9BA 4XV9A 4FSNA 3Q4CA 2ZJWA 1WMKA 2E9VA 2J6MA 4FUXA 3NX8A 2J90A 2Y9QA 2YM7A 3NNVA 4N70A 5JFXA 1JVPP 2DUVA 1LEWA 3Q96A 2R7BA 4O91A 4Y73A 1KE9A 4DYMA 3QZIA 4L8MA 4BI0A 4E20A 4GH2A 4TT7A 3KN5A 1H0WA 4ZLZA 5CTPA 2YCQA 5AA8A 4MQ1A 3NUPA 2XIZA 2BRHA 3LFFA 2YDKA 2ZMDA 3QQLA 5FXSA 2ZAZA 3ZRLA 3B2TA 3DQXA 5AP7A 3LCSA 4C35A 4D4SA 3UPZA 3NVKI 4X2KA 5J87A 4IIRA 4GFOA 1PYEA 3EQCA 3KXGA 3QXPA 3MGYA 5HG8A 3R8PA 4RVLA 3GBZA 2BRNA 2PE2A 4OTWA 3PG1A 2QHNA 5CAQA 4OTHA 1H0VA 4P7EA 4G31A 2ITYA 3DV3A 4FIIA 3CS9A 3T3VA 4FUYA 3ZFYA 2A1AB 2J51A 1OBGA 3R7GA 4B0GA 3NIZA 4S33A 3R7OA 1L3RE 2BAJA 4YPDA 2YDJA 3UPXA 5I9YA 5GNKA 4V05A 4LQMA 2EB2A 2HCKA 3DB6A 3H30A 3LZBA 2VD5A 1CKIA 1OZ1A 2BCJA 2V55A 2OXDA 3PY3A 3QA8A 4G3GA 3TJDA 5JMSA 4I41A 2B0QA 3BX5A 3U51A 4RIXA 3KN6A 2CLQA 4JI9A 3TL8A 4DFXE 3GUBA 3JY9A 2G01A 2JBPA 4RWJA 4F9YA 3EFKA 1PKGA 1AD5A 4FV3A 4QTCA 5E90A 1ZOGA 4FBXA 3ZEPA 4D55A 4YBKA 2X8EA 4MF0A 4YJPA 1O9UA 3ZC6A 4BWXA 5LMKA 3C4EA 4HPTE 4K18A 1H1PA 2R3MA 2BROA 2WOUA 5EM8A 2CKQA 2XNPA 3DAEA 4G9RA 3W33A 3WOWA 3BI6A 3WZUA 4GIIA 3R63A 4O0UA 1QPEA 2F7EE 3OUKA 4DFLA 4E26A 5BVKA 1KE6A 1YW2A 2W1CA 3TKHA 4GVJA 2JAMA 4I6FA 1I09A 3QRIA 1FGIA 4ALVA 2WO6A 3AMAA 3NCZA 4XOYA 5DT4A 3R0TA 3TV4A 4O38A 2PVNA 2W5HA 2WQNA 1GZ8A 3ROYA 3SX9A 3O0GA 3OXZA 4XBRA 2E9NA 2XNEA 5AUUA 4EYJA 4YSJA 3VS1A 3KEXA 4L67A 4AS0A 2XIKA 3R30A 4YMJA 5DMZA 4IZ5A 4RQKA 3HZTA 3EYGA 1YXXA 3EKNA 5AV1A 4CV9A 3E8EA 1STCE 4R8QA 3BU6A 3QZGA 5I3OA 2GS2A 4BGHA 5JFSA 5LOHA 4AA5A 3RPSA 5CSXA 4F70A 4HYIA 4CEGA 3ORPA 3K3JA 4OBOA 4FIHA 4D1ZA 4EWQA 4FV7A 3UO4A 3TEIA 2WTKB 1ZXEA 3U87A 2YJSA 3Q53A 4EH5A 2UVZA 5F9EA 3ATTA 1ZMVA 3DZOA 1JSVA 4PRJA 5CF5A 3R9RA 2BILB 3ZS5A 5IQDA 5LVPA 2WFYA 2PVRA 2XBJA 3Q2MA 3OCGA 3PSBA 3VUDA 3GCQA 3PA5A 5AIRA 2BHEA 4FGBA 5G6VA 1YI6A 4BCIA 2H6DA 3HVCA 4O2ZA 4RRVA 3RAKA 1UWHA 3GCVA 2YA9A 2BRGA 2X7GA 4M66A 1LPUA 2X8IA 3BEAA 3NUUA 3R02A 3IW4A 4FT0A 4ACCA 4EK5A 2QOCA 3OOGA 5CQUA 1K9AA 2PZPA 3G33A 4P90A 4F63A 5DI1A 5CAUA 3RNIA 2VTSA 2C30A 1OIQA 3ULIA 2NRUA 3OWLA 1Y6AA 5J8IA 5T3QA 4DH3A 2W06A 5ANKA 4MF1A 5AV3A 4B4LA 4D1SA 5E8VA 3QTWA 4QMVA 4XG6A 4ANSA 5ANEA 4DEEA 2WMAA 5HU3A 3KXHA 1WBVA 3PZHA 3QQFA 2YZLA 4E4MA 5JEBA 1PY5A 4YU2A 4Z3VA 2PUUA 4DEGA 2CNUA 1QCFA 2QOQA 1R3CA 2Z7RA 3KFAA 3QCSA 5CXZA 3TJCA 1QPJA 5L8LA 3QQHA 3Q52A 1H28A 4PPBA 4DCEA 2W5AA 3LFNA 4K1BA 1PHKA 2QOBA 4NK9A 3ZLXA 3ZUVA 5HX8A 4GJ2A 4CFWA 4JT3A 3BEGA 4BHZA 4ANNA 3PVGA 3CR0A 2WPAA 2E9UA 2Y4IB 5C8KA 3PWYA 2XK8A 2YAAA 3DXPA 4RWLA 3FMJA 4Z7HA 4L6QA 3HNGA 4YHJA 2OJGA 3UO6A 3AC4A 4Y83A 4O7SA 1F0QA 4FZDB 3LMIA 4PDPA 4YHFA 2ZVAA 2VTHA 3S0OA 3D15A 4MX9A 3PVWA 3QGYA 5HBEA 3KF7A 4BKZA 2I0EA 4PMPA 5F95A 3EFJA 4AAAA 4QMQA 2FGIA 5IDNA 3SG9A 4O6EA 3DKFA 5D1JA 3UQCA 5KNJA 5E8TA 3PXFA 4P5ZA 3UQFA 1QMZA 1G3NA 4RLLA 2JKQA 4B9DA 3LVPA 4BDDA 4EZ5A 4DA5A 4A7CA 3RHXA 5A4LA 3BYOA 5ICPA 5FWKK 4DG0E 4L9IA 1OITA 2RKUA 4ZEGA 2ONLC 2QLUA 4A9YA 2GMXA 2XS0A 4CXAA 5AX9A 3NYVA 3I4BA 3VBTA 2HZIA 4WIHA 3OY1A 4DTBA 4M69B 5M4FA 3ZC5A 3VO3A 2BKKA 3SDJA 3Q4ZA 5IZFA 3I1AA 2UW8A 4AZEA 3PJ8A 4U0IA 4XG2A 5ANGA 3OP5A 4XYFA 5LWMA 5CXHA 1GZKA 3MB6A 3WZJA 4CFNA 4RIYB 5C26A 3C50A 4HYHA 3NUSA 4NH1A 4OBPA 3SXFA 4AT5A 4ZZMA 3F2AA 5IQBA 4G34A 5IH5A 3KMWA 3P08A 4B99A 5FP5A 4TYIA 4A07A 4DLIA 4FEXA 5HESA 4I0TA 3AC5A 4MKCA 4B8LA 3KA0A 3THBA 4FSMA 3U6HA 4KUJA 2QOKA 2CCIA 4CVAA 4O7NA 1M7NA 4USFA 3UVRA 1YXSA 5TR6A 5JGAA 1U59A 5L2IA 4IMYA 4I92A 3MA3A 4N4SA 3RJCA 4CMUA 2OZAB 4DGNA 5IUHA 3UOKA 5CEPA 4FT9A 3ZONA 4PMMA 5CU2A 3QALE 3R7UA 5IQHA 1X8BA 4M8TA 3R1QA 2CN5A 4Y46A 5BVWA 3Q32A 5KHXA 2JAVA 4M69A 2JLDA 1XHAA 2PSQA 1K3AA 1E1VA 2YIXA 5ANOA 5H9BA 5IDPA 4KD1A 5GIOE 4YUQA 3UOHA 4S34A 4AN3A 3L8PA 3BWJA 4RIYA 4MBJA 5AR8A 4XH6A 2QNJA 2YCSA 3NYOA 5IPJA 4G6NA 1JAMA 3UG2A 5BVFA 1REKA 3IOPA 4JBQA 4X2NA 3U8WA 3UQGA 4A9TA 5I3RA 3FPQA 4FG8A 4O0SA 4GKIA 4R7HA 4BKJA 4UBAA 1NT2A 1H07A 4FNWA 3E63A 3W2PA 4QMZA 2XNGA 1YI4A 2XNNA 4KBCA 4MK0A 2BHHA 2F9GA 3WYXA 2UW3A 2OZAA 1QL6A 2E9OA 2E9PA 2H9VA 3R2BA 2VWWA 3EN9A 2FO0A 3LAUA 3U6IA 3JR1A 3SW4A 4E93A 5A4CA 4FSRA 4L46A 1BUHA 2KTYA 3HKOA 3MJ2A 4K33A 5T6KA 2J5FA 3AT2A 3MY1A 4RLKA 3PJCA 3UYSA 1QPDA 4W9WA 3RTPA 4NW6A 4F08A 5HE0A 3UIBA 4BZOA 2P3GX 3MPMA 1ATPE 3W8LA 2WMTA 4KBAA 3SOCA 3R01A 2X7OA 1UWJA 5H8BA 2QG7A 3TKIA 4FR4A 3OF0A 4J52A 4IXPA 3R8ZA 5KBRA 1FVVA 4EL9A 3F5PA 2J0IA 3R7IA 2J7TA 5HU9A 4IH8A 4CQEA 4IX3A 1J7IA 4BB4A 4KINA 3VS3A 3TI1A 2XP2A 2BTSA 3G0EA 4MEDA 4C4EA 1BL7A 3E8DA 4HGLA 2EVAA 4S31A 3FI2A 3TWJA 4M7IA 1FVTA 4FG9A 5HE2A 1OVEA 2HZ4A 5E1EA 4I4EA 4A4LA 4O7LA 4FTUA 4QT1A 3EMGA 3VWAA 1ZY4A 2NPQA 2IVSA 4C38A 3KK9A 4MVFA 4BCFA 4BGQA 3QRJA 4EOOA 4DGOA 3LKMA 2HENA 4K9YA 3LHJA 1UU9A 3MDYA 3MW1A 2QKRA 1SVGA 3POOA 4HYUA 4HCUA 4KNBA 5HNGA 2BUJA 3TTIA 5JGDA 3PPKA 3PXYA 3SXSA 3IW5A 3P7BA 5FLFA 1PYXA 2HOGA 2CJMA 4FG7A 3M42A 3VBXA 4ZJJA 4E5AX 4EQCA 1BI8A 4E73A 4I24A 2X4ZA 3FSKA 4ZTQA 3RWQA 3D14A 3V5PA 5IMEA 3CEKA 4FTCA 4X2JA 4JBPA 2JKOA 3H0ZA 1H24A 2XM8A 4IWPA 3L8VA 4YJSA 3OBGA 3DA6A 1M2PA 3BHVA 4FKTA 3RCDA 5FEEA 1RW8A 1WZYA 2R3HA 2C5YA 3U9CA 4FT7A 1CKPA 3VQUA 5E8UA 3FYJX 3TNHA 2REIA 4H3BA 4NUSA 5TO8A 4FA2A 3MVLA 4IJPA 1UKIA 3GQIA 4PTEA 3Q4UA 3KRLA 4UXQA 5A6OA 4FL3A 4QMWA 4FTIA 2PUNA 4YJRA 5BX0A 2W17A 4QMYA 3R8LA 4KKHA 2ITQA 3FKNA 3GOPA 3G6GA 3D5WA 1AQ1A 4QMNA 1OBDA 1WBNA 4O0XA 5E8XA 5D10A 2I6LA 4QP9A 2ZDUA 5E8SA 3B2WA 5DYJA 3UGCA 4EHZA 5G1XA 4TY1A 1ZLTA 3CGOA 2W9FB 2JKKA 2XRUA 5AADA 3K5VA 3ZO3A 4LOQA 3OEFX 2J0KA 2W99B 2PWLA 3D7ZA 3I81A 2CKOA 5DRDA 3TNPC 5EW9A 3PTGA 2XIYA 4DITA 3IECA 1KV2A 5J1VA 2ESMA 4ZTRA 2QONA 2PULA 5HO8A 5BPYA 3FZOA 4EOSA 3FZRA 3RPVA 2Y7JA 4C8BA 3EB0A 3GCPA 2PZYA 2RGPA 4TYHB 2OKRA 4RX8A 3WILA 2EXCX 3ORTA 4I0RA 3F69A 4H39A 2C1AA 3E3BX 4FVRA 4S2ZA 3FXXA 4RMZA 3FL5A 1W8CA 2UW6A 3FEGA 4AN9A 3D7TB 3GGFA 4NCTA 3HAMA 2UZDA 4FK3A 2ZYBA 3V8WA 4IE9A 4DEIA 1IA9A 4HGEA 2ETRA 1JNKA 1EH4A 1MP8A 4KKEA 4JJRA 4XG8A 1UVRA 1M7QA 3D83A 3LFAA 4W8DA 2DWBA 3TZ9A 3MN3A 4AUAA 4DINA 3ZMMA 4CQGA 2JIIA 1PRYA 1Z5MA 1Y8YA 5EQPA 2IZRA 4CGAA 4QP6A 5C8NA 3OG7A 2C6MA 2BTRA 3KQ7A 4XG3A 4DEHA 4BDGA 4E4NA 4NTSA 1ZZ2A 2OIQA 3BHTA 3CXWA 3FZ1A 1LR4A 2XK9A 4W4YA 3PIZA 3ORIA 5I5ZA 2AC5A 3KREA 2VGOA 4PX6A 3W10A 4I0SA 3JVSA 4JL9A 1YRPA 2BZIB 3DTCA 3KC3A 4L53A 4TYHA 1U4DA 3VBWA 3GOKA 4J8NA 4LL5A 4RVMA 3GEQA 3L8XA 4IAZA 4O1PA 5BMSA 3FUPA 5M56A 5EYDA 2A4LA 5TT7A 3NIEA 3O71A 3ZBFA 3AC3A 3EQFA 2B9IA 4PPAA 3RBWA 3BIZA 5J1WA 3P9JA 4FNYA 4BYIA 3D7TA 2XK4A 4MXXA 4PDOA 2WTJA 3R6XA 4Y95A 4RFMA 5D9HA 3NUXA 5HIEA 2ZV9A 1KSWA 4TWPA 1Z57A 2XH5A 1H8FA 3EQRA 2J0MB 2X39A 3TIZA 3H0YA 3RAIA 3N4UA 4UB7A 3HL7A 4EZ7A 2F57A 2NRYA 2UZBA 2XB7A 2VWVA 5GJFA 4DBNA 4JAJA 5L2WA 4J97A 3AT4A 5E91A 4RJ4A 4BL1A 4F1OA 4C3RA 4D2WA 1CM8A 4V04A 5HBHA 3NZ0A 1XH9A 1W82A 5J7BA 3LFSA 3QU0A 4K6ZA 3HMPA 2YLEA 3G9NA 4RJ5A 3C5IA 2QR8A 3B8QA 3E87A 4U3YA 4RJ3A 2F7XE 3POZA 1A9UA 1APME 1Y6BA 4WUAA 5CSVA 3N4VA 4UY9A 2HZNA 2Y6OA 4UWCA 3CSVA 1J7LA 4F0FA 3C51A 3PIYA 2ZV7A 3HMMA 2I7QA 4I6HA 4QYFA 3U6JA 3AGMA 3K5UA 4OTPA 5IQAA 4UMRA 4N6YA 1UU8A 2B52A 4CFXA 2QODA 1F5QA 4WSYA 5HVJA 1CDKA 3L9MA 1KUTA 4U42A 2YAKA 2OZOA 4GK2A 4F6SA 1PMUA 2F7ZE 3EZRA 3VS7A 4RWKA 3V3VA 4EHGA 3OT3A 4WT6A 3UTOA 3AQVA 4EKKA 5F94A 5ETAA 4FTTA 3AC8A 4UMPA 5LQFA 2V22A 5B0XA 1WBOA 1MRYA 3DTWA 2YCFA 3P1AA 5DR6A 4G3FA 4EYMA 3WF9A 3MS9A 4BIEA 3PJ2A 4KIQA 3QTUA 1J1CA 4ARKA 4R1YA 3EYHA 4HJOA 2ZOQA 2JITA 3FLYA 4FX3A 3UDBA 4D58A 3ORXA 3SKCA 5DPVA 3VULA 4JX7A 4RX9A 3WE4A 5IA5A 1YI3A 4G1WA 3WIKA 1YDSE 3DKCA 4HGTA 4LV8A 4RZVA 4W4WA 4A4XA 1AGWA 2NNWB 5DE2A 1LUFA 4QMOA 5CI6A 4XLVA 2XYUA 4XUFA 5DNRA 4ASZA 4BDKA 1OPKA 2VX3A 4ZZOA 2PYWA 3QYZA 2OFUA 5AFVA 4USDA 4FKPA 4D2TA 2Q0NA 4KA3A 1YHVA 2R9SA 4AFJA 3UNZA 4QP3A 2PMOX 3OEZA 3R9DA 2QC6A 3ORKA 4FT5A 5DHJA 3F3UA 3VHKA 4G16A 4F09A 2VWYA 4EJNA 2X6DA 4DGMA 3PXZA 5JQ5A 2GHLA 4TN6A 5BUEA 3OT8A 1VYWA 3FHIA 4JOAA 4CFUA 3BYUA 4G6LA 4YZNA 1R39A 4FEUA 3SHEA 4XOZA 2ETKA 4EH7A 5CX9A 5AP3A 2FSMX 2YABA 5AP2A 4JR7A 3GT8A 5HVKA 2WMVA 1OPJA 3LM5A 3RZFA 3EQHA 2BAQA 5H3QA 1IAJA 5LVNA 4ZY4A 2VO0A 5CT0A 4KAOA 3A2CA 3FY2A 4RVKA 5C27A 3NGAA 3R83A 3UIXA 3LM0A 3PSCA 4IWQA 4JQ7A 4Z7GA 4R3RA 5DIAA 4V0GA 3UOLA 2C0TA 2P55A 2VNYA 3QC9A 4FOBA 4G5JA 1GIIA 4CFFA 5C4KA 2GFCA 4LMNA 3LQ8A 3QTRA 4QO9A 4IAFA 2XIRA 3G0FA 4E5BA 2YWPA 1NW1A 4YTFA 3PVBA 3VW8A 4Y8DA 4FV0A 1H1RA 4C3PA 5AP5A 4IAKA 4IB0A 3CQEA 4W8EA 3W32A 2XKFA 4AGUA 5HTIA 3NW5A 4EH8A 3U4UA 4U45A 3ZLSA 1BYGA 4B7TA 3GENA 3AC1A 5E7RA 4KABA 4BDBA 4E6QA 5FP6A 4UYNA 3S4QA 4XV3A 5HKMA 4ERWA 3TM0A 3KRXA 3WARA 3OOMA 2OWBA 4FV9A 4PY1A 4XS2A 3FQHA 4FIFA 3ZUTA 4ZTNA 4B6LA 2OH4A 4GCJA 5EYCA 3WBLA 3AOXA 5HLNA 4AW0A 4HCVA 3ZHPC 4F7NA 4HVDA 4H58A 4JAIA 5DLSA 4YC8A 3PY0A 2R7IA 3UYTA 3P23A 4QTBA 2YZAA 3BKBA 2GPHA 2XK3A 2GQGA 4QYGA 2IN6A 2OGVA 3QLGA 4EH6A 5FTGA 1YWNA 4X2GA 4G6OA 4LMUA 3A99A 5FGKA 3VS6A 4WNMA 2YACA 1JSTA 5AM6A 4RVTA 3BCEA 4C4HA 2QOOA 4QP4A 2YM4A 3AMBA 4PMTA 2YN8A 4TL0A 3V8SA 5K4JA 1XKKA 3KMMA 5A14A 2V5QA 3EQDA 5KMNA 1H1QA 4K8AA 2VNWA 4H1MA 2C6EA 3OHTA 3SW7A 4KKGA 4ZSEA 3IONA 2VWZA 1XH6A 4C3FA 1L8TA 4GIHA 1OL1A 2IJMA 2OI4X 2WMQA 4QMSA 2Q0BA 4WO5A 3H9FA 3ORZA 4IBMA 4RA4A 3COHA 4U40A 3FLZA 4FSWA 4FSQA 4XP0A 5AUZA 4PNKA 1XBBA 4FKUA 3KMUA 4MBIA 3DBFA 2OF2A 1P14A 4A4OA 4HZSA 1OL6A 2Y6MA 5I9VA 4XG9A 5CAPA 2JKMA 4M13A 5C03A 2G2IA 5TKDA 3NUYA 4BYJA 4O84A 5CI7A 4AA4A 2FSTX 4NFNA 4FTMA 4FV4A 4GYGA 3EZVA 4J95A 3QZFA 3ZO2A 2VTMA 4JQ8A 2XZSA 2GNIA 4F7JA 1WVXA 3FI3A 3D4QA 4OUCA 2R3FA 1Y91A 4JIAA 4TPTA 1OKYA 3TUBA 3PA3A 4BCGA 2RSVA 4E6AA 2A19B 4YPSA 3C9WA 1FVRA 3KXNA 2VTIA 4QQTA 2BKZA 2VTNA 3H4JA 3OWJA 4RQVA 4OTRA 3DBQA 1W83A 2WMRA 4D2RA 2FSLX 4I93A 4LUDA 2VO7A 4N57A 3LMGA 3EL8A 3S00A 4H3PA 3A7GA 3IS5A 3E8NA 4NL0A 3ORMA 4I6BA 3QTIA 4JXFA 2B53A 2WTCA 2I0YA 1RDQE 3SVVA 1OPLA 3F3WA 4ACDA 2B9FA 5CENA 1ZYCA 3F66A 4DEBA 2VX0A 3Q5IA 3UIUA 5C4LA 3JXWA 4JLCA 2AC3A 2WQMA 4JR3A 4Z9LA 3GQLA 5TF9A 4DN5A 3F5GA 1E1XA 3NW6A 4X6QC 5HCZA 2ITZA 5BYZA 4I20A 3OXTA 4F6WA 2UZTA 3HMNA 3ID6C 4CMTA 4IFGA 2J4ZA 2WHBA 4C37A 4FKOA 5AJQA 4EOIA 3NSZA 4F6UA 3CTHA 2V0DA 4ACMA 2QCSA 2C3LA 2E2BA 2IZSA 3VNTA 4AA0A 4AXAA 2UZLA 3DAKA 2PVFA 2PMIA 4YURA 4O7RA 4K0YA 4MNEB 4EK8A 4K11A 1WBPA 2C6OA 2WTWA 4A9SA 5FDPA 1PJKA 5HBJA 1SZMA 5DGZA 5FG8A 4L42A 1MRUA 1OL7A 3A8WA 3DOGA 4EH4A 4ALUA 3F3ZA 3UNJA 2JBOA 2EUFB 5FD2A 3PLSA 3AGLA 3TN8A 1ZYDA 4OT5A 4EWHA 4U43A 4TWNA 3DJ5A 3GU6A 2CGUA 4BTMA 3F7WA 3KRJA 1PXPA 3G15A 4Q2AA 2QOIA 3CQWA 4CV8A 5C9CA 2GHMA 4BDFA 4IQ6A 3DDQA 2XEZA 2XNBA 4IWOA 2CDZA 5CF6A 5DEYA 4AX8A 2NO3A 5EW3A 4F99A 2BZKB 4XG7A 4BCHA 4J98A 3R73A 3KB7A 1OL2A 2AUHA 3Q9YA 4ZTSA 3BE9A 1XBCA 4M14A 5AV0A 1QPCA 2IO6A 4WNKA 4YLLA 5AUWA 4D5HA 4F1MA 4J8MA 3FMEA 4CTBA 4CYIA 4JIKA 2RL5A 4MNEA 1ZYJA 2VX1A 2W4KA 3O2MA 1RE8A 3OWPA 5AUVA 4YTHA 2BRMA 4LOOA 4F64A 4FT3A 4UXLA 2OJFE 2C68A 4ERKA 3T8OA 2I0HA 3PDTA 3OBJA 3BLQA 3FZTA 1S9JA 3ACJA 4ITIA 4KIOA 3CTJA 3LJ2A 3U9NA 4AZFA 4ITJA 3BE2A 1JKTA 1S9IA 2FB8A 3CD8A 2EWAA 3EOCA 4RPVA 5EHYA 5EFQA 3Q6UA 3I79A 4LYNA 4DG3E 3HYHA 3O17A 4NM3A 4QMPA 3MSSA 2DYLA 2WKMA 3C0HA 3GC8A 2HW6A 3HRCA 4W4VA 5HD7A 3ZUUA 4ASXA 5HZNA 3QCYA 4DH7A 3ZEWA 3PVUA 5FEDA 4IVAA 2QD9A 3I6WA 4C4JA 4LGDA 3A7FA 4QD6A 5BMMA 5IKWA 4EUUA 5A4TA 4R5YA 4X3FB 2UVYA 3KVWA 3NNUA 4CMOA 3QKLA 4I21A 3RM7A 3S95A 2JIUA 4QRCA 3FQSA 5J5TA 1YOLA 2WXVA 3R8UA 4UWBA 3IG7A 3QTQA 4ONAA 3II5A 4LOPA 3EKKA 2H8HA 4I94A 1K2PA 2XMYA 3NYXA 5IH6A 4U7ZA 2ITVA 1H08A 1SM2A 3MVHA 4QPMA 1IA8A 3NW7A 1GNGA 3TXOA 5LJJA 4I5PA 4D4RA 1OKVA 2WTVA 3LXKA 1JKLA 3QRUA 2O3PA 2G15A 3KRRA 1JKSA 1O6KA 3HX4A 2VO6A 4FYNA 4IAYA 2PVMA 2O65A 3F9NA 4JBOA 4O7YA 4DE4A 3UP7A 1TQPA 1Q99A 5CZIA 4BF2A 2PZIA 5M4CA 3EL7A 2PVYA 2JDSA 3A62A 1H4LA 3OMVA 1IRKA 4EOLA 4PV0A 5KHWA 5E92A 2FH9A 4N0SA 4I1ZA 5AV2A 1MQBA 2VRXA 4UEUA 4YBJA 4WBBB 4ZOGA 2R4BA 4M0YA 3DBCA 3NS9A 4X3FA 4ZP5A 4F7SA 3MIYA 4GL9A 3LLAA 3I5ZA 3OWKA 1P4FA 3DDPA 4RGJA 3LFBA 4L44A 1ZY5A 1U5QA 1LEZA 5CY3A 1NY3A 3LQ3A 3V5JA 4BN1A 4C2WA 4PDYA 4JG6A 4FL2A 4X6RA 4IC7A 3DXNA 2HZ0A 3TNQB 2W7XA 4GVAA 2XNOA 2R3JA 5K5NA 1CMKE 3ZLYA 3QWJA 2CKEA 2BMCA 4XX9A 5KMOA 3AD6A 2IVTA 2ITXA 2PZRA 5AEPA 2OIDA 4YC6A 4PDSA 3DY7A 4C34A 3DK3A 4D2SA 3OFMA 3QGWA 3HMOA 3PLAE 5EYMA 2YHVA 1JKKA 5KMMA 3CY2A 1JSUA 4DAWA 3UOJA 3QRKA 2ITTA 3CKWA 5JK3A 3I6UA 3DXQA 1V0BA 2H34A 4R5SA 4LL0A 4U81A 3IGOA 4NW5A 4UMUA 4DTKA 4G3CA 2IZTA 5IU2A 3L9NA 3CC6A 3IDPA 4YJQA 3QXOA 4MAOA 4QOXA 4BDCA 3KGAA 3VRYA 3O96A 3V6RA 2W1GA 3CP9A 4TRLA 3OROA 4EEVA 3UMWA 2JFLA 5CSPA 5CU6A 2BAKA 2PVKA 4LGGA 3SQQA 4ANMA 2XCKA 4L7SA 3CJGA 3CY3A 4Y85A 3ALOA 2GTMA 3G51A 3OTUA 3BV2A 4QYHA 3SLSA 2YEXA 4PMSA 3S2PA 3VUKA 5CU0A 3NCGA 3O8UA 3QQJA 5JRSA 4ANLA 2X2MA 3GB2A 5IQFA 1V0PA 4APCA 3D94A 5ANDA 3I5NA 2BFYA 2ITOA 3GU5A 3B8RA 3R1SA 4XV1A 3GFEA 3UC3A 3QUPA 5IH4A 4QP1A 1VZOA 5M55A 2HIWA 3V5TA 3W2QA 4BI1A 5J9LA 1MRVA 3MTLA 2WOTA 5AM7A 1JOWB 4BDEA 2P4IA 4BCQA 1SYKA 3FYKX 4FZ6A 4EOKA 2X1NA 5GZ9A 3QL8A 4FTKA 4BR3A 3C7QA 2X9EA 2RIOA 3E7VA 3OCBA 3D2KA 4PP9A 4RSSA 1V1KA 5KKRC 4X0MA 4O1OA 3R8MA 4AW5A 1ZRZA 3PZEA 4YLJA 2UZUE 5IUIA 1RJBA 5BUJA 5CAOA 3KXMA 2IWIA 4OTFA 5ACBC 2R3PA 4FTQA 4XMOA 3TDWA 2CLXA 5L6OA 5AX3A 4RZWA 1W0XC 4R1VA 3FHRA 5L8JA 4A9RA 1FQ1B 2UZWE 4FKWA 4GFGA 2A2AA 4BZNA 3FE3A 4ZIMA 2BFXA 3M11A 2J0JA 3OS3A 3R7YA 3FI8A 3MFSA 4EZ3A 4C62A 1GZOA 4FI1A 4U97A 5DFPA 1KV1A 2BALA 3FMMA 3PJ1A 4MWIA 4L43A 4QTAA 4AGCA 3FSFA 5AR5A 4YO4A 5M09A 4YJVA 3A7JA 3BHHA 3HV4A 3K54A 3RVGA 4BBFA 4HVGA 3ORLA 2W5BA 3RM6A 2X81A 2PVHA 4X3JA 5FTQA 3VAPA 3A4PA 2ITWA 2P2HA 4RX5A 5HE1A 1IAHA 4KSPA 4MXCA 3F3VA 4ZS4A 4TWOA 3FL4A 5CASA 3VIDA 4QQJA 3QFVA 2CMWA 3BHYA 2R3OA 5F20A 2R3KA 3BHUA 4BTFA 4Q5EA 2R3QA 1WBWA 5ETCA 4FTAA 3NDMA 5EKOA 3E62A 4AG8A 4ANQA 5AR4A 4BDHA 5ACKA 4E3CA 5A6NA 4OAUC 4X7QA 3RMFA 4WA9A 2PVLA 4D28A 3PYYA 4NIFB 3IQ7A 2O8YA 4GRBA 5DA3A 4IM0A 4BRXA 3DU8A 3QYWA 5LCKA 3QRTA 3GCUA 2VTJA 2GNHA 1TVOA 3C4ZA 1GJOA 4BZDA 4EBWA 1XH8A 3PG3A 5ETIA 4FNZA 3V5WA 4NU1A 4MH7A 3VF9A 2XM9A 4S32A 3ZTXA 4PQNA 4ZJVA 4HYSA 4USEA 5FM2A 5HCYA 1ND4A 2XVDA 3C4WA 4R6VA 4EOJA 3ZO4A 3HV3A 5D7VA 4P2KA 2B1PA 1Q62A 4F1TA 1ZOHA 5GZ8A 4CRSA 4L52A 4AOJA 4EK4A 3I7BA 4APPA 2WQBA 5FXQA 3CD3A 2IW6A 3HMIA 3R28A 4FV8A 3QTXA 4M68A 3GCSA 1MQ4A 5BNJA 3FKOA 2FSOX 2BVAA 2OG8A 3NAYA 3RZBA 4AE9A 3MTFA 3BGPA 4XP2A 4FKRA 2WMWA 3LPBA 4QPSA 3KL8A 3SAYA 5EDRA 5AAGA 3FZSA 2GDOA 3H9OA 4NIFA 1XQZA 1XH5A 4YSMA 2F4JA 3ANRA 2X7FA 4W4XA 2EB3A 3WIGA 3FXWA 4UV0A 3A61A 2BDJA 3N51A 4R7IA 1WVYA 2A27A 4L3JA 4CT2A 5CSHA 3RAWA 3IK3A 2ONLA 1JBPE 3M2WA 4KRCA 4PL4A 3ZFMA 4W9XA 1UU7A 2VU3A 5D11A 5IEVA 3HAVA 4R7BA 5KMLA 4FC0A 2HELA 5AUYA 4ZLOA 5IA2A 4I5HA 3UC4A 5EQEA 4IM3A 5FBNC 2DS1A 4DFUA 3ZSIA 1PF8A 4AWIA 1O6LA 4ZAUA 2VWIA 2WTDA 2BPMA 4CFMA 4FL1A 4EORA 4DG2E 3R71A 5CF8A 1VR2A 5FTOA 3PPJA 2OW3A 1NA7A 3MPAA 4FMQA 4AZSA 4ZZNA 3QF9A 4AFEA 1WBTA 2JDOA 4XBUA 4XRJA 2WAJA 5L3AA 3IDCA 2R64A 4JNWA 5GJGA 2ZM1A 3FZPA 3MBLA 3P86A 3ELJA 3BQRA 2GNGA 3BZ3A 2QOHA 1BKXA 2ZV2A 4II5A 5J79A 3O8TA 4MQ2A 4QP7A 3GU7A 2FYSA 5L2QA 4PNIA 2O63A 1PXIA 5HHWA 4OT6A 4J53A 4Q5HA 4BVUA 5HD4A 3RP9A 4B8MA 3RHKA 4O7TA 1JWHA 4C36A 2QO9A 2X8DA 1UNLA 4RA5A 3MPTA 4FV2A 1IR3A 2CGXA 4NTTA 4DFYA 5HO7A 2XCHA 4Y5QA 3UG1A 1YXVA 4IB5A 3DBEA 1WAKA 2V7AA 3AD5A 5KKRB 4GK3A 5HICA 4C57A 4Q9ZA 1SNXA 2PY3A 3HUBA 3A8XA 4C02A 3FBVA 4UYAA 2QKWB 2PK9A 2OJ9A 4GT5A 5HTCA 3MVMA 3ZZWA 3ULZA 4WNPA 3CBLA 3DLSA 4ZTHA 4CZYB 4J96A 2CKPA 1IG1A 4MXZA 3DNDA 2PU8A 4EC8A 3EFLA 2HWPA 4WSQA 5HNIX 4FKIA 3UE4A 4TYGA 4FSUA 4ITHA 3PIXA 4WBOA 3W2SA 3FI4A 3FLQA 2YISA 2OBJA 3HDMA 3ITZA 3EN4A 3KKVA 1NVRA 3E3PA 3COIA 3CPBA 4GSBA 3MFTA 1YKRA 5K0XA 4X21A 3N4TA 5AUXA 4IB3A 3RK7A 3O7LB 5HX6A 5I9ZA 3CQUA 5JFWA 2UUEA 4J99A 4IVCA 3FWQA 4HVHA 5B2LA 3PRIA 4QMXA 2ACXA 4HZRA 4IDVA 4KWPA 2HWOA 4S30A 3CJFA 2B55A 4H05A 3F2RA 2ITUA 1KOBA 2PTKA 2XF0A 3HV5A 4TYJA 2R0UA 4FV6A 2I1MA 3RALA 1TQMA 4R77A 3O8PA 3QBNA 5M07A 3PWDA 3VUHA 5CU4A 2WELA 1U5RA 2FA2A 5CWZA 3F5UA 3Q5ZA 5BVEA 1BI7A 2Y8OA 5CU3A 3ZCLA 2HYYA 5TE0A 4BDIA 4DH1A 5LMKC 4ZSGA 1PXJA 3ODYX 5IA1A 2HXQA 5L2TA 2JEDA 3AT3A 4O0YA
chains in the Genus database with same CATH superfamily
2X4FA 2BR1A 3DBDA 1ZZLA 3E93A 4BHNA 3O7LD 4MNFA 5ITAA 5HGIA 5JGBA 2QI8A 3NNXA 2YJRA 4IACA 3A60A 3G6HA 3W2RA 4DC2A 3CKXA 5J7HA 5FM3A 5FXRA 1YQJA 4FE2A 3WF7A 4O7WA 4WG3A 4RFYA 3TUCA 1YWRA 3PE2A 5AP1A 3UVQA 3QQKA 2C6KA 3KVXA 3BYSA 4WNOA 3IW6A 3QD0A 4ENXA 4FKSA 1Y57A 4O86A 3DJ7A 5DR9A 1TQIA 4JS8A 5CVFA 4KS8A 1SNUA 3VJOA 4D9UA 2GNFA 4UZDA 2JGZA 3JYAA 3C0IA 3MFUA 4YJOA 5KUPA 4IB1A 4DT9A 2PZ5A 5EYKA 3EIDA 4GT3A 1U46A 1OGUA 2LAVA 2UZNA 2XJ2A 4NJDA 3UODA 2VZ6A 4BTJA 5I9XA 3AG9A 3JUHA 3IPHA 3DCVA 5ETFA 1Q97A 3VS5A 2YFXA 4F0GA 2J2IB 4CD0A 1PXKA 3TNIA 2XK7A 2UZOA 3T3UA 5EI2A 5KBQA 4D0XA 4ORKA 2GQSA 2UW5A 3KCFA 2BZJA 2UW0A 4JG8A 4CLIA 2Z7QA 4IVDA 4E7WA 2QO7A 5DT3A 4BCMA 4EQUA 3ORNA 5KO1A 4EUTA 1J91A 3LJ0A 3ZLWA 3MESA 3NUNA 5HVYA 4U79A 3GP0A 3RPYA 1NVSA 4E5WA 1M2QA 3IW8A 4MXYA 5DBXA 4ANBA 5H8EA 5BVOA 1PW2A 4DTAA 3HA6A 4AN2A 3U54A 5J5SA 4EHEA 4GEOA 1ZYLA 1XO2B 2C6LA 2IW9A 4TWCA 4DHIB 4QMUA 2Z60A 3LCKA 3SOAA 3V04A 2YWVA 4DHZA 3W55A 4EH9A 3RGFA 3QHWA 3SG8A 5L8KA 5AP0A 4GK4A 4UWYA 2XJ1A 5HTBA 1PXLA 4ID7A 5EI8A 4UALA 3DAJA 2HXLA 4NJ3A 3QQUA 4CSVA 4QMMA 2YIYA 3LMHA 1TKIA 3BWFA 5B2KA 5IQEA 4CFVA 2QLQA 2BDFA 1GAGA 5FQDC 4DLJA 2VTLA 4GKHA 5LVOA 4XG4A 2PE0A 5M44A 4KRDA 2PHKA 3E7OA 2NP8A 4EHVA 3MB7A 3QX2A 1Z9XA 2AYPA 4EI4A 3ZM9A 4CG9A 3PP0A 3F88A 3UJGA 4PPCA 1I44A 3W2CA 4A06A 1OECA 4J1RA 5HQ0A 5HOAA 4I5CA 2BRBA 2UW4A 4PL3A 4FVQA 4F0IA 3KU2A 4IX6A 4O2PA 3R1NA 3MVJA 2F2CB 4YTIA 5A54A 4RT7A 5JSMA 1UNHA 1H1WA 2EXEA 2O5KA 3MJ1A 3ODZX 2QURA 5CVGA 4EQMA 2PUPA 4HNIA 3TT0A 4HVIA 2G1TA 5FDXA 4HGSA 4AACA 5K5XA 3NAXA 3TTJA 4FIJA 4NM5A 5GJDA 5A4EA 3WF6A 1YDRE 4CLJA 5HO6A 4DBXA 3PY1A 4J71A 3ZYAA 2XALA 3FMLA 2VO3A 2WMSA 1SMHA 4JDHA 5DT0A 3SA0A 5CNNA 2Y4IC 3HDNA 2WU7A 3T9TA 4IDTA 2XK6A 2KULA 1V0OA 4H3QA 1P4OA 5L6PA 1ZWSA 1NVQA 3DKOA 2YLFA 3V5QA 3GVUA 3O23A 4I23A 3DK6A 4LGHA 3G2FA 3UDSA 4YHTA 3NMUF 1FINA 2UZEA 2XEYA 1R1WA 1WVWA 3BL7A 1ZMWA 4RIXB 5K4IA 3UO5A 4IW0A 3PRFA 1YHSA 3V01A 3H10A 4D9TA 2WMUA 2J9MA 1KWPA 1XH4A 3QA0A 4QMTA 5AAFA 2OJIA 2DQ7X 2GS7A 2YCRA 2UW9A 3HA8A 4FKGA 4FGRA 2IZUA 5DG5A 3MYGA 4E8AA 4AOIA 4UMTA 4YTCA 3EFWA 5HIBA 4QTDA 3VN9A 4CKJA 4QTEA 2W9ZB 4IAIA 4BDAA 2PL0A 2QVSE 3DPKA 4IJ9A 4DFZE 3R9OA 1URCA 2I40A 4OBQA 3W1FA 5C01A 1BLXA 4N6ZA 4U80A 5EM5A 4GJ3A 4UN0C 4WKQA 4NFMA 4G2FA 2P33A 1JQHA 1YWVA 3ZU7A 2XA4A 4AZVA 1H26A 4C61A 4YR8A 5C1QB 2XUUA 5K0KA 1ZYSA 4PTGA 3OC1A 5CZHA 1Q8WA 5JZNA 3PA4A 2OJJA 1HOWA 4FK6A 5EDQA 4ALWA 4FNXA 4YJTA 2IW8A 3DB8A 4P4CA 2QOFA 3HGKA 2XKDA 5E4HA 4IEBA 4O4EA 2VV9A 3O50A 4LUEA 5CYIA 5K3YA 1T45A 3ZZEA 4JBVA 3RAHA 2X0QA 3OCTA 4Y72A 4M15A 2RFDA 4NKAA 4WG4A 3RCJA 4E4XA 5J95A 4EK3A 3WYYA 3VUGA 4DH5A 2WGJA 3R8VA 3JS2A 2YM3A 4M97A 2X0GA 4ANOA 3OCSA 3UZPA 2XJ0A 5EHLA 3AKJA 4BBEA 3HECA 3QLFA 3KXXA 2ZM4A 1PMVA 3MV5A 2B9HA 3LOKA 4GFMA 2OF4A 4O4DA 1H1SA 2AQXA 2IPXA 3MIAA 2WQOA 2WNTA 4CT1A 3EN7A 2PMNX 3ET7A 1XR1A 5J9YA 1OIUA 3E92A 4GUEA 3EQPA 3I60A 5HCXA 1VEBA 2QU6A 5JKGA 4BC6A 4YZBA 5AR7A 3A4OX 3BQCA 2V62A 4MXOA 2A0CX 4YZMA 2Y4PA 4TNBA 3VHEA 4EKLA 3S1HA 3ATSA 1P2AA 5A4QA 5L6WL 2OK1A 3EQBA 3Q04A 4XLIA 4E6CA 3WF5A 4BCOA 3QD3A 1W7HA 3E88A 2Q83A 4CZUA 3VBYA 4A9UA 5BVNA 1WBSA 1CKJA 4AP7A 3VUMA 2BIYA 4ZTMA 3UMXA 4FV1A 5JRQA 3UDZA 2CHLA 3AC2A 3OTVA 3OY3A 3IW7A 4M12A 3LJ1A 4FTLA 4F9AA 4GS6A 4GMYA 2X9FA 5E8WA 5H2UA 3SC1A 3WZKA 3VF8A 3ZBXA 1A06A 1XH7A 4U8ZA 4IAAA 4YJUA 4ZSLA 4EOPA 5BUIA 3O51A 4DF3A 3GC0A 1OKWA 2B9JA 3IDBA 5EOLA 3C4CA 5AV4A 4C4FA 4TTHB 2JD5A 5CAVA 1M17A 4IADA 4XCUA 4FKQA 3QX4A 2ZB1A 3NR9A 4JG7A 5HNBA 4ACHA 4CYJA 4MCVA 5EDPA 4AW2A 1NXKA 5FUTA 4C2VA 2X6EA 4F9CA 3JPVA 4C4GA 4DFBA 2H96A 3CPCA 3MH2A 3QC4A 2Z02A 1VJYA 1REJA 4RJ8A 2VUWA 4YC3A 3F3TA 3LFQA 2F2UA 5AR2A 4NZWB 2JIVA 4IHPA 5IEYA 3BGZA 2WTIA 1H27A 4AOTA 3CE3A 3KXZA 1OIRA 2P0CA 3P79A 4IWDA 2BDWA 3L9PA 2WIHA 3OD6X 3ANQA 1SVEA 5HLPA 1PKDA 2JDTA 5DOSA 4XP3A 3DKGA 3RWPA 2C5OA 2RG6A 2WEIA 3FMHA 3IO7A 4GT4A 5F1ZA 3UBDA 3NVMB 2OFVA 3MFRA 2QQ7A 1E9HA 4G3DA 4EK6A 4DGGA 5EI6A 5GHVA 3NLBA 3TCPA 3F7ZA 1DAWA 2BIKB 3GC9A 3QAME 5KE0A 4OTIA 4QPAA 4ASEA 4YLKA 3SGCA 2FUMA 1P5EA 2OH0E 4GG5A 4EOMA 4MYGA 2GU8A 2R3RA 2W1ZA 3R1YA 4FEVA 4NWMA 3BYVA 2VTTA 4O81A 4LM5A 3V6SA 3QUEA 5CSWA 3C4FA 5BVDA 1PMEA 5AR3A 2C3JA 4FKLA 3KRWA 4ENYA 3OUNB 4PF4A 3P5KA 1DAYA 2XRWA 2OO8X 2GNLA 4L45A 4CKIA 4EONA 2W0JA 2YM6A 4QNAA 4ASDA 3F5XA 5CALA 3VC4A 3C5UA 1F3MC 3Q60A 4L3PA 5LVMA 5BQ0A 3DT1A 3R7EA 1G8SA 2PUIA 4IVBA 4F65A 1ERKA 3PP1A 5CF4A 1M52A 4FSYA 4IFCA 1IEPA 4NEUA 5HIDA 5CEQA 5A3XA 4H1JA 5M51A 4O7ZA 2QOLA 2XBAA 3FMNA 3EH9A 4QYYA 4O21A 4Z55A 2WMXA 3LFDA 3COKA 4NM0A 3TKUA 4NCTC 1XMMA 4FZAB 1BMKA 3UP2A 1ZOEA 3R9HA 3U55A 1GIJA 3DZQA 3OXIA 5DR2A 4QQ5A 5FBOA 4FVPA 2ETMA 2YDIA 3DFCB 5KX8A 1H25A 2R5TA 3PSDA 2XKCA 1Q5KA 3Q9XA 2YM5A 3VUTA 1VYZA 3VVHA 3CLYA 4BCNA 4FEWA 4FJVA 3R04A 5H8GA 3WF8A 2OICA 3BLHA 5KMJA 4YJNA 3VBVA 3PXKA 3I0QA 1A48A 3FKLA 2O2UA 3EQIA 4FODA 3W0QA 2PMLX 3BU3A 3ZFXA 2ERKA 2FVDA 4KS7A 4OTGA 1YVJA 4GU9A 4HOKA 4UMQA 2R0IA 4XEYA 1FBNA 3HRFA 5CEOA 2CCHA 3D5VA 2RG5A 3ZRKA 5CS6A 4I3ZA 3WZDA 2YM8A 1FGKA 4RIWB 1LP4A 4JDIA 1JPAA 4Q9SA 3OZ6A 4GU6A 4BWKA 1Y8GA 1OB3A 2C47A 2ZM3A 3P7AA 3PXRA 4FZFB 4ZSJA 3TZ7A 4KSQA 5CNOA 1YOMA 3COMA 4AT4A 1PXOA 2YITA 3BRBA 2CN8A 4DH8A 3FY0A 2OU7A 4QP2A 1R0PA 3MH0A 3W16A 2OXYA 1W98A 3NWWA 4O0VA 2GCDA 5T68A 4YZCA 5HORA 4OR5A 1XJDA 3CTQA 4KIKB 3ZSHA 3DLZA 2R2PA 3GXLA 3FDNA 3C4XA 2W1IA 4ZXTA 4WG5A 4U44A 2CNVA 1OKZA 3ERKA 3FMKA 3FAAA 3QCXA 4FTJA 4ZY5A 3N9XA 3QKKA 3VBQA 1Q41A 3G5DA 3W8QA 2HK5A 4FZ7A 4WUNA 4F7LA 3NYNA 5ANIA 3RPRA 4MTAA 3HP5A 3GNIB 4RJ7A 3TG1A 4JQEA 5LXMA 3TUDA 4RIWA 3PUPA 4HVSA 5A46A 3NEWA 4FTOA 3ZRMA 3HV7A 3WZEA 4WD5A 3ZDUA 3C13A 5EM7A 2V7OA 1HCLA 4BKYA 2C6IA 3Q2JA 3NNWA 5D7AA 3F2NA 5EOBA 3LCDA 4U3ZA 3NFGB 1R0EA 2I0VA 2W05A 4LV5A 4AXEA 2WMBA 2C5XA 2XKEA 3QQGA 4R3PA 3NRMA 2GSFA 5EH0A 1W84A 4K2RA 4KIKA 3D0EA 2R3GA 2YIRA 3AXWA 3ZDIA 3UNKA 4KB8A 4CKRA 2RF9A 2BZHB 3GFWA 2VWUA 3L1SA 3R2YA 3V8TA 5IUGA 3EHAA 4HPUE 4LG4A 4O96A 3FC2A 2QG5A 4BWPA 4L00A 4EBVA 4OGRA 1SVHA 4ZTLA 4Y5HA 5IA0A 1B38A 1XBAA 2UW7A 4I22A 4O0TA 4DGLC 2IVVA 4BTKA 4D2PA 4R3CA 3KK8A 4M3QA 2CPKE 4FICA 4U5JA 2C4GA 5EK7A 4ZK5A 3TZ8A 4E6DA 3ZM4A 4O27B 2W1HA 3K2LA 5B7VA 5I0BA 4GUBA 5L4QA 5DH3A 3TV6A 3SD0A 2W96B 4PL5A 1Q4LA 4XV2A 5M4UA 4O4BB 5I9UA 4FTRA 4RWIA 3PJ3A 4AGWA 2HW7A 2Z2WA 4ZS0A 2AEGA 3I0OA 3G90X 3E5AA 1XMLA 2GNJA 2HAKA 1G8AA 3HUCA 5CEIA 4C0TA 4XHKB 4C58A 2C3IB 4U9AA 5DN3A 5HE3A 2XNMA 3FXZA 5GZAA 2EXMA 3P0MA 1KE8A 3ALNA 4L68A 4TNDA 2VN9A 5JT2A 4V01A 3LXLA 4HW7A 5IF1A 4O0WA 5CLPA 4BGGA 1YOJA 2X2KA 5IISA 2CGVA 5E9EA 3ENHA 4MD7E 4RC3A 4FEQA 4IX5A 4CCUA 4E4LA 2Z8CA 4ZLYA 5B2MA 4LFIA 4NM7A 3UZTA 2ZV8A 5KZ0A 1UV5A 3BELA 3EJ1A 3EN5A 4D4YA 3W0SA 5AIKA 4ZMFA 3HRBA 4AF3A 5LWNA 2GS6A 4BY9E 3MI9A 3EWHA 2B7AA 2XARA 4WOVA 4RJ6A 2WEVA 4NSTA 4U6RA 1ZAOA 3C0GA 4FV5A 5CEKA 4CNHA 3U4WA 2C1BA 2OXXA 4MHAA 2QU5A 3VS4A 3QZHA 4NKSA 3V5LA 4C4IA 3W0PA 2XIXA 2J0LA 1YXUA 3RPOA 4ZMEA 4MD9E 2CSNA 3A7IA 1MUOA 3VS0A 4RIOA 4OAVB 3AMYA 1PXMA 2YIQA 3LW0A 4D2VA 3H9RA 1KE5A 3LLTA 1Q61A 3F61A 2ITNA 3MY5A 3MY0A 2CNQA 2VTQA 4FIGA 4D0WA 4RC4A 4DEAA 5K9IA 5GINE 4DDGA 1JLUE 2EU9A 3IKAA 5AMNA 2QO2A 5D41A 3UIMA 4K77A 3VQHA 4R78A 1YXTA 3D5UA 3VW6A 2ZDTA 1Q8ZA 4FKJA 1RQQA 5CVHA 3W2OA 3BLAA 3MH3A 3DS6A 2UVXA 2SRCA 3PFYA 3E64A 4KIPA 1DI8A 1O6YA 5KCVA 1CTPE 3P78A 1M2RA 4GG7A 4XRLA 5DEWA 3L9LA 4MD8E 4FSZA 4IZAA 4IZYA 3QCQA 4AGDA 4G5PA 3DQWA 3I7CA 3FJQE 5F4NA 3GU8A 2YIWA 3LQ5A 1Q8UA 5GIPE 4HNFA 3MH1A 3GC7A 5FRIA 1FMOE 2W1DA 4RBLA 4YO6A 5ANJA 3TZMA 3ROCA 4WRSA 3FPMA 4KBKA 5AP4A 4C33A 2J50A 2P2IA 3FLSA 4LRKA 5E1SA 4X2FA 3Q9ZA 4M84A 4RC2A 4TXCA 5DWRA 4ACGA 4AW1A 5JZJA 4BFMA 2VWBA 3JY0A 5JQ8A 4FF8A 3FV8A 2WB8A 4UX9A 4CG8A 3F6XA 1OIYA 2JDRA 3FLNC 5EKNA 4ZSAA 3E8CA 1OMWA 4AE6A 4GV1A 1KE7A 2RFEA 3LFEA 1PMNA 3HP2A 4LI5A 3K3IA 1H00A 5CEMA 3PE1A 3CGFA 4ZY6A 3D2IA 4C7TA 2OIBA 4LV7A 4AT3A 2Y0AA 1Q3DA 3PPZA 3AD4A 3Q6WA 4YZDA 3NPCA 5E8YA 4G17A 3ZSGA 1DS5A 5KMIA 5IQGA 2WIPA 2OSCA 5EG3A 4L01A 4RFZA 2QR7A 3VJNA 2C5NA 5IEXA 4GYIA 3CCNA 1HCKA 3W18A 3GU4A 1KOAA 2B54A 2B4SB 2JFMA 3HLLA 4QQCA 5C8MA 4CCBA 1J1BA 1J7UA 5IA4A 4E1ZA 5EQYA 5I9WA 3FC1X 3R00A 2YERA 4IANA 3LCOA 1BX6A 1PXNA 4L7FA 5CQWA 2F49A 2LGCA 4H36A 4DT8A 4JDJA 4FYOA 2HY81 3F82A 4GW8A 2CGWA 3WE8A 3Q4TA 4MBLA 5LVLA 1GOLA 3QWKA 5M06A 4P5QA 5JH6A 2PPQA 2W4OA 2RFNA 3VRZA 3EQGA 1T46A 2ZB0A 3FLWA 3M1SA 3ZXTA 4BCPA 2IVUA 4AU8A 3QUDA 1DI9A 2VTRA 3BBTB 4MWHA 3UZRA 5M57A 1OUKA 2VGPA 2A98A 5M53A 2ZMCA 3R7VA 1Q3WA 3SXRA 2Z7SA 3CIKA 3DJ6A 4DEDA 4QMLA 1URWA 4TZRA 5HG9A 5IQCA 2R3IA 4EH3A 4G3EA 4C59A 4FIEA 5AAEA 4EC9A 5EM6A 2C6TA 3QTSA 4D5KA 2IG7A 4QNYA 3LFCA 2G2HA 4BBMA 4PP7A 2XANA 4ZJIA 4AXCA 3DGKA 1YDTE 1M14A 4IC8A 4F9WA 2O0UA 4BI2A 3BU5A 4I6QA 5KMKA 1UKHA 2UZVA 4YZ9A 2W1EA 1VLRA 5JFVA 3DFAA 3RNYA 2W4JA 1UA2A 3AKLA 2UV2A 4DCAA 1GY3A 1Q24A 3QHRA 1ZMUA 4FSTA 5DRBA 3ZH8A 4NYEA 4FOCA 4IM2A 4YNEA 1OI9A 5CANA 5IA3A 3BGQA 4O0RA 5A9UA 4FKVA 5IMXA 5EHOA 4CTCA 3KF4A 4BIBA 1R78A 5IG1A 4O6LA 3G9LX 4D1XA 2OLCA 3HV6A 4EH2A 4EOQA 1Q8TA 2R3LA 3A7HA 3IOKA 3L8SA 1ZARA 2XYNA 5HLWA 2R3NA 2VTAA 5JN2A 5FEQA 3ZOSA 1FMKA 4HCTA 3ACKA 4YGAA 2GHGA 3TDVA 4BDJA 3BYMA 3LE6A 3VUIA 4OTDA 3ETAA 4J7BA 4JRNA 3D5XA 4QYEA 3T9IA 4LRMA 3RK9A 1GZNA 5HG5A 1IASA 5LMBA 3W0RA 4AZTA 3IGGA 4O82A 4TYEA 1H01A 3SRVB 1B6CB 3LIJA 3QKMA 4JX3A 5HI2A 4EJ7A 4RX7A 2RFSA 3RINA 5KZIA 4YNOA 4PWNA 5L2SA 5HG7A 4F4PA 2O64A 2HY0A 1Q8YA 5BYYA 2VWXA 3RI1A 3BV3A 4O83A 4O7VA 4BCKA 2GQRA 4V0GB 2VTOA 3UVPA 2VTPA 5M08A 3GI3A 4M67A 2PE1A 3Q3BA 2C69A 1OM1A 3BLRA 3REPA 3R22A 3LCTA 4IZ7A 1J3HA 2C0OA 1U54B 3R21A 4JRVA 3ZO1A 3OW4A 1OL5A 3Q9WA 5DVRA 3SV0A 5AA9A 2X2LA 1YHWA 3KCKA 4UZHA 3P7CA 4O22A 2JDVA 1FPUA 2GTNA 5EW8A 3LXPA 2VAGA 3ENMA 1FOTA 1CSNA 4PUZA 3C1XA 5AP6A 3SRVA 3TNWA 3KULB 3VS2A 4Z16A 3MWUA 2GFSA 3LXNA 2WTKC 3KY2A 3EN6A 3QD2B 3QD4A 4I5MA 1BL6A 2C3KA 4OTQA 4JDKA 5J9ZA 4M0ZA 4WRGA 4D4VA 2G2FA 3QTZA 4FTNA 4AQCA 5E8ZA 4L3LA 3PXQA 3MA6A 4QP8A 2C5VA 4XNEA 4AZWA 5M4IA 3BPRA 2ERZE 3FQEA 2ITPA 1WFCA 4WHZA 5CT7A 3FMDA 5D12A 4OLIA 3V51A 1U54A 4BCJA 1OUYA 1TZDA 5HEZA 4BIDA 2Z7LA 3TV7A 5I4NA 2WQEA 2QHMA 1G5SA 4G9CA 3R9NA 3NUAA 5AWMA 1WCCA 4YP8A 5LMAA 4I4FA 3WI6A 3DK7A 4LRJA 4TW9A 2JC6A 4MXAA 3H3CA 3D9VA 4I6LA 2C0IA 4XJ0A 3BBWA 4PTCA 5LCJA 3KULA 3S3IA 3RK5A 3JVRA 5TOZA 1GIHA 1XWSA 4TKSA 4DHFA 1DM2A 3DNEA 3RKBA 3TACA 4RG0A 1UU3A 2WZJA 3ZXZA 4BICA 3PFQA 2WD1A 2C6DA 4NT4A 2J5EA 4CRLA 2W1FA 3P4KA 4OW8A 4IX4A 3OW3A 2G9XA 2WU6A 5IQIA 3HEGA 5BYLA 3OVVA 4U41A 5AUTA 4X3FC 5LARA 4JVGA 1B39A 1UNGA 3TIYA 4CZTA 4DFNA 2PVJA 4F9BA 4XV9A 4FSNA 3Q4CA 2ZJWA 1WMKA 2E9VA 2J6MA 4FUXA 3NX8A 2J90A 2Y9QA 2YM7A 3NNVA 4N70A 5JFXA 1JVPP 2DUVA 1LEWA 3Q96A 2R7BA 4O91A 4Y73A 1KE9A 4DYMA 3QZIA 4L8MA 4BI0A 4E20A 4GH2A 4TT7A 3KN5A 1H0WA 4ZLZA 5CTPA 2YCQA 5AA8A 4MQ1A 3NUPA 2XIZA 2BRHA 3LFFA 2YDKA 2ZMDA 3QQLA 5FXSA 2ZAZA 3ZRLA 3B2TA 3DQXA 5AP7A 3LCSA 4C35A 4D4SA 3UPZA 3NVKI 4X2KA 5J87A 4IIRA 4GFOA 1PYEA 3EQCA 3KXGA 3QXPA 3MGYA 5HG8A 3R8PA 4RVLA 3GBZA 2BRNA 2PE2A 4OTWA 3PG1A 2QHNA 5CAQA 4OTHA 1H0VA 4P7EA 4G31A 2ITYA 3DV3A 4FIIA 3CS9A 3T3VA 4FUYA 3ZFYA 2A1AB 2J51A 1OBGA 3R7GA 4B0GA 3NIZA 4S33A 3R7OA 1L3RE 2BAJA 4YPDA 2YDJA 3UPXA 5I9YA 5GNKA 4V05A 4LQMA 2EB2A 2HCKA 3DB6A 3H30A 3LZBA 2VD5A 1CKIA 1OZ1A 2BCJA 2V55A 2OXDA 3PY3A 3QA8A 4G3GA 3TJDA 5JMSA 4I41A 2B0QA 3BX5A 3U51A 4RIXA 3KN6A 2CLQA 4JI9A 3TL8A 4DFXE 3GUBA 3JY9A 2G01A 2JBPA 4RWJA 4F9YA 3EFKA 1PKGA 1AD5A 4FV3A 4QTCA 5E90A 1ZOGA 4FBXA 3ZEPA 4D55A 4YBKA 2X8EA 4MF0A 4YJPA 1O9UA 3ZC6A 4BWXA 5LMKA 3C4EA 4HPTE 4K18A 1H1PA 2R3MA 2BROA 2WOUA 5EM8A 2CKQA 2XNPA 3DAEA 4G9RA 3W33A 3WOWA 3BI6A 3WZUA 4GIIA 3R63A 4O0UA 1QPEA 2F7EE 3OUKA 4DFLA 4E26A 5BVKA 1KE6A 1YW2A 2W1CA 3TKHA 4GVJA 2JAMA 4I6FA 1I09A 3QRIA 1FGIA 4ALVA 2WO6A 3AMAA 3NCZA 4XOYA 5DT4A 3R0TA 3TV4A 4O38A 2PVNA 2W5HA 2WQNA 1GZ8A 3ROYA 3SX9A 3O0GA 3OXZA 4XBRA 2E9NA 2XNEA 5AUUA 4EYJA 4YSJA 3VS1A 3KEXA 4L67A 4AS0A 2XIKA 3R30A 4YMJA 5DMZA 4IZ5A 4RQKA 3HZTA 3EYGA 1YXXA 3EKNA 5AV1A 4CV9A 3E8EA 1STCE 4R8QA 3BU6A 3QZGA 5I3OA 2GS2A 4BGHA 5JFSA 5LOHA 4AA5A 1G8JA 3RPSA 5CSXA 4F70A 4HYIA 4CEGA 3ORPA 3K3JA 4OBOA 4FIHA 4D1ZA 4EWQA 4FV7A 3UO4A 3TEIA 2WTKB 1ZXEA 3U87A 2YJSA 3Q53A 4EH5A 2UVZA 5F9EA 3ATTA 1ZMVA 3DZOA 1JSVA 4PRJA 5CF5A 3R9RA 2BILB 3ZS5A 5IQDA 5LVPA 2WFYA 2PVRA 2XBJA 3Q2MA 3OCGA 3PSBA 3VUDA 3W0NA 3GCQA 3PA5A 5AIRA 2BHEA 4FGBA 5G6VA 1YI6A 4BCIA 2H6DA 3HVCA 4O2ZA 4RRVA 3RAKA 1UWHA 3GCVA 2YA9A 2BRGA 2X7GA 4M66A 1LPUA 2X8IA 3BEAA 3NUUA 3R02A 3IW4A 4FT0A 4ACCA 4EK5A 2QOCA 3OOGA 5CQUA 4O4CA 1K9AA 2PZPA 3G33A 4P90A 4F63A 5DI1A 5CAUA 3RNIA 2VTSA 2C30A 1OIQA 3ULIA 2NRUA 3OWLA 1Y6AA 5J8IA 5T3QA 4DH3A 2W06A 5ANKA 4MF1A 5AV3A 4B4LA 4D1SA 5E8VA 3AKKA 3QTWA 4QMVA 4XG6A 4ANSA 5ANEA 4DEEA 2WMAA 5HU3A 3KXHA 1WBVA 3PZHA 3QQFA 2YZLA 4E4MA 5JEBA 1PY5A 4YU2A 4Z3VA 2PUUA 4DEGA 2CNUA 1QCFA 2QOQA 1R3CA 2Z7RA 3KFAA 3QCSA 5CXZA 3TJCA 1QPJA 5L8LA 3QQHA 3Q52A 1H28A 4PPBA 4DCEA 2W5AA 3LFNA 4K1BA 1PHKA 2QOBA 4NK9A 3ZLXA 3ZUVA 5HX8A 4GJ2A 4CFWA 4JT3A 3BEGA 4BHZA 4ANNA 3PVGA 3CR0A 2WPAA 2E9UA 2Y4IB 5C8KA 3PWYA 2XK8A 2YAAA 3DXPA 4RWLA 3FMJA 4Z7HA 4L6QA 3HNGA 4YHJA 2OJGA 3UO6A 3AC4A 4Y83A 4O7SA 1F0QA 4FZDB 3LMIA 4PDPA 4YHFA 2ZVAA 2VTHA 3S0OA 3W0OA 1W2FA 3D15A 3PVWA 3QGYA 4MX9A 3KF7A 5HBEA 2I0EA 4BKZA 5F95A 3EFJA 4AAAA 4PMPA 2FGIA 4QMQA 5IDNA 3SG9A 4O6EA 3DKFA 5D1JA 3UQCA 5KNJA 2NYAA 5E8TA 3PXFA 4P5ZA 3UQFA 1QMZA 1G3NA 4RLLA 2JKQA 4B9DA 3LVPA 4BDDA 4EZ5A 4DA5A 4A7CA 3RHXA 5A4LA 3BYOA 5ICPA 5FWKK 4DG0E 4L9IA 1OITA 2RKUA 4ZEGA 2ONLC 2QLUA 4A9YA 2GMXA 2XS0A 4CXAA 5AX9A 3NYVA 3I4BA 3VBTA 2HZIA 4WIHA 3OY1A 4JMQA 4DTBA 4M69B 5M4FA 3ZC5A 3VO3A 2BKKA 3SDJA 3Q4ZA 5IZFA 3I1AA 2UW8A 4AZEA 3VONA 3PJ8A 4U0IA 4XG2A 5ANGA 3OP5A 4XYFA 5LWMA 5CXHA 1GZKA 3MB6A 3WZJA