5HLWA

Crystal structure of c-met mutant y1230h in complex with compound 14
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
299
structure length
284
Chain Sequence
ALNPELVQAVQHVVIGSSLIVHFNEVIGRHFGCVYHGTLLDGKKIHCAVKSLNRIDIGEVSQFLTEGIIMKDFSHPNVLSLLGICSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMHDKEYYSVAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor receptor
publication title Discovery and Pharmacokinetic and Pharmacological Properties of the Potent and Selective MET Kinase Inhibitor 1-{6-[6-(4-Fluorophenyl)-[1,2,4]triazolo[4,3-b]pyridazin-3-ylsulfanyl]benzothiazol-2-yl}-3-(2-morpholin-4-ylethyl)urea (SAR125844).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 284
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hlwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hlwA01
5EK7A 3T8OA 4B4LA 2B0QA 2I0HA 3QRTA 5J5SA 4FEWA 1QPEA 3P0MA 4ZTQA 3DAEA 2F9GA 5IH6A 4QMVA 2JBOA 2YIYA 4QP2A 1PXOA 4AT3A 3HA8A 3D7TB 3DNDA 4CCBA 3MPMA 4UN0C 4TZRA 2YEXA 4NSTA 4V01A 4F09A 5I9XA 5IQCA 2PZYA 4Y85A 4NK9A 3TL8A 2W4OA 4GU9A 1QMZA 2OLCA 4YUQA 1Y57A 5G1XA 3OBJA 4JL9A 2UV2A 1LEWA 1K9AA 2IO6A 3PVWA 5KO1A 2YM6A 3N51A 1M2RA 3JXWA 4G3EA 4OTGA 3LLTA 4FA2A 3BCEA 4O83A 1OGUA 3F9NA 3HV7A 3NCGA 4TW9A 5KMMA 2UW8A 3FI2A 3RPVA 3AD6A 3W55A 4L8MA 2C6TA 3LCSA 3F61A 3FMLA 4XMOA 3W10A 3LCOA 5L2SA 2XRUA 1FMOE 3CS9A 3HRBA 3A2CA 4O1PA 5DT3A 5DYJA 4KIOA 3VQHA 5T6KA 3UO4A 3BPRA 4L45A 1GIJA 4CV8A 1APME 4F0GA 3FQHA 4GRBA 2XK3A 4NH1A 2Z7QA 4PL3A 1MRUA 2HYYA 2R3MA 2ONLC 3QZHA 5IQHA 3V3VA 4RIWB 3VS0A 2RFDA 2BRMA 2UZTA 3HKOA 4IMYA 3KMUA 4F63A 2BROA 4MF1A 3TT0A 2GFCA 4LYNA 2J90A 1ZLTA 2HW7A 4WG5A 5AR2A 3GCQA 1YQJA 3BX5A 4P2KA 2E9VA 4ZSLA 3W1FA 1BUHA 4CFMA 5TKDA 1Y6BA 2ZJWA 4EQMA 4O0WA 3AT2A 2BTRA 1UA2A 2VTRA 3UC3A 3V5JA 2GS7A 4UXLA 3W2CA 1NT2A 2VGPA 2W4JA 3NYOA 2WFYA 2FSLX 2BUJA 3FMEA 4KKGA 5HIBA 3R9DA 4FSNA 4PY1A 4DFBA 4W9WA 4XG7A 2XMYA 4GEOA 4CQGA 2OJJA 1JLUE 1Q62A 4FVRA 3ZUTA 5A6OA 3PLSA 3HUCA 5EHYA 5FM2A 3MBLA 3UODA 3Q5ZA 1H08A 2X81A 2OIQA 4G3DA 2GSFA 2QOFA 3IONA 1JKSA 3MB6A 5EFQA 4W4XA 4ARKA 2C5OA 2JKKA 3EN9A 4ZTMA 4EH5A 3U55A 4QYGA 4FF8A 1LPUA 2XIZA 3PRFA 1M2QA 2R3NA 4E8AA 3BI6A 4YP8A 3FZTA 3OXIA 5HIDA 3RM7A 3ZBXA 5IA4A 4IXPA 4H3BA 3W2OA 4QMLA 3D5WA 4RWIA 4G9RA 5M56A 4BIEA 4BIBA 2J7TA 5DVRA 5HLNA 3Q4TA 3NLBA 1H1RA 2XIRA 1YOLA 5JFWA 1FVRA 3ORMA 3PSCA 4LUDA 4PDOA 3SG9A 4NW5A 4ZZNA 2GNIA 3PJCA 1SNXA 4FV9A 4I6QA 4OR5A 5M4FA 5DT4A 2PVMA 5CZIA 3WBLA 4C0TA 2QODA 3U6HA 4D9UA 4CT2A 5CSVA 1PXNA 2RSVA 5J7HA 2O64A 2VTJA 2XKFA 1Q4LA 3CTJA 3PXRA 2XNNA 3QCSA 4MD8E 5LJJA 5DPVA 3F5PA 3OOMA 4YLKA 5AR3A 3OW3A 2I0VA 3Q32A 4ZY6A 3R7IA 3MV5A 1KV1A 3QHRA 5IQFA 3QCXA 2VO3A 3QQLA 2ZVAA 3U9CA 4BC6A 3V8WA 3EN5A 1ZXEA 3RP9A 5M4IA 4IACA 4DINA 3K5VA 5LOHA 2QKWB 4FYNA 1XBBA 2V62A 3G33A 3HLLA 3MTFA 2B53A 2WZJA 4DN5A 4XRLA 2VO7A 3FXXA 4ZIMA 1LUFA 3R9HA 1X8BA 4CG9A 3IDPA 3IW4A 3C7QA 4H36A 5IQGA 4HVIA 4GJ2A 5C03A 3LQ3A 4I22A 3L1SA 2ZB1A 4CFVA 4KNBA 3GC7A 5EYDA 2GCDA 3PY1A 3FZ1A 5IMEA 3FMNA 5KKRC 1A48A 2YISA 3U51A 5LWNA 4ANLA 5HI2A 5AA9A 2OI4X 4CQEA 3ET7A 2IZRA 2R4BA 2W7XA 3QA0A 4FODA 4QYHA 2HZIA 4CSVA 4K0YA 3VHEA 5M44A 3L9MA 2BHEA 5DRBA 2BZIB 3B8RA 2X4ZA 4NIFA 3D94A 4FKVA 1OKVA 4MQ2A 5HU9A 2BIKB 1XBCA 5EM7A 4MTAA 3E88A 3WARA 3EYGA 4OTHA 2C68A 4FGRA 1H01A 2Z60A 1PW2A 3MA6A 3PVUA 3ULIA 1IA9A 2CMWA 2X8IA 3EL7A 4FTLA 3F3UA 4I24A 5HLPA 3SXFA 4ACHA 1VEBA 4AXAA 2X2MA 3CD8A 5J87A 3HZTA 3HMOA 5FWKK 3I7BA 3O17A 1DS5A 3VBVA 3VULA 1YXSA 5M08A 4FEXA 3F3VA 4CD0A 3WF6A 3A7IA 3GU6A 3RPOA 1XJDA 3F2RA 3OTVA 3HYHA 3ORLA 3QCQA 2WMWA 2O5KA 2VTIA 1YI3A 1Q8WA 3I0OA 4FV5A 5HD4A 5HE2A 2WTIA 2VD5A 3EZVA 3L8XA 3BE2A 3WZEA 4J1RA 3N4UA 4O7SA 4GK2A 3ULZA 3PA4A 5L8KA 5M09A 3C0GA 5HNBA 4FKIA 3TJCA 4WUAA 4DFZE 5I0BA 2XRWA 1ZYJA 3FLNC 4C4HA 2NRUA 3R71A 4A9YA 2CKOA 2ITQA 2PMNX 3KL8A 4YMJA 5K5XA 3O7LD 1K3AA 4X2NA 2C3JA 4NM7A 4GFOA 2UW7A 5A3XA 3VS4A 3NW5A 2A1AB 4H1JA 4XG9A 4R8QA 5E8SA 5KMOA 3ORIA 5D7VA 4ZZOA 3S2PA 3SKCA 4Q9ZA 5CXZA 3NUYA 3UJGA 4F9AA 2QQ7A 5L8LA 2CN8A 4NJDA 4X3FC 3AC8A 3W2SA 4E93A 4NUSA 4I92A 2HIWA 3KK8A 2VNYA 3UVPA 1OZ1A 1WBOA 2OH0E 2Y6OA 4DT8A 4IAKA 4CMUA 2QO9A 3D9VA 2XK4A 2VTSA 4JX3A 2XS0A 2YHVA 4R3RA 4RLLA 2BKKA 1WCCA 2F4JA 2P0CA 4QMTA 4YJTA 4HPUE 4HVGA 3W32A 2FYSA 2YCQA 3EIDA 2HZ4A 4WSYA 3KULA 4FKJA 4X2FA 3PXFA 3R1NA 5IA0A 3KCKA 4AT5A 2JKQA 1OPLA 2KTYA 4O1OA 5HIEA 2RFSA 3FKLA 5HORA 1IRKA 3BLHA 4XV9A 4DHFA 1UWHA 4L7SA 4IC8A 4EK3A 4FTIA 3EFLA 2BRBA 3VJOA 4YJRA 4UX9A 5GZAA 1HCLA 1SNUA 1Q3DA 4WA9A 4IDTA 3KC3A 3DZOA 1P14A 2C30A 3F7WA 4D1ZA 3WIKA 1P4OA 2UUEA 2C0IA 3LZBA 3DXQA 4USDA 1QPCA 3JPVA 4XEYA 5D41A 3TXOA 3HECA 4S31A 2QHMA 3F7ZA 4BCQA 4ALWA 4AW2A 1P2AA 5EKNA 4N6ZA 2UZOA 5FXRA 5GJDA 5C01A 3C0IA 3ZFMA 4C3RA 4CGAA 1P4FA 1WBWA 1KOAA 3U8WA 2GS6A 4BCHA 3O8TA 4FNYA 2IPXA 4BY9E 3LPBA 3QD0A 2UZVA 1AQ1A 3HRFA 4IIRA 2XKDA 3QGYA 5JQ5A 3E63A 3FI3A 3MH3A 3PA5A 3QLFA 4GV1A 5AUWA 3R9OA 4IJ9A 5E4HA 1M52A 1K2PA 4PP9A 4HZSA 4BRXA 3V6RA 2VTHA 3AC3A 3DLSA 4H3PA 3EQGA 3ZHPC 2W1IA 1KSWA 2Y4IC 1U46A 4O7ZA 1OPJA 4FV0A 3BYVA 3L9PA 2P4IA 2QOIA 5KZIA 4E1ZA 4YPDA 1PMVA 2VWXA 3RAIA 2BAJA 3SLSA 4F4PA 1OVEA 2C6EA 4K18A 3ZRMA 2PULA 1ZYLA 2HOGA 2QOHA 2LGCA 1ZOHA 4EBWA 2I1MA 2C5XA 3UG2A 4BDIA 2Z02A 4RVLA 5E8VA 3R1SA 4EKKA 2IW9A 3GT8A 2JDSA 4B8MA 4ZS4A 1PMUA 2F2CB 5DIAA 5AP1A 3MY0A 3FL5A 4OT6A 4FTNA 3WF8A 4O0XA 2VTAA 3MH1A 4UZHA 2JBPA 4FVPA 5CXHA 3UZRA 2RKUA 3A7GA 2J0IA 3GQIA 4WBBB 1PXPA 2ITNA 4AZTA 3H9FA 4KB8A 4MD7E 4XX9A 5EG3A 4C8BA 4EOOA 1YHVA 3NS9A 5HEZA 1JOWB 4D4SA 4KINA 2P33A 4LRJA 2GNGA 4OTPA 3NUNA 5EOLA 2C0TA 3UO5A 3D2KA 3FL4A 4RVMA 1DM2A 4BCOA 5GJGA 3BV2A 5GIPE 2PU8A 4GIHA 3TIZA 4Q2AA 4ZTSA 4O7RA 4U45A 2YABA 3R8ZA 5CU0A 3GU8A 3RGFA 4BICA 2OXDA 1FMKA 3PVGA 2VX1A 4QMSA 4O84A 4RA5A 5DA3A 4JS8A 5CLPA 2ZYBA 4BFMA 4F9YA 5IQEA 5ICPA 4YTFA 4LGHA 4TNDA 3CP9A 4CKRA 4W9XA 2A27A 2VX0A 3NEWA 5FQDC 2OWBA 3DAKA 4A9RA 3ZMMA 2GNJA 5E8WA 4IFGA 4IM0A 4KIQA 1Z57A 5A4EA 3UP7A 3V5PA 3KRXA 1GZNA 4FSQA 4AGDA 4EOQA 5J5TA 2VGOA 4AFJA 4ZMFA 3I6UA 2DWBA 2W1DA 3CGOA 3D0EA 3U54A 5CF5A 2ONLA 4M7IA 2WPAA 5EDRA 1STCE 2HENA 3CQEA 2XNOA 3H4JA 4ZJVA 3C9WA 3WE4A 4J96A 5K0KA 4GCJA 4FE2A 4IAYA 4BDDA 3VW6A 3ZZEA 5D10A 1CKIA 3EN7A 3VO3A 2F57A 3DTCA 2H8HA 4OTRA 3TIYA 2G2HA 5I9UA 2P2HA 1H07A 3E8EA 3O23A 3AMAA 4YZDA 5HD7A 4A9TA 1XQZA 3DPKA 3KY2A 4O0UA 4YJSA 2R5TA 3CPCA 5EW3A 5FEQA 5FBNC 4D2TA 4PNKA 3I81A 2QNJA 5GIOE 5FTOA 1E1VA 4N70A 4BDKA 5TR6A 4JRVA 3PJ8A 3E93A 3KF7A 1OM1A 4QNAA 4O0VA 4BB4A 4MHAA 5DEWA 4ZSJA 3OUKA 1PYXA 3HV4A 3DDPA 5BMSA 4QYFA 3VS6A 3SXSA 2VAGA 1OITA 2VTLA 2YDKA 4DGGA 1UNGA 2BRGA 3BE9A 1JQHA 3PPKA 4FEQA 4NIFB 5FGKA 3U4WA 1RE8A 2C69A 4ZTRA 1XH6A 3QC9A 3E8DA 4C4EA 3OVVA 3AC2A 4FI1A 3ZDUA 4GUEA 3K2LA 4P5ZA 1R1WA 1Q8ZA 4OBPA 2YJSA 2UW0A 5HBJA 3AMBA 1KV2A 3GU5A 3CIKA 4O38A 3HRCA 4HW7A 3ATTA 3H9OA 2R3QA 4DTAA 3V01A 5HBEA 2OXXA 2EB3A 4YPSA 3U4UA 3POOA 2HXLA 3FUPA 3MH2A 3QKLA 2PUNA 3VIDA 1OKZA 4YNOA 2ITVA 4NZWB 3A7JA 3K3JA 4BKYA 3VW8A 4RZVA 2W99B 3GC9A 3EFKA 4TN6A 1CSNA 2PMOX 4BZOA 3VUDA 3SA0A 3HV6A 3EQHA 5A9UA 3LMGA 4OTIA 2ZM1A 3IPHA 3I4BA 3QX4A 4MXXA 4CVAA 5HX6A 4L7FA 3UIMA 2BRNA 3TNHA 2DYLA 3VS1A 4HCUA 5KBRA 2J51A 3PXYA 3COHA 4DG3E 3IW8A 3FZRA 2V55A 4N0SA 1KE8A 2DS1A 2UZWE 3II5A 5D9HA 3L8SA 3ZYAA 1YWVA 3LVPA 3OCGA 3NPCA 4AAAA 3IDCA 3D83A 4UMRA 4ANBA 4NTSA 4FBXA 2OFVA 3A7HA 4DITA 2YCSA 3QZGA 4QMOA 4ALVA 4DFUA 5DBXA 3LE6A 5TO8A 5CEQA 1WVWA 4CMTA 5AV1A 2GNLA 3KK9A 3PG1A 5IMXA 3GI3A 2AYPA 3GU7A 3PFQA 5K4JA 2C5NA 4IC7A 4C3FA 4B8LA 4CFFA 1VJYA 5IQIA 4CFXA 3UMWA 3VUGA 4FSWA 3OD6X 2XEZA 2UZBA 4HGEA 5IUGA 3HA6A 2IW8A 4IWQA 2YZLA 4K1BA 2VRXA 5CS6A 4MD9E 5K4IA 2G15A 4AA4A 3PP0A 2OSCA 2W9FB 4JG7A 1H0VA 1DI8A 3RK7A 3OBGA 3KULB 3KMWA 3ID6C 1KE5A 4CV9A 3ZLYA 3IKAA 2VWWA 3LXPA 3A4PA 3OG7A 3CC6A 4LMUA 4DCEA 3BGPA 4ZY5A 3TUCA 3DAJA 2IZTA 5DGZA 1KE9A 2WU7A 3I1AA 3KXZA 4A4XA 4ANNA 1BI7A 1WMKA 4CKIA 4M66A 3R63A 5I9YA 4AZSA 3FMHA 4FT5A 4DH8A 2G1TA 3QFVA 3DBFA 4IWDA 2Q0BA 4E6DA 4TKSA 4YR8A 3QKKA 4IB1A 4ACMA 5EQYA 3OY3A 2PZIA 5E8UA 3T3VA 3TUDA 4MWIA 4TRLA 2ITPA 2JFMA 4FSYA 1RQQA 2X9FA 1GZ8A 3BIZA 4IX5A 5HOAA 1Z5MA 2PE1A 3GOKA 5EM8A 3VRZA 4DG2E 5L6PA 4BGGA 4O7VA 2WAJA 1I44A 2O63A 2YAKA 4QMWA 5AX3A 3F3WA 3MYGA 4FV1A 3CY2A 3UVRA 1YWNA 3TNQB 1R78A 2R3HA 2F7XE 2HAKA 4IB0A 4OLIA 2UZNA 3OCSA 1H1PA 2X4FA 2HWPA 2Y4PA 4PTEA 5CI6A 4AN2A 3OMVA 4WNMA 4AGCA 4M67A 3COKA 3CTQA 2ETMA 4FTAA 4V0GA 4L3JA 5CVHA 2WEIA 4OUCA 1W7HA 3UQGA 3LJ1A 2QO7A 5LVPA 3IOKA 4F7JA 3HP2A 3P7CA 3PIZA 4IH8A 3NYXA 4S33A 3QAME 3I5ZA 1BL6A 2BDWA 2JDVA 4BBFA 3FC2A 1YXUA 3SVVA 4AOTA 4TYJA 4UBAA 3C13A 5HVYA 5CASA 1KUTA 3QYWA 1TVOA 3E7VA 4YLLA 2R7BA 4XBRA 1WAKA 4R7IA 3GXLA 2WU6A 4FNZA 4H39A 4X3FA 4EOJA 3BWJA 3R1YA 1B39A 3ZXZA 2YZAA 4DYMA 1XH5A 3GUBA 4BN1A 2B4SB 5E8YA 3E8NA 3M1SA 4YTHA 5EI8A 3RK9A 3CCNA 4FTJA 5FTGA 4GJ3A 4RWLA 4XV3A 4YBKA 4YC8A 4BDCA 5KMJA 2W5BA 3IW7A 4YJNA 3UNKA 1CTPE 1UU8A 3ZEPA 2C5YA 2FSOX 1GY3A 2H34A 3E3BX 4QMYA 4GH2A 4ANSA 4MXCA 2W0JA 4FV3A 5M55A 2OZAA 3NVKI 2W1EA 3W8QA 4G16A 4W4WA 5CWZA 2PPQA 1BMKA 3R04A 4QOXA 5IKWA 3WZUA 4C33A 4KS7A 4XJ0A 2YFXA 1EH4A 4ZSGA 2XIXA 3KQ7A 3MFSA 5B2MA 2VWZA 5E8XA 3R83A 5KNJA 3IDBA 5IQAA 5EDQA 4DTKA 4CTBA 5I9VA 2QOBA 4J98A 3ODYX 5BVFA 4PF4A 4F9BA 3OW4A 1PXJA 1T46A 1OI9A 1G8SA 2WIPA 5FBOA 3NR9A 2G9XA 4IQ6A 4K9YA 4D4RA 5CU2A 4QTCA 4U6RA 2WMBA 4U41A 1LEZA 2ZMCA 4G6NA 3A61A 4ZXTA 3ZO3A 5HE3A 3PPJA 4PMPA 3PP1A 2H96A 3PJ1A 4FICA 5IPJA 5FM3A 1GOLA 1J1CA 1PXMA 3KN5A 1J3HA 3AQVA 3EQBA 3GB2A 4UWCA 2GHMA 4FV2A 3BHUA 2IVUA 2V7OA 3UIXA 3QC4A 2XIKA 4UYAA 3SC1A 1OIRA 3RWPA 3LXNA 3QXPA 4XG8A 5B0XA 2WIHA 3IGGA 5E1EA 4F1MA 3KXMA 3TNPC 3LFCA 5M4CA 4AGUA 2JKOA 4UMQA 1FQ1B 4G9CA 2VZ6A 2WMXA 3R9NA 2EXCX 2FB8A 3TJDA 1OIYA 3MTLA 4C58A 4D0XA 3MH0A 4II5A 2F7EE 4FR4A 5L6OA 3MJ2A 4IVAA 3H9RA 3F82A 3VJNA 5CAVA 2YDJA 3VC4A 4JQEA 2W5AA 1PKDA 3UO6A 4YJOA 4IB3A 3SDJA 2QLUA 2PWLA 2VO6A 3S4QA 2WQNA 3Q4CA 4RFZA 4DBXA 1ZYCA 5CU4A 4BYJA 4EKLA 1YHSA 2ETRA 1IR3A 4C57A 4EQCA 1M14A 5L2TA 4MX9A 5HCZA 4FIIA 3WYXA 2Z8CA 4F6SA 3DQXA 3KGAA 3PSBA 3R8PA 4FTKA 1JKTA 4E73A 5AFVA 4D1SA 3IG7A 4MK0A 5LMAA 3MVJA 3QQHA 4RG0A 3QTIA 1Q61A 3JVSA 1RW8A 1Q8TA 4MXAA 4DEBA 3SW7A 2QU6A 2WB8A 4M12A 2J6MA 4YBJA 3SX9A 4KS8A 3KVXA 4K77A 4L3LA 3PXZA 3RZFA 2FH9A 2X39A 3SQQA 2XCKA 5BQ0A 2PUPA 3G15A 1NVQA 2OJFE 3DBQA 4F99A 3FSFA 3DTWA 3LIJA 3FMJA 3P86A 5AM7A 2C4GA 5LVOA 3E87A 5JT2A 4L52A 3PWDA 1OL2A 1R3CA 4MWHA 5J8IA 4EH6A 4DF3A 3ORTA 3ATSA 3PE1A 3T9TA 4D4YA 3KRJA 2FUMA 5F4NA 1V0BA 5BVKA 4BYIA 3DFAA 3DQWA 5CEIA 5AUUA 5EQPA 1TQPA 4FIHA 4EQUA 4YZBA 4K11A 3KXHA 4EL9A 1WBTA 4WNOA 3OWJA 4D2RA 4NCTC 2BR1A 5EW9A 3C50A 3PSDA 3RZBA 4J53A 5F95A 2JIUA 4ZS0A 5CI7A 4OAUC 3ZONA 4AZFA 1OECA 2O8YA 1RJBA 4A4OA 3NUUA 3MW1A 4QNYA 5EM6A 3KN6A 2RGPA 4UMTA 4MXYA 5FLFA 4D58A 4JBVA 1OL7A 2XK9A 5CT0A 4I6FA 2IVSA 4RVTA 3KXNA 3OP5A 4WG3A 3DKCA 1YXXA 3DZQA 3ZUVA 1UU7A 4L01A 2HY0A 3D2IA 1OKYA 4FVQA 5HESA 2V22A 2YIRA 3P7BA 4O7NA 3F5XA 5FG8A 3PDTA 2A2AA 4O0YA 4O27B 3MPAA 5DI1A 1GIIA 2QONA 4ALUA 4R77A 3PLAE 5JEBA 3MY1A 1WBSA 2WTKB 2IVVA 3Q9WA 4RA4A 5AJQA 5L6WL 4AFEA 4BCNA 3RVGA 5I9WA 4LV8A 4IWPA 4HGTA 2J0JA 4QQCA 2BILB 4G34A 2Y8OA 4KBAA 2BDFA 1WZYA 3FLZA 4PPAA 1Q8UA 4I41A 3Q53A 4TYIA 3QA8A 2G01A 3IS5A 4IWOA 3LQ5A 4JR3A 3VS5A 3OCTA 2JDTA 4X3JA 4BF2A 4RIYB 4CZTA 3LJ0A 4C37A 3VF9A 2A4LA 3FLYA 5HCXA 1BKXA 2XBJA 3F66A 4FL3A 4FKRA 4EOLA 4F9CA 3LMHA 2XP2A 2W05A 1MQ4A 3BRBA 4WSQA 5FP5A 4FSMA 4BTMA 5HO8A 3VNTA 5J9YA 4X7QA 4FEUA 2QO2A 4BCKA 3RM6A 3QX2A 4FKSA 3ZO2A 5KMIA 1OB3A 4RSSA 3W2QA 3NVMB 4HYHA 2R3JA 4LQMA 4AT4A 5I4NA 5IUIA 3HP5A 4WOVA 5K9IA 5L4QA 2UW6A 1KE7A 1IA8A 1XO2B 1UKHA 5B2KA 3OXZA 4IX3A 4XG3A 4Y83A 3PXKA 4EZ5A 4PP7A 3HV5A 2PVFA 5JGAA 2JDRA 2F49A 2YM3A 4OTFA 4J99A 5L2WA 1FINA 2FGIA 3RPSA 3D15A 2GPHA 3QBNA 4JI9A 3NWWA 2W5HA 2VTTA 2ZV8A 4RJ4A 5CEPA 5AP0A 3BHTA 4FUXA 4CZUA 3D5XA 3JVRA 4YC3A 5A54A 3LFQA 4FL2A 1FPUA 2EWAA 3ZCLA 4O82A 3LQ8A 5DFPA 4FC0A 2J5EA 3KA0A 4MVFA 1O6KA 2WXVA 4KBKA 3PYYA 3FC1X 4U5JA 5HHWA 3DOGA 2WMTA 3UG1A 4CT1A 3NNXA 3WI6A 1MP8A 2PVKA 2QG5A 1NXKA 2C6OA 3OS3A 2J0LA 3UOHA 3QRKA 3VBQA 2WMRA 4FSZA 4O6LA 3E7OA 4IW0A 3S1HA 2BDJA 2AC3A 4JT3A 3QQKA 3V8TA 3RCDA 2VUWA 2R64A 4BGHA 5HG9A 2R0UA 3K3IA 2BZKB 5ETCA 3BBWA 4RIXA 2B55A 4N4SA 5FTQA 4UB7A 1F5QA 4IE9A 4PDPA 4ORKA 4ZJJA 2XNEA 1Y6AA 3FMMA 3R2YA 3RWQA 4XV2A 3GCUA 2CKEA 4A7CA 2C47A 4IBMA 2NP8A 4OTDA 2B1PA 4P90A 4EC9A 4O0SA 4JIAA 1UU9A 4FYOA 3VBWA 4B0GA 4C7TA 1H00A 3FYJX 3MIAA 4Q9SA 4D2SA 2PK9A 3BEGA 3GU4A 3NGAA 3SAYA 4AE6A 4RJ8A 4A07A 5HO6A 4FZAB 3TZ8A 2ZV9A 2EU9A 4J95A 3F88A 2XA4A 1QL6A 5KBQA 1JSVA 4W4VA 2CKQA 4E3CA 2RFEA 4I0SA 4Z7GA 3HMNA 5DG5A 4X3FB 1ZYDA 5I3RA 4AOJA 2I0YA 5AV2A 3ACJA 3EL8A 4DH1A 2OFUA 2RG5A 1SVGA 2B7AA 4C36A 2QCSA 4YZNA 3G9NA 5EYKA 5M07A 4E4NA 2R3PA 4G3CA 4C4GA 2PVJA 3BQRA 4GG7A 4KKHA 1H27A 4AWIA 4MNEA 4H05A 3QD4A 4E5BA 4GG5A 3FHRA 2VTOA 5ACBC 2O3PA 4E4XA 2IWIA 1U54A 3ROCA 4AF3A 1QPJA 4MKCA 5AWMA 3DJ6A 4CFNA 2IZUA 2GFSA 4IM2A 2ITZA 4G6OA 5KMNA 4UZDA 3MFUA 3SRVB 4X0MA 5C26A 5EYMA 3ZM9A 4TWNA 2QU5A 1Z9XA 3KVWA 5ETAA 4D28A 4BKZA 4CEGA 2GTNA 4FT7A 2CN5A 3R8LA 4DGOA 4O7TA 5L3AA 2X2LA 2X7OA 2P55A 1ZOGA 3E64A 4BDBA 1ERKA 2JLDA 4QPSA 1IAJA 2WQOA 5IUHA 1O6YA 4O96A 5HNGA 3TV7A 4DEEA 2C3IB 2HELA 3D7ZA 2X2KA 3EH9A 5AADA 2B9IA 2CLXA 3UOJA 4YJUA 3UZTA 3A62A 2QOKA 4U43A 4F7SA 3BYSA 1H24A 3GCSA 4O2ZA 2XYUA 4EORA 3MWUA 2ERKA 4FNXA 4YHFA 4UYNA 5BVEA 3C4WA 4IAZA 4RFMA 3RI1A 2YA9A 2WTVA 2WGJA 2GTMA 4QPMA 4WG4A 2CJMA 4MF0A 3QD2B 5BUIA 1E9HA 1JNKA 3G6GA 3WZJA 3HDMA 2OO8X 3MDYA 3OXTA 4DAWA 3R7UA 4AZWA 4KIKA 4ANQA 5D12A 3VN9A 3ANQA 3TKHA 3R21A 4MNFA 5JZNA 4ASEA 2OJGA 2C0OA 3BV3A 4BCJA 4BZNA 1Q99A 2W9ZB 1ZOEA 3G0EA 3TN8A 1JAMA 3UPXA 5C4KA 2C6DA 3ZS5A 5BYLA 5K0XA 2R0IA 3QWJA 3BGZA 4NM3A 1W82A 2Z7LA 4I0TA 3VHKA 3VVHA 5HTIA 3C4XA 3REPA 5J1WA 4OTWA 3FZSA 3UTOA 1H25A 2YM8A 3EQCA 3OWKA 3R30A 4FIJA 4LMNA 1AGWA 4GVAA 4DGMA 2IJMA 1Q97A 2H9VA 3QL8A 3FLSA 5CX9A 3LFFA 3ZTXA 3EMGA 4BL1A 4I6HA 5J9LA 4ACGA 4EI4A 3E5AA 4C02A 2CGWA 1BL7A 3DY7A 3DXNA 3CSVA 4QT1A 3O2MA 3W18A 3LKMA 1HCKA 4I5PA 4BI2A 2AC5A 4M84A 3QTSA 5DLSA 3ZDIA 1GIHA 3COMA 4QP4A 4I1ZA 3IECA 2PE0A 2PMIA 5LVNA 3FPQA 4DT9A 3UDBA 2NRYA 1UNLA 5H8EA 4QP8A 5JZJA 4X6RA 4P5QA 5HQ0A 2BVAA 4FKOA 3C4CA 4C3PA 3MJ1A 4IEBA 5CAQA 5L2IA 2ZM4A 4ACDA 4FTOA 3PY0A 4QYYA 4R3CA 1VYZA 4HYSA 5E8TA 1BYGA 3PTGA 3QU0A 2JD5A 4AZVA 4QPAA 2GQGA 3OT3A 3W8LA 3FKNA 3DKGA 3H3CA 3N4VA 2UVZA 3P78A 4FK6A 5BPYA 2QR7A 4DA5A 1G5SA 4FV7A 5AIRA 4YHJA 3P4KA 4NJ3A 4KBCA 3CXWA 3F2AA 3Q4UA 4U7ZA 3FQEA 4FX3A 1LP4A 1YDRE 4HJOA 2CLQA 4F7NA 3PA3A 3MSSA 4I4FA 4USFA 1ZYSA 1XKKA 2J9MA 2OG8A 2EXMA 1ZARA 3NW6A 1JKLA 2KULA 3QRIA 4DEDA 4NEUA 4FV6A 3I7CA 3KXXA 3DK7A 4TYHA 5E8ZA 5JK3A 4KSQA 4X6QC 4LRKA 3GVUA 4YJPA 3R1QA 4U9AA 4FKGA 1NA7A 3R7OA 3R9RA 2BAKA 3H0YA 4HGLA 4EJNA 4K33A 4YJVA 1WVXA 3EN4A 3OCBA 2CNUA 3ENMA 2WQBA 4LRMA 2HZNA 4WT6A 2XZSA 4JVGA 2C1BA 2ITXA 4IVCA 3GENA 5FRIA 2NNWB 3AOXA 3I60A 5AAFA 1IASA 1KWPA 1PY5A 3FMKA 3FZPA 3ZC6A 2XEYA 3AXWA 5AMNA 2W96B 4ZLOA 5J79A 3N4TA 5LQFA 5JSMA 4DE4A 1CDKA 1W8CA 1WBNA 5FD2A 3SV0A 3U87A 4HPTE 2GMXA 4XLVA 4YZ9A 2XCHA 4NWMA 4U97A 3D7TA 2X7FA 3U9NA 1OBGA 4EH7A 2J50A 3Q5IA 3PG3A 4RX8A 4C35A 4EH4A 5L2QA 4EH2A 5ANIA 1V1KA 5DMZA 4EK5A 2XJ0A 4JBQA 3NNUA 2E9PA 5AIKA 1YRPA 4APPA 5D1JA 2PVNA 3P1AA 3F6XA 3PVBA 3A8XA 1ATPE 3M2WA 1WVYA 5KZ0A 5BUJA 1TKIA 3TNIA 2R3GA 4CFWA 4MYGA 4XUFA 5BVWA 5ETFA 3EQFA 5LXMA 5HNIX 4OAVB 3TWJA 5ACKA 1U5RA 1G3NA 1E1XA 1YXVA 2HW6A 5CQUA 1YXTA 1Y8YA 5CVFA 4EOKA 3LXKA 2PVRA 4GK4A 5DH3A 2JIIA 4NCTA 3FSKA 4ZLZA 5CEMA 5IH4A 2OBJA 4DTBA 3CY3A 4EOMA 1CMKE 3C1XA 4XV1A 2PHKA 5HG7A 2JFLA 3UQCA 2P3GX 2QKRA 3CEKA 4PWNA 3PJ3A 3LCTA 3TNWA 1A06A 3G90X 3IQ7A 4JIKA 2QOCA 4RC2A 1NVRA 4FT0A 3ZFXA 3ZSIA 4IVBA 4R5SA 5AUTA 4LM5A 4RJ3A 4D55A 4AUAA 2BZHB 2C6IA 2GNHA 3UMXA 1J1BA 2YITA 4WNPA 3ORXA 3E8CA 2O2UA 2WOUA 2WMUA 2I6LA 3MVLA 3RAHA 4DH5A 1Q3WA 5DT0A 4AG8A 4NFNA 5CALA 1OL1A 2W4KA 4FMQA 4LUEA 4PL5A 3OFMA 1WBPA 4XNEA 5EKOA 3ZRLA 2BAQA 1OL6A 2CCHA 3OEFX 1REKA 4EOPA 4QTEA 4AP7A 2ZDUA 4Y5HA 2I40A 5DR2A 3MVHA 3ANRA 4D2PA 4JQ7A 5CQWA 3L9LA 4TYGA 1GZKA 3TV6A 4RIOA 1B38A 5AEPA 4W4YA 3FLWA 4XYFA 4D9TA 5M06A 4JBPA 2QVSE 3DK3A 2EXEA 2ZMDA 3JS2A 3VS7A 5LMKC 3C51A 2QOQA 3PJ2A 2ITYA 5ANDA 4C62A 3BYUA 3P08A 1NVSA 3PY3A 4FGBA 4FK3A 4GU6A 4RBLA 2R2PA 4RC3A 2UZUE 5AP6A 4EK8A 4AA5A 4HVHA 5IEYA 4Y46A 5M57A 4ID7A 5KMKA 4AX8A 3VUKA 3BLQA 4HCVA 4WD5A 3Q3BA 3QQJA 4WRGA 5LARA 4IX4A 4XOYA 2Y6MA 4YGAA 5B7VA 1UNHA 2QI8A 3AC1A 3TDVA 1SVEA 2ETKA 3KXGA 4IDVA 5BVDA 2C1AA 5KMLA 4C2VA 3NUAA 3ZXTA 4MNEB 4D5KA 1YVJA 4JOAA 4Y8DA 3ALNA 4XBUA 3DS6A 3KKVA 4FG7A 4FZDB 3A60A 5E90A 1J91A 1Q41A 5HVKA 3UE4A 1UWJA 3EQRA 4KAOA 5H2UA 3VQUA 4F9WA 4EK4A 5FDPA 3EJ1A 3FEGA 2HCKA 2JGZA 4OT5A 1DAYA 3NNVA 1PF8A 4QTBA 4FV8A 3H30A 4LFIA 3PPZA 5EI6A 5T3QA 3PZHA 1ND4A 1U59A 2OIDA 2J0KA 1XH8A 4RX9A 2XVDA 2R3OA 3E92A 2UVXA 3QTQA 3G0FA 1I09A 3UGCA 4FKWA 1PYEA 1XH7A 2ITWA 3EKKA 4FTQA 4TXCA 4TWOA 3OTUA 4UWBA 4YSMA 4HGSA 5CU6A 2OW3A 3BLRA 2CGUA 3FBVA 4U40A 3QUPA 3DKFA 1UV5A 3QHWA 5DHJA 4F6WA 3EB0A 5J1VA 3IOPA 4XOZA 1M7QA 3UYTA 2XYNA 1URCA 1YDSE 3OROA 4CRLA 4J8NA 3BHYA 4I6BA 1Q8YA 4QP7A 4I5MA 5D7AA 3DJ5A 2OXYA 3R8UA 1M2PA 4FEVA 4BCMA 4O91A 3ZFYA 4FT3A 2XK7A 3GCVA 3BBTB 4GT4A 2UZEA 3Q9XA 2XUUA 3I79A 4BCFA 2NO3A 3N9XA 3OOGA 3W16A 4ZEGA 5AR5A 4EK6A 2O65A 3EFWA 2Z7SA 3VUHA 4RRVA 4U3ZA 4RQVA 4K2RA 3ZC5A 3VUTA 1J7IA 1G8AA 2W06A 5IF1A 1P5EA 2IZSA 2QC6A 4G5JA 2X6EA 4KIKB 3TACA 5CAUA 3Q60A 3VUMA 5BUEA 4D0WA 3P9JA 4XG4A 2C6LA 2YLEA 3LXLA 4G1WA 4EYMA 2PVYA 4IZ7A 3UPZA 4ZMEA 1OUYA 4WUNA 2YERA 3ROYA 5L8JA 3E62A 3Q4ZA 3CR0A 3ZU7A 4M69A 3SOCA 3WZKA 2CCIA 4LOOA 4QYEA 4YLJA 1L8TA 3F3TA 3O0GA 3H0ZA 3GBZA 3FI4A 4KD1A 4U79A 3SOAA 4LOPA 4JAIA 2GU8A 4DFYA 3LJ2A 4GYIA 4L67A 2HZ0A 4JG8A 3NUXA 4RJ6A 3NAXA 5JFVA 2WQMA 1MRYA 5JGDA 1O9UA 3F5GA 3Q52A 2Z2WA 4R5YA 4TNBA 3TCPA 5H8GA 3WF9A 3SXRA 3VBTA 1SMHA 1ZZ2A 3NUPA 4GT3A 4RWJA 2EVAA 3DFCB 4RX5A 2XIYA 3KEXA 3NDMA 2BTSA 2X6DA 1J7UA 3JYAA 4DH7A 4TL0A 5JGBA 1FOTA 5IEXA 2WMVA 5CSPA 4HNIA 4KKEA 3LLAA 3MA3A 4NTTA 3RCJA 4AW1A 4GT5A 3QTXA 5A46A 3GQLA 5CEKA 2HK5A 2XJ1A 2R3FA 4C4IA 4AACA 3HAVA 3C4FA 4E4MA 3ZO4A 4IADA 4UMPA 2PSQA 4D1XA 4LOQA 4FIGA 4YZMA 3HNGA 3RTPA 5ITAA 3SG8A 3GFEA 4I0RA 3QXOA 4WO5A 2VWUA 2WQEA 2WD1A 3LOKA 3PWYA 4RZWA 4R7BA 4FTRA 5AV3A 3UIUA 3QLGA 4QP6A 3CGFA 2R3LA 1M7NA 2VNWA 2O0UA 5CF4A 4IANA 2J4ZA 4RFYA 2GHGA 2ZM3A 4A9SA 4EH8A 3EFJA 4R1VA 4W8EA 4CG8A 3AMYA 3HAMA 2PZ5A 5CT7A 4YJQA 4EJ7A 3B2WA 2XH5A 3ENHA 3LFBA 2CKPA 3QRUA 3O50A 3DCVA 3AGMA 4XHKB 5EOBA 3LFSA 3CTHA 4NFMA 2YM7A 2Q83A 3NYVA 2R3RA 4NW6A 5C8NA 5LVLA 4ENXA 3ZEWA 3DXPA 5M53A 4FKTA 3PRIA 4ITIA 3BQCA 1XWSA 3JY9A 2B9HA 5H8BA 4Z3VA 3QTRA 1FVTA 1GJOA 5HTCA 2YAAA 1B6CB 3MY5A 3HMIA 3MESA 2C6MA 3OHTA 2VWBA 5FEEA 3VBYA 5AAGA 3IW5A 2Y9QA 4EWQA 5AUVA 1Q24A 2VU3A 4MAOA 3TKUA 4L44A 5AUXA 4PPBA 3TZMA 4TPTA 2I0EA 4BDHA 4F0IA 3DNEA 1QPDA 5GZ8A 2QOLA 2PUUA 4OGRA 1PMEA 3CQWA 5AM6A 4AW5A 2DQ7X 3PUPA 4AQCA 3CKXA 3BELA 2UVYA 2ZV2A 2WMAA 3G2FA 3ZOSA 1OIUA 4IM3A 4ANOA 5KX8A 4F08A 1ZY4A 3TKIA 4BDEA 4ASXA 3Q04A 3R00A 1R0PA 4BI1A 4BWKA 5KUPA 1PXLA 4E6AA 5CSXA 3QGWA 5HG5A 4O21A 4TWCA 5BNJA 4JDIA 4EH3A 1H4LA 2EB2A 2XK8A 3RHXA 1BX6A 4XP2A 4ENYA 4FSTA 4R3PA 2YM4A 4EUUA 4BVUA 5EDPA 4RJ5A 4IB5A 4ZZMA 4FZFB 4JLCA 2X1NA 1HOWA 4I5CA 4FKLA 1PXKA 1Y8GA 3EQIA 3V5TA 5IA1A 3D14A 4XLIA 2PUIA 4JR7A 2BHHA 1MQBA 4PPCA 5JQ8A 2FSTX 4EZ7A 2VTQA 3KF4A 4LL5A 3JR1A 3S95A 3FZOA 4EEVA 5J9ZA 4IZ5A 3BU6A 3OZ6A 4LGDA 3ZRKA 4IHPA 2CDZA 4Q5HA 1DAWA 2HXQA 3RAKA 3VWAA 4CTCA 4ERWA 4DEIA 3I6WA 3DLZA 4PDSA 4F1TA 5ANGA 5HZNA 4R78A 3EQDA 3UP2A 4S2ZA 4A9UA 4AZEA 2VTNA 3QTWA 3U6JA 3BWFA 4CFUA 1JPAA 2ITTA 3ORKA 2WMQA 3HMPA 2GNFA 4MEDA 3FWQA 4O7LA 3PE2A 4RPVA 4EHVA 4OTQA 3Q6WA 3ELJA 2XJ2A 4J7BA 3BGQA 4O2PA 4TT7A 4UV0A 4DEAA 1NY3A 4DGLC 3FDNA 1SYKA 5IH5A 5BVNA 3LCDA 4I3ZA 4PMTA 1PKGA 4U81A 4FKUA 4BCGA 4BDJA 3MI9A 4J97A 4YC6A 3QKMA 4NKSA 4BDGA 5J7BA 5K3YA 5IG1A 4FTTA 5I9ZA 5IDNA 2R9SA 2V7AA 3FAAA 5T68A 3AC4A 1XH4A 3LM5A 4XP3A 4BKJA 2C3LA 3ZM4A 4BZDA 2XBAA 2I7QA 4B99A 5K5NA 5CTPA 3RNIA 3RBWA 2E9OA 3TI1A 3QZIA 1OUKA 4CCUA 4GW8A 4APCA 3C5IA 5IDPA 1OMWA 5JMSA 3SGCA 4LI5A 4AOIA 4S34A 4B7TA 4BIDA 4QQ5A 5JH6A 4DG0E 4AA0A 3EYHA 2IG7A 3ZSHA 4DEHA 2PZPA 3B2TA 3IO7A 5CENA 5HO7A 5HE0A 4Y95A 5CANA 1YKRA 5KKRB 2PL0A 5AV4A 4I4EA 4GMYA 3EQPA 4GL9A 5JFXA 4NL0A 2CNQA 2XK6A 2YACA 2UW4A 4FIEA 5JRSA 5CF6A 2WTKC 3MN3A 2WOTA 2CHLA 1OPKA 4GVJA 5HCYA 5IA2A 4YZCA 4LL0A 4GUBA 3A8WA 3VUIA 4BTFA 1V0PA 1ZMVA 3R2BA 5IA3A 5LCKA 2ITOA 3OC1A 4CMOA 5C4LA 5M4UA 4IZAA 5DEYA 4RGJA 2DUVA 2OIBA 3DGKA 4ZSEA 5CAPA 3F2NA 3Q96A 4TY1A 5AA8A 4H58A 4QTDA 2YWVA 2CPKE 2Q0NA 5CU3A 4XG2A 3HX4A 3WIGA 4JDKA 3WILA 2X8EA 3KMMA 2CNVA 1GZOA 5CYIA 3R8VA 1JKKA 1YOJA 4QMPA 4EOIA 5LWMA 3KREA 1OKWA 3O71A 4Z9LA 5TOZA 2VX3A 4BWPA 4G31A 5HE1A 5A4CA 5AP4A 3UOKA 3NSZA 5AP7A 3TTJA 5LMKA 3CD3A 3H10A 4IAFA 4V0GB 5I3OA 4EYJA 1VYWA 1ZMWA 4MXOA 5AP2A 4P7EA 4YU2A 5A4QA 4PTGA 2FSMX 3F3ZA 1ZZLA 2A0CX 3FV8A 4FG8A 2VTMA 4NKAA 2C6KA 5CSHA 4M69B 3R73A 3MB7A 3MVMA 4I21A 4R7HA 1H8FA 3LAUA 4XCUA 4FZ6A 5EHLA 2YDIA 4JQ8A 2QHNA 3LM0A 4D5HA 2YIQA 3TZ7A 4L00A 2CGXA 5IA5A 3EKNA 1GAGA 4UWYA 3QQGA 4L6QA 1R0EA 2B54A 2C3KA 5J95A 3R01A 2E2BA 2BPMA 3E3PA 3CQUA 3Q9YA 3C4ZA 2XNBA 1OIQA 4M15A 1ZAOA 5HVJA 4CXAA 4IX6A 4ZTHA 3PZEA 3NMUF 4M97A 5CEOA 2BIYA 3HGKA 4PUZA 5AP5A 4RC4A 4X2JA 4JX7A 4FL1A 5C8KA 4FOBA 3S3IA 3PXQA 5EQEA 3UIBA 1SM2A 2WO6A 4N6YA 1LR4A 4RQKA 3DDQA 4BWXA 2XF0A 2ACXA 2OZAB 2PE2A 4XH6A 4ASDA 4F7LA 2WMSA 3ZH8A 5AUZA 4HOKA 2GQRA 1WBVA 2YIXA 4YHTA 3O96A 4B9DA 4KRDA 2G2IA 4KABA 4TYEA 5EHOA 4FUYA 4XG6A 5DOSA 5H9BA 4BHNA 5AR8A 3GOPA 4YO4A 1FGKA 3BEAA 3FMDA 2JITA 3DA6A 4V05A 4GIIA 4KSPA 3QRJA 1ZRZA 4J8MA 3V5WA 4HCTA 5CAOA 1A9UA 3BHHA 2H6DA 3P23A 1VZOA 3FJQE 3IW6A 5HICA 4ANMA 1FBNA 2OKRA 4M0ZA 3NIEA 5AR4A 3WE8A 4QMUA 5DRDA 5ETIA 5LCJA 4E5AX 4ZP5A 1UKIA 3CPBA 2OJIA 3GC8A 3QD3A 4BCPA 2W1GA 1PMNA 1U5QA 1IG1A 1H26A 2AUHA 2BZJA 2OH4A 2J0MB 2XNGA 3D4QA 4IVDA 4ONAA 3ZSGA 2OICA 4BBEA 3A99A 3LFAA 1UU3A 3NIZA 4KA3A 3QCYA 4OW8A 1JWHA 4F65A 5TT7A 5CSWA 3ORZA 4EOSA 4JDHA 3P79A 1SVHA 4ZSAA 3O8UA 5DNRA 4QMZA 5ANKA 1KOBA 4EONA 3BHVA 1CKPA 1CM8A 2B52A 2ZB0A 3SW4A 2Y4IB 4M8TA 3ITZA 4C2WA 5JRQA 3COIA 4ASZA 4E7WA 2ZV7A 3EWHA 4IAIA 4Z7HA 3NCZA 4QP3A 2YWPA 4E26A 4WHZA 4ZAUA 2EUFB 2HY81 4BDFA 2WHBA 4AN9A 5HG8A 3NW7A 3FXWA 1YOMA 4GSBA 2JAMA 4QP1A 4FTMA 2ZOQA 4RT7A 4DFLA 4DH3A 4C4FA 3P5KA 3WYYA 4AN3A 1F0QA 4PDYA 1XHAA 4S30A 3RPYA 4E6CA 4U8ZA 4CKJA 3NX8A 4WIHA 2WELA 4NM5A 3W2RA 3HL7A 4M13A 2C5VA 4L3PA 4GFGA 3UZPA 4F64A 5HBHA 4DFNA 4GKHA 4A06A 2CGVA 3RJCA 3OEZA 2W1HA 1YHWA 2QD9A 4C4JA 4L43A 1W83A 4CZYB 1H1SA 4FG9A 1WFCA 1ZMUA 2XB7A 2JIVA 3DT1A 4H1MA 4JXFA 4QQTA 3O7LB 4UXQA 3EOCA 3HEGA 5AUYA 4HVSA 2RL5A 2V5QA 2PTKA 1MUOA 3ZO1A 3UVQA 5AV0A 3GGFA 4MXZA 4AU8A 4G6LA 4USEA 5HU3A 2WKMA 4D2VA 3QTZA 3GP0A 5IISA 4IZYA 4O22A 5M51A 3TM0A 3ZZWA 5AP3A 3R7YA 4I23A 2VTPA 4ZTNA 2QG7A 5CY3A 3UOLA 3SD0A 4KIPA 4A4LA 4PNIA 5FDXA 5IU2A 4PL4A 4FKQA 5GINE 5E91A 4FSRA 2GS2A 1YI4A 5DN3A 3AGLA 3CBLA 3TZ9A 5A4TA 4RWKA 3UQFA 3DBDA 4KUJA 4NYEA 4NM0A 1XBAA 3R8MA 4F6UA 4YTCA 3LFEA 4U80A 5CNNA 3Q2JA 1S9IA 5DR6A 1OBDA 4Y73A 2JAVA 4PRJA 4E5WA 3NNWA 5BMMA 5TE0A 1KE6A 4C61A 4M0YA 4O0TA 2W17A 2UZDA 1CKJA 2UW5A 3RHKA 4FIFA 1W0XC 4DEGA 5ANOA 4P4CA 5EW8A 4RJ7A 1R39A 2J2IB 4BGQA 4GKIA 4MH7A 2BMCA 4F70A 1SZMA 4TTHB 2WTJA 4L42A 1XR1A 5FUTA 3M42A 2VV9A 3VF8A 5IZFA 4LGGA 4JJRA 3GNIB 4K8AA 1PJKA 2X8DA 3WF7A 4ZY4A 1IAHA 3C0HA 1URWA 1H28A 3KCFA 3R7EA 3GC0A 5AR7A 4CLJA 3SHEA 3OWLA 3S0OA 4YO6A 2UZLA 3IGOA 3G51A 4I94A 4J71A 4XRJA 2GQSA 4QO9A 1H1QA 3ETAA 4HYIA 3NYNA 4FV4A 4UALA 1UVRA 4PQNA 4N57A 4BDAA 3PIYA 2W1ZA 1J7LA 4RLKA 1TQMA 1M17A 4JRNA 2IN6A 4E4LA 4QMXA 4Q5EA 2REIA 3I5NA 4HYUA 1BI8A 2PVLA 4GS6A 4WBOA 2BALA 4O81A 4E20A 4X2GA 4AS0A 4WKQA 3LFNA 3UYSA 4QMMA 3ZLWA 1Y91A 2YLFA 4AE9A 3QUDA 4DCAA 3CE3A 3FY2A 3AD4A 3ZLSA 2VWVA 4JAJA 3V5LA 4HVDA 2VWIA 5FXQA 1YWRA 1XH9A 4K6ZA 4WRSA 3BU3A 3JUHA 3KFAA 3UNJA 4NU1A 4L53A 4GK3A 4M14A 3R28A 3M11A 4TWPA 4FTCA 3ACKA 5H3QA 3KRWA 4YTIA 3V6SA 3POZA 4DBNA 4F1OA 3O8PA 3WF5A 3KRLA 2QURA 3BZ3A 4ZJIA 3R7VA 3AD5A 1JVPP 5A4LA 3R02A 4RIWA 4V04A 2OZOA 3LHJA 4BCIA 4QD6A 2ZAZA 4PX6A 3V04A 2F7ZE 3VS3A 2YJRA 2B9FA 3HUBA 4PMMA 4PTCA 4ZOGA 5TF9A 3RKBA 1V0OA 4R6VA 4RIXB 4QTAA 5CNOA 5C27A 3WOWA 4FSUA 3FYKX 1ZWSA 2JC6A 5LMBA 4J52A 4ZLYA 3QQFA 2RIOA 4FTUA 3G9LX 5C1QB 4LG4A 3TG1A 4D2WA 5F9EA 5A14A 1O6LA 2OJ9A 5ANJA 1JBPE 2OF2A 4WNKA 5F94A 3Q9ZA 1W98A 4H3QA 3RK5A 2XNMA 1OL5A 3UBDA 2Z7RA 1L3RE 4PV0A 2F2UA 5IQDA 3ORPA 3GEQA 2FA2A 3OT8A 5EYCA 4Y5QA 3D5UA 3DV3A 3R6XA 3OWPA 4HNFA 3K5UA 3MS9A 4U44A 4C34A 4CYIA 5GNKA 1H1WA 2WTDA 5BYYA 2BFXA 4R1YA 3G5DA 4QQJA 3ZBFA 4W8DA 4RVKA 4B6LA 1YW2A 3RALA 4S32A 2JDOA 3MPTA 3S00A 1H0WA 1FVVA 4X21A 2Y0AA 5BYZA 4I93A 5HLWA 5FEDA 4Z55A 4MCVA 4BI0A 4ZTLA 3BYOA 2E9UA 4KWPA 2R3IA 5HTBA 3NUSA 4UEUA 2BKZA 2ERZE 5GJFA 4EBVA 2RFNA 3NRMA 5A6NA 5JN2A 3FXZA 3AG9A 3IK3A 4M68A 5EH0A 3BU5A 3QWKA 2X9EA 4GFMA 4GYGA 3ZLXA 5IEVA 4MBJA 3FKOA 4BR3A 2J5FA 3TDWA 4O6EA 3DK6A 2W1CA 3FPMA 4KRCA 3QZFA 2SRCA 4G3FA 3C5UA 5EI2A 5IQBA 3FHIA 2X7GA 5HKMA 1U54B 4DFXE 1AD5A 4G2FA 2VN9A 4O0RA 2E9NA 3NZ0A 3RPRA 2GDOA 5BVOA 5CZHA 2X0GA 3RMFA 3TUBA 3T3UA 5FP6A 1DI9A 2CSNA 2QR8A 4RIYA 2UW9A 4CRSA 3MFTA 5AX9A 4JBOA 4LV5A 4RX7A 4XP0A 2BRHA 2OK1A 4BTJA 4XS2A 2OGVA 5C9CA 2NPQA 3B8QA 3HDNA 3OUNB 3RINA 1NW1A 3K54A 4O7YA 3L9NA 4RMZA 3ERKA 3HV3A 5G6VA 3RNYA 4FOCA 1JSTA 3VAPA 4ACCA 4G5PA 3R22A 2RF9A 4I5HA 5E1SA 3DKOA 3LW0A 5JKGA 5GZ9A 2WNTA 4JNWA 3KB7A 5DE2A 3D5VA 5B2LA 4JG6A 3FE3A 5F20A 2YIWA 4DLIA 3BKBA 3PIXA 3O51A 4BBMA 4M3QA 2VO0A 3R7GA 4DLJA 4FNWA 2WTCA 4O7WA 3P7AA 1JSUA 1QCFA 2ESMA 3W33A 1REJA 5HX8A 4UMUA 5ANEA 3V51A 3QUEA 3AT4A 3EHAA 4DC2A 5BX0A 3QALE 5F1ZA 4QP9A 3DB6A 1F3MC 3CKWA 4FZ7A 1BLXA 3F5UA 2ZDTA 4AGWA 2JKMA 4IJPA 2B9JA 3TEIA 4EC8A 5CVGA 2IW6A 2VWYA 3AC5A 3KU2A 3TTIA 4HZRA 3THBA 3QF9A 2PYWA 3DJ7A 4IAAA 2YCRA 3A4OX 3ORNA 4ZK5A 2R7IA 4BHZA 4EHZA 4EZ3A 4QMNA 3Q2MA 3GFWA 4ERKA 4PMSA 2V0DA 3OY1A 1YI6A 2IVTA 3LFDA 1FGIA 2QOOA 3Q6UA 5C8MA 5KE0A 5KHWA 2PY3A 2WEVA 4YNEA 4U3YA 4BTKA 3DBCA 2YCFA 2XKCA 2FVDA 3U6IA 3CJFA 5D11A 3ALOA 3EZRA 4ITJA 1VR2A 3WZDA 4U42A 3FQSA 2XNPA 3HMMA 4U0IA 3VRYA 1IEPA 2YN8A 3JY0A 2PZRA 4YURA 2ITUA 3FI8A 4G3GA 1T45A 5KHXA 4QRCA 4IFCA 5JFSA 3L8PA 1GNGA 1Q5KA 5HGIA 3ZUUA 4FT9A 4DGNA 5E7RA 3VBXA 3W2PA 2RG6A 3EN6A 3FY0A 5AAEA 1PXIA 4YSJA 2XKEA 3V5QA 4O86A 2GHLA 1MRVA 3MGYA 4G17A 4CNHA 3MIYA 3V8SA 2BFYA 4MQ1A 4E6QA 3C4EA 1YDTE 2PVHA 3QYZA 4MBLA 5GHVA 2PMLX 3I0QA 3MFRA 4CLIA 2JEDA 2UW3A 5EM5A 3LMIA 5KCVA 1U4DA 1S9JA 2XM9A 4QMQA 4F0FA 3OF0A 3UNZA 4OBOA 2YM5A 3A7FA 5DWRA 4ITHA 2P2IA 2R3KA 2Y7JA 4NT4A 2HWOA 3UC4A 3DB8A 4JDJA 3HVCA 3GCPA 3QTUA 4C59A 2FO0A 3KRRA 4OBQA 4Y72A 3TV4A 2OF4A 3L8VA 4EHEA 3ODZX 5E92A 2WTWA 5FXSA 4C38A 3FLQA 4EUTA 5E9EA 3CJGA 4AW0A 2QLQA 2W1FA 3CLYA 4CYJA 4TYHB 1ZY5A 2OU7A 3BYMA 3F69A 4D4VA 2XM8A 3T9IA 1RDQE 3QQUA 1PHKA 4EWHA 3SRVA 1TQIA 3NAYA 4L46A 3RAWA 4X2KA 4MBIA 2BCJA 4I20A 3G6HA 3R0TA 4L68A 4L9IA 2G2FA 3DBEA 1W84A 3AT3A 2LAVA 3VS2A 4EHGA 1PRYA 3DU8A 4EH9A 3LCKA 4FKPA 5DR9A 4UY9A 4Z16A 5LVMA 5CF8A 5I5ZA 2A19B
chains in the Genus database with same CATH superfamily
5EK7A 3T8OA 4B4LA 2B0QA 2I0HA 3QRTA 5J5SA 4FEWA 1QPEA 3P0MA 4ZTQA 3DAEA 2F9GA 5IH6A 4QMVA 2JBOA 2YIYA 4QP2A 1PXOA 4AT3A 3HA8A 3D7TB 3DNDA 4CCBA 3MPMA 4UN0C 4TZRA 2YEXA 4NSTA 4V01A 4F09A 5I9XA 5IQCA 2PZYA 4Y85A 4NK9A 3TL8A 2W4OA 4GU9A 1QMZA 2OLCA 4YUQA 1Y57A 5G1XA 3OBJA 4JL9A 2UV2A 1LEWA 1K9AA 2IO6A 3PVWA 5KO1A 2YM6A 3N51A 1M2RA 3JXWA 4G3EA 4OTGA 3LLTA 4FA2A 3BCEA 4O83A 1OGUA 3F9NA 3HV7A 3NCGA 4TW9A 5KMMA 2UW8A 3FI2A 3RPVA 3AD6A 3W55A 4L8MA 2C6TA 3LCSA 3F61A 3FMLA 4XMOA 3W10A 3LCOA 5L2SA 2XRUA 1FMOE 3CS9A 3HRBA 3A2CA 4O1PA 5DT3A 1TZDA 5DYJA 4KIOA 3VQHA 5T6KA 3UO4A 3BPRA 4L45A 1GIJA 4CV8A 1APME 4F0GA 3FQHA 4GRBA 2XK3A 4NH1A 2Z7QA 4PL3A 1MRUA 2HYYA 2R3MA 2ONLC 3QZHA 5IQHA 3V3VA 4RIWB 3VS0A 2RFDA 2BRMA 2UZTA 3HKOA 4IMYA 3KMUA 4F63A 2BROA 4MF1A 3TT0A 2ZFYA 3TYKA 2GFCA 4LYNA 2J90A 1ZLTA 2HW7A 4WG5A 5AR2A 3GCQA 1YQJA 3BX5A 4P2KA 2E9VA 4ZSLA 3W1FA 1BUHA 4CFMA 5TKDA 1Y6BA 2ZJWA 4EQMA 4O0WA 3AT2A 2BTRA 1UA2A 2VTRA 3UC3A 3V5JA 3NFGB 2GS7A 4UXLA 3W2CA 1NT2A 2VGPA 2W4JA 3NYOA 2WFYA 2FSLX 2BUJA 3FMEA 4KKGA 5HIBA 3R9DA 4FSNA 4PY1A 4DFBA 4W9WA 4XG7A 2XMYA 4GEOA 4CQGA 2OJJA 1JLUE 1Q62A 4FVRA 3ZUTA 5A6OA 3PLSA 3HUCA 5EHYA 5FM2A 3MBLA 3UODA 3Q5ZA 1H08A 2X81A 2OIQA 4G3DA 2GSFA 2QOFA 3IONA 1JKSA 3MB6A 5EFQA 4W4XA 4ARKA 2C5OA 2JKKA 2X0QA 3EN9A 4EH5A 4ZTMA 3U55A 4QYGA 4FF8A 1LPUA 2XIZA 3PRFA 1M2QA 3UDTA 2R3NA 4E8AA 3BI6A 4YP8A 3FZTA 3OXIA 5HIDA 3RM7A 3ZBXA 5IA4A 4IXPA 4H3BA 3W2OA 4QMLA 3D5WA 4RWIA 4G9RA 5M56A 4BIEA 4BIBA 2J7TA 5DVRA 5HLNA 3Q4TA 3NLBA 1H1RA 2XIRA 1YOLA 5JFWA 1FVRA 3ORMA 3PSCA 4LUDA 4PDOA 3SG9A 4NW5A 4ZZNA 2GNIA 3PJCA 1SNXA 4FV9A 4I6QA 4OR5A 5M4FA 5DT4A 2PVMA 5CZIA 3WBLA 4C0TA 2QODA 3U6HA 4D9UA 4CT2A 5CSVA 1PXNA 2RSVA 5J7HA 2O64A 2VTJA 2XAMA 2XKFA 1Q4LA 3CTJA 3PXRA 2NYAA 2XNNA 3QCSA 4MD8E 5LJJA 5DPVA 3F5PA 3OOMA 4YLKA 5AR3A 3OW3A 2I0VA 3Q32A 4ZY6A 3R7IA 3MV5A 1KV1A 1ST4A 3QHRA 5IQFA 3QCXA 2VO3A 3QQLA 2ZVAA 3U9CA 4BC6A 3V8WA 3EN5A 1ZXEA 3RP9A 5M4IA 4IACA 4DINA 3K5VA 5LOHA 2QKWB 4FYNA 1XBBA 2V62A 3G33A 3HLLA 3MTFA 2B53A 2WZJA 4DN5A 4XRLA 2VO7A 3FXXA 4ZIMA 1W2FA 1LUFA 3R9HA 1X8BA 4CG9A 3IDPA 3IW4A 3C7QA 4H36A 5IQGA 4HVIA 4GJ2A 5C03A 3LQ3A 4I22A 3L1SA 2ZB1A 4CFVA 4KNBA 3GC7A 5EYDA 2GCDA 3PY1A 3FZ1A 5IMEA 3FMNA 5KKRC 1A48A 2YISA 3U51A 5LWNA 4ANLA 5HI2A 5AA9A 2OI4X 4CQEA 3ET7A 2IZRA 2R4BA 2W7XA 3QA0A 4FODA 4QYHA 2HZIA 4CSVA 4K0YA 3VHEA 5M44A 3L9MA 2BHEA 5DRBA 2BZIB 3B8RA 2X4ZA 4NIFA 3D94A 4FKVA 1OKVA 4MQ2A 5HU9A 2BIKB 1XBCA 5EM7A 4MTAA 1VLRA 3E88A 3WARA 3EYGA 4OTHA 2C68A 4FGRA 1H01A 2Z60A 1PW2A 3MA6A 3PVUA 3ULIA 1IA9A 2XANA 2CMWA 2X8IA 3EL7A 4FTLA 3F3UA 4I24A 5HLPA 3SXFA 4ACHA 1VEBA 4AXAA 2X2MA 3CD8A 5J87A 3HZTA 3HMOA 5FWKK 3P5JC 3I7BA 3O17A 1DS5A 3VBVA 3VULA 1YXSA 5M08A 4FEXA 3F3VA 4CD0A 3WF6A 3A7IA 3GU6A 3RPOA 1XJDA 3F2RA 3OTVA 3HYHA 3ORLA 3QCQA 2WMWA 2O5KA 2VTIA 1YI3A 1Q8WA 3I0OA 4FV5A 5HD4A 5HE2A 2WTIA 2VD5A 3EZVA 3L8XA 3BE2A 3WZEA 4J1RA 3N4UA 4O7SA 4GK2A 3ULZA 3PA4A 5L8KA 5M09A 3C0GA 5HNBA 4FKIA 3TJCA 4WUAA 4DFZE 5I0BA 2XRWA 1ZYJA 3FLNC 4C4HA 2NRUA 3R71A 4A9YA 1G8KA 2ITQA 2PMNX 3KL8A 4YMJA 5K5XA 3O7LD 2CKOA 1K3AA 4X2NA 2C3JA 4NM7A 4GFOA 2UW7A 5A3XA 3VS4A 3NW5A 2A1AB 4H1JA 4XG9A 4R8QA 5E8SA 5KMOA 3ORIA 5D7VA 4ZZOA 3S2PA 3SKCA 4Q9ZA 3W0OA 5CXZA 3NUYA 3UJGA 4F9AA 2QQ7A 5L8LA 2CN8A 4NJDA 4X3FC 3AC8A 3W2SA 4E93A 4NUSA 4I92A 2HIWA 3KK8A 2VNYA 3UVPA 1OZ1A 1WBOA 2OH0E 2Y6OA 4DT8A 4IAKA 4CMUA 2QO9A 3D9VA 2XK4A 2VTSA 4JX3A 2XS0A 2YHVA 4R3RA 4RLLA 2BKKA 1WCCA 2F4JA 2P0CA 4QMTA 4YJTA 4HPUE 4HVGA 3W32A 2FYSA 2YCQA 3EIDA 2HZ4A 4WSYA 3KULA 4FKJA 4X2FA 3PXFA 3R1NA 5IA0A 3KCKA 4AT5A 2JKQA 1OPLA 2KTYA 4O1OA 5HIEA 2RFSA 3FKLA 5HORA 1IRKA 3BLHA 4XV9A 4DHFA 1UWHA 4L7SA 4IC8A 4EK3A 4FTIA 3EFLA 2BRBA 3VJOA 4YJRA 4UX9A 5GZAA 1HCLA 1SNUA 1Q3DA 4WA9A 4IDTA 3KC3A 3DZOA 1P14A 2C30A 3F7WA 4D1ZA 3WIKA 1P4OA 2UUEA 2C0IA 3LZBA 3DXQA 4USDA 1QPCA 3JPVA 4XEYA 5D41A 3TXOA 3HECA 4S31A 2QHMA 3F7ZA 4BCQA 4ALWA 4AW2A 1P2AA 5EKNA 4N6ZA 2UZOA 5FXRA 5GJDA 5C01A 3C0IA 3ZFMA 4C3RA 4CGAA 1P4FA 1WBWA 1KOAA 3U8WA 2GS6A 3BLAA 4BCHA 3O8TA 4FNYA 2IPXA 4BY9E 3LPBA 3QD0A 2UZVA 1AQ1A 3HRFA 4IIRA 2XKDA 3QGYA 5JQ5A 3E63A 3FI3A 3MH3A 3PA5A 3QLFA 4GV1A 5AUWA 3R9OA 4IJ9A 5E4HA 1M52A 1K2PA 4PP9A 4HZSA 4BRXA 3V6RA 2VTHA 3AC3A 3DLSA 4H3PA 3EQGA 3ZHPC 2W1IA 1KSWA 2Y4IC 1U46A 4O7ZA 4BJJA 1OPJA 4FV0A 3BYVA 3L9PA 2P4IA 2QOIA 5KZIA 4E1ZA 4YPDA 1PMVA 2VWXA 3RAIA 2BAJA 3SLSA 4F4PA 1OVEA 2C6EA 4K18A 3ZRMA 2PULA 1ZYLA 2HOGA 2QOHA 2LGCA 1ZOHA 4EBWA 2I1MA 2C5XA 3UG2A 4BDIA 2Z02A 4RVLA 5E8VA 3R1SA 4EKKA 2IW9A 3GT8A 2JDSA 4B8MA 4ZS4A 1PMUA 2F2CB 5DIAA 5AP1A 3MY0A 3FL5A 4OT6A 4FTNA 3WF8A 4O0XA 2VTAA 3MH1A 4UZHA 2JBPA 4FVPA 5CXHA 3UZRA 2RKUA 3A7GA 2J0IA 3GQIA 4WBBB 1PXPA 2ITNA 4AZTA 3H9FA 4KB8A 4MD7E 4XX9A 5EG3A 4C8BA 4EOOA 4F78A 1YHVA 3NS9A 5HEZA 1JOWB 4D4SA 4KINA 2P33A 4LRJA 2GNGA 4OTPA 3NUNA 5EOLA 2C0TA 3UO5A 3D2KA 3FL4A 4RVMA 1DM2A 4BCOA 5GJGA 3BV2A 4DHIB 5GIPE 2PU8A 4GIHA 3TIZA 4Q2AA 4ZTSA 4O7RA 4U45A 2YABA 3R8ZA 5CU0A 3GU8A 3RGFA 4BICA 2OXDA 1FMKA 3PVGA 2VX1A 4QMSA 4O84A 4RA5A 5DA3A 4JS8A 5CLPA 2ZYBA 4BFMA 4F9YA 5IQEA 5ICPA 4YTFA 4LGHA 4TNDA 3CP9A 4CKRA 4W9XA 2A27A 2VX0A 3NEWA 5FQDC 2OWBA 3DAKA 4A9RA 3ZMMA 2GNJA 5E8WA 4IFGA 4IM0A 4KIQA 1Z57A 5A4EA 3UP7A 3V5PA 3KRXA 1GZNA 4FSQA 4AGDA 2XAOA 4EOQA 5J5TA 2VGOA 4AFJA 4ZMFA 3I6UA 2DWBA 2W1DA 3CGOA 3D0EA 3U54A 5CF5A 2ONLA 4M7IA 2WPAA 5EDRA 1STCE 2HENA 3CQEA 2XNOA 3H4JA 4ZJVA 3C9WA 3WE4A 4J96A 5K0KA 4GCJA 4FE2A 4IAYA 4BDDA 3VW6A 3ZZEA 5D10A 1CKIA 3EN7A 3VO3A 2F57A 3DTCA 2H8HA 4OTRA 3TIYA 2G2HA 5I9UA 2P2HA 1H07A 3E8EA 3O23A 3AMAA 4YZDA 5HD7A 4A9TA 1XQZA 3DPKA 3KY2A 4O0UA 4YJSA 2R5TA 3CPCA 5EW3A 5FEQA 5FBNC 4D2TA 4PNKA 3I81A 2QNJA 5GIOE 5FTOA 1E1VA 4N70A 4BDKA 5TR6A 4JRVA 3PJ8A 3E93A 3KF7A 1OM1A 4QNAA 4O0VA 4BB4A 4MHAA 5DEWA 4ZSJA 3OUKA 1PYXA 3HV4A 3DDPA 5BMSA 4QYFA 3VS6A 3SXSA 2VAGA 1OITA 2VTLA 2YDKA 4DGGA 1UNGA 2BRGA 3BE9A 1JQHA 3PPKA 4FEQA 4NIFB 5FGKA 3U4WA 1RE8A 2C69A 4ZTRA 1XH6A 3QC9A 3E8DA 4C4EA 3OVVA 3AC2A 4FI1A 3ZDUA 4I6LA 4GUEA 3K2LA 4P5ZA 1R1WA 1Q8ZA 4OBPA 2YJSA 2UW0A 5HBJA 3AMBA 1KV2A 3GU5A 3CIKA 4O38A 3HRCA 4HW7A 3ATTA 3H9OA 2R3QA 4DTAA 3V01A 5HBEA 2OXXA 2EB3A 4YPSA 3U4UA 3POOA 2HXLA 3FUPA 3MH2A 3QKLA 2PUNA 3VIDA 1OKZA 4YNOA 5BV3A 2ITVA 4NZWB 3A7JA 3K3JA 4BKYA 3VW8A 4RZVA 2W99B 3GC9A 3EFKA 4TN6A 1CSNA 2PMOX 4BZOA 3VUDA 3SA0A 3HV6A 3EQHA 5A9UA 3LMGA 4OTIA 2ZM1A 3IPHA 3I4BA 3QX4A 4MXXA 4CVAA 5HX6A 4L7FA 3UIMA 2BRNA 3TNHA 2DYLA 3VS1A 4HCUA 5KBRA 2J51A 3PXYA 3COHA 4DG3E 3IW8A 3FZRA 2V55A 4N0SA 1KE8A 2DS1A 2UZWE 3II5A 5D9HA 3L8SA 3ZYAA 1YWVA 3LVPA 3OCGA 3NPCA 4AAAA 3IDCA 3D83A 4UMRA 4ANBA 4NTSA 4FBXA 2OFVA 3A7HA 4DITA 2YCSA 3QZGA 4QMOA 4ALVA 4DFUA 5DBXA 3LE6A 5TO8A 5CEQA 1WVWA 4CMTA 5AV1A 2GNLA 3KK9A 3PG1A 5IMXA 3GI3A 2AYPA 3GU7A 3PFQA 5K4JA 2C5NA 4IC7A 4C3FA 4B8LA 4CFFA 1VJYA 5IQIA 4CFXA 3UMWA 3VUGA 4FSWA 4DHZA 3OD6X 2XEZA 2UZBA 4HGEA 5IUGA 3HA6A 2IW8A 4IWQA 2YZLA 4K1BA 2VRXA 5CS6A 4MD9E 5K4IA 4JMQA 2G15A 4AA4A 3PP0A 2OSCA 2W9FB 4JG7A 1H0VA 1DI8A 3RK7A 3OBGA 3KULB 3KMWA 3ID6C 1KE5A 4CV9A 3ZLYA 3IKAA 2VWWA 3LXPA 3A4PA 3OG7A 3CC6A 4LMUA 4DCEA 3BGPA 4ZY5A 3TUCA 3DAJA 2IZTA 5DGZA 1KE9A 2WU7A 3I1AA 3KXZA 4A4XA 4ANNA 1BI7A 1WMKA 4CKIA 4M66A 3R63A 5I9YA 4AZSA 3FMHA 4FT5A 4DH8A 2G1TA 3QFVA 3DBFA 4IWDA 2Q0BA 4E6DA 4TKSA 4YR8A 3QKKA 4IB1A 4ACMA 5EQYA 3OY3A 2PZIA 5E8UA 3T3VA 3TUDA 4MWIA 4TRLA 2ITPA 2JFMA 4FSYA 1RQQA 2X9FA 1GZ8A 3BIZA 4IX5A 5HOAA 1Z5MA 2PE1A 3GOKA 5EM8A 3VRZA 4DG2E 5L6PA 4BGGA 4O7VA 2WAJA 1I44A 2O63A 2YAKA 4QMWA 5AX3A 3F3WA 3MYGA 4FV1A 3CY2A 3UVRA 1YWNA 3TNQB 1R78A 2R3HA 2F7XE 2HAKA 4IB0A 4OLIA 2UZNA 3OCSA 1H1PA 2X4FA 2HWPA 2Y4PA 4PTEA 5CI6A 4AN2A 3OMVA 4WNMA 4AGCA 4M67A 3COKA 3CTQA 2ETMA 4FTAA 4V0GA 4L3JA 5CVHA 2WEIA 4OUCA 1W7HA 3UQGA 3LJ1A 2QO7A 5LVPA 3IOKA 4F7JA 3HP2A 3P7CA 3PIZA 4IH8A 3NYXA 4S33A 3QAME 3I5ZA 1BL6A 2BDWA 2JDVA 4BBFA 3FC2A 1YXUA 3SVVA 4AOTA 4TYJA 4UBAA 3C13A 5HVYA 5CASA 1KUTA 3QYWA 1TVOA 3E7VA 4YLLA 2R7BA 4XBRA 3W0QA 1WAKA 4R7IA 3GXLA 2WU6A 4FNZA 4H39A 4X3FA 4EOJA 3BWJA 3R1YA 1B39A 3ZXZA 2YZAA 3ML1A 4DYMA 1XH5A 3GUBA 4BN1A 2B4SB 5E8YA 3E8NA 3M1SA 4YTHA 5EI8A 3RK9A 3CCNA 4FTJA 5FTGA 4GJ3A 4RWLA 4XV3A 4YBKA 4YC8A 4BDCA 2XALA 5KMJA 2W5BA 3IW7A 4YJNA 3UNKA 1CTPE 1UU8A 3ZEPA 2C5YA 2FSOX 1GY3A 2H34A 3E3BX 4QMYA 1G8JA 4GH2A 4ANSA 4MXCA 2W0JA 4FV3A 5M55A 2OZAA 3NVKI 2W1EA 3W8QA 4G16A 4W4WA 5CWZA 2PPQA 1BMKA 3R04A 4QOXA 5IKWA 3WZUA 4C33A 4KS7A 4XJ0A 2YFXA 1EH4A 4ZSGA 2XIXA 3KQ7A 3MFSA 5B2MA 2VWZA 5E8XA 3R83A 5KNJA 3IDBA 5IQAA 5EDQA 4DTKA 4CTBA 5I9VA 2QOBA 4J98A 3PFYA 3ODYX 5BVFA 4PF4A 4F9BA 3OW4A 1PXJA 1T46A 1OI9A 1G8SA 2WIPA 5FBOA 3NR9A 2G9XA 4IQ6A 4K9YA 4D4RA 5CU2A 4QTCA 4U6RA 2WMBA 4U41A 1LEZA 2ZMCA 4G6NA 3A61A 4ZXTA 3ZO3A 5HE3A 3PPJA 4PMPA 3PP1A 3AKJA 2H96A 3PJ1A 4FICA 5IPJA 3AKKA 5FM3A 1GOLA 1J1CA 1PXMA 3KN5A 1J3HA 3AQVA 3EQBA 3GB2A 4UWCA 2GHMA 4FV2A 3BHUA 2IVUA 2V7OA 3UIXA 3QC4A 2XIKA 4UYAA 3SC1A 1OIRA 3RWPA 3LXNA 3QXPA 4XG8A 5B0XA 2WIHA 3IGGA 5E1EA 4F1MA 3KXMA 3TNPC 3LFCA 5M4CA 4AGUA 2JKOA 4UMQA 1FQ1B 4G9CA 2VZ6A 2WMXA 3R9NA 2EXCX 2FB8A 3TJDA 1OIYA 3MTLA 4C58A 4D0XA 3MH0A 4II5A 2F7EE 4FR4A 5L6OA 3MJ2A 4IVAA 3H9RA 3F82A 3VJNA 5CAVA 2YDJA 3VC4A 4JQEA 2W5AA 1PKDA 3UO6A 4YJOA 4IB3A 3SDJA 2QLUA 2PWLA 2VO6A 3S4QA 2WQNA 3Q4CA 4RFZA 4DBXA 1ZYCA 5CU4A 4BYJA 4EKLA 1YHSA 2ETRA 1IR3A 4C57A 4EQCA 1M14A 5L2TA 4MX9A 5HCZA 4FIIA 3WYXA 2Z8CA 4F6SA 3DQXA 3KGAA 3PSBA 3R8PA 4FTKA 1JKTA 4E73A 5AFVA 4AQKA 4D1SA 3IG7A 4MK0A 5LMAA 3MVJA 3QQHA 4RG0A 3QTIA 1Q61A 3JVSA 1RW8A 1Q8TA 4MXAA 4DEBA 3SW7A 3PUFC 2QU6A 2WB8A 4M12A 2J6MA 4YBJA 3SX9A 4KS8A 3KVXA 4K77A 4L3LA 3PXZA 3RZFA 2FH9A 2X39A 3SQQA 2XCKA 5BQ0A 2PUPA 3G15A 1NVQA 2OJFE 3DBQA 4F99A 3FSFA 3DTWA 3LIJA 4O4FA 3FMJA 3P86A 5AM7A 2C4GA 5LVOA 3E87A 5JT2A 4L52A 3PWDA 1OL2A 1R3CA 4MWHA 5J8IA 4EH6A 4DF3A 3ORTA 3ATSA 3PE1A 3T9TA 4D4YA 3KRJA 2FUMA 5F4NA 1V0BA 5BVKA 4BYIA 3DFAA 3DQWA 5CEIA 5AUUA 5EQPA 1TQPA 4FIHA 4EQUA 4YZBA 4K11A 3KXHA 4EL9A 1WBTA 4WNOA 3OWJA 4D2RA 4NCTC 2BR1A 5EW9A 3C50A 3PSDA 3RZBA 4J53A 5F95A 2JIUA 3W0NA 4ZS0A 5CI7A 4OAUC 3ZONA 4AZFA 1OECA 2O8YA 1RJBA 4A4OA 3NUUA 3MW1A 4QNYA 5EM6A 3KN6A 2RGPA 4UMTA 4MXYA 5FLFA 4D58A 4JBVA 1OL7A 2XK9A 5CT0A 4I6FA 2IVSA 4RVTA 3KXNA 3OP5A 4WG3A 3DKCA 1YXXA 3DZQA 2X0PA 3ZUVA 3O5AA 1UU7A 4L01A 2HY0A 3D2IA 1OKYA 4FVQA 5HESA 2V22A 2YIRA 3P7BA 4O7NA 3F5XA 5FG8A 3PDTA 2A2AA 4O0YA 4O27B 3MPAA 5DI1A 1GIIA 2QONA 4ALUA 4R77A 3PLAE 5JEBA 3MY1A 1WBSA 2WTKB 2IVVA 3Q9WA 4RA4A 5AJQA 5L6WL 4AFEA 4BCNA 3RVGA 5I9WA 1OGYA 4LV8A 4IWPA 4HGTA 2J0JA 4QQCA 2BILB 4G34A 2Y8OA 4KBAA 2BDFA 1WZYA 3FLZA 4PPAA 1Q8UA 4I41A 3Q53A 4TYIA 3QA8A 2G01A 3IS5A 4IWOA 3LQ5A 4JR3A 3VS5A 3OCTA 2JDTA 4X3JA 4BF2A 4RIYB 4CZTA 3LJ0A 4C37A 3VF9A 2A4LA 3FLYA 5HCXA 1BKXA 2XBJA 3F66A 4FL3A 4FKRA 4EOLA 4F9CA 3LMHA 2XP2A 2W05A 1MQ4A 3BRBA 4WSQA 5FP5A 4FSMA 4BTMA 5HO8A 3VNTA 5J9YA 4X7QA 4FEUA 2QO2A 4BCKA 3RM6A 3QX2A 4FKSA 3ZO2A 5KMIA 1OB3A 4RSSA 3W2QA 3NVMB 4HYHA 2R3JA 4LQMA 4AT4A 5I4NA 5IUIA 3HP5A 4WOVA 5K9IA 5L4QA 2UW6A 1KE7A 1IA8A 1XO2B 1UKHA 5B2KA 3OXZA 4DHJA 4IX3A 4XG3A 4Y83A 3PXKA 4EZ5A 4PP7A 3HV5A 2PVFA 5JGAA 2JDRA 2F49A 2YM3A 4O4EA 4OTFA 4J99A 5L2WA 1FINA 2FGIA 3RPSA 3D15A 2GPHA 3QBNA 4JI9A 3NWWA 2W5HA 2VTTA 2ZV8A 4RJ4A 5CEPA 5AP0A 3BHTA 4FUXA 4CZUA 3D5XA 3JVRA 4YC3A 5A54A 3LFQA 4FL2A 1FPUA 2EWAA 3ZCLA 4O82A 3LQ8A 5DFPA 4FC0A 2J5EA 3KA0A 4MVFA 1O6KA 2WXVA 4KBKA 3PYYA 3FC1X 4U5JA 5HHWA 3DOGA 2WMTA 3UG1A 4CT1A 3NNXA 3WI6A 1MP8A 2PVKA 2QG5A 1NXKA 2C6OA 3OS3A 2J0LA 3UOHA 3QRKA 3VBQA 2WMRA 4FSZA 4O6LA 3E7OA 4IW0A 3S1HA 2BDJA 2AC3A 4JT3A 3QQKA 3V8TA 3RCDA 2VUWA 2R64A 4BGHA 5HG9A 2R0UA 3K3IA 2BZKB 3NFFB 5ETCA 3BBWA 4RIXA 2B55A 1W2CA 4N4SA 5FTQA 4UB7A 1F5QA 4IE9A 4PDPA 4ORKA 4ZJJA 2XNEA 1Y6AA 3FMMA 3R2YA 3RWQA 4XV2A 3GCUA 2CKEA 4A7CA 2C47A 4IBMA 2NP8A 4OTDA 2B1PA 4P90A 4EC9A 4O0SA 4JIAA 1UU9A 4FYOA 3VBWA 4B0GA 4C7TA 1H00A 3FYJX 3MIAA 4Q9SA 4D2SA 2PK9A 3BEGA 3GU4A 3NGAA 3SAYA 4AE6A 4RJ8A 2XARA 4A07A 5HO6A 4FZAB 3TZ8A 2ZV9A 2EU9A 4J95A 3F88A 2XA4A 1QL6A 5KBQA 1JSVA 4W4VA 2CKQA 4E3CA 2RFEA 4I0SA 4Z7GA 3HMNA 5DG5A 4X3FB 1ZYDA 5I3RA 4AOJA 2I0YA 5AV2A 3ACJA 3EL8A 4DH1A 2OFUA 2RG5A 1SVGA 2B7AA 4C36A 2QCSA 4YZNA 3G9NA 5EYKA 5M07A 4E4NA 2R3PA 4G3CA 4C4GA 2PVJA 3BQRA 4GG7A 4KKHA 1H27A 4AWIA 4MNEA 4H05A 3QD4A 4E5BA 4GG5A 3FHRA 2VTOA 5ACBC 2O3PA 4E4XA 2IWIA 1U54A 3ROCA 4AF3A 1QPJA 4MKCA 5AWMA 3DJ6A 4CFNA 2IZUA 2GFSA 4IM2A 2ITZA 4G6OA 5KMNA 4UZDA 3MFUA 3SRVB 4X0MA 5C26A 5EYMA 3ZM9A 4TWNA 2QU5A 1Z9XA 3KVWA 5ETAA 4D28A 4BKZA 4CEGA 2GTNA 4FT7A 2CN5A 3R8LA 4DGOA 4O7TA 5L3AA 2X2LA 2X7OA 3W0PA 2P55A 1ZOGA 3E64A 4BDBA 1ERKA 2JLDA 4QPSA 1IAJA 2WQOA 5IUHA 1O6YA 4O96A 5HNGA 3TV7A 4DEEA 2C3IB 2HELA 3D7ZA 2X2KA 3EH9A 5AADA 2B9IA 2CLXA 3UOJA 4YJUA 3UZTA 3A62A 2QOKA 4U43A 4F7SA 3BYSA 1H24A 3GCSA 4O2ZA 2XYUA 4EORA 3MWUA 2ERKA 4FNXA 4YHFA 4UYNA 5BVEA 3C4WA 4IAZA 4RFMA 3RI1A 2YA9A 2WTVA 2WGJA 2GTMA 4QPMA 4WG4A 2CJMA 4MF0A 3QD2B 5BUIA 1E9HA 1JNKA 3G6GA 3WZJA 3HDMA 2OO8X 3MDYA 3OXTA 4DAWA 3R7UA 4AZWA 4KIKA 4ANQA 5D12A 3VN9A 3ANQA 3TKHA 3R21A 4MNFA 5JZNA 4ASEA 2OJGA 2C0OA 3BV3A 4BCJA 4BZNA 1Q99A 2W9ZB 1ZOEA 3G0EA 3TN8A 1JAMA 3UPXA 5C4KA 2C6DA 3ZS5A 5BYLA 5K0XA 2R0IA 3QWJA 3BGZA 4NM3A 1W82A 2Z7LA 4I0TA 3VHKA 3VVHA 5HTIA 1TFFA 3C4XA 3REPA 5J1WA 4OTWA 3FZSA 3UTOA 1H25A 2YM8A 3EQCA 3OWKA 3R30A 4FIJA 4LMNA 1AGWA 4GVAA 4DGMA 2IJMA 1Q97A 2H9VA 3QL8A 3FLSA 5CX9A 3LFFA 3ZTXA 3EMGA 4BL1A 4I6HA 5J9LA 4ACGA 4EI4A 3E5AA 4C02A 2CGWA 1BL7A 3DY7A 3DXNA 3CSVA 4QT1A 3O2MA 3W18A 3LKMA 1HCKA 4I5PA 4BI2A 2AC5A 4M84A 3QTSA 5DLSA 4AAYA 3ZDIA 1GIHA 3COMA 4QP4A 4I1ZA 3IECA 2PE0A 2PMIA 5LVNA 3FPQA 4DT9A 3UDBA 2NRYA 1UNLA 5H8EA 4QP8A 5JZJA 4X6RA 4P5QA 5HQ0A 2BVAA 4FKOA 3C4CA 4C3PA 3MJ1A 4IEBA 5CAQA 5L2IA 2ZM4A 4ACDA 4FTOA 3PY0A 4QYYA