5HLWA

Crystal structure of c-met mutant y1230h in complex with compound 14
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
299
structure length
284
Chain Sequence
ALNPELVQAVQHVVIGSSLIVHFNEVIGRHFGCVYHGTLLDGKKIHCAVKSLNRIDIGEVSQFLTEGIIMKDFSHPNVLSLLGICSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMHDKEYYSVAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor receptor
publication title Discovery and Pharmacokinetic and Pharmacological Properties of the Potent and Selective MET Kinase Inhibitor 1-{6-[6-(4-Fluorophenyl)-[1,2,4]triazolo[4,3-b]pyridazin-3-ylsulfanyl]benzothiazol-2-yl}-3-(2-morpholin-4-ylethyl)urea (SAR125844).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 284
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hlwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hlwA01
3UNKA 3HV7A 1Z57A 3KVWA 3NIZA 4WO5A 4YNOA 2BALA 2FSLX 3ZFXA 3F5PA 5AUUA 1WAKA 3F3VA 3A62A 3H0YA 3UMWA 3L9NA 3UO5A 4AZFA 4ANSA 1V1KA 1KOBA 4ACHA 3MFSA 5CLPA 2WMQA 3FY0A 4WRGA 4G9CA 5D41A 4CNHA 3O96A 2Y4IB 4CV9A 3EZRA 4JAJA 4RJ8A 2XCHA 3PG1A 4JNWA 3UQGA 2R3RA 3QCYA 4NJDA 3ZCLA 4EHZA 3ZU7A 4WHZA 2OF4A 3PPJA 4L3LA 4I5MA 4BN1A 2PK9A 2W5HA 2B4SB 2UW7A 4LRJA 3L8VA 4IDTA 3PY3A 4QOXA 3CKXA 5BPYA 3V51A 5HG8A 4PL3A 3MYGA 2Y4IC 5IQAA 4WOVA 3RINA 5BUIA 4DTAA 4FIIA 3OTVA 5FP5A 3TJDA 4XJ0A 5IQFA 1UNGA 3DCVA 3ZLSA 3DS6A 4ZK5A 3EKKA 2SRCA 3G6HA 4J8NA 3NW5A 3PP1A 3LXNA 5JGAA 3F3ZA 4MQ2A 5EK7A 4L42A 5ETCA 4J71A 3SA0A 3HV3A 3PWYA 3WE8A 4KRCA 1W83A 3BYUA 2WZJA 5ANDA 4FV9A 4JIKA 3R8MA 2VRXA 3AOXA 1ZMUA 4RWLA 3SHEA 3WYYA 4DGNA 3RHXA 2A4LA 3R22A 5FBNC 5BVDA 3FKLA 4R1YA 1VR2A 3LXKA 1GZNA 3QCSA 3COHA 4F6UA 4F70A 3GGFA 3NS9A 3DKCA 3JY0A 4KA3A 5D1JA 5IISA 3KRWA 4PNIA 3ELJA 3KY2A 2WFYA 1PRYA 3MI9A 4H1JA 3F5XA 5HLPA 4ITIA 3A8XA 2XVDA 5CSHA 3VN9A 3GXLA 4L67A 4G3DA 4BWXA 4E7WA 1YKRA 3DAEA 2QO2A 4EI4A 3OCGA 4EKLA 4BTJA 4ACDA 2NO3A 4LG4A 4FTMA 1V0OA 3LMIA 4I0SA 4BCFA 4D2RA 3A7FA 3DDQA 5IUHA 4LL5A 2F7XE 4UV0A 2IZTA 4WIHA 1YXTA 3R9OA 5JKGA 2ZM3A 2EWAA 5B0XA 3FMDA 4NJ3A 2GNFA 3BLRA 5HCZA 4JBOA 3W33A 2YZLA 5K9IA 2C0OA 4ZZNA 3A4PA 4TYIA 5AM7A 4WBOA 2WMRA 3UOJA 1GNGA 1WBOA 4DTBA 3NZ0A 4P7EA 4YPSA 4FX3A 3V5PA 3S95A 2PU8A 3O8PA 5C9CA 5HOAA 1PY5A 4FZ7A 4DE4A 2PWLA 3NUYA 5HE1A 5CEMA 3PVWA 2NRUA 2Y6OA 4RIWB 3WYXA 2VWIA 3CLYA 1JNKA 4EH4A 1DS5A 4FL1A 4LOPA 1ZWSA 5CY3A 5L6WL 5JSMA 2F4JA 2YAAA 5AIRA 3Q4UA 4TWNA 4FUYA 2VTJA 4ZSJA 1ERKA 5HD4A 1IR3A 3KXMA 3P86A 2GS2A 3ET7A 4DEDA 1M2QA 1KWPA 3FC2A 3RAWA 3MESA 3VUHA 3UE4A 3TCPA 4H3QA 2ZDTA 1FGKA 2X81A 4NUSA 5E91A 4BCJA 5CU4A 4O0WA 1UKIA 2WNTA 3MVMA 4C58A 3TZ8A 2UW9A 2WTDA 5I9UA 3NYOA 2VNWA 3Q2JA 2BZIB 2WEVA 4O0XA 4Y5QA 4USFA 2VWVA 3CGFA 3K5UA 4N70A 4NIFB 2EVAA 3DXNA 2ONLA 4QTBA 3AGMA 4FV2A 2W1GA 5EW3A 1Z9XA 3EH9A 3LCTA 3F3TA 5K0XA 1A06A 3V04A 4DEGA 5CT7A 4H3PA 2ITUA 2XKEA 4MBJA 4ZTQA 5CXHA 4IEBA 5CSXA 2XP2A 4DHFA 3Q6UA 2JAMA 2OI4X 4ZTLA 2W1IA 2JDSA 1W8CA 2RIOA 4CLJA 2QOHA 5CNOA 3VIDA 3ZRKA 1M7QA 3E7OA 4WSQA 1A48A 5HORA 2QR8A 3HDNA 4GFOA 4EJNA 5ETAA 3CPCA 3Q3BA 1H8FA 3UJGA 4DYMA 4E8AA 4RA5A 4GKIA 4MD8E 1PW2A 4ZTHA 4G9RA 5FD2A 3OWLA 3FKOA 5EM5A 2BAKA 5JEBA 3F9NA 3HL7A 4PTCA 3ZFMA 4AW2A 4DINA 5DFPA 5CZIA 2VAGA 3MH2A 3R7UA 4HGTA 3UZPA 2WIPA 5JK3A 5DRBA 4UMRA 2WEIA 1QCFA 3E5AA 3GFEA 3LPBA 3A7JA 2PL0A 4FTUA 5M4IA 3SVVA 2H9VA 3KA0A 3ZXZA 2OJGA 3BU5A 2EXEA 4IJPA 4D1XA 1OBDA 2WB8A 4FBXA 4ALWA 4XG2A 4FTLA 2O5KA 3ZC6A 5HU9A 4IADA 4GFGA 5C27A 3EMGA 4ALUA 2PVNA 4DGLC 4IAIA 3R1YA 4YZDA 5E8SA 5H8GA 2QKRA 2B53A 4YMJA 2CLXA 4PMSA 5HCYA 1CDKA 1YOJA 2YM8A 4FG7A 1S9IA 4ARKA 3C4CA 2VTSA 5A46A 4QMNA 3BQCA 1ZYJA 3RAKA 4J98A 4MXOA 4W4WA 4W9WA 4RJ3A 4F09A 2BRMA 3ERKA 3FYJX 4BKYA 2JAVA 4I93A 4QP3A 4AAAA 2PVRA 2X7OA 3RTPA 4D1SA 5FEDA 3PSBA 3IPHA 5DPVA 3VHEA 4M0YA 4R5SA 4AA5A 5AM6A 4AU8A 2XJ1A 4PP7A 2JDTA 2YLEA 4BIDA 4GK4A 3E7VA 4U42A 4DGOA 1XHAA 2WTCA 4BDBA 1V0PA 3LQ3A 4A06A 2YCQA 4CQEA 3MIYA 4F7NA 4OTFA 3FLWA 2C6IA 5GZ9A 5BMSA 3SQQA 3IW5A 5IQHA 5AAFA 1Q8WA 2B9JA 3NAXA 4N4SA 4E26A 3EQGA 5J9ZA 3FZSA 5HG7A 4JBVA 2V7AA 3VS7A 4BCGA 3BE9A 4EK5A 5KKRB 2Q83A 4E4NA 2QQ7A 4E93A 2HW7A 3PIYA 1GJOA 4YUQA 4QP6A 4FK3A 2CKEA 1YWRA 4IZ7A 4KBCA 3V8TA 4G17A 4AF3A 4LUEA 5AV2A 3W18A 3R8LA 4O38A 4BTMA 1BX6A 1KE9A 5IDNA 5AR5A 4RBLA 5KKRC 2X6EA 4X3FA 1YHWA 3HUCA 4I24A 4O2PA 3O0GA 5AUWA 4C2WA 5JFXA 5IZFA 3PDTA 4D2PA 2VWYA 2BCJA 3NIEA 3BYSA 5AV4A 4ZZMA 4JDKA 1NT2A 3ATSA 3R7EA 4NCTC 4UMQA 4AZSA 2VWWA 5L8JA 4AP7A 4K2RA 4EYMA 4IVAA 3QX2A 5IPJA 4QNAA 4R78A 3LFSA 3IK3A 2QI8A 4GT3A 2UW6A 1OIYA 2Z2WA 1OB3A 2E9VA 3DKFA 2OWBA 2Z7QA 4HNFA 3IGGA 2YM3A 4X2GA 5D7AA 3EYGA 4DFUA 4KIOA 2XZSA 5CEPA 5I9WA 4MTAA 1UWJA 4FKLA 5CYIA 4FZ6A 4D5KA 3MVHA 3S0OA 4NM3A 3QTRA 4BI2A 5M57A 2IW6A 3HKOA 4KIKB 4RX8A 2JBPA 2C0TA 5KMMA 4MNEA 3VRYA 3VUDA 2IPXA 4FGRA 1UVRA 5M07A 3RK9A 1WVWA 1Z5MA 2PUNA 4RQKA 3FZOA 3LKMA 2Q0BA 1J1BA 1VYWA 5K0KA 4M0ZA 1J7LA 2JDOA 2XK7A 1VZOA 1QPDA 3P0MA 3C4ZA 2J0MB 2VX0A 3FPMA 4V04A 3ZLYA 3C5IA 2JD5A 3FZRA 3QD3A 2BROA 3KULB 4HPUE 1XBAA 3GI3A 3R1NA 2DS1A 5LXMA 3RAIA 1PMVA 1O6LA 1LEWA 5EYMA 1YXUA 3BEGA 4APPA 5C4LA 3VBYA 5AP0A 3ANQA 2XK4A 4NH1A 2QOIA 3CE3A 3I60A 4AOJA 2X6DA 2GPHA 4KSQA 1ZMWA 3F66A 1B6CB 3S4QA 4DT8A 5B7VA 1UV5A 2BILB 4BC6A 4XP2A 5AUXA 3MH3A 5A4TA 2JC6A 2YITA 4ACCA 3G51A 4Y83A 3CJFA 2V62A 4EH6A 4FKRA 5EI2A 3U8WA 1W0XC 4GS6A 4IVDA 2R3KA 3CGOA 3FQSA 4PTGA 2OK1A 3IECA 5K3YA 4YHFA 1ZARA 3KXNA 2O2UA 3ETAA 5KUPA 2P4IA 3HRBA 4TPTA 5GJGA 1Q4LA 2GFSA 3MY5A 4L7FA 2NP8A 5CEKA 3PXRA 5EHOA 3COMA 3PY0A 3AG9A 5IQDA 3K3IA 3LQ5A 4L6QA 4QTCA 3PJ3A 3WIGA 4I23A 2HELA 3QQKA 3H9FA 4JDJA 1KE5A 4ACGA 5L2SA 3L8XA 4MNFA 2W5AA 5KHXA 5ANEA 5CAOA 4BCHA 3D7TB 2R3IA 3IONA 1YOMA 4K11A 4QYFA 3ZBFA 2GTMA 2OJIA 3UIMA 5IEXA 5EM8A 4ZJJA 4QPSA 4FKSA 3R8ZA 4H1MA 4TYJA 1YXVA 3JYAA 3LFEA 2QO9A 5C1QB 3RWQA 1H01A 4BTFA 1OPKA 4XRLA 1ND4A 3TDVA 3LJ0A 3PA3A 5C8MA 5DNRA 5FM3A 5J9YA 3PRFA 4OTDA 4LOQA 4M7IA 2UZDA 3NCZA 2C6TA 1WBVA 4C59A 3G90X 4FUXA 3WF6A 1ZZ2A 2FB8A 2X2KA 3LFDA 4KABA 2OFVA 2JDRA 4FT0A 3ZM4A 4BDHA 4NYEA 2QOKA 5AR4A 2X7FA 5L2QA 2XBJA 3RP9A 1K3AA 3RCJA 3AMYA 4IB1A 2WIHA 4YLKA 5A4QA 2Z02A 4EH9A 4QP2A 2XK6A 4BWPA 1SNUA 4KRDA 2X2MA 3GOPA 4X6QC 4Z55A 3ZUVA 5DWRA 2IVSA 3ORPA 5EW9A 5FXSA 4YP8A 2OJ9A 2XNOA 4O22A 4DH3A 2NPQA 3MFRA 4HPTE 4NKAA 4FR4A 5FP6A 1G8SA 3R7IA 4TNBA 4EOOA 3NUXA 4F7SA 2JEDA 4DBXA 4DLJA 5F9EA 5JQ8A 2PMIA 2X8IA 4RFYA 5IA4A 4U41A 2FO0A 3NWWA 5FTQA 4EC9A 5JT2A 3E3PA 4WNMA 3O2MA 3FI4A 3NUAA 1MRYA 2YN8A 5BYLA 2C6EA 2YDKA 2I0VA 2XF0A 3AC5A 4FSTA 3D2IA 4IB0A 1JKKA 3KGAA 4A4LA 5AA9A 2OGVA 2VWBA 5KX8A 3FLSA 4DT9A 2GQRA 3BWJA 5BVOA 3OC1A 4YPDA 3W8LA 4ZY6A 4AG8A 3DXQA 2W96B 4FZFB 2WMVA 4G3FA 4O0TA 2ETKA 4M12A 5BVWA 4P2KA 1YQJA 2R3HA 3TJCA 4ONAA 2PSQA 4AX8A 4EK4A 3R1SA 4K18A 4LQMA 3FZPA 3E63A 5BMMA 3HAMA 3GC8A 4IWOA 4GT5A 4KD1A 2R3NA 2J6MA 3UOKA 1JSVA 1QL6A 3PJ8A 1U59A 3RAHA 4IX5A 3JR1A 4YTCA 3P4KA 5C8NA 3MPAA 3MB7A 3QGYA 4RWJA 4D58A 3W2CA 4ZS4A 3GVUA 2XM9A 1U54B 2XBAA 2UVZA 3OXIA 4UYNA 4M97A 2QD9A 4FOCA 3BBTB 3I6WA 3MWUA 5C03A 2P0CA 3OXTA 4GT4A 4IM2A 5TT7A 5M4UA 2BRGA 3POOA 5FXRA 5CSWA 4EOIA 3JUHA 2QR7A 4XS2A 4NL0A 3HMPA 4PUZA 3SX9A 3ALOA 1JSTA 4TYHB 1KE7A 3KL8A 1ZYCA 3KN5A 4R3PA 3GU6A 3MW1A 5EH0A 3ZO2A 4FEVA 4FI1A 3FE3A 2PMLX 5KNJA 1SZMA 4EQUA 4CFVA 3R8VA 3IW8A 4Y85A 2J9MA 5DEWA 3TV7A 2XCKA 3TZ9A 4C02A 5KZ0A 4F9YA 2GHLA 1KE6A 4BCMA 4EUTA 5JZJA 3HNGA 4M84A 4S2ZA 3W16A 4DLIA 4HVGA 4UMTA 5LCJA 2J5FA 2W9FB 4RIXB 3C13A 5A6OA 3OROA 4XLVA 4YBKA 3HP5A 4QT1A 3DBEA 3TV4A 3DNDA 2Y6MA 5L6OA 4MD7E 2VNYA 5AP1A 2GMXA 4F7JA 3BRBA 1OZ1A 4EYJA 3V5QA 3QRTA 4MYGA 4FZAB 4ZP5A 2BUJA 2QU5A 3JVRA 4KB8A 3PRIA 4FSZA 2UZUE 2YHVA 3CY3A 3V6RA 4S33A 5GJFA 4A7CA 4U79A 4NU1A 4XG8A 2X1NA 1SVEA 2Z8CA 4YC6A 4IXPA 4TRLA 3R1QA 2C5NA 1BI7A 1YDRE 5AP3A 4O7VA 4CFMA 2PZPA 2R3QA 4IB5A 5HHWA 5CF6A 4Y8DA 4D0XA 3BYOA 4YC3A 3RNYA 2O3PA 3VW6A 5CNNA 2ITQA 2OXDA 3DT1A 1JQHA 3A99A 4KKGA 5CAUA 5IQEA 2XH5A 2ITPA 3GCUA 2CCIA 3QKMA 4QYEA 2VV9A 3FSKA 3VO3A 4E5BA 3F6XA 5K4IA 1ZYLA 4Q5HA 3LMHA 3AT4A 1E1XA 4O0VA 4NZWB 2WPAA 2ZYBA 1H0WA 1LUFA 3B8QA 4FTAA 1U5RA 5EG3A 3VF8A 3ZMMA 5M51A 3U6IA 3NYVA 4E5AX 4J99A 1WBSA 4O27B 1IA9A 3MJ1A 1OMWA 2B9IA 1WBWA 3QCXA 5DT3A 3BQRA 3SRVA 4MXXA 4AN2A 4CFFA 4YJRA 3FMEA 3MFUA 4O1OA 5M44A 3PPZA 4O83A 2OIBA 3AMAA 2Y8OA 3BIZA 3NSZA 1MRUA 1FVRA 4OBPA 2C6OA 3ODYX 1P14A 3SOAA 1FVTA 4IQ6A 2WTKB 3IDPA 5AAEA 2BKZA 4BR3A 2O8YA 3V01A 4JLCA 4ASDA 4FKQA 2WTWA 1MQBA 3JVSA 4YJNA 4FC0A 1M52A 3SLSA 4BZOA 2DYLA 3CTHA 3CEKA 2WKMA 3QUDA 1GIIA 1J91A 1XH5A 2ZM1A 3OOMA 2WTKC 1PXIA 4MD9E 3FDNA 3MVLA 2CCHA 2VTQA 4IHPA 4PMPA 4OBOA 5FXQA 4QYYA 4IM3A 3WE4A 4YNEA 5BUJA 2QOQA 1UA2A 4C0TA 1WBNA 3M1SA 3KFAA 4YHTA 3DAJA 4O6LA 5D12A 3V8WA 3UVQA 4IAYA 5AX3A 4JBQA 1Q8UA 2BHEA 2WMWA 4YZMA 4F9BA 3ZO4A 4NM5A 3VRZA 4ZLYA 2A0CX 4J1RA 2UZBA 4BCIA 4WSYA 1MP8A 2XEYA 3AT2A 3EN9A 2J0LA 1ZYSA 2GS6A 2ITYA 3A7IA 2R0IA 4NEUA 4ANOA 3WZDA 4X2JA 5J7BA 4BWKA 5M06A 3QAME 3H10A 5DVRA 2V55A 3UQCA 2ZOQA 4F64A 3KXXA 2CKOA 3LOKA 3AC8A 4B9DA 3MA3A 4M69B 3R02A 2CJMA 3VWAA 3TG1A 5HLNA 3DA6A 1YVJA 3RM6A 3NVMB 4BTKA 3ZS5A 3R30A 3BWFA 4F1MA 3CQEA 3KC3A 3P7AA 4V0GB 4B99A 4O7NA 3WI6A 1F5QA 3ACJA 3PXZA 3KCKA 4BHZA 2GHGA 5G1XA 1CTPE 3QTQA 5F1ZA 2H34A 3C1XA 3NNVA 3CIKA 4CVAA 2F57A 4FOBA 4IZAA 3A60A 1WCCA 3HZTA 4ZOGA 4H58A 3R7OA 5IA3A 5KMOA 4O0YA 4BRXA 4FVQA 4C4HA 1YDSE 2O64A 4USDA 4FICA 4AGCA 4HVDA 3CD8A 2FH9A 5A3XA 3NNUA 4BCQA 2PUUA 4XEYA 3IDBA 2I40A 1DM2A 4YJPA 3K5VA 2IW8A 4AGUA 3I5NA 4C4FA 3COIA 2R0UA 3LXPA 5T6KA 3I7BA 2YM7A 5AADA 4TWCA 2R4BA 3NNWA 2H8HA 2X8EA 3JY9A 3DXPA 3KCFA 3PXKA 3I5ZA 4LUDA 3VUGA 3KEXA 4E6QA 1O9UA 3WF5A 3WZJA 3CY2A 5CI7A 3E8DA 3Q53A 3VS0A 4WG3A 2B7AA 3ORMA 4E3CA 1ZY4A 2R3FA 2RKUA 1T46A 3OD6X 4ITHA 3VUKA 3K2LA 5JZNA 2XIKA 5E1EA 1GZOA 2WGJA 4MKCA 3R2YA 3P23A 4RGJA 3QUEA 2UZNA 5LMBA 3PZHA 3VS3A 4E4LA 4RVTA 4HVHA 3WF8A 2UW4A 4QMVA 3NX8A 3IO7A 4U3YA 4WNPA 4YJTA 1E9HA 2HY81 5KMLA 4IW0A 1YDTE 5A4LA 3I1AA 4XG6A 4AOIA 3Q4CA 2HAKA 2FGIA 2XNGA 2CGXA 1PXJA 3UVPA 4YSMA 4PV0A 3PY1A 4I6HA 2GCDA 2J0JA 2BKKA 4BFMA 5A4CA 4QMLA 1FMOE 4QMUA 4WBBB 4BIEA 4KUJA 3HP2A 4S34A 4CZTA 5CVHA 4AW1A 4RVLA 3W1FA 3RJCA 1JVPP 2VX3A 1J7IA 4YC8A 4E73A 3BHUA 4D4SA 2XMYA 2GTNA 4DCEA 5J1WA 3ZHPC 4UXQA 4ZY4A 3QU0A 4AGDA 1I44A 3QD0A 2V0DA 5CALA 4Y95A 5L2IA 4M67A 4L8MA 4BF2A 3ZBXA 4A9SA 1A9UA 4N6YA 4AFEA 4K9YA 3BZ3A 5DR9A 3OT8A 4XBUA 1KSWA 3UIXA 4AE6A 5AP2A 3DTWA 3ZUTA 3HMOA 4F1OA 2OZOA 4J52A 4MHAA 3OG7A 1JAMA 2XKFA 2XS0A 2OZAB 1KE8A 2PZRA 3FQHA 3PWDA 5AV0A 4GJ3A 3QCQA 3LM0A 2G2IA 1Q62A 1S9JA 1YXSA 2PVHA 4I0TA 4XHKB 4I1ZA 1HCKA 5FBOA 4H05A 4RZVA 3VS5A 2A2AA 2IVVA 3KF7A 2BDJA 3RGFA 3VAPA 4Z7HA 2RSVA 3EQIA 4L43A 2OW3A 3ZZEA 4QMWA 3A2CA 3O51A 3DZQA 4L46A 2JKKA 4E6DA 5M53A 2R5TA 4EH5A 3RHKA 5C8KA 3M11A 2YM6A 4D5HA 4UWBA 4QTEA 3DBQA 1CKPA 4GIHA 5AWMA 3G2FA 3KU2A 4FKIA 2OH0E 4FZDB 3CS9A 3GB2A 1VEBA 5L8LA 4JL9A 1YWNA 4OTRA 4KBKA 3UG1A 4YGAA 2BZKB 2ZJWA 1CM8A 3MN3A 3Q9ZA 4QP1A 1J3HA 3GP0A 4WNOA 5HNIX 4UALA 3KRJA 5D10A 4ERKA 5TF9A 2F2CB 3SXRA 4BDGA 5LMKC 3B8RA 4E20A 3UPXA 5A6NA 4ZTNA 3GENA 4FVRA 4LMNA 4U5JA 4QMOA 2J90A 5CEIA 3TZMA 4D9UA 4PDOA 3EQDA 2B55A 2YDJA 4ZS0A 3OBJA 4F65A 4R7BA 3D5XA 3LFFA 4IVBA 4X2KA 4CQGA 3R8PA 3CR0A 2O63A 5IQCA 1NVRA 2OO8X 4HYUA 3TDWA 3EHAA 3BGPA 2VU3A 2FVDA 2BHHA 4EZ3A 3K54A 2AYPA 3L1SA 3PIXA 4ASZA 4GUBA 4P4CA 1OI9A 5A54A 3UDBA 1URWA 3G9LX 4WD5A 3EFWA 3ZSIA 4U9AA 1H1WA 3FXZA 4TY1A 3TNHA 4BVUA 5EKNA 4PQNA 3WBLA 4USEA 3SD0A 3G0FA 5IEYA 1H24A 5EDQA 4EBWA 1G8AA 4C4EA 4ZEGA 3VS1A 2HIWA 4FT3A 1CKIA 3DKOA 5I3OA 2C5VA 3PP0A 1Q3WA 3H30A 4TWPA 1ZLTA 3FI8A 2DQ7X 2QCSA 3IKAA 4XP3A 4DFZE 3U4WA 2PVFA 2QHMA 4OBQA 3I0OA 3NVKI 2XNPA 2YIWA 3PVGA 3F3WA 2XYNA 3PSCA 2IVTA 4IAKA 3LZBA 4O0UA 2XYUA 4RJ4A 2RFSA 4YTHA 2IZSA 4C2VA 2XNEA 4I22A 2P33A 3EL8A 3R2BA 1NVSA 3LJ2A 2JLDA 4UN0C 1XR1A 1YHSA 3SOCA 4FKOA 4QO9A 4RMZA 4QMYA 4XH6A 2JBOA 4C36A 1XH7A 4EOMA 3EFLA 2YCRA 3U51A 4F0IA 3MS9A 3R7GA 3MBLA 5A14A 4NWMA 1H08A 4YJVA 3FKNA 4IWQA 4YJUA 3LHJA 3SC1A 4DC2A 3BELA 5JH6A 2ETMA 4UXLA 2VO3A 3C0HA 3QFVA 1B39A 3PE2A 4G3CA 4QYHA 3MVJA 2YIRA 4DH7A 4EZ7A 2OXXA 3LVPA 3P7BA 4KS8A 4FSYA 5EOLA 1DAWA 3NDMA 3TIZA 4FSMA 5HNGA 5TE0A 4O0RA 1RDQE 4GL9A 5DGZA 4XP0A 4FTJA 4FV0A 2QG5A 2J5EA 2OJFE 2BIYA 3C50A 2RFNA 1O6KA 2A1AB 1ATPE 3HYHA 4B7TA 3QHRA 4PY1A 1PYXA 2UZWE 2WQNA 5HI2A 4EQCA 2I0HA 3G15A 3GU4A 4DITA 3SG8A 4ZJIA 3UOLA 3GC0A 2W1EA 3FWQA 3MB6A 3D4QA 2VTTA 5HE3A 5CF5A 2B54A 3EQBA 3AC3A 3HX4A 4YZ9A 1WFCA 2QHNA 3W2QA 1STCE 5FWKK 4B4LA 2YJRA 1R0PA 2PVLA 3TUDA 3E62A 3RZBA 3ZLXA 4ZJVA 1ZXEA 4U3ZA 3BU6A 4MX9A 2GNGA 4IAFA 2CN8A 4Y46A 5EYKA 3UBDA 4UWCA 2XIYA 4K8AA 4F9CA 4QQCA 4Z16A 1OIRA 3DAKA 1RQQA 3AC2A 5H8EA 2YLFA 2CLQA 5HESA 4X2FA 4UWYA 4BYJA 4FK6A 3OMVA 3OZ6A 5HVKA 4O81A 4FIJA 4GK3A 5IA0A 3BU3A 4FTIA 5HIBA 3F5GA 3L9PA 1KV1A 3FAAA 3EQRA 4ASEA 1IG1A 1W82A 4AZWA 3EN4A 4FSWA 4FKJA 4JQ8A 4JR3A 3ZONA 1W7HA 3OCSA 5H8BA 3RPSA 2VGOA 5KCVA 4KSPA 1K2PA 4LV5A 5IH5A 2C5OA 5IKWA 3RKBA 3ZM9A 2C5YA 3DK6A 3KXZA 4AA4A 4BBEA 3RBWA 2XK3A 2PYWA 4O7SA 2X9FA 3LJ1A 2J0KA 1FPUA 3NGAA 4JOAA 4KBAA 4DF3A 4RRVA 5CAQA 3OS3A 2F9GA 3W10A 5CX9A 4ZXTA 4AW5A 5KMNA 2BPMA 3MV5A 3HAVA 3C4EA 4RIWA 3MGYA 3TV6A 4F6SA 3C4XA 2NNWB 3G5DA 5C26A 2VTMA 3NYNA 5GIPE 1R78A 2YFXA 2RG5A 4XBRA 4U7ZA 3NUPA 3ZLWA 4O0SA 5K5NA 3UTOA 4LV8A 2ITOA 5E8WA 3PE1A 2GQGA 2UUEA 3T9TA 4AUAA 5DYJA 4IACA 1H1QA 3QZHA 4GEOA 3FZ1A 4UZHA 2PY3A 3FI2A 3GC9A 5JGBA 5IG1A 5CU3A 3LQ8A 5DOSA 4O7LA 3NUNA 1IASA 2YIYA 3MY0A 1GY3A 4A9TA 1BMKA 3TKUA 2YERA 1ZOHA 2WMAA 2YCFA 3DQXA 3LCDA 4GV1A 3ZDIA 3EYHA 1G3NA 4N6ZA 4NIFA 4EH2A 5HZNA 4BICA 2BZHB 1TVOA 2BMCA 2BRHA 3SG9A 2ERKA 4DCAA 2E9PA 4JR7A 3KVXA 5AUTA 4L53A 5E8VA 3R83A 4C37A 4CYJA 1BUHA 3BEAA 5HBHA 3RWPA 3WILA 4F6WA 2GFCA 1OPJA 5M08A 4BDDA 4IBMA 4PL5A 2OKRA 4TT7A 2WO6A 5GHVA 1GIHA 3UO4A 4F9AA 3A7GA 3BHYA 3PG3A 3IW4A 3SKCA 4G3EA 2J50A 1FINA 1OUYA 2WHBA 3CCNA 3EB0A 3FQEA 3DLZA 4G3GA 4AXAA 4BCNA 4DFYA 2BFXA 1XJDA 4BDKA 4E6CA 2QOBA 3Q04A 3W2RA 4O82A 2O65A 2BDFA 4YSJA 5E7RA 3FYKX 4RX5A 3UGCA 4GVJA 3Q60A 4F9WA 2G9XA 3GCPA 1I09A 3G6GA 2PMOX 3NLBA 3VS4A 3A7HA 3DB8A 3OW4A 3S3IA 4FTOA 3QKLA 4FKGA 3OVVA 2CN5A 1H1SA 2R9SA 4PMMA 5DT4A 4C57A 4YJSA 5A9UA 2HYYA 2W1CA 3ZUUA 2G15A 3RPVA 1XH6A 1OECA 3TXOA 1LP4A 3ZRMA 4L9IA 4WG4A 3QQJA 2HZNA 2XUUA 3P5KA 4R6VA 5HG5A 4DFLA 4EK3A 4L52A 5FDXA 4EKKA 3WARA 3O8UA 2OXYA 1YWVA 1DI8A 1OBGA 1W84A 4EQMA 1Q61A 2WOUA 4ZTSA 3DBCA 4DG2E 4U44A 4QYGA 2W4KA 3PYYA 2PE2A 2X9EA 3D15A 1XH9A 3PLSA 4GG7A 4IX4A 4AZEA 4KAOA 4Y5HA 4GJ2A 3ORXA 4J53A 4CG9A 4QMZA 5K4JA 4XLIA 1UU8A 3UMXA 3CTQA 3D9VA 4QMSA 3CQWA 4RVKA 4CKIA 1VYZA 2R7IA 4M14A 4P5QA 2VTIA 4RX7A 4FKPA 4ITJA 3S1HA 4QMQA 3QZIA 3QC4A 4AW0A 2WU7A 3FLQA 3H9RA 3ROYA 1V0BA 4PF4A 3W2OA 3QZGA 4L7SA 3TTIA 4TXCA 3JXWA 4NK9A 1U5QA 1ZOEA 4B8LA 4YBJA 2ZMDA 2QOLA 3ACKA 4AFJA 2XKDA 3MDYA 4OW8A 3T8OA 2GNHA 4MWHA 1LEZA 3E64A 4KINA 5EI8A 1IAJA 4YJQA 5LJJA 3PXFA 4JQEA 2LAVA 4CCUA 4FT5A 1FBNA 4FV7A 2ZVAA 3VNTA 3IG7A 2JKQA 2PVKA 2UZVA 3ORIA 4NCTA 5HE2A 1J7UA 2CKQA 2R64A 4HGLA 2XRWA 3CTJA 2HCKA 4HCVA 1BL7A 4NW5A 5C01A 3ZXTA 4GYIA 2YWPA 1PXNA 3N9XA 4I21A 2QOCA 4W8EA 4BCPA 5AAGA 3VC4A 4AZVA 1UU7A 1O6YA 3NPCA 3EN7A 4XG4A 2GU8A 3W8QA 3OP5A 4C3FA 2YWVA 3L8SA 3QKKA 4RPVA 2XK8A 5JFSA 2PVJA 4M15A 5E8TA 4XX9A 3ZTXA 2C3JA 3GBZA 4XG7A 4E5WA 1OIUA 4JAIA 5CSPA 2EB2A 3SV0A 4EONA 5CANA 3H3CA 4QP9A 4IX6A 3CSVA 2WMTA 3GFWA 2ZDUA 4BKZA 1P4OA 2RGPA 5JFWA 2R3JA 5EHYA 3V6SA 1YI3A 2OLCA 3TUCA 3I4BA 2ZV8A 4FYNA 5DA3A 4EJ7A 5J5TA 2EUFB 4KIKA 2BAJA 4EBVA 3UPZA 4ASXA 2C6MA 3OWJA 4L00A 4RSSA 5BYZA 4FV8A 2YJSA 3FLNC 3LAUA 4LL0A 1GIJA 3ULIA 4GH2A 4I94A 3RVGA 3GQLA 2PVMA 5BVEA 4ZMEA 3OBGA 4FNWA 2IG7A 5TO8A 3KULA 3P79A 3KRXA 4IIRA 5KE0A 3F88A 5EFQA 4AQCA 3HV5A 1BL6A 2OFUA 5I0BA 5HCXA 1NVQA 3FL4A 3QALE 4XV9A 4IB3A 4ACMA 3U6HA 3GOKA 1JLUE 3D0EA 5AR2A 2EB3A 1Y57A 2NRYA 4CXAA 2C68A 3D7ZA 3BYVA 3BV3A 5FTOA 4NKSA 3PJ2A 3V5JA 5LWMA 4DEAA 5FM2A 2VTHA 4I6BA 1YI4A 4U43A 3QGWA 4QRCA 3CC6A 3R28A 3QTSA 4ZLZA 4DEBA 5HTCA 2F7EE 1Q8YA 2CSNA 4Q9ZA 4P5ZA 3NMUF 3TKHA 2CMWA 3OY1A 4N0SA 1JWHA 4D2TA 4U6RA 2XM8A 2PULA 2OBJA 4FTRA 2C0IA 5KHWA 5AR8A 3QYWA 2G2FA 3I7CA 2P3GX 4RFZA 3ZO1A 5J87A 2IN6A 3RI1A 5L6PA 1BI8A 4J8MA 1WZYA 3LFNA 4HNIA 3ZC5A 4HJOA 4E6AA 2YIXA 2JIVA 3ZRLA 2XB7A 1Q3DA 3OUNB 3C4FA 4RJ7A 5AA8A 5HVYA 3A4OX 3TNPC 3GEQA 3D7TA 4IAZA 4KIQA 2C3LA 4XMOA 5CS6A 5HO8A 4QQTA 4ORKA 5HKMA 3IW6A 5BUEA 4KKHA 4RFMA 1T45A 4A9RA 2HWPA 3PLAE 4CV8A 2QOOA 4CSVA 2OH4A 2VTAA 4X0MA 1IEPA 5AP5A 4C3RA 3BE2A 2W4OA 4CFUA 3F2NA 4GSBA 5IDPA 2W06A 5I9ZA 4FA2A 3QTUA 4U40A 2V7OA 1MUOA 2IZRA 3QD2B 4JRNA 4RIYB 3TKIA 4J96A 4KWPA 4AT5A 5E9EA 4CLIA 4G16A 3R63A 5F20A 3FMLA 4DBNA 3OWPA 3MFTA 3GC7A 3D2KA 3COKA 3NEWA 3F2AA 4DEEA 1OIQA 3TNWA 4FG8A 4CZYB 4ZSGA 1LPUA 1OL6A 3MY1A 3NR9A 3QRKA 4I20A 4O2ZA 5AV1A 3CP9A 2BDWA 4UMUA 3F3UA 2B9FA 4O7TA 3HRCA 2GDOA 2X0GA 4BZDA 3DFAA 2ZB1A 2BIKB 3BCEA 5D11A 5CAVA 3QRIA 1J1CA 3THBA 4BGQA 2XEZA 4LGDA 2WELA 4LYNA 2HXLA 3QA0A 4EOPA 3R7YA 3QQFA 3SDJA 2XIRA 3GQIA 3Q96A 4FIHA 4HGSA 4TL0A 1HOWA 5FG8A 4UZDA 3QLGA 2R3LA 2OJJA 4DAWA 5B2KA 4CG8A 1DI9A 1OL5A 3TN8A 4TKSA 5AIKA 3B2TA 3CQUA 4GU6A 3VULA 2YDIA 1H25A 3GCVA 5DLSA 4PMTA 2VO7A 2I0YA 2E2BA 2X7GA 3P78A 4RX9A 5J7HA 3UYSA 5L2TA 3QLFA 3FEGA 5BVKA 3PUPA 3DGKA 3VJOA 4EZ5A 4MVFA 3F5UA 3H0ZA 3FMJA 3U55A 4HCUA 4JS8A 4XOYA 2I6LA 4FODA 3W2PA 3HDMA 4JIAA 2JITA 5HD7A 1REJA 2VZ6A 2HZ4A 5TR6A 2UW5A 2VGPA 4PDPA 3CBLA 4IE9A 1OKVA 3OUKA 4EEVA 4G34A 4IJ9A 4AWIA 2F49A 3ENMA 4FSNA 5ACBC 3E3BX 4Z9LA 5IQGA 3E93A 4W4XA 4UX9A 1SMHA 4U45A 4NT4A 2A27A 1TQPA 3E8EA 2IO6A 3OFMA 4FGBA 3ZYAA 4BHNA 4CT2A 3BHTA 4I5HA 4FNXA 1U54A 4YR8A 4ZMFA 4LM5A 4CZUA 2QOFA 2IW9A 2Z7LA 1JKLA 5FEEA 3C0GA 4WKQA 1M2PA 1VJYA 2BAQA 4TYHA 4FTNA 3LM5A 5E8YA 2W0JA 5GNKA 2DWBA 3VJNA 2B1PA 3N4TA 2Q0NA 4C4IA 2RL5A 5CAPA 2CDZA 2ACXA 1Q97A 5ANOA 1APME 1KV2A 3RALA 4LMUA 2JFMA 3QRUA 3DK3A 4K1BA 4BY9E 4DH8A 4AN9A 5IH4A 1IA8A 5AMNA 4D4VA 4L45A 2QC6A 4I0RA 1DAYA 1M7NA 3HA8A 2FSOX 5CWZA 4FEUA 4GKHA 2RFDA 3F7WA 1WVYA 5I3RA 4PPAA 1REKA 1TQIA 3VHKA 4S32A 4RIXA 1ZY5A 1WBPA 2X8DA 5EHLA 3MIAA 3T3UA 3KF4A 5LVMA 4FIEA 3ZZWA 1OL1A 1YHVA 2C5XA 2WMSA 3RPYA 3Q32A 2X39A 2JKOA 1YOLA 3PA5A 3EZVA 4L3PA 4XG3A 1UKHA 3BPRA 4AT3A 3DTCA 5DH3A 3L9MA 4R3RA 3DQWA 2QONA 2ITVA 4CKJA 2C69A 4RJ5A 4FV1A 2PUPA 3U9NA 5IUGA 5ETFA 4UYAA 4FF8A 4YO6A 5E4HA 3UNZA 3Q9YA 3O7LD 4BB4A 1OL7A 3LE6A 3VQUA 3CXWA 2FSMX 4AACA 5HIEA 4PX6A 3REPA 2R2PA 3Q4TA 3R0TA 5EYDA 4Q9SA 2CPKE 5AP7A 3RMFA 3A8WA 4G31A 3AD4A 4MEDA 4DGMA 1NA7A 3F82A 4IAAA 5ICPA 4CEGA 4I5PA 1RW8A 4AT4A 4RG0A 3DLSA 5CVFA 4EK8A 3LXLA 1H1PA 5DHJA 3AQVA 1JSUA 2X4ZA 5DR6A 3QF9A 2C47A 2REIA 4B6LA 5GINE 1XO2B 3O7LB 4W9XA 5BVNA 3V5LA 4K0YA 2OU7A 3R9RA 3QX4A 4QQJA 3CJGA 4HZRA 4IFGA 2E9OA 5T68A 4C38A 5CXZA 5ITAA 3C4WA 5B2MA 2PE1A 4X7QA 3UOHA 4HZSA 3DDPA 2ONLC 4I6QA 3CKWA 2AC5A 1OKYA 3DOGA 4FEQA 4NW6A 2V22A 2VWZA 3C51A 4A4OA 5H9BA 4O84A 4F0GA 2UW3A 3MA6A 2WTIA 4AE9A 4DA5A 2B9HA 5JRSA 4YZBA 3UC3A 3FMKA 4P90A 2ZAZA 1XKKA 2H6DA 4Q2AA 2OG8A 5EI6A 3VS2A 3VUMA 2O0UA 2Z7SA 4QQ5A 5AR3A 3VBVA 3LFCA 3RK7A 4OLIA 4PDSA 2PVYA 4BCKA 4X6RA 2ETRA 2J0IA 2J4ZA 3VBQA 3BBWA 2JIIA 2ZV7A 3ZEWA 4TYGA 1OM1A 5L8KA 4V01A 3MPMA 1Q5KA 3HV4A 4QMMA 3R9NA 4D9TA 3IS5A 5JFVA 4WUAA 1IRKA 2C30A 4K6ZA 4C8BA 4YURA 2UZOA 3OWKA 2Y4PA 2OSCA 2W05A 3NW6A 2R3OA 4G5PA 4TN6A 4UEUA 4II5A 4F1TA 5AP4A 5HICA 4JJRA 1OGUA 4D1ZA 1XBCA 3GCSA 2VWXA 3M42A 4G1WA 1QPEA 4RA4A 4WG5A 4CYIA 5IMEA 5IU2A 4HCTA 2QVSE 3VQHA 4D4RA 5JGDA 3FMMA 2EU9A 2P55A 4R7HA 3O50A 3R9DA 3BX5A 4C34A 1PXOA 4JG7A 3EQPA 3GNIB 2HZIA 4S30A 3BGQA 5EM6A 2XRUA 4D0WA 5HIDA 3G0EA 2PZ5A 4UMPA 5IEVA 1UNLA 2F2UA 4YO4A 2RFEA 3ORTA 3DJ6A 4GIIA 4XYFA 1Y8YA 2XA4A 2Y9QA 4FV3A 3UZTA 4G6LA 5H3QA 4QPMA 2P2HA 4C3PA 4B8MA 4G6NA 2IJMA 3TEIA 4BBMA 3LFAA 4PNKA 3OF0A 4M69A 5LVLA 3O17A 5CVGA 2XNNA 3QYZA 5E90A 5LCKA 2HY0A 1NY3A 4IVCA 4F99A 5F94A 1RE8A 3OOGA 1MQ4A 5AV3A 4V0GA 4MXZA 4RC2A 3NRMA 3UIBA 2YA9A 3KKVA 3FSFA 5E8UA 3NYXA 4O86A 1XQZA 2RF9A 3TIYA 4U0IA 3HEGA 4PDYA 4IZ5A 4X3FB 3HUBA 4FV4A 4J95A 3IGOA 5HBJA 4O1PA 1JPAA 3G33A 1H4LA 1H0VA 2XNMA 3ODZX 5E92A 3TACA 3UIUA 4D2WA 4JRVA 3C5UA 2IVUA 4DTKA 5HU3A 4PRJA 5CU6A 4BGHA 4ZSAA 4EWQA 3V8SA 4I4FA 4ALVA 4X3FC 3EQFA 4CFWA 3HMNA 5ETIA 2W9ZB 4I92A 3R6XA 2UZEA 5IA2A 5EQPA 2ZV2A 1NW1A 2YABA 4OTWA 2GS7A 2QLUA 2AUHA 1BYGA 2WQMA 4IC8A 4C61A 5LOHA 5KMJA 1Y8GA 2JIUA 3ANRA 3P08A 4GG5A 2FUMA 3EWHA 3DBFA 1XWSA 4V05A 1AD5A 3TL8A 2UZTA 4MNEB 4R7IA 4YJOA 3WF7A 1H1RA 3EFKA 4WRSA 1GAGA 1PXPA 3FMHA 3OW3A 5AFVA 4EH7A 2C6DA 3MH0A 5EDRA 3RCDA 3PSDA 3UP7A 5KO1A 5HNBA 5CQWA 2GNLA 1JOWB 1ZOGA 4I5CA 2AC3A 3DBDA 4ZSEA 3R71A 5JMSA 4LI5A 3EJ1A 2UVYA 4DEIA 3GT8A 5LVPA 3UP2A 3IDCA 3F61A 4ZAUA 4TW9A 4FSQA 3S2PA 2XJ0A 3FPQA 4F08A 4DFNA 1U46A 3KXHA 4GCJA 3I0QA 3FXXA 4FE2A 2X4FA 2A19B 3QTWA 3RK5A 3O71A 4RJ6A 4XG9A 4FKTA 2WU6A 2YISA 4WT6A 3UNJA 3ORLA 3FLZA 4BCOA 3VBXA 3GCQA 4FNZA 5DG5A 3NW7A 4IC7A 3EIDA 3KQ7A 2XNBA 2R3PA 3PJ1A 5CEQA 5HG9A 4C35A 4EK6A 3AMBA 4F63A 4R1VA 1R3CA 5AUYA 1UWHA 4I4EA 2PZYA 2W7XA 4PPBA 3EN5A 3C7QA 4ZIMA 4ZY5A 4RLKA 3QWJA 4LRMA 4OTIA 3B2WA 4M13A 4RC3A 3D5WA 4CGAA 4L01A 4H36A 2EXMA 2OZAA 5E8XA 4ANBA 3AC1A 2YIQA 3KMMA 3LFQA 2G2HA 3AD6A 4XUFA 4FEWA 1XBBA 3LFBA 3QQHA 3UODA 5J1VA 4N57A 1HCLA 1QPJA 2UW8A 3VUIA 1TKIA 2BFYA 3ZFYA 1QMZA 3PFQA 2QKWB 3O8TA 3R04A 5AUZA 2FSTX 4FT9A 5I9XA 1SVHA 5TKDA 2ITTA 4FTKA 4FTQA 3QXPA 3R21A 2WMXA 1CMKE 4O91A 4OGRA 3ROCA 4EHGA 2HXQA 4NM7A 4EL9A 2VX1A 4E4MA 4GW8A 5AUVA 3WF9A 4FV5A 4XCUA 2WMUA 4RVMA 5LMKA 1WMKA 3SAYA 4EOQA 3OXZA 1U4DA 3EQCA 3WZEA 3W2SA 2VTPA 4CRLA 4MXYA 4U81A 3ZOSA 1OPLA 3PVUA 4H3BA 4KKEA 2HOGA 1F3MC 1W98A 4MF1A 3E92A 2JGZA 2Z7RA 4HGEA 3FMNA 1PKGA 4GRBA 2HENA 3Q9XA 1ZZLA 1PMEA 3OHTA 3TNIA 4XOZA 2C6KA 2PTKA 2YZAA 4NTSA 1RJBA 2BRNA 1AGWA 5M4FA 4YLJA 2WQOA 3GUBA 2YM4A 5AX9A 4E1ZA 4ENYA 4FG9A 5L4QA 3ORZA 4APCA 1H27A 3VS6A 5C4KA 2H96A 5FDPA 2GQSA 4PP9A 5FGKA 3ZH8A 4JQ7A 4DFXE 3BGZA 4GVAA 4QD6A 5I9VA 3U9CA 3DJ7A 4ENXA 3Q5IA 1GZKA 5B2LA 3RNIA 5DI1A 4C62A 2QURA 2W17A 1K9AA 2W5BA 3C9WA 3FC1X 4AN3A 5G6VA 2I1MA 5GZ8A 4I6FA 3TNQB 1Q41A 3QA8A 3MPTA 4FIGA 4QP4A 3U87A 4CMUA 3AC4A 5EDPA 3IW7A 4OT5A 2QU6A 4WNKA 5ANJA 3RZFA 3ORKA 4GU9A 4EC8A 4NFNA 2WOTA 5I4NA 4FIFA 4FSRA 4L44A 4R5YA 5IF1A 3UZRA 5FTGA 4AGWA 5DN3A 5CT0A 5ANGA 2R7BA 4MK0A 4G6OA 2QNJA 3WOWA 3KB7A 1GOLA 5T3QA 1Q8ZA 2GNIA 3CPBA 4CKRA 4HYIA 3HMIA 1Y91A 3PZEA 3Q5ZA 2ZV9A 3QQLA 4CRSA 4CTCA 2PUIA 4M68A 5EQYA 4R77A 3UC4A 3KMUA 2HWOA 3DJ5A 1M2RA 4F7LA 4AOTA 2JDVA 4U80A 5E8ZA 4TZRA 4A07A 1Y6BA 4EUUA 2C3IB 1L3RE 2VTRA 5ACKA 3DY7A 3ALNA 3KREA 3P9JA 3QHWA 5AEPA 5I9YA 2QG7A 4C33A 1URCA 4QNYA 4FT7A 2VWUA 4DFBA 4CMTA 3UYTA 4DN5A 3V5WA 1PKDA 4M3QA 1SVGA 2PPQA 4MQ1A 5J9LA 4FYOA 4W8DA 5LWNA 4JXFA 1G5SA 2OF2A 3PJCA 1XH8A 4BZNA 4FNYA 4E4XA 4ERWA 3DPKA 4ANMA 1CKJA 3ZSGA 3FI3A 1KOAA 3GU8A 4HYHA 4XV2A 5DR2A 5CU2A 3R7VA 3JS2A 4MBIA 3PPKA 3QWKA 4AS0A 4ZZOA 2BTSA 2KULA 4BIBA 2C4GA 4O7RA 2UZLA 4U97A 1E1VA 3HMMA 2XK9A 3E8NA 4FKVA 2FYSA 5CASA 2IZUA 3QRJA 3BYMA 3VBTA 5HVJA 4EH8A 4GMYA 2HK5A 1P5EA 1R39A 2IWIA 2JKMA 4RLLA 4QP7A 4RWIA 3FHIA 3N51A 4YTFA 1Y6AA 2WQBA 4FL3A 1R0EA 2OIQA 4UB7A 4OTHA 4LGHA 1WBTA 5AP6A 2WAJA 3W32A 4I3ZA 4PWNA 3TUBA 3SGCA 4HOKA 3O23A 4F4PA 3R00A 4IH8A 3DZOA 3H4JA 3R73A 2C6LA 4FKUA 3HVCA 4FKWA 2CGUA 1SNXA 4B0GA 3HECA 4RZWA 4CFNA 2BTRA 3R01A 2VD5A 4GYGA 5IQIA 3FZTA 4D55A 5HQ0A 3FY2A 4FTCA 5HTIA 4CT1A 2YACA 4C4GA 4BKJA 3FJQE 2VUWA 5DIAA 5E1SA 4LOOA 2CKPA 2P2IA 3ATTA 2CGVA 4KNBA 3AGLA 4TWOA 3SRVB 2VTNA 4BDCA 3FLYA 1UU9A 4X21A 4O7WA 2I0EA 4OTQA 4S31A 4QP8A 4BBFA 3UVRA 1F0QA 3LIJA 3BLHA 4CTBA 5M4CA 4W4VA 3MSSA 3DKGA 2RG6A 4GUEA 4R3CA 3NUSA 3OEZA 3Q52A 4K33A 5D9HA 3E8CA 5FEQA 5LMAA 4BDFA 3R9HA 5HX6A 3OEFX 4YZNA 2VO0A 3QC9A 3SXFA 1M17A 4JT3A 4BL1A 5ANKA 3QXOA 5H2UA 4NFMA 3D5VA 1SM2A 2WTVA 3QQUA 4EOKA 2XKCA 4D4YA 4O96A 5J5SA 3DB6A 3KXGA 3OY3A 4M8TA 4QMTA 3D83A 3QZFA 1YI6A 4IWDA 5HX8A 3KRRA 5KMIA 2HZ0A 4Y72A 4A4XA 4ANNA 3KN6A 1ZRZA 3M2WA 5D7VA 4EOJA 4HVSA 1TQMA 2BZJA 2JFLA 4W4YA 3FUPA 4J7BA 3RPRA 4JDIA 4QMPA 5KMKA 1MRVA 4BYIA 5FUTA 4JX3A 5HE0A 1YXXA 5JQ5A 1BLXA 5DBXA 1OKWA 4OTGA 3MH1A 1FGIA 2W4JA 2ITZA 4A9YA 3L9LA 4DEHA 3UQFA 2UV2A 5AJQA 2V5QA 5A4EA 5FQDC 3BHVA 4FTTA 4JG6A 2WMBA 4LRKA 3LW0A 3JPVA 1OKZA 2UVXA 1FOTA 4MAOA 3TT0A 4R8QA 4JX7A 4JDHA 5J79A 2CNUA 3F7ZA 3KK8A 4LGGA 3FHRA 4HVIA 1Q99A 4U8ZA 4EWHA 5M09A 3KMWA 4YU2A 2GSFA 1H00A 2KTYA 5CSVA 4EOSA 5BQ0A 4JBPA 5GZAA 1Q8TA 2VTOA 4JI9A 2YAKA 5HGIA 2GHMA 3QUPA 4O7ZA 3HA6A 3G9NA 3IQ7A 3HV6A 4PTEA 3U6JA 2W99B 3QQGA 4TYEA 3SW4A 3BHHA 4IDVA 1H26A 4AA0A 4D2VA 4C7TA 3LLTA 2ZB0A 2ESMA 5JN2A 3N4UA 3PIZA 3U4UA 3AD5A 5AR7A 4CCBA 2R3GA 5HLWA 1AQ1A 2BRBA 2EXCX 1JKTA 2ZM4A 1EH4A 4ANQA 3ZDUA 3OCBA 5HO7A 5JRQA 4H39A 3BLQA 5CQUA 5EM7A 4DG0E 3DU8A 2W1FA 3QTZA 3LMGA 2FA2A 4O21A 2WD1A 4CD0A 2VO6A 3ENHA 3MJ2A 4NTTA 1KUTA 4AZTA 1L8TA 4D28A 4ID7A 1OUKA 4DH1A 3LCSA 2QO7A 3P1AA 4FMQA 4D2SA 4ZTRA 1Q24A 5FRIA 3Q2MA 2WTJA 4FL2A 3QTIA 1IAHA 4NM0A 3NAYA 3PTGA 4EHVA 4RWKA 2G1TA 5J8IA 5L3AA 1NXKA 2Y7JA 2PE0A 4Z7GA 3BKBA 5EOBA 2XIZA 1PXMA 3V5TA 4BI0A 5KZIA 4RT7A 4EH3A 5BX0A 2GNJA 5CEOA 5KBQA 2E9UA 1YRPA 2PHKA 4BDJA 3D5UA 5IUIA 3AT3A 4YTIA 3W55A 2HW6A 1P4FA 3QL8A 4RIOA 1GZ8A 3PXQA 3I6UA 4GFMA 3LCOA 3BI6A 4MCVA 5HTBA 5I5ZA 5HBEA 4OAUC 2I7QA 5BYYA 1OVEA 3TWJA 4QPAA 5DE2A 5HO6A 3CD3A 2C1AA 3WZUA 3P7CA 4O7YA 1ZMVA 5M56A 3IOPA 2PMNX 4IM0A 4X2NA 5DRDA 2YM5A 3KRLA 2QODA 3DFCB 5K5XA 3HGKA 2J51A 5LARA 3PVBA 1SYKA 1PYEA 2BR1A 3OCTA 3EN6A 4L3JA 4M66A 1PXKA 1ZYDA 3UO6A 1P2AA 2YEXA 4LFIA 3MTFA 3QBNA 3RPOA 5J95A 1XH4A 3GU5A 4BGGA 4UY9A 3Q6WA 4IWPA 5EKOA 5FLFA 3SXSA 1JBPE 4XRJA 3T3VA 3OT3A 2C3KA 4CMOA 4TTHB 1BKXA 2R3MA 5CENA 5CU0A 2ITXA 4MXAA 5L2WA 1H07A 1B38A 3DK7A 3HLLA 3KK9A 3D14A 3DNEA 1FVVA 3RM7A 4WUNA 3ORNA 4MF0A 3LCKA 5DT0A 3EOCA 3BV2A 4JG8A 4XV3A 2X2LA 4QTAA 3D94A 5EQEA 2UW0A 1PF8A 4MH7A 3HRFA 3K3JA 3WZKA 4F0FA 4GK2A 5M55A 3LLAA 3S00A 2LGCA 1PMUA 2XIXA 3VF9A 1PJKA 4OTPA 4PL4A 3VUTA 2ITNA 3II5A 2ERZE 2VTLA 4EOLA 1WVXA 1QPCA 3I81A 4WA9A 4YZCA 5GJDA 5LVNA 4FEXA 3Q9WA 2PZIA 4IFCA 4IANA 4DGGA 3F69A 3AXWA 5HEZA 1JKSA 2XJ2A 3VVHA 2CGWA 1R1WA 4ZLOA 3ZSHA 4Z3VA 4JVGA 4YHJA 4I41A 3PA4A 3PXYA 4C4JA 4HYSA 4FVPA 4CFXA 3R8UA 2BVAA 2F7ZE 3A61A 4DG3E 5LVOA 3VW8A 4G5JA 4NSTA 3OTUA 5F95A 1M14A 4J97A 3ZEPA 5LQFA 1PMNA 2B52A 3H9OA 3FL5A 4Y73A 4L68A 3TTJA 3F2RA 2ITWA 4EHEA 3QTXA 3EL7A 4IX3A 4MXCA 3I79A 2W1HA 4MBLA 2CNVA 4TNDA 4XV1A 2CHLA 3FXWA 3T9IA 3U54A 4MWIA 4QMXA 2VN9A 5IMXA 4YLLA 2CNQA 5IA1A 3NUUA 2YCSA 2C1BA 3E87A 2J2IB 1FQ1B 3L8PA 3POZA 3ITZA 3GU7A 4FV6A 3E88A 4IZYA 3VBWA 4EORA 3SW7A 5EW8A 3MTLA 3EKNA 3EQHA 1OITA 3QD4A 4OR5A 1PXLA 1YW2A 4X3JA 3UG2A 4BDIA 4FSUA 4O6EA 3FV8A 4BDAA 2J7TA 2B0QA 4Q5EA 4OAVB 3ZO3A 2WQEA 3V3VA 5BNJA 1H28A 4QTDA 3ULZA 2W1ZA 5CF8A 2Y0AA 5EYCA 4KIPA 3EFJA 4OT6A 5F4NA 4A9UA 3ID6C 2OIDA 5DEYA 2G01A 4HW7A 1ZAOA 2Z60A 4KS7A 2QLQA 5TOZA 1UU3A 3NCGA 1UNHA 4IMYA 5GIOE 4G2FA 3NNXA 3WIKA 5BVFA 5CI6A 5CF4A 3TI1A 4PPCA 3TZ7A 4ANLA 4BDEA 2OICA 5ANIA 5IA5A 3N4VA 2DUVA 4XNEA 1X8BA 1FMKA 5KBRA 3IOKA 4RC4A 4RIYA 1LR4A 4OUCA 4BI1A 5CZHA 2WXVA 2E9NA 3DV3A 4K77A 4ZTMA 1OL2A 4UBAA 4DH5A 2W1DA 3C0IA 1CSNA 2ZMCA 5IQBA 3TM0A 3Q4ZA 5DMZA 4ZSLA 5CTPA 1PHKA 4RQVA 3FBVA 5IH6A
chains in the Genus database with same CATH superfamily
3UNKA 3HV7A 1Z57A 3KVWA 3NIZA 4WO5A 4YNOA 2BALA 2FSLX 3ZFXA 3F5PA 5AUUA 1WAKA 3F3VA 3A62A 3H0YA 3UMWA 3L9NA 3UO5A 4AZFA 4ANSA 1V1KA 1KOBA 4ACHA 3MFSA 5CLPA 2WMQA 3FY0A 4WRGA 4G9CA 5D41A 4CNHA 3O96A 2Y4IB 4CV9A 3EZRA 4JAJA 4RJ8A 2XCHA 3PG1A 4JNWA 3UQGA 2R3RA 3QCYA 4NJDA 3ZCLA 4EHZA 3ZU7A 4WHZA 2OF4A 3PPJA 4L3LA 4I5MA 4BN1A 2PK9A 2W5HA 2B4SB 2UW7A 4LRJA 3L8VA 4IDTA 3PY3A 4QOXA 3CKXA 5BPYA 3V51A 5HG8A 4PL3A 3MYGA 2Y4IC 5IQAA 4WOVA 3RINA 5BUIA 4DTAA 4FIIA 3OTVA 5FP5A 3TJDA 4XJ0A 5IQFA 1UNGA 3DCVA 3ZLSA 3DS6A 4ZK5A 3EKKA 2SRCA 3G6HA 4J8NA 3NW5A 3PP1A 3LXNA 5JGAA 3F3ZA 4MQ2A 5EK7A 4L42A 5ETCA 4J71A 3SA0A 3HV3A 3PWYA 3WE8A 4KRCA 1W83A 3BYUA 2WZJA 5ANDA 4FV9A 4JIKA 3R8MA 2VRXA 3AOXA 1ZMUA 4RWLA 3SHEA 3WYYA 4DGNA 3RHXA 2A4LA 3R22A 5FBNC 5BVDA 3FKLA 4R1YA 1VR2A 3LXKA 1GZNA 3QCSA 3COHA 4F6UA 4F70A 3GGFA 3NS9A 3DKCA 3JY0A 4KA3A 5D1JA 5IISA 3KRWA 4PNIA 3ELJA 3KY2A 2WFYA 1PRYA 3MI9A 4H1JA 3F5XA 5HLPA 4ITIA 3A8XA 2XVDA 5CSHA 3VN9A 3GXLA 4L67A 4G3DA 4BWXA 4E7WA 1YKRA 3DAEA 2QO2A 4EI4A 3OCGA 4EKLA 4BTJA 4ACDA 2NO3A 4LG4A 4FTMA 1V0OA 3LMIA 4I0SA 4BCFA 4D2RA 3A7FA 3DDQA 5IUHA 4LL5A 2F7XE 4UV0A 2IZTA 4WIHA 1YXTA 3R9OA 5JKGA 2ZM3A 2EWAA 5B0XA 3FMDA 4NJ3A 2GNFA 3BLRA 5HCZA 4JBOA 3W33A 2YZLA 5K9IA 2C0OA 4ZZNA 3A4PA 4TYIA 5AM7A 4WBOA 2WMRA 3UOJA 1GNGA 1WBOA 4DTBA 3NZ0A 4P7EA 4YPSA 4FX3A 3V5PA 3S95A 2PU8A 3O8PA 5C9CA 5HOAA 1PY5A 4FZ7A 4DE4A 2PWLA 3NUYA 5HE1A 5CEMA 3PVWA 2NRUA 2Y6OA 4RIWB 3WYXA 2VWIA 3CLYA 1JNKA 4EH4A 1DS5A 4FL1A 4LOPA 1ZWSA 5CY3A 5L6WL 1XMLA 5JSMA 2F4JA 2YAAA 5AIRA 3Q4UA 4TWNA 4FUYA 4JMQA 2VTJA 4ZSJA 1ERKA 5HD4A 1IR3A 3W0RA 3KXMA 3P86A 2GS2A 3ET7A 4DEDA 1M2QA 1KWPA 3FC2A 3PFYA 3RAWA 3MESA 3VUHA 3UE4A 3TCPA 4H3QA 2ZDTA 1FGKA 1G8KA 2X81A 4NUSA 5E91A 4BCJA 5CU4A 4O0WA 1UKIA 2WNTA 3MVMA 4C58A 3TZ8A 2UW9A 2WTDA 5I9UA 3NYOA 2VNWA 3Q2JA 2BZIB 2WEVA 4O0XA 4Y5QA 4USFA 2VWVA 3CGFA 3K5UA 4N70A 4NIFB 2EVAA 3DXNA 2ONLA 4QTBA 3AGMA 4FV2A 2W1GA 5EW3A 1Z9XA 3EH9A 3LCTA 3F3TA 5K0XA 1A06A 3V04A 4DEGA 5CT7A 4H3PA 2ITUA 2XKEA 4MBJA 4ZTQA 5CXHA 4IEBA 5CSXA 2XP2A 4DHFA 3Q6UA 2JAMA 2OI4X 4ZTLA 2W1IA 2JDSA 1W8CA 2RIOA 4CLJA 2QOHA 5CNOA 3VIDA 3ZRKA 1M7QA 3E7OA 4WSQA 1A48A 5HORA 2QR8A 3HDNA 4GFOA 4EJNA 5ETAA 3CPCA 3Q3BA 1H8FA 3UJGA 4DYMA 4E8AA 4RA5A 4GKIA 4MD8E 1PW2A 4ZTHA 4G9RA 5FD2A 3OWLA 3FKOA 5EM5A 2BAKA 5JEBA 3F9NA 3HL7A 4PTCA 3ZFMA 4AW2A 4DINA 5DFPA 5CZIA 2VAGA 3MH2A 3R7UA 4HGTA 3W0OA 3UZPA 2WIPA 5JK3A 5DRBA 4UMRA 2WEIA 1QCFA 3E5AA 3GFEA 3LPBA 3A7JA 2PL0A 4FTUA 5M4IA 3SVVA 2H9VA 3KA0A 3ZXZA 2OJGA 3BU5A 2EXEA 4IJPA 4D1XA 1OBDA 2WB8A 4FBXA 4ALWA 4XG2A 4FTLA 2O5KA 3ZC6A 5HU9A 4IADA 4GFGA 5C27A 3EMGA 4ALUA 2PVNA 4DGLC 4IAIA 3R1YA 4YZDA 5E8SA 5H8GA 2QKRA 2B53A 4YMJA 2CLXA 4PMSA 5HCYA 1CDKA 1YOJA 2YM8A 4FG7A 1S9IA 4ARKA 3C4CA 2VTSA 5A46A 4QMNA 3BQCA 1ZYJA 3RAKA 4J98A 4MXOA 4W4WA 4W9WA 4RJ3A 4F09A 2BRMA 3ERKA 3FYJX 4BKYA 2JAVA 4I93A 4QP3A 4AAAA 2PVRA 2X7OA 3RTPA 4D1SA 5FEDA 3PSBA 3IPHA 5DPVA 3VHEA 4M0YA 4R5SA 4AA5A 5AM6A 4AU8A 2XJ1A 4PP7A 2JDTA 2YLEA 4BIDA 4GK4A 3E7VA 4U42A 4DGOA 1XHAA 2WTCA 4BDBA 1V0PA 3LQ3A 4A06A 2YCQA 4CQEA 3MIYA 4F7NA 4OTFA 3FLWA 2C6IA 5GZ9A 5BMSA 3SQQA 3IW5A 5IQHA 5AAFA 1Q8WA 2B9JA 3NAXA 4N4SA 4E26A 3EQGA 5J9ZA 3FZSA 5HG7A 4JBVA 2V7AA 3VS7A 4BCGA 3BE9A 4EK5A 5KKRB 2Q83A 4E4NA 2QQ7A 4E93A 2HW7A 3PIYA 1GJOA 4YUQA 4QP6A 4FK3A 2CKEA 1YWRA 4IZ7A 4KBCA 3V8TA 4G17A 4AF3A 4LUEA 5AV2A 3W18A 3R8LA 4O38A 4BTMA 1BX6A 1KE9A 5IDNA 5AR5A 4RBLA 5KKRC 2X6EA 4X3FA 1YHWA 3HUCA 4I24A 4O2PA 3O0GA 5AUWA 4C2WA 5JFXA 5IZFA 3PDTA 4D2PA 2VWYA 2BCJA 3NIEA 3BYSA 5AV4A 4ZZMA 4JDKA 1NT2A 3ATSA 3R7EA 4NCTC 4UMQA 4AZSA 2VWWA 5L8JA 4AP7A 4K2RA 4EYMA 4IVAA 3QX2A 5IPJA 4QNAA 4R78A 3LFSA 3IK3A 2QI8A 4GT3A 2UW6A 1OIYA 2Z2WA 1OB3A 2E9VA 3DKFA 2OWBA 2Z7QA 4HNFA 3IGGA 2YM3A 4X2GA 5D7AA 3EYGA 4DFUA 4KIOA 2XZSA 5CEPA 5I9WA 4MTAA 1UWJA 4FKLA 5CYIA 4FZ6A 4D5KA 3MVHA 3S0OA 4NM3A 3QTRA 4BI2A 5M57A 2IW6A 3HKOA 4KIKB 4RX8A 2JBPA 2C0TA 5KMMA 4MNEA 3VRYA 3VUDA 2IPXA 4FGRA 1UVRA 5M07A 3RK9A 1WVWA 1Z5MA 2PUNA 4RQKA 3FZOA 3LKMA 2Q0BA 1J1BA 1VYWA 5K0KA 4M0ZA 1J7LA 2JDOA 2XK7A 1VZOA 1QPDA 3P0MA 3C4ZA 2J0MB 2VX0A 3FPMA 4V04A 3ZLYA 3C5IA 2JD5A 3FZRA 3QD3A 2BROA 3KULB 4HPUE 1XBAA 3GI3A 3R1NA 2DS1A 5LXMA 3RAIA 1PMVA 1O6LA 1LEWA 5EYMA 1YXUA 3BEGA 4APPA 5C4LA 3VBYA 5AP0A 3ANQA 2XK4A 4NH1A 2QOIA 3CE3A 3I60A 4AOJA 2X6DA 2GPHA 4KSQA 1ZMWA 3F66A 1B6CB 3S4QA 4DT8A 5B7VA 1UV5A 2BILB 4BC6A 4XP2A 5AUXA 3MH3A 5A4TA 2JC6A 2YITA 4ACCA 3G51A 4Y83A 3CJFA 2V62A 4EH6A 4FKRA 5EI2A 3U8WA 1W0XC 4GS6A 4IVDA 2R3KA 3CGOA 3FQSA 4PTGA 4AXEA 2OK1A 3IECA 5K3YA 4YHFA 1ZARA 3KXNA 2O2UA 3ETAA 5KUPA 2P4IA 3HRBA 4TPTA 5GJGA 1Q4LA 2GFSA 3MY5A 4L7FA 2NP8A 5CEKA 3PXRA 5EHOA 3COMA 3PY0A 3AG9A 5IQDA 3K3IA 3LQ5A 4L6QA 4QTCA 3PJ3A 3WIGA 4I23A 2HELA 3QQKA 3H9FA 1TZDA 1KE5A 4JDJA 4ACGA 3L8XA 4MNFA 2W5AA 5KHXA 5ANEA 5CAOA 4BCHA 5L2SA 3D7TB 2R3IA 3IONA 1YOMA 4K11A 4QYFA 3ZBFA 2GTMA 2OJIA 3UIMA 5IEXA 5EM8A 4ZJJA 4QPSA 4FKSA 3R8ZA 4H1MA 4TYJA 1YXVA 3JYAA 3LFEA 2QO9A 5C1QB 3RWQA 1H01A 4BTFA 1OPKA 4XRLA 1ND4A 3TDVA 3LJ0A 3PA3A 5C8MA 5DNRA 5FM3A 5J9YA 3PRFA 4OTDA 4LOQA 4M7IA 2UZDA 3NCZA 2C6TA 1WBVA 4C59A 3G90X 4FUXA 3WF6A 1ZZ2A 2FB8A 2X2KA 3LFDA 4KABA 2OFVA 2JDRA 4FT0A 3ZM4A 4BDHA 3W0MA 4NYEA 2QOKA 5AR4A 2X7FA 5L2QA 2XBJA 3RP9A 1K3AA 3RCJA 3AMYA 4IB1A 2WIHA 4YLKA 5A4QA 2Z02A 4EH9A 4QP2A 2XK6A 4BWPA 1SNUA 4KRDA 2X2MA 3GOPA 4X6QC 4Z55A 3ZUVA 5DWRA 2IVSA 3ORPA 5EW9A 5FXSA 4YP8A 2OJ9A 2XNOA 4O22A 4DH3A 2NPQA 3MFRA 4HPTE 4NKAA 4FR4A 5FP6A 1G8SA 3R7IA 4TNBA 4EOOA 3NUXA 4F7SA 2JEDA 4DBXA 4DLJA 5F9EA 5JQ8A 2PMIA 2X8IA 4RFYA 5IA4A 4U41A 2FO0A 3NWWA 5FTQA 4EC9A 5JT2A 3E3PA 4WNMA 3O2MA 3FI4A 3NUAA 1MRYA 2YN8A 5BYLA 2C6EA 2YDKA 2I0VA 2XF0A 3AC5A 4FSTA 3D2IA 4IB0A 1JKKA 3KGAA 4A4LA 5AA9A 2OGVA 2VWBA 5KX8A 3FLSA 4DT9A 2GQRA 3BWJA 5BVOA 3OC1A 4YPDA 3W8LA 4ZY6A 4AG8A 3DXQA 2W96B 4FZFB 2WMVA 4G3FA 4O0TA 2ETKA 4M12A 5BVWA 4P2KA 1YQJA 2R3HA 3TJCA 4ONAA 2PSQA 4AX8A 4EK4A 3R1SA 4K18A 4LQMA 3FZPA 3E63A 5BMMA 3HAMA 3GC8A 4IWOA 4GT5A 4KD1A 2R3NA 2J6MA 3UOKA 1JSVA 1QL6A 3PJ8A 1U59A 3RAHA 4IX5A 3JR1A 4YTCA 3P4KA 5C8NA 3MPAA 3MB7A 3QGYA 3NFGB 4RWJA 4D58A 3W2CA 4ZS4A 3GVUA 2XM9A 1U54B 2XBAA 2UVZA 3OXIA 4UYNA 4M97A 2QD9A 4FOCA 3BBTB 3I6WA 3MWUA 5C03A 2P0CA 3OXTA 4GT4A 4IM2A 5TT7A 5M4UA 2BRGA 3POOA 5FXRA 3O5AA 5CSWA 4EOIA 3JUHA 2QR7A 4XS2A 4NL0A 3HMPA 4PUZA 3SX9A 3ALOA 1JSTA 4TYHB 1KE7A 3KL8A 1ZYCA 3KN5A 4R3PA 3GU6A 3MW1A 5EH0A 3ZO2A 4FEVA 4FI1A 3FE3A 2PMLX 5KNJA 1SZMA 4EQUA 4CFVA 3UDZA 3R8VA 3IW8A 4Y85A 2J9MA 5DEWA 3TV7A 2XCKA 4O4FA 3TZ9A 4C02A 5KZ0A 4F9YA 2GHLA 1KE6A 4BCMA 4EUTA 2ZFYA 5JZJA 3HNGA 4M84A 4S2ZA 3W16A 4DLIA 4HVGA 4UMTA 5LCJA 2J5FA 2W9FB 4RIXB 3C13A 5A6OA 3OROA 4XLVA 4YBKA 3HP5A 4QT1A 3DBEA 3TV4A 3DNDA 2Y6MA 5L6OA 4MD7E 2VNYA 5AP1A 2GMXA 4F7JA 3BRBA 1OZ1A 4EYJA 3V5QA 3QRTA 4MYGA 4FZAB 4ZP5A 2BUJA 2QU5A 3JVRA 4KB8A 3PRIA 4FSZA 2UZUE 2YHVA 3CY3A 3V6RA 4S33A 5GJFA 4A7CA 4U79A 4NU1A 4XG8A 2X1NA 1SVEA 2Z8CA 4YC6A 4IXPA 4TRLA 3R1QA 2C5NA 1BI7A 1YDRE 5AP3A 3AKJA 4O7VA 4CFMA 2PZPA 2R3QA 4IB5A 4AQKA 5HHWA 5CF6A 4Y8DA 4D0XA 3BYOA 4YC3A 3RNYA 2O3PA 3VW6A 5CNNA 2ITQA 2OXDA 3DT1A 1JQHA 3A99A 4KKGA 5CAUA 5IQEA 2XH5A 2ITPA 3GCUA 2CCIA 3QKMA 4FJVA 4QYEA 2VV9A 3FSKA 3VO3A 4E5BA 3F6XA 5K4IA 1ZYLA 4Q5HA 3LMHA 3AT4A 1E1XA 4O0VA 4NZWB 2WPAA 2ZYBA 1H0WA 1LUFA 3B8QA 4FTAA 1U5RA 5EG3A 3VF8A 3ZMMA 5M51A 3U6IA 3NYVA 4E5AX 4J99A 1WBSA 4O27B 1IA9A 3P5JC 3MJ1A 4AXFA 1OMWA 2B9IA 1WBWA 3QCXA 5DT3A 3BQRA 3SRVA 4MXXA 4AN2A 4CFFA 4YJRA 3FMEA 3MFUA 4O1OA 5M44A 3PPZA 4O83A 2OIBA 3AMAA 2Y8OA 3BIZA 3NSZA 1MRUA 1FVRA 4OBPA 2C6OA 3ODYX 1P14A 3SOAA 1FVTA 4BJJA 4IQ6A 2WTKB 3IDPA 5AAEA 2BKZA 4BR3A 2O8YA 3V01A 4JLCA 4QDEA 4ASDA 4FKQA 2WTWA 1MQBA 3JVSA 4YJNA 4FC0A 1M52A 3SLSA 4BZOA 2DYLA 3CTHA 3CEKA 2WKMA 3QUDA 1GIIA 1J91A 1XH5A 2ZM1A 3OOMA 2WTKC 1PXIA 4MD9E 3FDNA 3MVLA 2CCHA 2VTQA 4IHPA 4PMPA 4OBOA 5FXQA 4QYYA 1W2DA 4IM3A 3WE4A 3ML1A 4YNEA 5BUJA 2QOQA 1UA2A 4C0TA 1WBNA 3M1SA 3KFAA 4YHTA 3DAJA 4O6LA 5D12A 3V8WA 3UVQA 4IAYA 5AX3A 4JBQA 1Q8UA 2BHEA 2WMWA 4YZMA 4F9BA 3ZO4A 4NM5A 3VRZA 4ZLYA 2A0CX 4J1RA 2UZBA 4BCIA 4WSYA 1MP8A 2XEYA 3AT2A 3EN9A 2J0LA 1ZYSA 2GS6A 2ITYA 3A7IA 2R0IA 4NEUA 4ANOA 3WZDA 4X2JA 5J7BA 4BWKA 3VONA 5M06A 3QAME 3H10A 5DVRA 2V55A 3UQCA 2ZOQA 4F64A 3KXXA 2CKOA 3LOKA 3AC8A 4B9DA 3MA3A 4M69B 3R02A 2CJMA 3VWAA 3TG1A 5HLNA 3DA6A 1YVJA 3RM6A 3NVMB 4BTKA 3BLAA 3ZS5A 3R30A 3BWFA 4F1MA 3CQEA 3KC3A 3P7AA 4V0GB 4B99A 4O7NA 3WI6A 1F5QA 3ACJA 3PXZA 3KCKA 4BHZA 2GHGA 5G1XA 1CTPE 3QTQA 5F1ZA 2H34A 3C1XA 3NNVA 3CIKA 4CVAA 2F57A 4FOBA 4IZAA 3A60A 1WCCA 3HZTA 4ZOGA 4H58A 3R7OA 5IA3A 5KMOA 4O0YA 4BRXA 4FVQA 4C4HA 1YDSE 2O64A 4USDA 4FICA 4AGCA 4HVDA 3CD8A 2FH9A 5A3XA 3NNUA 4BCQA 2PUUA 4XEYA 3IDBA 2I40A 1DM2A 4O4DA 3K5VA 4YJPA 2IW8A 4AGUA 3I5NA 4C4FA 3COIA 2R0UA 3LXPA 5T6KA 3I7BA 2YM7A 5AADA 4TWCA 2R4BA 3NNWA 2H8HA 2X8EA 3JY9A 3DXPA 3KCFA 3PXKA 3I5ZA 4LUDA 3VUGA 3KEXA 4E6QA 1O9UA 3WF5A 3WZJA 3CY2A 5CI7A 3E8DA 3Q53A 3VS0A 4WG3A 2B7AA 3ORMA 4E3CA 1ZY4A 2R3FA 2RKUA 1T46A 3OD6X 4ITHA 4DDIA 3VUKA 3K2LA 5JZNA 2XIKA 5E1EA 1GZOA 2WGJA 4MKCA 3R2YA 3P23A 4RGJA 3QUEA 2UZNA 5LMBA 3PZHA 3VS3A 4E4LA 4RVTA 4HVHA 3WF8A 2UW4A 4QMVA 3NX8A 3IO7A 4U3YA 4WNPA 4YJTA 1E9HA 2HY81 3W0PA 5KMLA 4IW0A 1YDTE 5A4LA 3I1AA 4XG6A 4AOIA 3Q4CA 2HAKA 2FGIA 2XNGA 2CGXA 1PXJA 3UVPA 4YSMA 4LDTA 4PV0A 3PY1A 4I6HA 4DDGA 2GCDA 2J0JA 2BKKA 4BFMA 5A4CA 4QMLA 1FMOE 4QMUA 4WBBB 4BIEA 4KUJA 3HP2A 4S34A 4CZTA 5CVHA 4AW1A 4RVLA 3W1FA 3RJCA 1JVPP 2VX3A 1J7IA 4YC8A 4E73A 3BHUA 4D4SA 3UDTA 2XMYA 2GTNA 4DCEA 5J1WA 3ZHPC 4UXQA 4ZY4A 3QU0A 4AGDA 1I44A 3QD0A 2V0DA 5CALA 4Y95A 5L2IA 4M67A 4L8MA 4BF2A 3ZBXA 4A9SA 1A9UA 4N6YA 4AFEA 4K9YA 3BZ3A 1W2CA 5DR9A 2X0OA 3OT8A 4XBUA 1KSWA 3UIXA 4AE6A 5AP2A 3DTWA 3ZUTA 3HMOA 4F1OA 2OZOA 4J52A 4MHAA 3OG7A 1JAMA 2XKFA 2XS0A 2OZAB 1KE8A 2PZRA 3FQHA 3PWDA 5AV0A 4GJ3A 3QCQA 4MUQA 3LM0A 2G2IA 1Q62A 1S9JA 1YXSA 2PVHA 4I0TA 4XHKB 4I1ZA 1HCKA 5FBOA 4H05A 4RZVA 3VS5A 2A2AA 2IVVA 3KF7A 2BDJA 3RGFA 3VAPA 4Z7HA 2RSVA 3EQIA 4L43A 2OW3A 3ZZEA 4QMWA 3A2CA 4LV7A 3O51A 3DZQA 4L46A 2JKKA 4E6DA 5M53A 2R5TA 4EH5A 3RHKA 5C8KA 3M11A 2YM6A 4D5HA 4UWBA 4QTEA 3DBQA 1CKPA 4GIHA 5AWMA 3G2FA 3KU2A 4FKIA 2OH0E 4FZDB 4O4EA 3CS9A 3GB2A 1VEBA 5L8LA 4JL9A 1YWNA 4OTRA 4KBKA 3UG1A 4YGAA 2BZKB 2ZJWA 1CM8A 3MN3A 3Q9ZA 4QP1A 1J3HA 3GP0A 4WNOA 5HNIX 4UALA 3KRJA 5D10A 4ERKA 5TF9A 2F2CB 3SXRA 4BDGA 5LMKC 3B8RA 4E20A 3UPXA 5A6NA 4ZTNA 3GENA 4FVRA 4LMNA 4U5JA 4QMOA 2J90A 5CEIA 3TZMA 4D9UA 4PDOA 3EQDA 2B55A 2YDJA 4ZS0A 3OBJA 4F65A 4R7BA 3D5XA 3LFFA 4IVBA 4X2KA 4CQGA 3R8PA 3CR0A 2O63A 5IQCA 1NVRA 2OO8X 4HYUA 3TDWA 3EHAA 3BGPA 2VU3A 2FVDA 2BHHA 4EZ3A 3K54A 2AYPA 3L1SA 3PIXA 4ASZA 4GUBA 4P4CA 1OI9A 5A54A 3UDBA 1URWA 3G9LX 4WD5A 3EFWA 3ZSIA 4U9AA 1H1WA 3FXZA 4TY1A 3TNHA 4BVUA 5EKNA 4PQNA 3WBLA 4USEA 3SD0A 3G0FA 2IEWA 5IEYA 1H24A 5EDQA 4EBWA 1G8AA 4C4EA 4ZEGA 3VS1A 2HIWA 4FT3A 1CKIA 3DKOA 5I3OA 2C5VA 3PP0A 1Q3WA 3H30A 4TWPA 1ZLTA 3FI8A 2DQ7X 2QCSA 3IKAA 4XP3A 4DFZE 3U4WA 2PVFA 2QHMA 4OBQA 3I0OA 3NVKI 2XNPA 2XARA 2YIWA 3PVGA 3F3WA 2XYNA 3PSCA 2IVTA 4IAKA 3LZBA 4O0UA 2XYUA 4RJ4A 2RFSA 4YTHA 2IZSA 4C2VA 2XNEA 4I22A 2P33A 3EL8A 3R2BA 1NVSA 3LJ2A 2JLDA 4UN0C 1XR1A 1YHSA 3SOCA 4DHZA 4FKOA 4QO9A 4RMZA 4QMYA 4XH6A 2JBOA 4C36A 1XH7A 4EOMA 3EFLA 2YCRA 3U51A 4F0IA 3MS9A 3R7GA 3MBLA 5A14A 4NWMA 1H08A 4YJVA 3FKNA 4IWQA 4YJUA 3LHJA 3SC1A 4DC2A 3BELA 5JH6A 1ST0A 2ETMA 4UXLA 2VO3A 3C0HA 3QFVA 1B39A 3PE2A 4G3CA 4QYHA 3MVJA 2YIRA 4DH7A 4EZ7A 2OXXA 3LVPA 3P7BA 4KS8A 4FSYA 5EOLA 1DAWA 3NDMA 3TIZA 4FSMA 5HNGA 5TE0A 4O0RA 1RDQE 4GL9A 5DGZA 4XP0A 4FTJA 4FV0A 2QG5A 2J5EA 2OJFE 2BIYA 3C50A 2RFNA 1O6KA 2A1AB 1ATPE 3HYHA 4B7TA 3QHRA 4PY1A 1PYXA 2UZWE 2WQNA 5HI2A 4EQCA 2I0HA 3G15A 3GU4A 4DITA 3SG8A 4ZJIA 3UOLA 3GC0A 2W1EA 3FWQA 3TMOA 3MB6A 3D4QA 2VTTA 5HE3A 5CF5A 2B54A 3EQBA 3AC3A 3HX4A 4YZ9A 1WFCA 2QHNA 3W2QA 1STCE 5FWKK 4B4LA 2YJRA 1R0PA 2PVLA 3TUDA 3E62A 3RZBA 3ZLXA 4ZJVA 1ZXEA 4U3ZA 3BU6A 4MX9A 2GNGA 4IAFA 2CN8A 4Y46A 5EYKA 3UBDA 4UWCA 2XIYA 4K8AA 4F9CA 4QQCA 4Z16A 1OIRA 3DAKA 1RQQA 3AC2A 5H8EA 2YLFA 2XAOA 2CLQA 5HESA 4X2FA 4UWYA 4BYJA 4FK6A 3OMVA 3OZ6A 5HVKA 4O81A 4FIJA 4GK3A 5IA0A 3BU3A 4FTIA 5HIBA 3F5GA 3L9PA 1KV1A 3FAAA 3EQRA 4ASEA 1IG1A 1W82A 4AZWA 3EN4A 4FSWA 4FKJA 4JQ8A 4JR3A 3ZONA 4QEBA 1W7HA 3OCSA 5H8BA 3RPSA 2VGOA 5KCVA 4KSPA 1K2PA 4LV5A 5IH5A 2C5OA 5IKWA 3RKBA 3ZM9A 2C5YA 3DK6A 3KXZA 4AA4A 4BBEA 3RBWA 2XK3A 2PYWA 4O7SA 2X9FA 3LJ1A 2J0KA 1FPUA 3NGAA 4JOAA 4KBAA 4DF3A 4RRVA 5CAQA 3OS3A 2F9GA 3W10A 5CX9A 4ZXTA 4AW5A 5KMNA 2BPMA 3MV5A 3HAVA 3C4EA 4RIWA 3MGYA 3TV6A 4F6SA 3C4XA 2NNWB 3G5DA 5C26A 2VTMA 3NYNA 5GIPE 1R78A 2YFXA 2RG5A 4XBRA 4U7ZA 3NUPA 3ZLWA 4O0SA 5K5NA 3UTOA 4LV8A 2ITOA 5E8WA 3PE1A 2GQGA 2UUEA 3T9TA 4AUAA 5DYJA 4IACA 1H1QA 3QZHA 4GEOA 3FZ1A 4UZHA 2PY3A 3FI2A 3GC9A 5JGBA 5IG1A 5CU3A 3LQ8A 5DOSA 4O7LA 3NUNA 1IASA 2YIYA 3MY0A 1GY3A 4A9TA 1BMKA 3TKUA 2YERA 1ZOHA 2WMAA 2YCFA 3DQXA 3LCDA 3NFFB 4GV1A 3ZDIA 3EYHA 1G3NA 4N6ZA 4NIFA 4EH2A 5HZNA 4BICA 2BZHB 1TVOA 2BMCA 2BRHA 3SG9A 2ERKA 4DCAA 2E9PA 4JR7A 3KVXA 5AUTA 4L53A 5E8VA 3R83A 4C37A 4CYJA 1BUHA 3BEAA 5HBHA 3RWPA 3WILA 4F6WA 2GFCA 1OPJA 5M08A 4BDDA 4IBMA 4PL5A 2OKRA 4TT7A 2WO6A 5GHVA 1GIHA 3UO4A 4F9AA 3A7GA 3BHYA 3PG3A 3IW4A 3SKCA 4G3EA 2J50A 1FINA 1OUYA 2WHBA 3CCNA 3EB0A 3FQEA 3DLZA 4G3GA 4AXAA 4BCNA 4DFYA 2BFXA 1XJDA 4BDKA 4E6CA 2QOBA 3Q04A 3W2RA 4O82A 2O65A 2BDFA 4YSJA 5E7RA 3FYKX 4RX5A 3UGCA 4GVJA 3Q60A 4F9WA 2G9XA 2NYAA 3GCPA 1I09A 3G6GA 2PMOX 3NLBA 3VS4A 3A7HA 3DB8A 3OW4A 3S3IA 4FTOA 3QKLA 4FKGA 3OVVA 2CN5A 1H1SA 2R9SA 4PMMA 5DT4A 4C57A 4YJSA 5A9UA 2HYYA 2W1CA 3ZUUA 2G15A 3RPVA 1XH6A 1OECA 3TXOA 1LP4A 3ZRMA 4L9IA 4WG4A 3QQJA 2HZNA 2XUUA 3P5KA 4R6VA 5HG5A 4DFLA 4EK3A 4L52A 5FDXA 4EKKA