1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
3VHKA 5CSHA 1L3LA 3MVHA 3CY2A 4EM0B 2F7XE 1QPCA 5CSXA 1UKHA 5A54A 3KXZA 5AR3A 5D7AA 1PP7U 4J52A 4KA4A 4ALUA 4DH5A 3BWJA 3GBZA 4D1XA 1DM2A 5AX3A 3DAJA 3IDCA 4FV5A 2W4OA 2NNWB 3P08A 3Q9VA 4GO1A 5A46A 1YDSE 3DKCA 4LOQA 4C57A 3W2QA 4U43A 1RDQE 1NVRA 3NEUA 2IVSA 1RW8A 3FLNC 4QMVA 3O17A 3NW7A 4BDGA 3M8FA 3VS6A 2JT1A 3DV8A 1DAWA 2E9OA 1YW8A 5I4NA 3W8LA 3MQ0A 3VODA 1U5TB 4EOKA 3T8RA 5FXRA 4ZTMA 1BI8A 4JOAA 3MPMA 4O0XA 5AIKA 4L9JA 1K9AA 2P6TA 3CTJA 2RG5A 4K8AA 4F4PA 2X0LA 2WHBA 4M84A 5K4IA 3QZHA 1W84A 4MTDA 1CKIA 4DAWA 5K5OA 2Z7LA 3F8BA 1P5EA 2JDSA 2W4JA 3E88A 5BOXA 1QPDA 3WTYC 5AUTA 1NHAA 3R30A 3LAPA 3LJ2A 4O7ZA 4ZSLA 5M4IA 3DZQA 3VO3A 1UB9A 5TO8A 5IUHA 5I3RA 1OR7A 1JSUA 3IOPA 1IN7A 1ZGJA 1YKRA 4O0TA 2OZAB 4BXUA 1VJYA 1XJDA 4RWKA 3FLZA 4L53A 4BCKA 5BS6A 4EZ7A 3CY3A 1Y6BA 4QMSA 3ZPLA 3U2RA 3BU6A 4PX6A 3R00A 3EYIA 2BKZA 3TACA 3RIRA 5HCXA 4C4JA 3NUYA 2UZEA 4DFUA 3V3VA 3PQJA 2VBZA 3QU0A 1V4RA 1ZMUA 5GJDA 3Q4TA 4WNPA 2VODA 3OW4A 4MKCA 4EOQA 3SOCA 3W10A 4RVMA 4K33A 2XCKA 1K2PA 3BU5A 4M69B 1OL6A 5IMXA 4DNCA 4I6BA 4EZ5A 3JXWA 4LL5A 3SG8A 5EI6A 2ELHA 3P7BA 3MGYA 4W4VA 3Q04A 3PY3A 5D41A 2WOTA 2VD5A 4AT3A 4S33A 1H1WA 5LMKA 3QU3A 3D15A 2Y6OA 4U0VA 2ZB1A 1R22A 2W7XA 1YXSA 4L9TA 1ZOEA 2KTYA 1ZMWA 4KMFA 2P55A 3KA0A 4WRSA 2J5PA 2PFBA 2C3JA 4TYHA 3EB0A 2JZYA 4BDEA 5L3EA 5DUIA 4E4MA 3REOA 1S29A 4IAIA 3LQRA 2PVFA 3P9JA 3TO6A 3OY3A 5C03A 4DTAA 3WTWC 4C35A 2PWLA 4WUNA 4FT7A 4RWJA 4BWPA 3DOGA 3MTLA 3KVXA 5B2MA 1JKKA 4AGDA 1FQ1B 2WD1A 2FNAA 2Y0MA 4D4RA 1WBNA 4V04A 4IACA 5DOSA 2WNTA 3LCTA 3DBCA 3R83A 2OBJA 4I98B 3QQHA 3QWKA 5HTIA 4F7LA 4CZZA 4FKPA 3VS3A 5JFVA 4PTGA 4I6HA 3HZTA 2XA4A 2PMNX 4CYDA 2W24A 3LXPA 2UW4A 3WARA 3LWFA 2R2PA 2C4GA 2YDJA 3O2MA 3PP0A 1W8CA 4DH3A 1AD5A 1JE8A 4CYIA 4WG3A 5KUPA 3HRCA 2DBBA 1PMEA 4HPUE 5AAEA 3F8NA 3Q5ZA 4MEDA 4PWNA 2B4SB 3R21A 3A7FA 4I6QA 4AE6A 2R3MA 3LFAA 5ETFA 3QCSA 3EFLA 4P90A 1JKTA 2HKXA 2DQLA 4D1SA 4RB3C 4EUTA 4YZCA 3LE6A 4W4XA 3OS3A 3O7LD 4EKLA 1RZ4A 3ZHPC 4M69A 5CAVA 3GF2A 1XH8A 2L02A 3PUPA 2RG6A 5HIDA 5EQPA 3B8QA 2OA4A 2W85A 5CVVA 2HW6A 1ZG5A 3CBLA 3ZM4A 1IN4A 3QCYA 3A99A 2UZVA 4DT8A 3ZUUA 5I3OA 2RGPA 2R3OA 4FZAB 4OT6A 2NNYA 2DQRA 1USSA 4PMPA 4BHNA 3R7EA 2FNPA 3VWAA 4E1ZA 4Y15A 4UZHA 2GNIA 4HGLA 4OIQF 3QTWA 5FUTA 3PJ8A 3E5UA 1QBJA 5HTCA 4PGHA 5KMKA 2J0LA 3OCGA 2G01A 5TE0A 4MXYA 4ZH4F 4FTMA 4NM5A 4P2KA 3CR0A 3TKIA 4ZSGA 5LOHA 3MA3A 5BVEA 2O0YA 1CF7B 3R6SA 2C5OA 3U4UA 1KE5A 3HDMA 2Y4PA 5HTBA 4RT7A 3HMIA 3D14A 4Q9ZA 2DPUA 2PVJA 4CG9A 3TUDA 3KCFA 3QGYA 4L52A 1D8JA 2IN6A 2QOOA 2GDOA 3FAAA 4JQEA 3W8QA 5KMJA 1B39A 4ZSJA 4AZSA 4DTBA 2YCSA 4DGOA 2XRWA 5IQCA 1XD7A 3VEPA 4IADA 5BMMA 1CKPA 4USDA 3ALOA 4LOPA 4IE9A 4F9BA 3CSVA 1VR2A 4YFNF 4ZTHA 1FVVA 5L6WL 2J6MA 4O7LA 2EV0A 5J7HA 1FSEA 4LLGF 4MYGA 2XIYA 3CO7C 3C18A 3DS6A 2QQBA 3DB6A 4AF3A 2NNNA 5EH0A 1PKGA 4EKKA 3FXUA 2P4IA 5J1VA 4FOBA 4RJ5A 3LMGA 3IWZA 3V5TA 1UNHA 5A6NA 3KMMA 4BCMA 3LFNA 1J59A 2OH4A 2XJ1A 3P79A 5EI2A 4O2ZA 5CLSA 5HLGA 4AP7A 4XUFA 5HG9A 4EQCA 3S1HA 4BZOA 3ELJA 4TWOA 1URWA 4RJ3A 2PZ5A 2ITZA 2I0EA 3QD3A 4FEUA 5JZNA 2YIWA 1JHHA 2PEXA 3MS9A 3R8PA 4IZ5A 4L5JA 4HZRA 4DEIA 3CTAA 3U51A 5ILVA 4S04A 4M9XA 4IHSA 4PDPA 4I21A 2VV9A 3ERKA 2F5DA 2CKEA 2O6GE 4OR5A 4DH7A 4RPVA 5AEPA 4YZBA 4CKRA 5CU2A 3LCOA 1KYWA 5J95A 1I5ZA 5C8KA 2EFNA 4YC3A 4XHKB 3ZDUA 3QPTA 1H08A 1PXKA 5EYCA 3N4MA 2OGVA 5HD4A 1ATPE 2GTMA 2WKMA 4OTDA 4G34A 5KKRC 4FKTA 1ZWSA 4CZYB 4BDHA 3G51A 3DPLC 3T8TA 4G6QA 3H4JA 3PLSA 3RZFA 4LUEA 4XLVA 5T68A 3H9RA 2CPKE 2WMBA 1HW2A 3ORTA 4FNYA 1B1BA 2WTIA 3FZSA 5AV0A 5C4LA 2ZV7A 5HI2A 2C6YA 2YJSA 2C0OA 2F7EE 3U9GA 3BU3A 2ONLC 2P2IA 4ON0A 2UZOA 2OZAA 3R63A 5AUWA 5JR3A 4A5NA 4FI1A 4AZFA 2PE2A 1I6XA 1EH4A 2X7FA 5IQDA 5C9CA 4C34A 5FM2A 3OUNB 3IRRA 2PI0A 1J0RA 4L42A 4O86A 4XG7A 2YM8A 2X0GA 4NFMA 3I6WA 4QP6A 4HQMA 2H94A 2RF9A 3NYXA 2RKUA 4CLJA 3TJCA 2XB7A 1JGSA 3GCVA 4E6QA 3NVKI 2MLKA 4EQMA 3KFWX 4GUEA 3QRKA 1OVEA 4JBAA 3QAHA 4APPA 4NL0A 2Z7QA 5HVKA 2MD5A 4BI2A 4BYJA 3V8JA 3MEXA 4ZIMA 2G9XA 4I93A 1KU9A 4EH3A 4TWNA 3JUHA 4KBAA 1IRGA 4BBFA 2ZNYA 4A4OA 2Y8OA 3Q60A 3R9NA 4L3JA 2ZJ2A 2WB8A 4CMTA 4N9HA 3PP1A 5DIAA 3C4WA 1UWHA 3BYUA 3ZRLA 3BLRA 1O6YA 4MWHA 3GT8A 1Q3WA 3ZO4A 3KEXA 1DDNA 1Y91A 3GCPA 2WAJA 2QBYA 2BRGA 3F88A 4HCVA 2ITOA 1ONVA 3PE2A 1VTNC 4I5CA 4ANSA 3UOJA 4L0ZB 4W8DA 4K2RA 2ZV8A 5KCVA 2ESMA 1LEBA 5CEMA 3PSBA 3E62A 4FTIA 4X2FA 1H4LA 3V7RA 3IKTA 5AP1A 4C3FA 1K3AA 4HCUA 2P5LC 2H6DA 4B09A 3DCVA 4ENMA 4GW8A 2X2LA 3OBGA 5KHWA 4RGSA 3OT3A 5E18F 5LGTA 3EYYA 1IRKA 4RX8A 3TN8A 2R0IA 3AMAA 2P0CA 3SX9A 1PUEE 1YRPA 3TUCA 4RS8A 2CN8A 2J51A 2CNUA 4X0MA 3FKLA 3ZUTA 3K54A 3TNQB 1W7PA 3ATTA 2JKKA 5KMMA 3ORIA 2GZWA 3ACJA 3LOKA 4YMJA 1XMAA 1PP8F 4IB5A 4Q2AA 3WTXC 1ZYDA 2J0JA 3V5PA 4ZYHA 5L3CA 2OH0E 2EV5A 1Z91A 1V1KA 4YLLA 3HV5A 3THBA 1FPQA 3IW4A 2OIQA 5H6QA 4XG9A 4P9UA 5CEKA 2R3SA 2WMTA 2FEZA 3UOHA 1WKMA 3CIKA 3N9XA 4KKGA 4YHTA 2WU6A 4RC4A 3R2BA 2C6LA 2FGIA 2VWYA 4CLIA 3QKKA 3BQCA 3D0SA 4CFXA 2K86A 2DYLA 3NNVA 3U54A 1OI9A 3EFWA 2PZRA 4AIJA 1ZRDA 3LSTA 1OYYA 1UU7A 4EWQA 3RPUA 2A1AB 1GXQA 3V8LA 5AR5A 2HWOA 3QQJA 3FLWA 3BE2A 4ESFA 1ZZLA 5FLXZ 4KBCA 3FY0A 2C6OA 1MP8A 2HTJA 3FMJA 2E2BA 4E26A 3VW8A 5E8TA 3ORMA 1S9JA 2XIZA 2COMA 4AVPA 4I5PA 1YXXA 3S2WA 4L67A 1PXNA 3BQRA 3EQFA 4OAUC 4U97A 5CSVA 5E7RA 4MQ1A 2EA2A 4UALA 1TQIA 3JVSA 3BIZA 4FTKA 5HCZA 5F9EA 2STTA 1U4DA 3JTGA 4M67A 4I5MA 5JFXA 3Q2JA 4BIEA 3FMNA 2F5FA 5IA2A 3ZO2A 4G5PA 2MLGA 1XH6A 4ERKA 3MFTA 4ZTSA 3U8WA 1OZ1A 4L7FA 5LWNA 5ED4A 4UEUA 2W05A 3CTHA 2W25A 1OUKA 2VGPA 5CAUA 3E6BA 4F70A 4L01A 4FKRA 3IW7A 4LGWA 3MYGA 3ERED 4YJOA 4JLCA 3Q9WA 3RAIA 5ICGA 2D1HA 3PA4A 5LVOA 2VTSA 3VRYA 4D58A 1P4AA 1P4FA 1BIAA 4QP7A 3BPVA 3R1QA 2IW8A 3MVMA 4ENJA 3PXZA 2A69F 4U0WA 4QQ5A 4AZTA 3IGOA 5CNOA 3ZO1A 1BM9A 4KSQA 1KV1A 4CDGA 3OCBA 3RZBA 4FSUA 3DGKA 1XGNA 4O2PA 3TNIA 2VNWA 4FL3A 5M55A 4OT5A 2QKRA 2UZUE 4GFGA 4CXAA 3SC1A 5BVFA 3K1NA 4BN1A 4PP9A 4OGRA 3GCUA 4BCOA 4LGGA 4BDCA 3CPCA 4DHFA 3T3VA 4FMQA 3RKBA 5FWKK 3QRJA 4GYGA 3TGNA 3HOTA 2FSWA 4WXCA 2ITUA 3SRVA 3E5QA 2WMUA 3KXNA 4GFOA 5CU4A 4ASDA 4WRGA 1JVPP 1MRYA 4O21A 2OBPA 4AGCA 3UVRA 1R36A 4A12A 5ANIA 5AMNA 5FBNC 4H1JA 3KP2A 3O2PE 5LCKA 4W4YA 5M4FA 4F9WA 3NRMA 4LG0B 3CUOA 5LRSA 4JXFA 4G3CA 3ZN1A 1ZLKA 2HYYA 4U5JA 3NNXA 5J1WA 1STZA 4E8AA 1CMKE 3IS5A 4YNEA 4FT8A 4KUJA 2I1MA 3Q52A 2C5VA 2O61A 2WWYA 3E6CC 2V9VA 1PJKA 2HKOA 2BTSA 4XX9A 3ANRA 2EWNA 3VS2A 4EH2A 2L01A 5CXZA 4S05A 3DDPA 1T38A 4QP2A 5D7VA 4H39A 1ZYSA 2Z7SA 3F3UA 4FIHA 3P78A 3VQUA 4M72A 4E5BA 4FNXA 3E8EA 3LFSA 5ILSA 1PMNA 5H20A 3KL8A 3ALNA 3HSFA 3IONA 5EHLA 3CQWA 1HQCA 3ORKA 3W2SA 5M06A 4Z16A 4MNUA 3MFKA 2M1BA 4BGQA 2QQ9A 2C6IA 3TIYA 5A4CA 4IJPA 2PN6A 4JAJA 1WVYA 3TZ8A 3CJGA 2AC5A 2GMXA 5DYMA 2OXDA 3OF0A 4EH5A 2UZDA 4PL3A 4BI1A 3WU0A 3BCEA 4RFZA 4DE4A 2PVMA 4C33A 4PDOA 1PF8A 3BGQA 4O0VA 2H9VA 4C61A 5DI1A 4RGRA 3R8VA 4BF2A 4NQWA 3SQNA 5LHIA 2KIMA 5E8XA 3JAMZ 1H07A 2R3PA 5FGMA 1YW9A 2PQ8A 4ZP5A 3NUNA 4DEHA 3E3BX 1ZG3A 2IJLA 3D7TB 3MY1A 1F0QA 2FA5A 3OXIA 3GZ5A 2J9MA 3C5UA 2I0HA 2GA1A 2RFDA 3PTGA 2QQ7A 2CLXA 4DEDA 4KNBA 4DC2A 3RK7A 4Z55A 3FC1X 4G7HF 2REIA 3CLYA 2R9SA 4QRCA 3BV2A 1IXCA 2P6SA 1G3WA 3RPYA 1KE9A 2XS0A 3RKWA 5LVNA 4EOMA 4KINA 2C6KA 1APME 3ODZX 3UIMA 5LMAA 4QYFA 4RIYB 4FKSA 2X7GA 2EK5A 3IW6A 2IA2A 4PPAA 5DT0A 4GIHA 2YA9A 2BILB 1LPUA 5CVIA 1ZH5A 4EORA 4OU0A 4FT0A 4GXOA 3WU1B 4AIHA 1BC8C 5H8EA 3LCKA 1TKIA 3DY7A 4EHVA 2CGUA 4ZZOA 2QO7A 3J81Z 2ETKA 4LK1F 4WF2A 3BEGA 5IA5A 3DTCA 3KXHA 3BYVA 4M71A 3OG7A 3HSEA 2IVVA 2YEXA 4GJ2A 4FV3A 2V1XA 1ZXEA 4Y83A 5DR2A 3S2PA 4G3EA 1R0EA 4BKYA 3TI1A 4IEBA 3CGOA 3W2RA 3T5XA 3QTRA 4IFGA 5HNBA 4GV1A 2BPMA 3RPOA 2JBOA 5E8WA 2QONA 5KE0A 4UMUA 5F6FA 2HOGA 5CT7A 2QVSE 1FBQA 4XBFA 5DPVA 5FEQA 2C6MA 1R23A 5HLWA 2X8EA 2B54A 2WEVA 5C27A 3H9FA 5ETIA 4LGHA 3DBDA 5FEDA 3SXYA 1X3UA 2DFIA 2JKMA 2OKRA 3F2NA 4PDKA 5G6VA 2V22A 4Z9LA 5LVMA 3EZRA 3HL7A 4BCJA 5CSPA 1FMOE 4CFFA 5CTPA 2P4WA 4ZLZA 4FF8A 2ZKZA 3ORLA 1WBWA 2STWA 4FNZA 2FBHA 2ZM1A 4FKIA 4HQEA 3OWKA 3RMFA 4MD8E 5GINE 4JR7A 2UZNA 2BRHA 5LVPA 2CFXA 5TF9A 3BV3A 2WELA 3ACKA 4LGDA 4WKQA 3FYJX 4O27B 3TG1A 3S4QA 1F3MC 2PZIA 3E7VA 4NK9A 3MVJA 1A48A 1H1PA 2ZJWA 2Z2WA 4TYEA 5IA3A 4BHBA 5FB2A 3NDMA 3PPZA 3KZYA 4AAAA 2CNVA 3OOMA 3W6JB 3QFVA 1OGUA 3E8DA 2ITYA 4JDJA 2B9IA 4HVIA 3KEQA 3P4KA 4O0RA 2EXCX 3O71A 4WXHA 2JIIA 2YIQA 2VE8A 4S34A 5D4SA 3FPQA 3I64A 2XNGA 4M14A 2FRHA 4RFYA 5IUGA 4FIJA 3EHAA 4JQ7A 3AMYA 3PRIA 3ZQ7A 2EWAA 3FYKX 3HRSA 3M1EA 5KHXA 5JQ8A 1QNTA 2W0JA 3SW4A 4IWPA 3KRRA 4BDJA 2GFCA 1XSVA 4AT5A 4TL0A 5K9IA 3BGPA 4WSYA 3UNZA 1M17A 2BKKA 2OO8X 3FLYA 2W5HA 3DXJF 3HTUA 3R61A 2X6EA 2B55A 4CFWA 4HV5A 4G9YA 1FWZA 2G15A 4FKUA 2OFUA 4BVUA 2IA1A 2YFXA 3K3IA 2RGVA 1DS5A 4C02A 1W82A 3N4VA 2HXQA 4ETSA 2NP8A 1PDNC 1OPKA 4HYHA 4BAYA 2WQNA 3LZBA 3ODYX 3CD8A 4KIPA 4IRIA 1PXPA 5AM7A 3R8UA 4FX3A 2XYNA 3WE3A 4PMSA 2X8IA 2QLUA 2XAHA 3NUSA 5E1WA 2LF7A 3KETA 5DA3A 3QX2A 1FP1D 4JG7A 4IAZA 1U5RA 3DNDA 4YIIA 4XV1A 2A0CX 1KA8A 4CFVA 2C6EA 4UMQA 4UXNA 5CX9A 4WBOA 1A9UA 2X39A 3QKMA 3BZ6A 3HP5A 5DUKA 3TO9A 3QD0A 3NYNA 1KOBA 3FZVA 5AV3A 1WBVA 3FZRA 4G6OA 3D5LA 4XEYA 3L8VA 3CGFA 2L3DA 5GHVA 1OBGA 4ZSEA 4MQ2A 1XSXA 3DXPA 3WYYA 4M9ZA 3VIDA 2DT5A 4OOIA 3BP8A 3E93A 5DEQA 2HYGD 1SD7A 2BTRA 2L4AA 2DI3A 3HIFA 4EEVA 3WF9A 3TV6A 1BJAA 5BX0A 1ZAOA 5J5SA 3F2RA 3CXWA 2P8TA 4NCTA 3P7AA 2V6CA 4Q5HA 4J71A 1R39A 1B6CB 1O9UA 1Z1DA 3GGFA 4W4WA 1VEBA 4ZTRA 3VS4A 4EMSA 2O64A 4NW5A 4AS0A 4J1RA 2VWBA 5C8NA 3IWFA 5GNKA 3OWJA 2CWEA 2VWZA 4V05A 3RCJA 4EYMA 5LJJA 2HWVA 2XVCA 4DBXA 4FSRA 4P5ZA 4YO4A 3LJ0A 4FSTA 5AFVA 2ITXA 5CAOA 3FXRA 3Q2MA 1LEAA 3QAME 3S00A 5JRSA 3UPZA 4PZJA 3HHHA 4M12A 5A3XA 4EK3A 1I44A 2NYXA 3PWYA 3F69A 3G3ZA 3D7TA 2F2UA 3UG2A 1CDKA 4RVTA 5FD5A 4EQUA 3PWDA 5J6XA 1FPUA 4NEUA 5FP6A 5DN3A 2VTQA 4FT3A 1P14A 4FTUA 4NTTA 4X7QA 1HKQA 2MC3A 4F6UA 2FE3A 4CT1A 2VXZA 4O84A 2O8YA 3E64A 1IAWA 2OICA 3QP5A 1LB2A 5JFRA 3FI3A 4MBLA 4N0BA 1YDRE 3KB7A 3SAYA 4C3PA 4AX8A 4IAAA 1SAXA 2PVYA 3VBVA 3KREA 1FBUA 3H3ZA 5AV1A 5JH6A 1FYMA 2WO6A 5EOBA 4ZTQA 4UHTA 3IC7A 3I60A 3KK8A 3DK6A 4K11A 4YNOA 3ROYA 5L8JA 3F61A 1GVJA 4IHPA 5AP0A 2QNJA 2BRBA 5CAQA 5M4CA 2Z5UA 3QCQA 4IXAA 3A8XA 5LARA 3ZBXA 5HBJA 4I2OA 1XH5A 1G5SA 2HWPA 3RKYA 2ZMDA 1F9NA 4EOJA 5HG8A 4KIFA 1FGIA 2HEOA 3G6GA 1UA2A 2C0IA 1RE8A 5HE1A 4N57A 4L5IA 4B0GA 3VUTA 2FOKA 4D0XA 3SV0A 2BHHA 4BR3A 4LV8A 3CLOA 4ONAA 3IGGA 2OI4X 4YJPA 4M8TA 4ZTNA 1FC3A 2HZNA 4NIFB 2CCHA 2GXGA 2P2HA 1FOKA 5F4NA 2OK1A 3G0FA 3QBNA 1KU2A 3HECA 1ZREA 3VOEA 3PXFA 3K69A 5L2IA 3ZONA 3FQSA 3NS9A 4U7DA 4FG9A 1A06A 1W7PB 2EU9A 4JIAA 4TNBA 3I1AA 4OW8A 4X3FC 5JEBA 3O7LB 4U45A 4BFMA 4RGJA 5E92A 3N51A 1XCBA 1I1GA 2VT2A 1H9GA 4UV0A 2UVZA 2R3RA 5ICCA 3UE4A 3FSFA 2IRFG 2WOUA 4CGZA 4YJTA 1FMKA 3BHYA 2JPBA 2X4FA 2OG8A 2QC6A 3R7OA 2H34A 2JFLA 4ZJVA 1BUHA 3DU8A 3NIZA 4MNFA 4ZLOA 4FSZA 4OTWA 4HYUA 2XAGA 4IDTA 5I0BA 1YO5C 5AUXA 3OW3A 4OIRF 3ANQA 3KRWA 4CRLA 3SLSA 1YVJA 4D55A 1K6OA 4O22A 3FJQE 4UVAA 4CMUA 5CI6A 4TY1A 4BCGA 1I27A 4ID7A 2OD5A 4USEA 2PYWA 4WX9A 3FMEA 4BCPA 2YIXA 4Y17A 2NRAC 4K2EA 3BHVA 3KCKA 5FFXA 2CO5A 3DV3A 2GQSA 1FLIA 2H27A 3A4PA 4F7ZA 5HU3A 4R7HA 3ZS5A 1WMKA 1YHSA 1BYGA 3MWUA 5EFQA 1QPEA 3UOLA 4QMOA 2OQGA 3MESA 4CV8A 1XHAA 4AD9A 2JRTA 3PYYA 3SHFA 4KS7A 5CVUA 3GVUA 4HW0A 5E17F 4BICA 5LWMA 4HAMA 4CCBA 4BYYA 5EM5A 4M7IA 2PULA 2LAVA 4ANQA 3SXSA 2Z99A 1QPJA 5GJFA 4DF3A 4I20A 4LUDA 3VRZA 3WTVC 2A07F 2JDVA 3TZ9A 2ITNA 1YW7A 2QWWA 4RSSA 3EL7A 1LDDA 2EUFB 4NW6A 5HGIA 2OU2A 3OCSA 1YI6A 1LEWA 3FMSA 2HGCA 4X2KA 3A4OX 3QRTA 1J75A 3EMGA 2L54A 4H36A 5ETAA 4DEEA 4PL5A 1BI1A 3E3PA 4TKSA 4CSVA 4UXLA 3Q4UA 5CXHA 3ZRKA 4ZY4A 3Q32A 3Q6WA 2IO6A 4A0YA 4FTJA 5HEZA 3IL2A 2XROA 4F09A 5J8IA 5HLPA 2WQBA 4A0ZA 2GHGA 5E8UA 2PL0A 4C59A 4HNFA 5M09A 5LGUA 2BDFA 4QMUA 3D7ZA 1E9HA 3RPSA 3ORXA 5AX9A 2YCFA 5CANA 2JITA 2BGCA 4EH6A 5HS7A 1IUYA 5DEYA 1MJ9A 4O7YA 2UW6A 1R7JA 4L3PA 4BB4A 4O7TA 3UTOA 1UKIA 3MI9A 1L8TA 3GC8A 1XH4A 2FF4A 2XM8A 1OMIA 1O57A 3DJ5A 2Z7RA 4A6EA 3Q4CA 3H9OA 3TDZC 3BI6A 3EN5A 2XYUA 3V5WA 4ZXTA 1KQ8A 4IWQA 2VRXA 5F1ZA 3DAKA 3IOKA 2CGXA 4CTBA 1P2FA 3SVVA 5H3QA 1SMHA 5HBHA 2B7AA 2UV2A 4U44A 2V79A 4OBPA 3N4TA 5HICA 4PTCA 4OTPA 4ITIA 3QQGA 4GVAA 3T0YA 4IH8A 3SGCA 3KMUA 4PF4A 5CF4A 3EKKA 3EQPA 3DJ7A 5M57A 3CS9A 3R0TA 3GOKA 4ZS4A 4EL9A 2PLYA 4I01A 1GHCA 3UO6A 2QG5A 4IJ9A 3KLOA 3KVWA 3RI4A 4ALWA 5AA8A 3B73A 1ZHFA 2RL5A 5HG7A 4APCA 2C5NA 4L46A 4U6RA 4QYHA 4I0RA 2ITQA 4RIXA 1GZNA 4U79A 4M0ZA 2EFPA 4MX9A 3VNTA 5L3AA 4GUBA 4A0XA 2HFHA 4E7WA 4JG8A 2GS7A 5LEJA 5AR2A 3TO7A 3KP5A 3NW5A 2RIOA 1O6KA 3EFKA 2XKDA 2HELA 3E6DA 3NUXA 2IW9A 3WGIA 2B9HA 5AA9A 1KU7A 2F9GA 3LPBA 2EXMA 3CP9A 5D6FA 2RKHA 3FMDA 3QTSA 2UW5A 4WSQA 2YWPA 4JDKA 4R1VA 4PUZA 1G3TA 5IMEA 1HCKA 3EQRA 4LFIA 4NU1A 4KWPA 5DE2A 3O50A 1LJ9A 4PQNA 4MF1A 4A6DA 4CD0A 3GQIA 4I4EA 2G2HA 4GS6A 3TJDA 3J80K 4I94A 2X4ZA 3ZFXA 4MHGA 4JT3A 5LQFA 3R8LA 4NCTC 5F64A 3QQUA 2VX0A 3I7BA 2XK8A 5JKGA 3RAHA 1O3QA 2XRUA 3UMXA 2J7TA 1U3EM 2YZAA 3AC5A 3CJNA 4MF0A 3FQHA 1FNNA 1UU3A 4YJRA 3W1FA 5AJQA 4CKJA 2CSNA 3ID6C 3LQ5A 2QOKA 3T8OA 3IW5A 3NUUA 4A4XA 3D5WA 4O6JA 4QMXA 3EIDA 2DUVA 2V7OA 2BFXA 4HGSA 1V3FA 2WV0A 3QTIA 1FVRA 3N4UA 5KMOA 4QP8A 3R04A 2J0KA 1GIIA 2WMAA 5EM6A 1YDTE 2BE5F 2J5OA 2WMSA 2RV8A 4R77A 2FMLA 3DJ6A 2YLEA 4K77A 1U5TC 2R3KA 3C4ZA 4AZWA 3KP4A 1Z6RA 2JD5A 3Q9ZA 4F64A 5L8KA 4AN2A 3NLBA 1YIOA 2IZUA 1XBAA 4I5HA 4O7SA 4FIEA 2YISA 3KCCA 5GIPE 2P7CB 1OITA 4M73A 4X3FB 3HSRA 4I09A 2CDZA 5HESA 3GW2A 5EW9A 2LNBA 3MB6A 3RWPA 3OFMA 4E3CA 4EH8A 2QLQA 5FFZA 3EQCA 4NB5A 4CICA 4RX9A 5CQUA 2BCJA 1CF7A 4M97A 3K0LA 4P55A 3I54A 5L8LA 4MEYF 4AA0A 1KGSA 3MDYA 2XH5A 2OU7A 4HOKA 5KO1A 4J97A 4BHPA 2OJFE 3KU2A 2VTNA 3WGGA 2WTVA 1H24A 4B8MA 5AP2A 2UW3A 2V1DA 4EJVA 1IR3A 5DD8A 1Q8UA 5AP4A 1E1XA 2W1CA 3EOCA 5KMLA 3W2OA 1GNGA 5LMBA 4B6LA 4FTQA 3E6MA 4GCVA 1H1SA 5I9UA 3LMIA 2XK3A 1KE7A 3LFEA 3DA6A 5CAPA 2A61A 4C8BA 3FF5A 4IC7A 3OWPA 1ZRZA 5ACKA 1TTYA 4JX7A 4XV3A 4MBIA 4A9SA 4AQCA 4BIDA 2MH2A 1MJAA 3Q9YA 2GS2A 1BL7A 4FL1A 1YOLA 1J1BA 1MZBA 4UUVA 4FKJA 5EQYA 4A9RA 2HY81 3LFCA 2Z02A 1Z9XA 4CRSA 3AC8A 5BMSA 4U7ZA 4LG0A 3B8RA 4EOPA 1IZ1A 1J91A 2WIHA 2XKPA 5ANEA 4JBVA 3L9PA 3QGWA 3TV7A 4WA9A 3V6RA 3NNUA 2M45A 3FZ1A 3WF5A 2W96B 4MD7E 4FGBA 2CQKA 1K78B 3HYIA 2C1BA 1BOAA 5HDGA 4JDHA 3E87A 5CY3A 5CSWA 5K5NA 3F7ZA 1Q5KA 2DW4A 1I1SA 1IXSB 2BHEA 2D2WA 4OTQA 3MZHA 2JBPA 3RPQA 4AA4A 4UBAA 3P9IA 4MHAA 1FGKA 5HCYA 2DS1A 2GTNA 5DYJA 4AWXB 3OWLA 4G6LA 4Z7HA 4NTSA 1WVXA 4G9CA 4EBWA 2A4LA 2XCHA 4QP3A 1QZYA 3GFWA 3RWQA 4DT9A 1U59A 5L2WA 4TYGA 4WXDA 4AN3A 2JC6A 4HX4A 4I92A 5HVJA 4YURA 3QC4A 1R1TA 4FV9A 1I09A 1H0MA 4Y85A 5E8GA 4KFCA 5J79A 5E8IA 1Q8ZA 3F82A 4XRFA 5BPYA 3OXZA 2FBIA 2Z8CA 4FE2A 3TKUA 2GIVA 3B2TA 4K6ZA 3ZLWA 3I53A 2YHVA 1YS7A 3RINA 4YJSA 1Q8TA 2BV6A 2R0UA 3L00A 3KN5A 4LJZF 4GIIA 5ERIA 5J5TA 2V1UA 1MKMA 3KE2A 3KXXA 3PQKA 3A2CA 4HW7A 3ROCA 4RIXB 1MRUA 4TPTA 4FIGA 3OOPA 4KNYA 1OMWA 3T9TA 1Q1HA 2BZKB 5HDNA 4P7EA 1EV7A 1O3SA 1USTA 2UWMA 1SVHA 3Q3BA 3RTPA 2ZM3A 4ZK5A 5HNGA 1SNUA 4WT6A 5D4RA 5AM6A 5K5RA 2XBJA 3CKXA 1Z6TA 2XNNA 3U9CA 3C3WA 2L4MA 1DUXC 5AONA 3PJ1A 4IZYA 4AW5A 5IH6A 5HKMA 2VTTA 3ULZA 2A27A 5A6OA 3AT4A 1JBPE 4G3FA 4IB0A 5CVRA 3PFQA 1UU9A 2WTDA 2PUIA 5KMIA 3FKNA 4IXPA 2GFSA 4ENXA 1R1WA 4Z7GA 3JY0A 3L9MA 4M0YA 2HZTA 2GNHA 3HMMA 3Q96A 1P6RA 3T1BA 1IAJA 4KIKB 4P9FA 3PE1A 4KN7X 3HV7A 4A7CA 4WO5A 1OIYA 4YZMA 1PXJA 3FXQA 4RJ8A 4O7WA 2CKPA 5DRBA 4HX7A 3GVAA 4H58A 2XAQA 1M14A 4S2ZA 2CNQA 2XKOA 3PSCA 4L9NA 3ENHA 5EDRA 3ZRMA 5M51A 2XUUA 3Q9SA 1PYEA 4G7ZF 1FVTA 2JAVA 1QCFA 2J5EA 1GIHA 1ZLTA 3GEQA 2HOEA 3MIAA 4DGLC 2XNEA 3G6HA 5E1XA 4G8XA 5TRDA 2R3GA 2JSCA 4ZZLA 3RM6A 4TZRA 5ILUA 4I0SA 1R00A 3BYSA 3R4KA 3L9LA 4KA3A 2Z33A 3GUBA 3UIXA 1W5SA 4JQFA 3BKBA 5EDQA 3TOBA 2I0YA 2QU6A 1Y8YA 5CYIA 4PL4A 4MXXA 1R1VA 2UVXA 4IWDA 4JNWA 2ZAZA 3OUKA 3F21A 4FT5A 2B1PA 2UVYA 2FBKA 1JSTA 3K1MA 2ITWA 3NAYA 4TN6A 3UC3A 4LRKA 5IZFA 1H0VA 5FLFA 4BQAA 4DGNA 2J50A 5D5XB 2ERZE 3QTQA 3F5GA 5EKOA 4GKIA 3GWZA 4O6LA 4YZDA 2O3FA 3DXQA 2WQOA 3D4QA 4DTKA 4R78A 1FX7A 2QOLA 4XP2A 1ZOHA 4CHUA 2R7DA 5JFWA 1T98A 5IT3A 4RZWA 4TWPA 2WTJA 5AADA 4X3FA 3BY6A 4S31A 4C2VA 4I0AA 3TDWA 4K1BA 4ARKA 4R3RA 3BOQA 1WSUA 2AC3A 4C62A 3I0TA 1VYZA 3DF8A 4FEQA 5K5QA 4FKOA 2FUMA 4IX4A 2Y9QA 1SMTA 4RVKA 4CNHA 3OC1A 4NFNA 4QQTA 4BCNA 3ZMZA 4K0YA 5HD7A 1B9MA 2VAGA 3PA3A 2WTWA 3F6OA 2IWIA 4UZDA 2QHNA 3C4EA 3TDUC 2HAKA 1RUNA 2YN8A 4UN0C 3VUKA 3GC7A 4D2RA 5LRRA 3CPBA 3PG3A 1YI3A 2QHMA 4O81A 3TDVA 1RJBA 2ADUA 2IZTA 3D2KA 3BE9A 3HRMA 5HO7A 1H00A 1WI9A 2CKOA 4JL9A 1UU8A 3JSOA 3DQWA 4BRXA 4EOOA 4UMRA 2JLDA 2G2FA 3OZ6A 5GJGA 3TXOA 3WF8A 4ENKA 3ULIA 2NRUA 4AW0A 1PXIA 4MAOA 4D28A 1QL6A 3KGAA 5FP5A 3OP5A 5CASA 3R60A 4X2NA 4XG2A 3P23A 4FTRA 1WAKA 1UCRA 2OLCA 3M2WA 2FYSA 4GK2A 3FE3A 3UDBA 5D5WB 2QR7A 4X2GA 4IIRA 1DPRA 3UMWA 4HYEA 2LF8A 3F8MA 5LXMA 2W17A 1MJBA 2DLLA 4RLKA 4FUXA 5HDKA 4M6YA 4X6RA 4EJNA 1YW2A 2OZ6A 2XJ0A 4YSMA 4EV0A 3GFMA 4D5KA 2JKOA 3GEZA 3ZC6A 2R3QA 4EC9A 2ACJA 3H3CA 1XGMA 4CTCA 2Y4IB 1K78A 5BVDA 4TTHB 4FV4A 3UC4A 1ZY4A 3EQHA 3ZU7A 4EHZA 4U81A 4B99A 1B38A 4I0TA 4F0IA 1G8AA 3LHJA 1LP4A 4U40A 1D5VA 3MH1A 3UPXA 3ATSA 3NMUF 4HBLA 4L9IA 5EHOA 4Z3VA 5BPDA 4GKHA 3RCDA 2ISYA 4BWXA 3FX3A 2RFSA 5A4LA 4JR3A 3UO4A 3FM5A 5JI6A 3RJCA 3E8CA 2ERKA 2ETHA 1ON1A 2B0LA 4ZMFA 3F22A 2PJPA 3SRVB 3EQBA 2CW0F 1S3JA 1AWCA 4BZNA 3MFSA 3IKVA 1UVRA 3MJ2A 3F9NA 4QNYA 1REKA 3SG9A 3V8TA 4DINA 3PA5A 4D2PA 3PVBA 2UZWE 4EK6A 4OINF 5EM7A 4WIHA 1BI3A 2E7XA 4HLYA 2ZO4A 5I5ZA 2EB3A 3PVWA 4W9XA 5IQFA 1JWHA 5HG5A 3UYSA 2V5QA 3FLSA 5H2UA 2X4HA 2IZSA 1SNXA 3F6VA 3H92A 4CO8A 3FXWA 3D5XA 3C5IA 1OIRA 3A60A 1M7QA 4YO6A 3NUPA 3R7YA 4ANLA 1XKKA 3I0QA 3S3IA 5B2KA 4IM3A 2ZV2A 3K2LA 1B6AA 5K0KA 4DN5A 3LM5A 3I7CA 4OBOA 4JBPA 2BAQA 4OTHA 2PUUA 4OTRA 4PNIA 2OXXA 2BZHB 3IHUA 1JKLA 3Q5FA 5CYVA 3BEAA 3FPMA 4A5MA 4IAFA 3C13A 3S0OA 2R4BA 2OJ9A 2GS6A 5M07A 2VN2A 2UW8A 1XSDA 4FT9A 1LQ1A 2GNJA 3FZOA 4HVGA 4BYIA 4DH1A 3UGCA 1PW2A 4KIKA 4R7IA 3L9NA 3GCQA 3BHTA 3NEWA 2O3PA 4BTJA 4XSXF 2YU3A 5FTGA 2WMXA 2YITA 1T46A 2QODA 1E1VA 4JAIA 1KUTA 4UVBA 3J80Z 2OXYA 4BHZA 3OTVA 3F66A 3R01A 1MGTA 3RYPA 2A6HF 3UNJA 4DFLA 3UG1A 4AOTA 2YCQA 2QG7A 1R58A 4FIFA 5ANJA 4EJTA 2EFWA 5F20A 3HMPA 3KQ7A 5DLSA 1YWVA 4D0WA 3FDNA 2QOFA 3RAWA 2BAKA 4EJUA 3VJNA 2YAKA 4LB5A 3C4FA 1R1UA 5I9YA 3LXNA 3IG7A 4J98A 4AACA 3QUEA 2G2IA 4NWMA 4D0PA 3IKAA 1OYWA 5EEGA 4XLIA 1KU3A 4F6WA 3ET7A 2W84A 4FV8A 4CYJA 4WOVA 1SD4A 4BDBA 2F2CB 2GNGA 2Q8KA 3R1SA 1OL5A 3PFIA 1Q62A 4E4NA 3HKOA 1O7FA 1U6GA 3M8EA 5LGNA 3HRBA 4A9YA 2WMWA 2ACXA 3OCTA 3CCNA 4P96A 1FT9A 2UXXA 4FEVA 4NKSA 3SZPA 2HIWA 2GQQA 4II5A 3AXWA 4I7HA 4QTEA 1AGWA 1OECA 2PMIA 3P0MA 2PY3A 4C38A 4IB1A 2VWXA 4RB0A 4WG5A 5D6EA 3NRVA 4BTMA 3C0GA 2K02A 4NKAA 4ZY6A 4UV8A 2IW6A 5H8BA 2R64A 4U42A 5I9ZA 4FV0A 3ZTXA 1J7LA 4CVAA 1FYKA 2UZTA 1VYWA 4AU8A 4YHFA 3COAC 4QNAA 1LR4A 2QENA 1YTYA 1F1ZA 4JBQA 4TXCA 3KRXA 3CQUA 5H8GA 4TYJA 2PMHA 5JT2A 2IW5A 2PVKA 4L44A 4E6CA 2XNMA 5J7BA 3F3TA 3LCDA 5TT7A 2BAJA 1R78A 1UHWA 4IWOA 4LQMA 1G4DA 3DNEA 1XH7A 4MGRA 5A4QA 4AOJA 5EW8A 2J4ZA 4PPBA 3IW8A 3WF6A 4HVSA 1W5TA 3COHA 5E8ZA 2VUWA 5GZAA 3NYVA 5AIPA 3VBWA 1YQJA 3DKFA 2Q0NA 5I9XA 3FL4A 3GUDA 4ACDA 2O03A 4F6SA 3GX4X 2W9FB 3GLXA 3SHEA 4UNOA 4IM2A 4O91A 1ZRCA 3UZTA 3WYXA 5HHWA 4O3MA 3VS0A 3DQVC 4QPSA 3NWWA 2QOQA 4Q5SF 3NCGA 2GHLA 1V0OA 4PV0A 3P9KA 4MXZA 4Y5QA 3GXLA 3C4XA 1W7PD 2ZMEB 5IISA 2H6BA 4GG7A 4XLNF 4AE9A 1JAMA 4IVAA 2YIYA 3SKCA 3FZPA 2ISZA 2B9FA 4YBKA 4BNCA 3BWGA 2EV6A 2QI8A 2C47A 2PVRA 5AIQA 4P4CA 1K79A 4G17A 4FICA 1XDSA 2XGXA 1XB4A 4DH8A 2XRNA 1ZG1A 4DFBA 2XAFA 1JPAA 4FK6A 3ZP5A 5J8FA 3WILA 2W4KA 2R3JA 5BNJA 2PMLX 2QKWB 1G6NA 5ICPA 2NRYA 2PVHA 5M4UA 3WTSC 5DWRA 3LA3A 5A14A 3UZRA 4E6AA 1KYZA 3VJOA 3EN7A 1ZYLA 1SZMA 3FWQA 5BVWA 4U41A 3AD6A 5TR6A 4BY9E 2W57A 2Y6MA 3KXGA 3NR9A 2QM3A 1O6LA 2HQNA 3V6SA 1BKXA 4GK4A 2IT0A 5JK3A 3V7CA 3RYRA 1DI9A 1WBPA 4IHTA 2BMCA 1SFEA 4U0IA 1REJA 4UY9A 2WQMA 3QYZA 3VULA 2EB7A 4U9AA 3ITZA 4N0SA 4KT5C 2E9PA 4DGMA 5DT4A 3MV5A 1UNLA 5FM3A 4PY1A 3G9LX 2ZOQA 3E92A 4RIOA 4AW1A 4LL0A 1BX6A 4JJRA 4TWCA 3U1DA 4QTAA 5FDXA 3R9HA 1LVAA 3V8SA 2J0IA 4E4XA 1W4MA 4N6ZA 3DTWA 4OMYA 3NZ0A 4RJ4A 4ZZDA 4IX6A 1B59A 2KRFA 4EVIA 4TT7A 3VBTA 1ODDA 5CF6A 1XGSA 3M9AA 1URCA 4AZEA 2UW9A 3ZSGA 5H6RA 4CEGA 4BDAA 2ZM4A 3ROUA 2RQPA 2BYVE 3F8CA 3Q5IA 1Q97A 3LQ3A 3LQ8A 5C1QB 3QD4A 5B0XA 3PDTA 2C5YA 3VW6A 2Y7JA 3SXRA 3VUDA 5L6PA 2A5YB 5HX8A 3EQGA 2PTKA 1H8FA 2XEZA 3LFKA 5AWMA 1RNLA 5BUEA 3GU6A 1GY3A 3RK9A 3R71A 3FUPA 2G7UA 3FHRA 1RUOA 5K4JA 2WIPA 4KYWA 4YFKF 4BTFA 5FQDC 4YP8A 4AA5A 3I5ZA 3UNKA 4ENNA 5ANOA 2HXLA 2BZIB 2JPCA 4QWQA 1SVEA 2ZVAA 3LA7A 4LLLA 2GAUA 3REPA 4JBOA 4FHTA 1V0PA 4XBUA 1XMKA 1U54B 1S6LA 5K5XA 1WZYA 4QQJA 3BYMA 2Y75A 2QO9A 1WVWA 4Q5EA 4LD5A 4EM2A 5L2TA 3T3UA 2YR2A 4ZMEA 4KABA 1BIBA 2O63A 2GQRA 5A2QZ 4DQ2A 4QP4A 3FHZA 2O0UA 2WMRA 3FMHA 4XYFA 5BYYA 3R0JA 1OIUA 4YC6A 2R7FA 4YGAA 3G73A 2UZLA 3AC1A 3DBQA 3ECOA 1ZZ2A 4BWKA 2ITVA 3ZLYA 1YXUA 2VO3A 1S7OA 4ZZMA 4IMYA 5D11A 2M5WA 3DKGA 3RAKA 3F3WA 4HYSA 4EK4A 4QTBA 1TW3A 4G3DA 4HDUA 1BN5A 2HENA 4L3LA 1MQBA 2X9FA 2XBAA 2YM3A 4XV9A 2ZXJA 5K0XA 4QMQA 5KMNA 1L3RE 4PTEA 2VBYA 2ITTA 3DKWA 2VTLA 2I6LA 4JVGA 3CO6C 4FSWA 3K1PA 4L43A 3LFDA 4PMMA 3HUGA 3R6XA 3DZOA 3W2PA 4DG0E 5HVQC 3LIJA 5IKWA 3RBWA 3WIKA 4L7SA 2Q83A 4HVHA 3MY5A 4OTGA 3BHHA 3ZMDA 3VUMA 2P33A 2K4JA 3VBXA 2WMQA 2VBWA 2FH9A 2GXBA 5CVFA 3QPHA 2XKEA 3MBLA 2UW0A 2QOCA 4UV9A 5HOOA 3TTIA 1MUOA 4J8MA 5JZJA 1JQHA 4F63A 3W18A 2HW7A 3SXFA 4CQGA 1Q3DA 4U3YA 2FQ3A 3QRFF 2HYFA 5IQHA 4AUAA 4QLCU 5CEQA 4FUYA 5J9YA 3EDPA 5D12A 4ZJIA 5IT9K 4NYEA 1T39A 3CUQC 3VS1A 5BUJA 3WE8A 4IX5A 2ETMA 3VVHA 3BPXA 5HLHA 4YG2F 4FBXA 5FTQA 5DD4A 3BZ3A 5FGKA 3GU7A 4QYGA 3ORPA 3W32A 4IZ7A 3PJ2A 5DCMB 4BGHA 5IQEA 4WG4A 1W98A 3OMVA 3I0OA 2R5TA 3HOSA 4BH9A 3ZM9A 2CSOA 2GA2A 5ANDA 4KAOA 5TOZA 3G90X 1BI2A 3C1DA 3MWMA 1UNGA 3VC4A 1P4WA 5BMZA 2VTAA 5CJ9A 2XMYA 4P5QA 3RP9A 3UP2A 2P7VB 3C9WA 3AD4A 1HSTA 4FG7A 3FI2A 3R1NA 3KMWA 2IA0A 2XASA 3AC4A 1BL6A 5DFPA 5DBXA 3HRTA 4EH4A 5E20A 4RB1A 2XIXA 3TKHA 5IDNA 2YPRA 5B7VA 3TKYA 1P92A 3F5PA 3FWEA 4RGXA 3CUQB 4D5HA 3NQOA 1MDMA 3VUIA 4NJ3A 4JG6A 4YR8A 3HVCA 4E5AX 2SRCA 4BBEA 2KULA 4DITA 1ON2A 4ZYGA 4LMNA 4DFXE 3CEKA 4FKGA 3QQFA 4WCGA 2PBIA 2YM7A 2WTEA 3M7GA 2RFEA 2PMOX 4YLKA 3ENMA 5EOLA 3R9RA 4V0GB 2WMVA 4YU2A 4GFMA 5J8CA 3TEIA 2FA2A 3FQEA 2XIRA 3QA8A 4I6FA 2VO6A 3MAJA 2OZUA 2C69A 3MJ1A 4YHJA 3M1SA 2YDKA 5FTOA 3WZDA 4M6XA 4KKHA 4NM0A 2OF4A 3I5UA 5L6OA 4L45A 5CF8A 4E93A 2M30A 3UZPA 3FXZA 1R5GA 1FBSA 3DBEA 2XAJA 4RFMA 4DLJA 1HBXG 2XK6A 4ZYDA 4BZDA 4NH1A 2W1FA 3VUHA 4FEWA 4AGWA 2XV4S 1GZOA 4D4YA 4MD9E 4DLIA 3EZVA 1XWSA 3DLSA 4FNWA 3P7NA 1TNTA 3LLAA 5HNIX 1XCVA 5EKNA 5FXSA 4QP1A 3TZMA 4EM1A 3A7JA 4MEXF 1HW5A 5J9ZA 4D4VA 4N70A 4XJ0A 1Z9CA 2D1VA 2RDPA 5FD6A 3MN3A 4CKIA 3QQLA 4F9YA 4E70A 3OBJA 3RKXA 4QMNA 3DFAA 2VBXA 3ZLSA 3FMKA 5A4EA 4M66A 3DAEA 3HV3A 4OUCA 5HLNA 4ANMA 3O23A 4QT1A 5BVNA 2YDIA 2P5VA 3A7GA 1J5YA 2MH9A 1YOJA 1JSVA 1ERKA 3LA2A 5HO8A 3OD6X 1G3SA 3RNIA 2A3SA 4EBVA 1PMVA 4DEAA 3KY2A 3DXNA 3DB8A 1HOWA 2UW7A 1WRJA 4XRLA 4JS8A 3NIEA 4HCTA 3GB2A 3HGKA 1HKSA 4R5SA 3ZC5A 3T9IA 3EETA 2JIUA 1YQAA 3WTZA 2W9ZB 4IQ6A 2Z3YA 5AAFA 4G6DA 4L00A 3ZXTA 2ONLA 4GYIA 3FMMA 4ANOA 4R3PA 4GG5A 2BZJA 3HV6A 3KF7A 4KIBA 3AGLA 3P5KA 5DR6A 2IPXA 5FBOA 3OHTA 4ALVA 2CYYA 1PYXA 4FODA 1F5QA 1IF1A 1Q8WA 3HNGA 4FTNA 3F6XA 1H01A 3EL8A 2IVUA 1GJOA 4UMPA 3HUCA 3V8WA 4DFNA 4ZJJA 5FD2A 2KJBA 2Z60A 3E5XA 1KQ9A 2RN7A 4EH9A 4M13A 5F1RA 4KMUX 4RIWA 4QYYA 1M2RA 1JNKA 2OJIA 3DT1A 4W8EA 4FSYA 1A04A 4XG4A 5FRIA 3MY0A 5CZIA 5A9UA 1U5QA 1XR1A 3HRUA 4G3GA 4L68A 1Y6AA 4HV6A 3I4BA 4BC6A 4YTCA 2WQEA 3EUHA 4PPCA 1OKVA 2FSLX 4CZUA 3KK9A 3O51A 2WTKC 5EYMA 3VQHA 2OW3A 5HS9A 4OBQA 3ZMTA 3GZ6A 4G1WA 4BCIA 4D2SA 2BDJA 2B53A 1YG2A 2VOPA 5KZIA 2DTRA 1SD5A 3TOAA 5AV4A 1ZGAA 2CGVA 3UVQA 3UP7A 5BQTA 2BIYA 4RA5A 4J99A 1WBSA 3AC3A 5K1YA 5KVRA 2K4BA 5IQIA 3BJ6A 3V01A 3FI8A 1E2XA 5GZ8A 4R1YA 3MCZA 5AP7A 4BIBA 4C36A 4N9IA 3QF9A 4CG8A 4EJWA 1M2PA 1U78A 3LXKA 2XUBA 2VTOA 4ORKA 2XK9A 3UOKA 1CSNA 3TIZA 3NYOA 4GEOA 3L09A 4M3QA 1L0OC 2C3LA 4X3JA 3KXMA 4ESJA 1M7NA 2PU8A 2HDCA 5JGDA 2VT3A 3WBLA 3U6HA 2VTHA 2VTJA 2GQGA 2UZKA 4IRHA 3ZLXA 4XLPF 2XK4A 4F7NA 4E6DA 4Q47A 4ZAUA 2CMWA 3HLLA 2C3IB 3ZO3A 5DCMA 2P3GX 4LV5A 1U5TA 3VB2A 4OLIA 1QQIA 2BDWA 2OAZA 1SM2A 4IAKA 2XHKA 1OM1A 5E1ZB 3MIYA 4FX0A 4B9DA 1P2AA 3QUPA 3P1AA 3TNHA 3DQXA 1JKSA 3TNPC 4IVNA 2YIRA 4B7TA 3HRFA 5ANKA 4GVJA 4L8MA 3QL8A 3GNIB 4PNKA 1R5HA 1IXRC 1SFXA 3F5UA 3BX5A 4G94A 4YPDA 4HZFA 1ZOGA 5KZ0A 1MD0A 3A61A 2H6CA 2XKFA 5KBQA 4ERWA 3OXTA 3O0GA 3ZFMA 4ACGA 3U6JA 1MDMB 4NSTA 3HA8A 4CQEA 4KIOA 4R8QA 4BGGA 4Y8DA 3EYGA 3E63A 3BJAA 2ZBKA 4CT2A 4CZTA 4IPAA 3L1SA 2I0VA 3D2IA 2X2MA 1YI4A 3D5UA 5JVTA 3DLZA 3R7UA 4XMOA 1Z05A 5E8YA 4R6VA 2YX7A 2IVTA 4HOBA 1XO2B 5F94A 4ZSAA 4DEBA 1IN8A 4FK3A 4EH7A 2W99B 3GP0A 2VO7A 4Y73A 5HOAA 3BBWA 3WZUA 5HZNA 4UB7A 3E8NA 4PDYA 3WZEA 2A6EF 1U2WA 2YZLA 2Y0AA 1O3RA 1NT2A 2B9JA 3PXYA 3FL5A 4OMZA 2VC0A 2ZMCA 2CKQA 4EYJA 4GU6A 3UYTA 1D3YA 5IT9Z 4J96A 3JYAA 2VX1A 5EYKA 3QHWA 4LG4A 5JHUA 2QURA 2UXNA 2YM5A 1H9TA 1R0PA 3LKMA 3JW4A 3GU8A 1TQPA 1QGPA 3C1XA 3SQQA 3A8WA 4M9SA 3W16A 2XF0A 3BPRA 3TM0A 3G15A 5IU2A 4L0YB 1J7UA 4XG6A 1B9NA 4Q9SA 3QYWA 2B0QA 1X8BA 5CWZA 2QO2A 3UVPA 5DG5A 3A7HA 4FV2A 3R8ZA 1H27A 2G1TA 1O7LA 2BEOA 3ZXZA 4BL1A 5DDGA 2M8EA 4LFUA 2QLZA 5FXQA 2X1NA 1YFHA 2XK7A 4YTHA 3KULA 3EJ1A 2A68F 4HPTE 2KJCA 5IH4A 1UWJA 3CKWA 4XP3A 2YJRA 3GFEA 3U9NA 3PPKA 1AOYA 2YM4A 5AP6A 3LCSA 1FZPB 5D8LB 2FB8A 2CJMA 1DI8A 4QD6A 4F7JA 4G2FA 4IVCA 2K27A 4LYNA 1JLUE 1KSWA 4G9RA 4AW2A 4ACHA 4ASZA 4DG2E 3PY1A 4I23A 5IEXA 4FTAA 1BBYA 2NS0A 4IB3A 4IF4A 2K7LA 5E1EA 2DK5A 2O2UA 4HJOA 4FVPA 4HGTA 3L2CA 1J7IA 2E1NA 5JMSA 2OZOA 3PRFA 3PG1A 5HLIA 4TW9A 2OIBA 2J90A 3KRLA 1IA8A 4G16A 3SFZA 4QQCA 3V5QA 1TVOA 1T0FA 5FG8A 4RAYA 2VGOA 4GGGA 4O6EA 3JPVA 3LQQA 2DO7A 3WI6A 1GIJA 3RDIA 2R3FA 3G5DA 5G1XA 5IUIA 4C58A 2FMYA 2XEYA 4CFMA 3WODF 5CQWA 2AS5F 1H28A 4E20A 5CVJA 1YLFA 3MW1A 2FSOX 4RC3A 1J9IA 4A9UA 4D9TA 2F7ZE 2YAAA 4ZS0A 2W06A 2TDXA 2HY0A 3R02A 4A06A 2B52A 1IASA 5HIEA 3EQLF 4TNDA 1Q61A 4B8XA 2GCDA 3LLTA 3ZMSA 4ENYA 5ICFA 4WNMA 4ZYEA 4Q48A 4O96A 3Q6UA 1R3CA 3RPRA 2Z9OA 2RSVA 2JIVA 3PVUA 3OVVA 4X6QC 2W5BA 2BALA 4RRVA 5HO6A 1TBXA 5EI8A 3TWJA 3KZZA 3PSDA 3TL8A 4RIWB 4YJVA 4GH2A 2V0DA 1ND4A 4AGUA 3WZJA 5DCFA 3R7GA 5HE3A 5IQBA 5DH3A 4O7VA 1G3NA 5LCJA 3BRBA 5HU9A 4F0FA 5DEWA 4AOIA 3TUBA 5BYZA 2YX4A 1P4XA 4YTFA 2JEDA 4FTCA 4MBJA 3V5LA 3HV4A 4KUMA 1Z57A 4WD5A 2Q0BA 5IPJA 2O8XA 1YWNA 5JGAA 1SMYF 5AR4A 5IF1A 2JAMA 1KWPA 1E17A 3WIGA 3FY2A 3VHEA 4H3QA 2O5KA 3FZTA 1CTPE 3WE4A 2PHKA 3DK3A 4R5YA 2H96A 3ECHA 4PRJA 4CFNA 1W7HA 3ZH8A 3BGZA 4RA4A 3I6UA 2C68A 3UJGA 5ICEA 2EXEA 5CVHA 1XDUA 3V5JA 5M56A 3O96A 5ACBC 1ZN2A 3GFJA 3EQIA 4LRMA 4DFYA 3PXRA 1GZKA 4D9UA 2EB2A 2XKCA 2HCKA 2E1CA 1Q24A 4YBJA 1Q8YA 4FV7A 1WBOA 4FTTA 4OIOF 1DP7P 5D5UB 1NY3A 2O65A 3V4GA 2CN5A 3AQVA 2WPAA 3M42A 4I4FA 1U54A 5C26A 4EOIA 1YYVA 5IEYA 5DR9A 4BDFA 3QKLA 3EYHA 4C37A 4UX9A 3LFBA 5J87A 4IAYA 4KRDA 3A62A 4U7BA 5I9VA 3GQLA 5KKRB 1T6SA 3BYOA 1ZRFA 4U3ZA 4W9WA 1YHVA 2AXLA 3L8XA 4JK1X 4YJNA 4AT4A 4B4LA 3K9TA 2VWIA 5BVOA 3F3VA 5EQEA 2DU9A 2X2KA 4EOSA 4IVDA 1J2XA 4OTFA 1BI7A 3TZ7A 2F5EA 3ZCLA 3HAMA 1BMKA 3MPTA 3D94A 5HE2A 5JSMA 2GNFA 2IG7A 2ZNZA 3EN6A 3MSSA 3MB7A 3RK5A 4BTKA 3GU4A 5D1JA 4MNEB 5IA1A 2WTCA 2F5CA 3I5NA 3F3ZA 3QCXA 1IN6A 4ITJA 3GFLA 4MXOA 3G2FA 3N97A 3ETAA 1KQ0A 2C5XA 4ITHA 2NAZA 5LHGA 2CHLA 4GMYA 3P86A 2OQRA 4QMWA 4CXFA 4MCVA 5A4TA 2VZ6A 2ZMEA 2GSFA 4O82A 4UXQA 3VBYA 5GIOE 1LNWA 4J8NA 4NM3A 3U55A 3SZTA 3F7WA 3Q53A 3PIZA 2FVDA 4MWIA 2JGZA 4I0BA 5AR8A 2QOHA 3ORZA 1S7AA 4TRLA 3EKNA 3UODA 3VBQA 2EFOA 4XV2A 4EHGA 3KP6A 3L9FA 4KDPA 3Q9XA 3MZYA 1OKYA 3OEFX 2UZBA 2VU3A 5HQ0A 2FSMX 2BIKB 2R3IA 3LW0A 1Z5MA 1ZYCA 4BDKA 4EJOA 2J2IB 2W1GA 3EH9A 3E97A 4FZFB 2RFNA 2AUHA 5CU0A 2WXVA 3QALE 1FINA 3AC2A 5LHHA 4EGYA 1YXTA 3DP7A 1UV5A 3JSPA 3FEGA 4MK0A 3GFIA 3K5VA 4AWIA 4NJDA 2HS5A 2DK8A 2D45A 1KE6A 3NUAA 4YUQA 2YLFA 5DT3A 5M44A 3KULB 1G3YA 4P5OA 3OT8A 3QRUA 1DAYA 1JOWB 4O1PA 3ZMMA 2RVCA 2WEIA 5EYDA 2VNYA 1NVSA 4F99A 4FR4A 3I59A 4F9CA 2BFYA 3AGMA 1FSHA 4HZSA 3EN4A 2XM9A 5EM8A 3CUQA 5IQGA 2X9EA 3U4WA 5E90A 4DG3E 2QOBA 4C2WA 3R22A 5BQ0A 1FBNA 1ZLJA 3ZDIA 4GSBA 2IPQX 4KSPA 2HZ4A 3ZZEA 4M74A 1OL1A 3POZA 4YPSA 4OIPF 4CMOA 1EH7A 3KRJA 3W55A 4EZ3A 4GT4A 3MH2A 4EI4A 1IEPA 2LSOA 2BRMA 1WFCA 3RM7A 3C51A 1XQZA 3QX4A 2DQ7X 5DGZA 3EWHA 4HYIA 4O5VA 3B02A 3SA0A 2YABA 2RC4A 1STCE 1S8NA 4QTDA 1JHFA 2PUPA 5LLQA 3CD3A 3F8FA 3VFZA 2PSQA 3QZGA 1OB3A 3ZUVA 2XVDA 5HVYA 5CU6A 2VTMA 4D1ZA 1LUFA 3FHIA 3UO5A 4EK5A 1QZZA 5T6KA 4QPMA 2FU4A 3R8MA 2ESNA 3COIA 3ZOSA 5AAGA 3AMBA 2JKQA 5TJJA 1WCCA 2VTRA 2GPHA 2ZCWA 5FO5A 3O8PA 3G0EA 3QLGA 2XIGA 4FC0A 3UQGA 3GI3A 4GL9A 1G8SA 2QYOA 4N6YA 4ASNA 4CGAA 5HBEA 3I59B 1EH6A 3JAMK 2XZSA 3E5AA 4DEGA 3PPJA 5E8VA 1WQ2A 1XBBA 3GC0A 4LOOA 1GXPA 5JN2A 3KLNA 1XGOA 2PG4A 1S9IA 1BC7C 5B2LA 2VE9A 4FEXA 1QO0D 4GCJA 1W0XC 4U8ZA 4F65A 3AD5A 2GWRA 5IA0A 4KB8A 4DCAA 4A4LA 4LMUA 3KF4A 3F3XA 4PP7A 3C7JA 2YERA 4GT3A 3ZMVA 4ACMA 4YJQA 4A9TA 1H1RA 4E5WA 3MPAA 4XCUA 2VX3A 3FBVA 4BDDA 4Z2YA 2KIFA 3RALA 4I22A 3ZSIA 4KICA 4MVFA 1NXKA 4UWYA 2PZPA 4H3BA 4XNEA 4BCHA 2ITPA 3JR1A 3P7CA 3QZFA 3PLAE 5D8KB 2R3LA 5L4QA 4H3PA 4QPAA 4GU9A 3KEOA 4BCQA 4GRBA 5CU3A 4DBNA 3ORNA 1Y0UA 1OPCA 4F1TA 4IX3A 3QXOA 3F2AA 4U0YA 1T2KA 3HYHA 4EHEA 4R1HA 2XJ2A 3LJ1A 1CKJA 3ZFYA 4R7BA 1OL7A 5AIRA 1ZY5A 3LFQA 4JRNA 4DGGA 3GO5A 1O3TA 4WWCA 2ZDUA 3R9OA 3J81K 2JDTA 3DFGA 3W6KB 2Y4IC 4FOCA 3LM0A 5JGBA 3A7IA 4JX3A 1OIQA 4I24A 3BDDA 1AQ1A 3PVGA 2EJRA 3FV8A 2DAOA 1RI7A 1M2QA 4KIGA 3COMA 4ESBA 4JI9A 1J1CA 1ZMVA 3RTRA 4FKWA 4LK0F 3DKOA 3OROA 1Y8GA 4MNEA 4WK8F 2WFYA 4IFCA 4F9AA 1HKTA 3OY1A 3HDNA 5E1SA 2X8DA 1FY7A 4DYMA 4D2VA 3TCPA 3KKVA 2CGWA 3W33A 4UVCA 4RB2C 2V7AA 4IJAA 2C6TA 3TQNA 4XP0A 5EHYA 5JFSA 2PE0A 4ZOGA 2MA3A 3FXXA 5FLXK 1HCLA 2PVNA 1HW1A 2BR1A 1EH8A 1GOLA 1BLXA 3IECA 1UFMA 5AUYA 3DEUA 2VWUA 3IRQA 1YOMA 4XOZA 2VWVA 1SYKA 3WF7A 3UQCA 5T3QA 2ETRA 4IBMA 1Y57A 3R1YA 3MTFA 2OSCA 4UWBA 4BBMA 2IVMA 3GENA 1IA9A 4HF1A 4RC2A 3IK3A 3FMQA 4RAZA 4AN9A 3KP3A 3UQFA 4YJUA 4X2JA 1GZ8A 4K18A 3QTZA 2ESHA 3I4PA 5CENA 2GNLA 3MH0A 2ZDTA 3KFAA 3GYHX 4FV1A 4FVQA 4O7NA 2BROA 3U87A 4BCFA 2Y48A 1HXDA 3WE2A 2VN9A 4V0GA 3BJOA 5ETCA 3EFJA 5I9WA 2W1HA 4PDSA 3P9CA 3CC6A 3S95A 3TNWA 3ZN0A 1KV2A 5DHJA 3ZZWA 5JQ5A 2W1IA 2WTKB 4C4EA 3C4CA 4K9YA 4YTIA 1NW1A 2PK9A 4L18B 5CLPA 3FMLA 3TTJA 4DA5A 1OPLA 4O0YA 5CT0A 4TYIA 3GC9A 2HK5A 3ZBFA 1SFUA 4J53A 5AV2A 3H3UA 3NAXA 2QR8A 5CI7A 4C4FA 1ZYJA 6PAXA 3V51A 4QTCA 1SD6A 4MQVA 2XNBA 1D8KA 3NX8A 1PXMA 3IQ7A 2NPQA 3GOPA 3SD0A 3ZMUA 4UYNA 4C7TA 3R9DA 2X7OA 2HZ0A 4G31A 4QMZA 1YXVA 3DPTA 4XG3A 3RHXA 2KIUA 5DV5A 4LLNA 1TQMA 5D5VB 4D2TA 4KS8A 1T45A 4QYEA 2C30A 4E4LA 3LXLA 5AUVA 3ABUA 3ZYAA 4TYHB 3QTUA 4B8LA 2LDUA 3ZSHA 3AOXA 4EJ7A 4C4GA 1KOAA 5HIBA 2PZYA 3QUDA 5DMZA 2GU8A 1GAGA 5BUIA 2ZB0A 3FC2A 4F0GA 2VOOA 4F1MA 3WZKA 4FKLA 2VWWA 2XP2A 5CEPA 3PXQA 2C0TA 1MQ4A 2C6DA 2PMUA 3C50A 3O8TA 2OF2A 4FZDB 4QMLA 4RWIA 1WWXA 4IZAA 4M68A 2G9WA 1YWRA 4NUSA 5CVGA 2VC1A 4FSQA 3F72A 4EQQA 5E4HA 3VAPA 3K3JA 4XOYA 4BKZA 3HP2A 5E8SA 3D5VA 4QMMA 4I02A 4FX4A 5L3GA 1PHKA 4RIYA 4Y95A 4LB6B 1FYLA 2VONA 4E73A 3DFCB 4HDVA 1J7KA 3IPHA 1XN7A 2OWBA 4QOXA 3R2YA 3ULQB 4WNOA 3L8PA 3IDBA 3WTUC 2ZV9A 3HMOA 2V55A 3WG9A 1CGPA 1TLHB 5AUUA 1C0WA 1SVGA 4A07A 2JDRA 3RVGA 3L8SA 5LBQA 1OBDA 4ZEGA 3BELA 5F95A 4RJ6A 5DRDA 4AFJA 3O8UA 5HX6A 4F1OA 3C7QA 5ANGA 2CCIA 5L2QA 2FSTX 3K2ZA 4RZVA 5HORA 4KIQA 3B2WA 4WHZA 1REPC 3AT3A 3AAFA 3DK7A 5FEEA 3NSZA 3VF9A 5HS8A 5EEHA 1PKDA 4RX5A 1PMUA 4CFUA 3FSKA 3PIXA 5M08A 3AG9A 4WNKA 3II5A 3R0AA 4O1OA 2H8HA 4QO9A 4WBBB 4MH7A 4ZZNA 4MTEA 3VUGA 1K7AA 2HZIA 2F2EA 1XH9A 4RWLA 4RJ7A 4RQVA 2PE1A 2CG4A 2F57A 4HF0A 2YCRA 5KNJA 1J3HA 4USFA 1RQQA 5L3DA 1XBCA 4CV9A 1JXSA 4G5JA 1ZARA 1BI0A 3ISPA 4H1MA 4LRJA 4UMTA 4C4IA 3PY0A 3M11A 1OKZA 3IO7A 3IDPA 3NCZA 4IC8A 4OAVB 3ELKA 4ANNA 2QUFA 2W1ZA 3HAVA 3H0ZA 5L3BA 3LMHA 4NM7A 1PY5A 3QTXA 5BPIA 2QVOA 4QMTA 3QZIA 5FDPA 2C1AA 3POOA 2QOIA 3GXOA 1H26A 3CQEA 1Q41A 4ACCA 3FMRA 1W83A 4HA8A 2FXAA 3PJCA 3DDQA 4DCEA 3CDHA 3RGFA 2E9UA 4KD1A 4MQ9F 1HSJA 4LM5A 3JS2A 1V0BA 2M87A 3MA6A 3CTQA 3UBDA 4PMTA 2YACA 1H0WA 4JRVA 3BLQA 4FSMA 2NO3A 2EFQA 3COKA 2E7WA 4IW0A 3PXKA 2YWVA 5JRQA 5E91A 1B4AA 4BHCA 3SW7A 4EUUA 3FI4A 5AP3A 2A2AA 4BDIA 4YZNA 4TV7A 3ML6A 3HEGA 4ZLYA 5CNNA 5IDPA 4WUAA 3ZEWA 3DBFA 4YC8A 4FKVA 4O7RA 2FO0A 1OL2A 4FA2A 2WGJA 3JTHA 3HA6A 1RIOH 3JVRA 2A19B 5BVKA 2WC2A 4FG8A 2QCSA 1TW2A 1CM8A 4RMZA 2LKPA 4D2WA 4O38A 4EK8A 3D0EA 3F23A 4XSZF 2PUNA 2HR3A 2R7BA 3CE3A 3NPCA 3ABTA 4U88A 3OTUA 4KN4X 3KP7A 4NHJA 3PZEA 4U80A 1FP2A 2C3KA 1FOTA 3V7SA 2JTVA 1YS6A 3UIUA 3VS7A 4ZY5A 2F4JA 4FL2A 4HLXA 4M15A 3ZEPA 5H9BA 4H0EA 2X6DA 3Q4ZA 3W2CA 3QOPA 5GZ9A 2CGPA 3QHRA 1IN5A 1U8RA 3EQDA 3TV4A 3MFRA 3QA0A 3R7IA 5EK7A 4AFEA 2PPQA 3NW6A 3QWJA 4RBLA 3WGHA 3SOAA 1PXLA 4H05A 2LGCA 1MRVA 1TNSA 3LAJA 5C8MA 4C0TA 2WU7A 4Y46A 1OKRA 5C4KA 2IZRA 5IG1A 4MXCA 4EOLA 2R7IA 4ANBA 2JDOA 2HQRA 4EWHA 3PJ3A 4YZ9A 3V04A 3FM3A 3O3KA 4EC8A 2ZYBA 4L9VA 4R3CA 5BYLA 2MBFA 3WTTC 3LFFA 4KBKA 4OTIA 4Y5HA 4X21A 3PZHA 4G7OF 1WBTA 5DVRA 4I1ZA 3MVLA 4JDIA 5D9HA 2OJJA 4YIFA 2W5AA 4HVDA 4F08A 4LI5A 2J5FA 5CALA 5M53A 1Q99A 1H1QA 5CS6A 2QBYB 4FGRA 2W1DA 3EN9A 3TT0A 4HX8A 3VF8A 2E9NA 1F4KA 3SDJA 3BBTB 1M52A 2Q0OA 1P4OA 3O6BB 4FTLA 4FSNA 3OOGA 1IAHA 4KKEA 3BLHA 4FVRA 2KKOA 3HX4A 4PGGA 3L7WA 4MXAA 3MFUA 5IH5A 4L6QA 2DWBA 4YLJA 1OYIA 3BHUA 2YSRA 3C0HA 2IJMA 1IG1A 4RLLA 2OJGA 4LMYA 4IDVA 2I40A 4GT5A 1U46A 4FKQA 5E9EA 3LAUA 5LVLA 4MTAA 4NT4A 3BROA 5IEVA 2XNPA 1PXOA 3I71A 4ASEA 4HNIA 3WOWA 4FYNA 4GJ3A 3I81A 5AR7A 4FV6A 5LMKC 5KK1A 4HF2A 3F5XA 4RGUA 4EONA 4Y72A 4S32A 2RNJA 4BI0A 5D10A 3J7AO 5KX8A 2GHMA 5A2QK 2WZJA 2VO0A 3FLQA 1YHWA 4HGEA 1UHMA 4C3RA 3DPKA 3C0IA 5L3FA 2HTSA 4FYOA 4O83A 5DNRA 1LDKB 3KC3A 5EDPA 2EVAA 2UUEA 1Z7UA 5C01A 3I79A 4J7BA 3R73A 4IRGA 1LDJA 4ZTLA 1NA7A 4S30A 1KE8A 3QU6A 3G9NA 1OKWA 3QRIA 4QP9A 4KRCA 3CJFA 1QPMA 2YM6A 4O0WA 3RNYA 3QQKA 2E9VA 1LEZA 4F7SA 4YSJA 1OUYA 3OEZA 4NZWB 4AIKA 3VN9A 3FKOA 1DPUA 4V01A 4EGZA 1ULYA 3VS5A 2Q2EA 4FZ7A 3JY9A 4XG8A 4JIKA 1IW7F 4N4SA 4IM0A 3NVMB 1IRFA 4IANA 3AT2A 5K3YA 2XIKA 2BBYA 3K5UA 4AG8A 2R3HA 4XH6A 2ZFWA 4YFXF 1VZOA 3HHGA 2BUJA 3NNWA 3I58A 2G7HA 3V8KA 5IQAA 4RG0A 5HE0A 2IP2A 4D4SA 2DPDA 4G6NA 2QZ8A 2J0MB 1Q4LA 4O0SA 3PIYA 3OV8A 3KN6A 4J95A 4NIFA 2BRNA 5CEIA 3QLFA 3QP6A 3E3VA 3RJPA 1H25A 3H0YA 4RQKA 3RI1A 4UYAA 4Q4ZF 4I41A 4GK3A 3GU5A 5CF5A 3H10A 4FTOA 4ASXA 4R8HA 4UWCA 1OPJA 2OFVA 4XRJA 2EA4A 3RHKA 5AP5A 2I7QA 4PCQA 5TKDA 4XBRA 3H30A 1F5TA 4AXAA 4QMPA 2V62A 3QD2B 4RVLA 4I3ZA 4IVBA 4R79A 3UIBA 2XNOA 1ZYRF 5L2SA 5CZHA 2JFMA 3NGAA 5CEOA 5EW3A 3HUBA 4FIIA 2QD9A 4CCUA 3D9VA 2OIDA 4RX7A 3D83A 1QMZA 2AYPA 4FZ6A 3LVPA 3E7OA 5LEKA 4O0UA 5ITAA 3BWFA 2VTIA 2CLQA 2VTPA 5KBRA 3U6IA 4Y13A 2W1EA 5EG3A 4JQ8A 4C4HA 2P5KA 2F49A 3RPVA 2BVAA 3QXPA 4XS2A 4A2UA 3R7VA 5IA4A 2QQAA 4QMYA 2R3NA 3GCSA 1NVQA 2QU5A 4AZVA 1PRYA 5AUZA 3MH3A 2H09A 3R28A 3QC9A 3G33A 3HMNA 2X81A 2PVLA 4BKJA 3HTSB 4DFZE 5J9LA
chains in the Genus database with same CATH superfamily
3VHKA 1PVEA 1ZR2A 2X1DA 5CSHA 1L3LA 2CV1A 3MVHA 5KNLA 3CY2A 5BNGA 4EM0B 2F7XE 1QPCA 5CSXA 4UY8I 1UKHA 5A54A 3KXZA 1MBGA 5AR3A 5D7AA 1PP7U 4J52A 4KA4A 4ALUA 4DH5A 3BWJA 3GBZA 4AC0A 4D1XA 2MD0A 1DM2A 2CS3A 5AX3A 3DAJA 3IDCA 3MMYB 1MBKA 4FV5A 1ZELA 2W4OA 2NNWB 3P08A 4A3BJ 3Q9VA 4GO1A 5A46A 1YDSE 3DKCA 5TGTA 4LOQA 4C57A 3W2QA 4U43A 1RDQE 1W36D 1NVRA 5H2FC 3NEUA 2IVSA 1RW8A 3FLNC 4QMVA 1Z0XA 3O17A 3NW7A 4BDGA 3M8FA 3VS6A 2JT1A 3DV8A 1DAWA 2E9OA 1YW8A 4DW6A 5I4NA 3W8LA 3MQ0A 3VODA 1U5TB 4EOKA 3T8RA 5FXRA 4ZTMA 3BL9A 2O9LA 1BI8A 2V7FA 3DEEA 4JOAA 3MPMA 4O0XA 1YIJI 5AIKA 4L9JA 1K9AA 2P6TA 3CTJA 2RG5A 2VI6A 4K8AA 4F4PA 2X0LA 2WHBA 2DA2A 2X6WA 4M84A 5K4IA 3QZHA 1W84A 4MTDA 1CKIA 2IS2A 4DAWA 2GOXB 2DA6A 4BQQA 5K5OA 2X0QA 2Z7LA 3F8BA 4QIWN 1P5EA 2JDSA 2W4JA 3E88A 5BOXA 1QPDA 3BCAA 3WTYC 5AUTA 1NHAA 3R30A 3LAPA 1P9QC 3G1MA 3LJ2A 3M07A 4O7ZA 4ZSLA 5M4IA 3DZQA 3VO3A 1UB9A 4A3GJ 5TO8A 5IUHA 5I3RA 1OR7A 1JSUA 3RZOJ 3IOPA 1IN7A 1ZGJA 1YKRA 4O0TA 2OZAB 4BXUA 1VJYA 1XJDA 4RWKA 3FLZA 4L53A 4BDYA 4BCKA 5BS6A 4EZ7A 3CY3A 1GVDA 1MMSA 1Y6BA 4QMSA 3ZPLA 3U2RA 3BU6A 4PX6A 3R00A 3EYIA 2BKZA 3TACA 2XC7A 3RIRA 5HCXA 4C4JA 3NUYA 3S93A 5B1BH 2UZEA 4DFUA 3OMYA 1UMQA 3V3VA 3HOXJ 3PQJA 2VBZA 3QU0A 1V4RA 1ZMUA 5GJDA 3Q4TA 4WNPA 2VODA 3OW4A 4MKCA 2LFBA 4EOQA 1GV2A 3OYHA 3SOCA 1BJZA 3W10A 1JKOC 4RVMA 4K33A 2XCKA 1K2PA 3KIOC 3BU5A 4M69B 3AFHA 1OL6A 1YOVB 5IMXA 4DNCA 4I76A 4I6BA 4EZ5A 4C2TA 3JXWA 4LL5A 3SG8A 5EI6A 3BG3A 2ELHA 3P7BA 3MGYA 4W4VA 3Q04A 1JUMA 3PY3A 5D41A 2WOTA 2VD5A 4AT3A 4S33A 1H1WA 2E34A 5LMKA 3QU3A 3D15A 2QA4I 2Y6OA 1X1BA 4U0VA 2ZB1A 1R22A 2W7XA 1YXSA 4L9TA 1ZOEA 2KTYA 1ZMWA 4KMFA 2P55A 3KA0A 4WRSA 2J5PA 2PFBA 2C3JA 4TYHA 3EB0A 3J7AY 2JZYA 4BDEA 5L3EA 5DUIA 4E4MA 3REOA 1S29A 4IAIA 2VKDA 3LQRA 2PVFA 3P9JA 3TO6A 3OY3A 5C03A 4DTAA 3WTWC 3KYLA 4C35A 9ANTA 2PWLA 3QOEA 4PJMA 4BS9A 4WUNA 4M3GA 4FT7A 4RWJA 4BWPA 3DOGA 3MTLA 3KVXA 5B2MA 1JKKA 2IAIA 4AGDA 1FQ1B 2WD1A 3LSRA 2FNAA 2X48A 2Y0MA 4D4RA 1WBNA 4V04A 1DP3A 4IACA 5DOSA 2L9RA 2WNTA 3LCTA 5KCMA 3DBCA 3R83A 2OBJA 4I98B 3QQHA 3QWKA 5HTIA 4F7LA 3ZGKA 4CZZA 3HXLA 4FKPA 3VS3A 2OV7A 5JFVA 4PTGA 4I6HA 3HZTA 2XA4A 2ELKA 3OS1A 2PMNX 4CYDA 4LIUA 2W24A 3LXPA 2UW4A 3WARA 2FD5A 3LWFA 2R2PA 3VYTB 3GTQJ 2C4GA 2YDJA 3O2MA 3PP0A 2L7ZA 1Z3XA 3C2GA 1W8CA 4DH3A 1AD5A 1JE8A 2ELJA 4WG3A 4CYIA 3HRCA 5KUPA 2DBBA 1PMEA 4HPUE 5AAEA 3F8NA 3Q5ZA 1W36C 4MEDA 4PWNA 2B4SB 2OF7A 3R21A 3A7FA 4I6QA 2LP0A 4AE6A 2R3MA 3LFAA 2DFFA 5ETFA 3QCSA 3EFLA 4P90A 1JKTA 2HKXA 2DQLA 4ZTFA 4D1SA 2NS8A 4RB3C 4EUTA 4YZCA 3LE6A 1HDDC 4W4XA 3OS3A 3O7LD 4EKLA 1IC8A 1RZ4A 3ZHPC 4M69A 5CAVA 1Y8QB 3GF2A 2B63J 1XH8A 4BJJB 2L02A 3PUPA 2RG6A 5HIDA 5EQPA 3B8QA 2OA4A 2W85A 3C2HA 5CVVA 2HW6A 1ZG5A 3CBLA 1PJRA 3ZM4A 1IN4A 3QCYA 3A99A 3IAM2 4DBQA 2UZVA 4DT8A 3ZUUA 5I3OA 2RGPA 2R3OA 3EPZA 4FZAB 1WH7A 4OT6A 2NNYA 2DQRA 1USSA 3CJTB 4PMPA 4BHNA 3R7EA 2FNPA 3VWAA 2NVUB 4E1ZA 4Y15A 1D1AA 1R5ID 4UZHA 2GNIA 4HGLA 4OIQF 3QTWA 3UNGC 5FUTA 4NDLA 3PJ8A 2WY8Q 3E5UA 1QBJA 5HTCA 4PGHA 5KMKA 4DZPA 2J0LA 3OCGA 1B72A 2G01A 1OCOH 5TE0A 4MXYA 4ZH4F 4FTMA 4NM5A 4P2KA 3CR0A 3TKIA 2CQNA 4ZSGA 5LOHA 3MA3A 5BVEA 2O0YA 3OR1C 3R6SA 1CF7B 2C5OA 3U4UA 1KE5A 3HDMA 2Y4PA 5HTBA 1V55H 4RT7A 1W2FA 3HMIA 1ST4A 3D14A 4Q9ZA 2DPUA 2PVJA 4CG9A 3OYFA 5F1JA 3TUDA 3KCFA 3QGYA 1TWCJ 4L52A 1D8JA 2IN6A 2QOOA 2GDOA 3FAAA 3HC7A 4JQEA 3W8QA 5KMJA 1B39A 4F93B 1FOYA 4ZSJA 3A0BC 4AZSA 4DTBA 2YCSA 4DGOA 2XRWA 5IQCA 1TZDA 1XD7A 3VEPA 4IADA 5BMMA 1CKPA 4USDA 3ALOA 4LOPA 4IE9A 4F9BA 3CSVA 1VR2A 3OYDA 4YFNF 4ZTHA 1FVVA 1JKQC 5L6WL 2J6MA 2XSDC 4O7LA 2EV0A 5J7HA 1FSEA 4MYGA 4LLGF 4XLAA 2XIYA 3CO7C 3C18A 3DS6A 4RA2A 2QQBA 3DB6A 4AF3A 2ZSHB 2NNNA 5EH0A 1PKGA 4EKKA 3FXUA 2P4IA 5J1VA 4FOBA 4RJ5A 2I8DA 3LMGA 3IWZA 3V5TA 1UNHA 5A6NA 3KMMA 4BCMA 3LFNA 1J59A 2OH4A 2XJ1A 4MIMA 3QQAA 3P79A 5EI2A 4O2ZA 5CLSA 5HLGA 4AP7A 4XUFA 5HG9A 4EQCA 3S1HA 4BZOA 3ELJA 4TWOA 1URWA 4RJ3A 2PZ5A 2ITZA 4A3DJ 2I0EA 3QD3A 4FEUA 5JZNA 2YIWA 3LSMA 1JHHA 1OISA 2PEXA 3MS9A 2NVYJ 3R8PA 4IZ5A 4L5JA 4HZRA 4HSTA 4DEIA 3CTAA 5EJCA 3U51A 5ILVA 4S04A 4M9XA 4C3JJ 4IHSA 2IS4A 4PDPA 4I21A 2VV9A 3ERKA 2F5DA 2KHMA 2CKEA 2O6GE 4OR5A 4DH7A 4RPVA 1ZQ3P 5AEPA 3DKYA 4YZBA 4CKRA 5CU2A 3LCOA 1KYWA 5J95A 1I5ZA 5C8KA 2V6EA 2KT0A 2EFNA 2WB1A 3H9JA 4KJZA 4YC3A 4XHKB 3ZDUA 3QPTA 1H08A 1PXKA 4IHXA 2H8RA 5EYCA 2K85A 3N4MA 1A36A 2OGVA 5HD4A 1ATPE 2GTMA 2WKMA 4OTDA 4G34A 5KKRC 4FKTA 1ZWSA 4CZYB 4BDHA 3G51A 3DPLC 3T8TA 4G6QA 3LSKA 3H4JA 3PLSA 3RZFA 1T56A 4LUEA 4XLVA 5T68A 2OTLI 1UG0A 3H9RA 2CPKE 2WMBA 1HW2A 3ORTA 4FNYA 1B1BA 2WTIA 3FZSA 5AV0A 5C4LA 2G0EA 2ZV7A 5HI2A 2DDAA 2C6YA 2YJSA 2C0OA 2F7EE 3U9GA 3BU3A 4B3AA 2KRHA 2ONLC 2P2IA 4ON0A 2DXIA 2UZOA 2OZAA 3R63A 5AUWA 5JR3A 4A5NA 3BG9A 3BR1A 4O4BB 4FI1A 4AZFA 2PE2A 3UR3C 1I6XA 1EH4A 2X7FA 5IQDA 3NWSA