1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
1WBSA 3I60A 4NM7A 4FX0A 4YJUA 3G0FA 4O91A 3G6GA 4IZYA 3C51A 4BDEA 3C13A 3MZYA 5HICA 1VEBA 2VBXA 4QP2A 3RCJA 4EKLA 3ZH8A 3DDQA 4NWMA 4DTKA 3MYGA 5JZJA 1GNGA 2C30A 3WZUA 2HIWA 3VJNA 3WE8A 4PTGA 3E63A 3GCVA 3JYAA 4PZJA 3NYOA 1G4DA 3KP7A 3QUPA 4CFMA 1REJA 2YEXA 4RFMA 3V01A 5HDKA 4G6LA 5JK3A 1QZYA 4G3CA 4KN4X 1XDUA 2XCKA 3ZYAA 2GQGA 1H24A 4FV0A 2E1CA 4X2NA 2I0VA 1FMOE 4CFUA 5CI6A 4UVCA 1BUHA 1FPQA 1PMEA 2PVYA 3DS6A 2XCHA 3IWZA 4WK8F 1SZMA 4LV8A 4KMFA 4OTIA 4S2ZA 4IVAA 3D2IA 2GAUA 2PMIA 4YNEA 3ZRMA 3DGKA 4OBOA 2M45A 4GV1A 3MH2A 1XBAA 4UMRA 4CMUA 3RGFA 1JGSA 2OZUA 5HZNA 4NH1A 1FX7A 3BZ6A 4PPBA 3G5DA 4OU0A 4MCVA 3R61A 5JFVA 1Z6TA 1R7JA 4BICA 3BKBA 2GNLA 1E17A 4O7SA 3RNYA 5CQWA 3L1SA 3GU7A 5DVRA 2EB7A 4IX3A 5L6WL 4DG3E 2NRYA 3DJ5A 5IEVA 2ITQA 4E5AX 4AIKA 1Q8UA 4EOMA 1OITA 4F1OA 4AN9A 3QPHA 3AT4A 4KIBA 2RFEA 3ZFMA 3QKKA 2J4ZA 2WTIA 3S95A 3HSFA 1TQIA 5KCVA 2F7XE 3FXXA 4AIJA 1QBJA 2CGUA 1UFMA 1F4KA 4HV5A 4A5NA 5LARA 3ZN1A 4JQ8A 3QRJA 1FYMA 4BZOA 2CDZA 3L9LA 1H27A 4OOIA 4BY9E 3AMAA 3NNWA 4E4MA 2D1VA 4FL3A 1BC8C 1GZNA 1XDSA 3GU8A 4E8AA 4GS6A 1E2XA 3K1MA 1GY3A 5T68A 3DK7A 3HRUA 4A2UA 3GFJA 4IAIA 4R3RA 5H3QA 3I53A 1YOMA 4BAYA 5CAPA 1L3RE 2C6TA 1U59A 2GIVA 2ITUA 2CN5A 1OPCA 2DS1A 2HXQA 4NTTA 2YZAA 2Z7QA 3TM0A 1MQ4A 3JUHA 1GXPA 4G6DA 4S32A 5E91A 4U0IA 4CKRA 1XB4A 4F9YA 2J5EA 4DFNA 2DAOA 3VUDA 4BWPA 4OTQA 3JS2A 2ESMA 4Q5SF 4M7IA 3MVJA 5C4KA 3IW8A 3R9NA 3VB2A 3ZS5A 1R36A 4XSXF 2ZAZA 2HYYA 2GPHA 3DK3A 1ODDA 1YYVA 4GYIA 4LFIA 4W4WA 2ETRA 3BELA 5AA9A 2GHGA 1SYKA 5HBHA 1KWPA 2PLYA 4MXAA 2YDJA 4CRSA 4FK3A 3GLXA 4FT0A 3G90X 2VTSA 3RKBA 3RI4A 5AIQA 5CZHA 2ZV8A 1OYWA 4NIFB 3C18A 5JR3A 4FV2A 4RT7A 2WIPA 2V79A 5E20A 2H96A 4ZEGA 1KQ9A 2WHBA 1S6LA 2ITWA 3CLOA 3KFWX 1H1RA 4YZDA 1K78B 1XH6A 4WNPA 1YWRA 3AD6A 3QGYA 4FIFA 2R7IA 1A48A 2AS5F 4WXCA 3F2NA 2PY3A 1BN5A 4FV8A 4XOZA 4WUNA 4PWNA 5EQEA 3NUYA 1SNUA 5FEEA 4E3CA 2C3IB 4MF0A 4IM0A 2JGZA 4WG5A 2J7TA 4HNFA 3GZ5A 5M55A 5IEYA 5E8WA 3NLBA 4HZFA 3R7UA 5CSWA 3TNPC 3E7VA 2Z5UA 4ZTRA 2YDKA 2EV5A 2B9FA 4BDAA 4DH5A 3I0QA 3EFJA 4XV1A 4KRCA 3D4QA 1BI0A 2JPCA 3F6VA 4E4LA 1FBUA 2V6CA 2RF9A 4LB5A 2W99B 1ZYJA 3EQRA 3LJ1A 2GHMA 2FBHA 3ORLA 5JFSA 1Y8GA 3CGFA 1Y91A 4YSMA 2GNJA 1TLHB 1D3YA 5GINE 5HG8A 4Y95A 5A14A 4AW5A 2FSOX 5DT0A 5I3RA 3QFVA 2R4BA 4QMYA 5LQFA 3VS2A 5L3AA 4DG2E 3NUAA 3B8QA 3PG1A 2JDOA 2J9MA 1Q8YA 4HAMA 3LCSA 4X6RA 1B38A 1T45A 5JFXA 2C4GA 2WXVA 4AZVA 3QCYA 3P79A 3KRWA 3ZMTA 4C4EA 5IG1A 3VS3A 3O8TA 4LGGA 2FSMX 4YLLA 4IC7A 5TF9A 4FSNA 5IA1A 4IFGA 5IUIA 3DB6A 5CAUA 3QQFA 2J5OA 4HOKA 2XA4A 2ONLA 1KYWA 1LQ1A 1G3SA 3P0MA 4HPTE 2E9VA 2W1HA 5CLPA 4PP7A 1YW7A 3E8CA 4FKJA 1ZG5A 3ROCA 4L00A 1NVRA 3DKGA 4I3ZA 1U4DA 3PXRA 4A5MA 4KIKA 4IJ9A 4JR3A 3IDCA 1SMYF 4ZZNA 2LF7A 4OTRA 3ALOA 2UW9A 4CYDA 3IGGA 3E6CC 5DYMA 1ZRZA 2OXDA 2VO6A 3NAYA 2VWYA 4U97A 4I20A 4M97A 2HK5A 5CSHA 3D5VA 3K9TA 4LI5A 1Y57A 2VT3A 5IDNA 1BIBA 4CFVA 4O27B 2XIXA 4DT9A 4MBLA 1XJDA 2H6BA 2H27A 4HGLA 3I54A 4D28A 3KQ7A 1FBNA 3UE4A 1GAGA 5KK1A 5IT9K 1UA2A 3CP9A 4A6DA 2I0HA 3MFKA 2VTOA 3BWGA 3QWJA 3F6XA 2YN8A 2QLUA 3PVUA 3QTIA 4BN1A 3DNEA 2MH2A 4AA5A 3EMGA 1JQHA 1SMHA 3UZRA 3FZPA 2WTKB 2YX7A 1ZYCA 4P55A 1FYLA 3V5WA 4ZK5A 4AS0A 3CJNA 3W10A 3V7SA 4IJAA 3HLLA 4CYIA 4EQUA 1B59A 2JLDA 2CNQA 5EQYA 1CSNA 4CG8A 2JPBA 3HV5A 4Z9LA 4HVHA 3MPTA 1IAJA 4X2KA 4AF3A 3E6MA 4FX3A 5HDNA 4A07A 1PY5A 3P5KA 3K54A 2DI3A 3ZP5A 3O7LD 2QLQA 3BGQA 3PJ2A 4PPAA 3SRVB 1ZYLA 4C38A 4USDA 4O5VA 4TT7A 2WD1A 1Q4LA 2XIKA 1HOWA 2FF4A 2ACXA 4EC9A 2VWWA 2EB3A 4FG8A 3VEPA 2WZJA 3DLZA 4LG0A 5HD4A 3QZFA 3D5LA 3PDTA 4DAWA 2KIFA 4HYEA 1TVOA 2PPQA 3QCXA 4TWCA 3KRRA 5M08A 1ZOEA 1RI7A 3BY6A 1L0OC 5IQGA 3LCDA 3R01A 2XRNA 4IVCA 4I02A 3HMNA 3BGPA 3PYYA 2ZB0A 5J8IA 2ZV9A 2ZB1A 4WRGA 5H2UA 3S0OA 1KE7A 5EM8A 4UVAA 3I0TA 2J6MA 2V62A 1MP8A 4EK3A 5EDRA 5IH6A 1S3JA 3TIYA 2HZIA 3ZC5A 3LOKA 3R73A 1OIUA 5D12A 3IGOA 5L4QA 3MB6A 4M15A 2JBPA 4GH2A 5HLWA 5FWKK 3Q52A 1XH9A 4YHJA 4ANOA 5AUXA 5CVRA 4CEGA 3OCGA 4C57A 3H3UA 3FAAA 4TTHB 3W2CA 3RWQA 2HEOA 4MXCA 5IMXA 2GA2A 4JQFA 5IQHA 4D4RA 1W7PD 1XN7A 4M68A 3ZSHA 3FF5A 5HNGA 5CSPA 1JOWB 3V5QA 1YOLA 3ORIA 4L53A 5AADA 3R2YA 4OR5A 4AA0A 5K9IA 2X4ZA 2ITTA 5LMKA 1E1VA 3B73A 3UPXA 3VBQA 5B2LA 3UZPA 4HDUA 3DU8A 2MA3A 3I7BA 3PXFA 5FEQA 3MTLA 3HAMA 1I44A 3BQRA 3Q6UA 5LWNA 3PA4A 2RFSA 5K5OA 3R71A 1B9NA 3U51A 5E9EA 3BPRA 1FPUA 5HTBA 2GQQA 4HF1A 2DT5A 3CTHA 2HOGA 3LFEA 3FXZA 1LJ9A 1JKLA 2P4IA 4RIOA 1OR7A 4I92A 4EH3A 2YISA 4Y46A 3FLQA 3Q60A 4RX5A 2O5KA 3UYTA 4QMPA 4RMZA 5JMSA 3SC1A 3F66A 4LGDA 1SVHA 4EJWA 4MHAA 3G0EA 5BVOA 3SW7A 4S33A 2IVVA 5A3XA 4IXPA 2BIKB 3E93A 4DCEA 4RB0A 1E1XA 2QR8A 3DAJA 4DBNA 4X2GA 3ERKA 4MTDA 4O0RA 5FBOA 4RJ8A 3MI9A 4L42A 4R8QA 4C2WA 1XCVA 4N6ZA 4FT8A 2PL0A 2F7EE 4MXZA 3U6JA 2OBPA 2FMYA 3P7NA 2C0OA 5E1EA 4PMMA 3RTPA 3WOWA 5DBXA 5HLGA 3C7JA 2RFDA 5HE1A 2B53A 1HBXG 2BDFA 5LLQA 3F8CA 3U6HA 2RKUA 2W1ZA 1WI9A 2BHHA 3E7OA 4JQ7A 2VO0A 5CAVA 3VS7A 3KF7A 3FZTA 3R22A 5FP6A 4ZS0A 2FQ3A 2GS2A 3PG3A 2OJ9A 2E9OA 5D7VA 3GCSA 4A9SA 2WEVA 3RZFA 4C0TA 4OMYA 3PSCA 2W17A 2W96B 1R0PA 2NPQA 3KEXA 4TYGA 3LWFA 4GIHA 5D5VB 5HDGA 1ZY5A 3RDIA 4D2TA 4JG6A 4CD0A 2EV6A 4IIRA 2BKZA 1WBNA 3IW5A 4IEBA 2M87A 2GDOA 3IRRA 4UX9A 4QMWA 4RS8A 3CUQB 2K4BA 4IB3A 5A4TA 3TNIA 1SFEA 4L01A 4I5PA 2ISZA 5KMMA 1QPDA 3RKWA 4AW1A 3T9IA 3L09A 3WTUC 4L5JA 4UV8A 5DHJA 2WTCA 4IB1A 1R78A 5G1XA 4L0YB 4KABA 4MXYA 3MAJA 2XNPA 3DV3A 1G3NA 3ECOA 2STWA 1KU9A 2OQGA 3VRZA 2G2FA 4L9TA 2C5OA 3FI4A 4NIFA 3JVRA 4YPSA 3FZ1A 4O3MA 3PZEA 4CO8A 3DAEA 4BDBA 3OV8A 4BYJA 3E8NA 2BZHB 3UVRA 3PTGA 3GBZA 4PF4A 3R7OA 4EH6A 5IISA 4BKYA 2GCDA 3TTJA 2E9NA 5M4UA 3BJOA 4UWYA 5FGKA 3Q9WA 5IQFA 4FVRA 4BYYA 2QQAA 1J7KA 3O51A 4FIJA 2C5NA 2HS5A 3E8DA 2BRMA 3E5UA 4MQVA 2QU5A 3DKCA 4A9RA 2WO6A 4PCQA 1LDJA 2IW8A 2KRFA 2W5AA 5A4LA 3H4JA 2P7CB 2WTKC 1W5SA 4RX8A 3TN8A 4MEYF 4R1HA 3ZMDA 3WF8A 3ROYA 4XJ0A 4CLIA 4O38A 3F3TA 4EH7A 4I94A 3N4MA 2FOKA 4YJVA 2W25A 1TKIA 5DFPA 4JJRA 2UZVA 2VC1A 1W82A 4EK8A 3KLOA 3MIAA 4M74A 3CTQA 4IRHA 1OBGA 4I41A 3FPMA 4A0ZA 4L6QA 1RUNA 4YHFA 4EL9A 1PHKA 2CMWA 3EOCA 3Q9VA 2H34A 3R9RA 2YIRA 4W9XA 1U78A 1X3UA 4GCVA 2FGIA 3QUEA 3OEFX 4RJ3A 1U46A 5CS6A 4CXAA 4MF1A 3HTSB 2PWLA 2HZ4A 4EJTA 3AC5A 4FTAA 3OOPA 4MWHA 4PTCA 4FSWA 4BDDA 2HQRA 3KULA 3DXJF 3QA8A 3CDHA 1KQ8A 3LQQA 2ETMA 2M1BA 2L4MA 5FLXZ 4F64A 3UG1A 3R00A 4ONAA 3O17A 1UKHA 2VTQA 4JK1X 4PV0A 4EUUA 2EVAA 4F1MA 5CJ9A 4E5WA 4YJNA 5CEIA 1M14A 1M2QA 1WFCA 1ZXEA 4AW2A 4R3PA 3M11A 4KT5C 1FWZA 3ZM4A 2ELHA 1TQPA 3SOCA 3VBVA 2AYPA 4R3CA 2VD5A 4I1ZA 1EH6A 2RIOA 4MYGA 2W1GA 4FE2A 1P6RA 2FUMA 2CKPA 4C3FA 3F3UA 4AD9A 3SX9A 5J79A 3U1DA 4HLXA 5CXZA 5E90A 4LG0B 3PP1A 1U5QA 5F1RA 3O96A 2SRCA 5AP7A 3GCPA 3IPHA 2G2HA 4Y13A 2RL5A 4XLIA 1G8AA 4K18A 3TUCA 1IN4A 5KMNA 5AUTA 1H1SA 3U2RA 2X0GA 4GXOA 1GJOA 1O7FA 2JAMA 3W55A 3H3CA 3ZEWA 4CGZA 1O9UA 2BTRA 3R0TA 1T38A 3AC4A 4M13A 4RA5A 2JT1A 4PRJA 4C3PA 2EK5A 3E5AA 1NY3A 4HGSA 4YO6A 4IX4A 2Z7SA 4G16A 3WIGA 4QYHA 4FC0A 5LMKC 4BKZA 5DGZA 4ESJA 4MNEB 5HOAA 3NNXA 2WEIA 3GU5A 5AONA 2Z33A 4XG2A 2G15A 4RAYA 5HLPA 4U0WA 3VS6A 4BVUA 4GK3A 4G6OA 2QG7A 2EFPA 4CQEA 4M8TA 5HX6A 2ACJA 1Y8YA 5IQEA 3TOAA 3QTQA 4HX7A 4E6AA 4UXLA 2ERKA 5CY3A 3RPSA 4H36A 3VS1A 5HVQC 3KMWA 5JEBA 6PAXA 3P1AA 4R7HA 4A4OA 5D5XB 3HOTA 3AT2A 4P9FA 1D8JA 5IPJA 3NUSA 2CW0F 4AWIA 3GZ6A 4KNYA 2OFVA 3QU3A 3EWHA 3VQHA 1W84A 4AUAA 3I5NA 1OL7A 4Z3VA 2M5WA 1XH4A 4HV6A 5EYDA 2JDTA 4F6UA 1GZOA 4DITA 3COIA 2BPMA 3MB7A 3J80Z 3R9OA 4TYIA 1WVXA 5D7AA 5F4NA 4O84A 4DEDA 2YSRA 3LMGA 2R3LA 3NUNA 3NZ0A 5A54A 2Y9QA 4MKCA 1W83A 5AR8A 4IHSA 3GEZA 4FKTA 3E8EA 5FEDA 4FEUA 5K5QA 1Q99A 3F8BA 2VWIA 3GVUA 2XAHA 2XGXA 4QP3A 3EIDA 1P2AA 3F3ZA 3T0YA 3R0AA 4K2RA 2GNIA 4XG6A 4U7DA 4X3FA 4IWOA 5A4QA 4WBOA 3ZMUA 2Y0MA 2VNWA 4B99A 4B8XA 3ZN0A 2VTJA 4R5YA 4FZ7A 1T39A 4KWPA 2ZFWA 2VE9A 4EOLA 3P9JA 1PYEA 3S00A 3ENMA 2UZDA 4CKIA 3BRBA 5K4JA 2GFSA 3QRUA 4EH5A 4ID7A 2V9VA 1KOBA 4UUVA 3V8TA 4K0YA 3H9RA 3R0JA 4MK0A 2VWZA 1ZG3A 3K3IA 5M44A 1HW2A 3FE3A 3Q5ZA 2VXZA 5CEKA 2HZ0A 4FTLA 2A6EF 5E8VA 2XK4A 4GK2A 2BMCA 5CAOA 4WBBB 2JITA 1F1ZA 3A4OX 4WSQA 3P7AA 2O2UA 2J0LA 2PUPA 1JXSA 2WTDA 3R02A 4M72A 2WMQA 4P7EA 3EJ1A 3QTUA 3WTZA 3GT8A 4DFBA 4J8MA 5L2TA 1H9TA 4PUZA 3QHWA 3ZO3A 4AFJA 4U41A 5HG9A 3PPZA 5CEPA 3Q53A 4JLCA 3SVVA 4CT2A 4Q2AA 1XSXA 1J5YA 3BV3A 5A4CA 2WKMA 5BYZA 5CU6A 3BX5A 4XBRA 2FNAA 1BKXA 2I0EA 2VZ6A 3P86A 3ATTA 2L01A 4UHTA 1OZ1A 1TW2A 1I09A 2GNFA 1CDKA 4YSJA 5D11A 3A7HA 4X2FA 3FQSA 4HYUA 3UBDA 3NW7A 5BVDA 1FLIA 1NA7A 4DNCA 1YKRA 5FO5A 2MLGA 4HOBA 4BB4A 1P4OA 4W4YA 1JLUE 2P4WA 1FBQA 3HAVA 1H07A 4F63A 5KZ0A 4WCGA 2BZIB 1V4RA 4FX4A 1H0VA 4KBCA 4RVLA 3KVXA 1Z1DA 3FMMA 3KLNA 3ENHA 4OIRF 4UMQA 2PJPA 4TPTA 4FEVA 2DUVA 4O1OA 3R7EA 3SD0A 2FSLX 4DG0E 2X39A 2G2IA 4J71A 1JHFA 3CD3A 5FFXA 1T0FA 3EQGA 2WMWA 2PVNA 4ZYEA 3HRMA 4FK6A 2YJSA 5IKWA 3A8XA 4C58A 4FTRA 2M8EA 3IW6A 5KO1A 3FXRA 2A27A 4NHJA 4ZJJA 4P90A 4U79A 1MDMB 2G7HA 3QX2A 2HKXA 3QTWA 2VTNA 2BRGA 4AN3A 4UMUA 4ZZOA 2CPKE 3LKMA 1GHCA 4BYIA 4D5KA 3BBWA 3PA3A 5M56A 3KC3A 1B6AA 3VBYA 4D9TA 3ZO1A 5E92A 4EJOA 1PW2A 4J1RA 3AGMA 4N0BA 4GFOA 4NU1A 4EJ7A 3LW0A 3M42A 4KAOA 2R3MA 4O7ZA 4FODA 2ZXJA 3IL2A 3ZTXA 4L0ZB 2BAKA 3R30A 5DDGA 4NFNA 4U45A 2EB2A 2R3IA 1A04A 1Q3WA 4E26A 2PZYA 1IW7F 2P8TA 4IZAA 1DAWA 4PL4A 4AGDA 4J52A 1SMTA 2OH4A 1B4AA 1ZWSA 4QYEA 4M12A 4K6ZA 1EH4A 3VOEA 4ZZDA 1XO2B 3FLWA 2UXNA 4KKEA 2GTNA 2F49A 3DKOA 4MXXA 1JSUA 2A69F 5JVTA 1Q8ZA 4GT5A 4N70A 1LR4A 4QOXA 5ICGA 2K02A 4I5MA 5DE2A 2CSNA 5AR3A 1PXIA 4TWOA 5FUTA 4LQMA 1S8NA 5FP5A 3DKWA 3BPXA 2BZKB 4ALUA 3V51A 5JRSA 3HOSA 3QOPA 3UVQA 1OL1A 2XB7A 1R58A 4F6WA 3PRIA 3JSPA 3CJFA 3RAKA 4OAVB 3OBJA 4O0XA 4BCGA 3QD3A 4IRIA 3P7CA 5IDPA 5GJDA 4Y72A 2BRHA 4FV5A 3U9NA 1MZBA 3LFDA 3P9CA 3UIXA 3ORNA 5L3BA 2X9EA 4QTBA 4YR8A 2C6EA 3F7WA 1R00A 4I6FA 4ACMA 3K0LA 1AD5A 4EHEA 3CUQC 4XH6A 4YJRA 2W1CA 3UG2A 3IRQA 2WQNA 3V5PA 5HBEA 5AUWA 5AA8A 4RGRA 2VBWA 4WOVA 4EWHA 2XEZA 4MD8E 3KMUA 5A4EA 5AR7A 1H4LA 1YS6A 2O03A 4APPA 4IWQA 3TI1A 3SZPA 2AC3A 1PXMA 2X9FA 4FTJA 4ALVA 2R3SA 5JRQA 3WIKA 1IF1A 4U9AA 4F9AA 4Q9SA 1KV1A 3EQCA 3NDMA 5H20A 2X7FA 5DH3A 4BZDA 4CFWA 3LXNA 4WD5A 4R1YA 4BTMA 4PDKA 4F1TA 5LOHA 3TV4A 3O8UA 2HDCA 3OW3A 2WMXA 3EKKA 3TOBA 4IC8A 4EKKA 4PPCA 4EOOA 5BQ0A 5ITAA 1YI6A 2LF8A 2X6EA 4C02A 1BLXA 4A06A 1FVVA 4LRJA 4TKSA 1WKMA 5AUYA 3NRMA 3AAFA 4QRCA 3OW4A 4BCHA 2VT2A 4R79A 2OQRA 1R0EA 4JRVA 2ITVA 3FXUA 3SQNA 2OJFE 4IAFA 5E8UA 3R04A 4I6BA 2G9WA 4H0EA 4PNIA 1QPJA 2OZOA 3LQ3A 2QVSE 1XD7A 4D1ZA 5BQTA 3TDUC 4E6CA 5FTGA 3GVAA 3WTYC 2QCSA 2Q0OA 4UYNA 3GC8A 2OFUA 2YM4A 1PP8F 4DBXA 3TKUA 4L7FA 3O23A 3WF9A 2NAZA 1OL5A 5DYJA 3C5IA 1YRPA 1NT2A 4S34A 2M30A 5FDPA 2R3OA 3R9HA 4MQ2A 1J1CA 2O64A 5L6OA 4J96A 4OBQA 3EH9A 2JC6A 3ZM9A 4KINA 3ODZX 4PX6A 4HX4A 2VTMA 3HHHA 4DFLA 5KMIA 2IJLA 1OKVA 2QOHA 1WQ2A 4TW9A 5BPIA 3A7JA 3S2PA 1H25A 2GXGA 3ODYX 1OYIA 2XEYA 3UDBA 3RCDA 3KGAA 1YTYA 1T46A 4RB1A 3FHZA 3MW1A 3MFUA 4GKHA 5HU9A 1IAWA 3O3KA 3A61A 4UALA 5IEXA 2GZWA 3R8VA 2OZ6A 3LJ0A 2QO2A 3R21A 3OTVA 4JBQA 3KXGA 4ZY6A 3N4TA 4JG7A 3FMKA 3I4BA 5IUGA 3TJDA 3F3WA 3TNHA 3RYPA 4L8MA 3VQUA 1UHMA 1TW3A 3OBGA 2A07F 3AD4A 1HCKA 4E1ZA 4GVAA 4F7JA 4TRLA 3HA6A 4M9ZA 4P5ZA 5AP1A 2EWNA 4V0GA 2TDXA 2O6GE 2YITA 4I2OA 2P5KA 4NUSA 4ENMA 3UC3A 4CZZA 4GUEA 3PUPA 2YX4A 1IAHA 1MQBA 3IDPA 3K5VA 2ITOA 2FMLA 2X4FA 4IFCA 3TUBA 1VYWA 3MWMA 1XMAA 2LAVA 2KJCA 3F23A 4Y5QA 3VUGA 1WBWA 3KXZA 4NQWA 3FWEA 2R3RA 4V05A 4FNWA 1R1VA 1KUTA 4U6RA 2HYGD 1DS5A 3WU0A 4H3PA 4EC8A 5HCZA 5F94A 4I0AA 3IONA 4YZNA 4JIAA 1QPEA 3CD8A 1MGTA 3NS9A 4KRDA 5CSVA 3Q4TA 4AN2A 3F9NA 2IP2A 4BCPA 5H8EA 5FM2A 3IS5A 2P2IA 3RALA 3H3ZA 1R1UA 5FTOA 5AUUA 3L8XA 4QP9A 3C4EA 5EK7A 1PF8A 3P08A 1CKJA 3EYHA 5EQPA 4F7LA 4I93A 2R0UA 1IN5A 3CUQA 3LFNA 3PY3A 4TN6A 4DH3A 2ZMDA 5LMBA 4RC3A 1FP1D 2PSQA 2V7AA 2EUFB 3OVVA 4EZ3A 3ISPA 1GXQA 5AR5A 4FT5A 3QRIA 2P2HA 5BUIA 2G01A 1ZLKA 1KU7A 4QNYA 4CRLA 4OTDA 4BWKA 4OTWA 2GTMA 3SAYA 5GNKA 3NEUA 1LPUA 3QCQA 4AACA 3DXQA 1OKWA 2V0DA 2F5CA 1GZKA 3EN9A 2J50A 2BE5F 3LZBA 4LRMA 3WILA 1WBVA 1FP2A 4L7SA 2DTRA 5ICEA 4YJSA 2Z2WA 3NYVA 2XRWA 4O22A 4HGTA 3KK9A 1I5ZA 5EDPA 1NVSA 3PFQA 3D9VA 4L9VA 3ZO2A 4PDOA 1PRYA 1PJKA 1SD4A 1ONVA 4IADA 2XUUA 1KE5A 3BJ6A 3B02A 4IWDA 1OPJA 3WE3A 2ZM3A 4BBEA 3RI1A 2OICA 1GVJA 3EZVA 4XRLA 1HSJA 4FZ6A 3V6RA 3LFQA 3E3PA 3KP6A 4ENKA 2CYYA 4M73A 2EWAA 2WAJA 4U42A 2X4HA 5HIBA 4DGNA 4HQMA 4FV3A 4Z2YA 2R3GA 4AOTA 3PP0A 3R7YA 2MLKA 4WNOA 2QOQA 1GIIA 3ULIA 3RZBA 3ZFXA 4OTPA 3FI8A 5E4HA 5DWRA 3QU6A 4C4IA 2W9FB 4MTEA 4L43A 5DD8A 3HRFA 4J53A 4LGHA 4JQEA 1S9JA 4MGRA 3FKNA 3WZDA 5CYIA 4QTEA 2DQLA 4BCQA 3R60A 2CCIA 2D2WA 3O50A 3DZQA 3TO7A 4LRKA 1RJBA 3PWYA 2NNNA 4C33A 1A9UA 2R7DA 2XKPA 2XROA 3R7GA 4G34A 3FKOA 3EN7A 4YFNF 1H1WA 5I9YA 3T1BA 4MEDA 5ETFA 3IOKA 3PE1A 5HVKA 3VO3A 1J91A 1ZZ2A 2C6OA 5CVGA 1J1BA 4FYOA 5EOBA 3DBCA 5CU3A 2FA5A 2XNMA 3F82A 2PZRA 2WTJA 2X6DA 5CEQA 4UV0A 4AGUA 3NRVA 3TL8A 2OIDA 2J2IB 1JBPE 4WSYA 1ZARA 1O3RA 3QC4A 2BDWA 4FT7A 3ULZA 3TV6A 4AGWA 4KKHA 4KSPA 1IRFA 2FSWA 1ZOGA 5C01A 2MH9A 4I09A 3LXPA 4F0GA 4JIKA 5B0XA 1SFUA 3ZZWA 3MVLA 1LEAA 2QQBA 4RZWA 5ANOA 2BFYA 4R7IA 3UOLA 2V7OA 3GYHX 2QO7A 4YHTA 4BCFA 3SQQA 2YERA 4HZSA 1UCRA 1DDNA 2VOOA 4QP1A 4XP3A 4EI4A 4OTGA 2Y8OA 3R8ZA 4NKAA 3IECA 2F57A 3A8WA 4RB3C 3GEQA 1KE9A 3V3VA 3CIKA 4RFZA 4F09A 2B4SB 5DA3A 2YM6A 2W1FA 1YXXA 5CT7A 2I6LA 5KNJA 2HWPA 4ZTQA 4YU2A 2O0UA 3ZU7A 5K0XA 1ERKA 1ON1A 3BZ3A 3KXNA 3NW6A 4BL1A 3KL8A 5AMNA 1PDNC 4RBLA 3ET7A 3LHJA 2V1DA 1H9GA 3MTFA 4NSTA 4O7TA 2ZDTA 5HVJA 2ZMEA 2RQPA 5CASA 2O0YA 3MFTA 1J9IA 3J7AO 2PUNA 4LGWA 4O81A 2XAGA 4E20A 5AM7A 5H6RA 4U81A 2CGPA 1ZMUA 3R1SA 4EVIA 4QQCA 2X8EA 3LXLA 1OMIA 2GHLA 3CY2A 4QMTA 3COMA 3QYZA 4BR3A 2VE8A 1GOLA 4A6EA 4UWBA 3EQIA 4G94A 4HLYA 1WVYA 3ZONA 5GZAA 1OPLA 2WTVA 4F65A 5GZ8A 4GFGA 3KETA 4Y5HA 3QF9A 4M67A 3ZUTA 4D4VA 5AWMA 4G9RA 1LP4A 2G1TA 4MD9E 5HESA 5LVPA 2O65A 1ZMVA 2UW6A 3FPQA 1YXSA 1XSDA 3FC1X 2BGCA 5DV5A 4XLNF 1J75A 3QP6A 3VBTA 1R22A 3A7GA 4O2PA 3VF8A 3SFZA 4O0UA 2FYSA 3RPYA 2RDPA 4AE6A 5IT9Z 1XH7A 5HIEA 3GC9A 4K9YA 3UP2A 1BBYA 4YC3A 3G6HA 5AR4A 3GF2A 4II5A 2JAVA 3NX8A 3G15A 3QZHA 4EV0A 3EKNA 1JHHA 1LDKB 1ZRCA 2CNUA 3L00A 2QC6A 3FMEA 4M3QA 3ORXA 1XGSA 5HNIX 1URCA 3CE3A 4HCVA 4G8XA 4Q5HA 3MBLA 4W4XA 4ZTMA 2FBIA 4I0TA 4D55A 3KREA 3THBA 4JI9A 4KIKB 2CGVA 2QWWA 2I40A 4FEWA 3E3VA 3PPJA 3HGKA 3DBDA 4D58A 5E1ZB 5DN3A 1WBTA 4WO5A 3RKYA 1U5RA 3C1XA 4G3FA 4L3LA 3TKIA 2IT0A 4JBVA 4IHPA 2VTIA 4IACA 1AWCA 4MQ9F 4Y83A 1CKIA 3C0HA 1CKPA 4WRSA 4WG3A 2VTAA 2A0CX 5KUPA 3OCSA 4CFFA 5K5XA 2QI8A 3ORZA 1UU7A 2C5YA 4JBAA 2GWRA 3N51A 1K78A 4I5CA 2DPDA 3QALE 3TO6A 2XJ0A 2VX3A 3E92A 2XK3A 1FC3A 3DF8A 2IVUA 5EH0A 1V0OA 1T98A 2XNOA 2XNEA 3K1NA 3RPRA 4EM0B 2IRFG 4IAKA 3KULB 4Y17A 1VYZA 3FL5A 4X3FC 1JNKA 3FL4A 3LM5A 2CWEA 3R4KA 4DGLC 4XP2A 2Q0BA 4KIQA 4PTEA 4FI1A 2B54A 4H39A 2XKOA 2C5VA 4C62A 1JSVA 3O2MA 4KB8A 4U44A 3ABUA 2XKEA 3G33A 1RIOH 2J90A 3F6OA 3LFBA 4TNDA 1Z57A 4GG7A 4BC6A 1USTA 3KKVA 3TT0A 3GOKA 4HBLA 4E93A 4YPDA 4MBIA 4ENXA 2YDIA 1XGNA 4XX9A 5D5UB 1ZOHA 1P2FA 1OBDA 4FTCA 2XAJA 4HJOA 3ECHA 3D7TA 2UW3A 2BR1A 4LD5A 3FJQE 4AW0A 4ZJIA 5TJJA 2JDVA 4C34A 5L2IA 4GK4A 3WE2A 3ZSIA 2GS6A 3KCKA 2QD9A 3MV5A 3OXZA 1Z5MA 3WBLA 3MEXA 4D4YA 4ZJVA 3FXWA 4TZRA 4UB7A 3PJ8A 4E4NA 2XKDA 2XBJA 4W9WA 4CCBA 4JDIA 1FNNA 4GGGA 3G9LX 2F2CB 4ANQA 3I59A 1BI7A 1WBPA 3HV6A 3NNVA 3PIXA 4IAYA 5E8XA 2G9XA 4XG3A 3LXKA 2UZNA 1MDMA 1SAXA 1LEWA 3J81Z 1IA9A 3F8MA 2WTEA 4ZAUA 2YWVA 4KS7A 3SHFA 4G3EA 3GXLA 4ZH4F 4V04A 2VWUA 5JFRA 2JDRA 3Q4UA 3W32A 4PGHA 3DT1A 3M7GA 2E9PA 4C37A 4NM0A 4PP9A 3O6BB 4ASZA 5HLHA 2RSVA 5AAFA 2OKRA 3I59B 3DP7A 3EDPA 2QBYB 4LYNA 2W9ZB 3AQVA 4YG2F 3MSSA 3LQ8A 3TXOA 1IXRC 1KYZA 4ANMA 1EH8A 3BYUA 4LUEA 3QTZA 3DTWA 2J0IA 3CQUA 2OBJA 5C1QB 1H26A 3W2RA 4FBXA 4WA9A 5LHHA 2ZKZA 3OMVA 4K33A 4NTSA 1H08A 3D7ZA 2HZNA 5J9ZA 1XR1A 1CGPA 5HTIA 4CLJA 4KUJA 2WMSA 3KY2A 5TRDA 4KFCA 3U8WA 3BU5A 3DQXA 4MH7A 2XM9A 4TWNA 4USEA 2QOFA 3H30A 5BUJA 2WMBA 4XCUA 5ETCA 1B9MA 4XLVA 2JDSA 2HFHA 3RPQA 3LMHA 2PVJA 2IW5A 3NAXA 4PDPA 5HEZA 3IHUA 1YXTA 2QOIA 3UPZA 5F1ZA 3C0GA 5LGTA 4EM1A 4YJOA 1FVRA 1QMZA 1P4XA 3E5QA 4AZEA 3C4ZA 3JVSA 4N0SA 2YCQA 4DT8A 1IXCA 3I58A 4UXQA 4FKRA 4RWKA 4WHZA 3SRVA 2C1AA 3K3JA 3VNTA 3DCVA 1YVJA 3QBNA 4JBOA 5A46A 3ELJA 4DH7A 5F95A 3OT3A 2WMAA 1ZRDA 2A19B 2IVSA 1FINA 2ONLC 2GU8A 1OM1A 3GFMA 5IA3A 3QTRA 3L8SA 2IA0A 3LIJA 2W1IA 5F64A 5DNRA 3DFAA 1YQJA 4NEUA 4WF2A 3AMYA 3P9KA 2PVKA 1YHWA 1Q97A 3CS9A 1RNLA 4HCUA 1RE8A 5D9HA 4U0VA 3IOPA 5AUVA 1QZZA 2EXCX 1SVEA 1WBOA 1V0BA 3MVHA 2XK8A 3IKTA 3N4UA 1HKSA 3WODF 3FWQA 1WWXA 3FSKA 3F2AA 4UWCA 5K5NA 3H0ZA 1QGPA 4YIFA 5I3OA 4AT4A 3AT3A 2ZV2A 4FNZA 3F5GA 4D2RA 4EOPA 4XBUA 3GUBA 3NPCA 4B4LA 3JTHA 3PE2A 2YM8A 3B2TA 2ESHA 2W85A 3HUGA 4NK9A 4EJNA 3E6BA 4L9JA 4BBFA 2XAQA 2Y6MA 2L4AA 4F4PA 4FTMA 1RUOA 3PSBA 2PI0A 4QMQA 5HD7A 2X8IA 2CKQA 2OJIA 3G2FA 4QMOA 2OW3A 1OKYA 5EM6A 3W2PA 3T8TA 3WTWC 2FB8A 5DIAA 5DMZA 5KMOA 4NW6A 2BIYA 4Y73A 3HDMA 4UN0C 3BP8A 4XG4A 4IZ7A 4WNKA 2AXLA 3V5TA 2Q2EA 5CVVA 5FBNC 3CSVA 1S9IA 4MNFA 5EG3A 5JT2A 5E8IA 2QENA 4RWJA 3LAJA 2Y4IB 2FVDA 4P5QA 1RW8A 1O57A 4OIOF 2JEDA 4FICA 5C8MA 4AT3A 2OLCA 5ILVA 4XV3A 4G9YA 3MDYA 3W8QA 1DAYA 2QKRA 5EI8A 3HKOA 2WMVA 3QL8A 2Y4PA 3KRJA 2UW5A 4G7ZF 5DG5A 1Q41A 1Y6AA 2BV6A 1D5VA 1K79A 1PXJA 5AP0A 2UVXA 3DB8A 4BHPA 1WVWA 3AC3A 3GFWA 3R6XA 5D4RA 1JE8A 3GU4A 3RMFA 2QLZA 3GCQA 4UMPA 4HVGA 4XLPF 5KVRA 4X0MA 5KHXA 4FL2A 3MA3A 3AG9A 4ARKA 4ASDA 3G73A 1T2KA 4FZAB 3UQFA 4F9CA 3HSRA 4O7VA 3U4WA 4LLLA 1Y0UA 1P4AA 2ZJWA 3MN3A 4A9YA 2QQ7A 4S04A 2KJBA 2CFXA 5HE0A 5EEHA 3VW6A 5J1VA 4FTOA 3PWDA 4ACHA 3L9FA 1U5TA 2XJ2A 4PY1A 3VJOA 4M69B 4OTHA 3D0SA 5HO6A 3ZUVA 3FDNA 5TOZA 3I81A 4BI0A 3QQHA 2UV2A 3MS9A 1H28A 3ZLWA 3VULA 2W05A 5J9YA 2KIUA 4EONA 2WC2A 2X0LA 3DJ6A 3KB7A 4YZBA 4LMUA 5DCMA 4IDTA 2HYFA 4QYGA 4KIOA 1OYYA 2C5XA 3F8FA 1CMKE 2V55A 3QC9A 3AD5A 5J6XA 4FSQA 2OIQA 3QAHA 2PVLA 4YJQA 3EFLA 2D1HA 2AUHA 4H1MA 4BTFA 4ZMFA 4KDPA 4O86A 1J7UA 4X7QA 4WX9A 3PXKA 2DPUA 4YC8A 4RIWA 4IBMA 4ZY4A 3VUHA 2W1EA 3DPTA 4MHGA 5TKDA 4YFKF 2R3QA 5IA5A 3PZHA 4NKSA 3BYMA 1XGMA 4R6VA 2NS0A 3MY0A 5DCMB 2QONA 3FQHA 3PY1A 1Z9XA 4R5SA 3POOA 3FMRA 1I1GA 4EK5A 4IQ6A 5M4CA 4M0YA 3PLAE 3GCUA 4X3FB 3W16A 3D94A 4FTUA 1PUEE 2QOOA 3QZGA 2EJRA 1TNSA 3HMPA 4FNXA 2YFXA 5ETIA 4HF2A 1Z05A 4UEUA 1G5SA 3UP7A 2WQMA 3DQVC 2EFNA 5D5WB 2VX1A 3DK6A 4D1SA 3FC2A 2UWMA 2VTLA 3H10A 1XQZA 3NIEA 5AX9A 3KP2A 2J51A 3D2KA 3Q5IA 4ZLOA 1XCBA 4DEIA 1YQAA 4RVKA 2UZLA 4N6YA 1DP7P 2O3FA 2VWBA 2W0JA 4U8ZA 2VC0A 4OAUC 2NNWB 2P33A 5TE0A 4DC2A 2DQRA 2KTYA 4BIDA 5IQAA 2OF4A 4RIYA 1YS7A 3TZMA 4FSRA 5K3YA 4CGAA 3L2CA 4D2WA 2GMXA 5LVOA 4MNUA 1NVQA 4AU8A 4OLIA 3BOQA 4I98B 1JAMA 3LFSA 2EU9A 4KA4A 1UU8A 5A9UA 5KKRB 3NVMB 3HRBA 2O63A 2RNJA 4EGYA 3S3IA 3TV7A 4Z7HA 5IH5A 4ZIMA 2B9HA 2UZOA 4I21A 1OKZA 5HE3A 5JGAA 3WYXA 3KZZA 5LXMA 4J95A 1IXSB 3OUKA 2O8XA 3E3BX 4HA8A 2GA1A 4Q48A 4ENJA 4JDHA 5KX8A 3H9FA 3U6IA 1FSHA 3HA8A 2NNYA 4BDHA 4FTNA 2QVOA 1Q3DA 2YIQA 4RIYB 4RPVA 3H9OA 4ZZMA 1U6GA 5IA4A 3FZRA 2CJMA 5F9EA 3OWPA 1BYGA 3M8FA 5EYKA 5GIPE 3QLGA 3MQ0A 2IA1A 4TYJA 3HX4A 3LCTA 1CM8A 2VTTA 3QD4A 4GCJA 4KIPA 3TG1A 3PVBA 4LOQA 5DPVA 1RDQE 1YW2A 3BEGA 4MAOA 4IH8A 4JVGA 4FTTA 3S1HA 4QQTA 4MVFA 2BALA 1O3SA 3EN6A 4J99A 4F6SA 4E7WA 4WG4A 2FU4A 3UIMA 2WU7A 5CSXA 1ZLTA 2GS7A 2QHMA 1FGIA 3V8JA 1PXKA 3DQWA 4A4LA 1BC7C 3SHEA 4ENYA 1B39A 1BIAA 3NW5A 3C4CA 2RV8A 4BHBA 4A9UA 3VWAA 4LLNA 5AV2A 3OP5A 5D6EA 5BMZA 5FLFA 4ZOGA 4EMSA 4YLJA 2YLFA 3KXHA 4NZWB 2UW4A 3UZTA 3ROUA 3QRFF 2DK8A 1JPAA 4Z55A 3UODA 3OFMA 3RP9A 5LCJA 2X81A 3OXTA 2B9IA 3QA0A 2MC3A 4DTAA 3PLSA 4QMUA 2PN6A 2W57A 3L8VA 3FMQA 5AUZA 5HG7A 1ZRFA 3VUMA 2R64A 5JGBA 5L6PA 2VWVA 3FZVA 2BAJA 4CQGA 2K7LA 3BGZA 4HF0A 3A7IA 4RC2A 5DCFA 3NUUA 3N9XA 3F21A 3HSEA 4QMMA 2R3HA 3VBXA 5AIPA 2IJMA 4M9SA 4G6QA 5AX3A 5J1WA 1JKSA 4RJ5A 5ILSA 4RC4A 3OF0A 3P7BA 1BI8A 1G3WA 3PJ3A 5L3GA 4QTDA 4O0TA 5ETAA 5IT3A 4NW5A 1DI8A 5HO8A 4YZMA 2HENA 4C35A 4HX8A 2ZNYA 3OCTA 5DI1A 1JKTA 5FM3A 3BI6A 5EM5A 2A5YB 1LB2A 4GRBA 4QNAA 1ZH5A 3CY3A 4QMXA 2XNBA 2UZWE 3PFIA 5CI7A 1B6CB 3RAIA 4BBMA 1U54B 3CGOA 2VO7A 3P4KA 2DBBA 2IW9A 4JDKA 4GJ3A 4LB6B 4QMLA 3FM3A 1PMNA 3R2BA 2PMHA 3A7FA 4BDCA 3HDNA 3TNWA 4UBAA 5T6KA 3W33A 1R5HA 4RZVA 4Y8DA 1UNHA 2JKKA 3ELKA 4OTFA 4H3QA 4XS2A 4A9TA 3RK7A 1W7HA 4FTIA 3MH3A 4FV4A 4FSUA 3FKLA 5HU3A 5IA0A 1YI4A 4EZ7A 2PUIA 1UU3A 1F3MC 4DEGA 4YTCA 2COMA 4F9WA 3Q4CA 3KF4A 4RX9A 4YUQA 4L9NA 3J81K 5IA2A 4U3YA 2Q0NA 2F7ZE 4UMTA 2B0LA 2YABA 3QD0A 4G5JA 3F72A 3WTTC 5FD2A 5LVLA 5EI2A 5CAQA 4DYMA 3R8UA 2HY0A 3CQEA 3EHAA 5K4IA 4F7NA 3PJCA 3CUOA 4H05A 1GIJA 2FXAA 3CCNA 2CSOA 3EQFA 4FIEA 4GIIA 5LEJA 3D7TB 2H94A 1XH8A 5C8KA 3EYIA 4MWIA 4W8DA 1URWA 1IEPA 1O6YA 2I1MA 1HCLA 4B9DA 4IM3A 4L3JA 3FI2A 2VONA 3NVKI 2C68A 3W6JB 4IM2A 2XV4S 2EA2A 5CVUA 4B7TA 2OXYA 5AEPA 5DR6A 5J5SA 1OECA 3FXQA 4GJ2A 4FSMA 4F99A 1G3TA 3GFEA 4FL1A 3UIUA 4EOKA 3GFLA 1DI9A 2CLXA 2OSCA 4X21A 4ANLA 1G6NA 1W98A 2PK9A 4AVPA 2P0CA 3NUPA 4R78A 3U9GA 2PTKA 1OB3A 5M07A 2ZVAA 1QPMA 2W06A 2H9VA 4EWQA 3OWJA 4AXAA 4O0SA 3SLSA 1OI9A 3RTRA 2C6LA 4JX7A 2FO0A 4RG0A 4FKOA 5BYLA 3Q04A 5ANEA 4ACGA 5IUHA 5BMSA 2B0QA 4AOIA 2LDUA 3KEQA 4WT6A 5I9VA 3EQDA 5KMJA 3UMXA 4O7WA 1P14A 5A2QZ 5HBJA 3HMMA 3NNUA 1H0WA 2XK9A 3FEGA 1Z6RA 3UOJA 4LL0A 4RFYA 5I5ZA 5AV1A 3D5XA 4YP8A 2YACA 4ACDA 3LLAA 4HNIA 3V7RA 5BS6A 3V8WA 4O6LA 4I01A 5J5TA 4ZYGA 1W7PA 4PL3A 1YW9A 2UZKA 2XS0A 1U54A 5DRDA 2C3KA 3BDDA 1BI2A 2GQSA 4CCUA 3COAC 1VJYA 2DW4A 4QP4A 5FD6A 1MJ9A 2XIRA 3ZLSA 3F3XA 2BYVE 2F5FA 4XEYA 3TJCA 4D4SA 3QGWA 3E88A 2EXMA 5HS8A 2FH9A 1R23A 1HW1A 3OOMA 4XOYA 4AE9A 3DTCA 5AJQA 4KMUX 2QYOA 4CMTA 4D0XA 2J0MB 3G9NA 3KRXA 2XIGA 2CQKA 4D9UA 2UZUE 4G2FA 5IF1A 5TT7A 3F5UA 2BAQA 4QQJA 5E8ZA 4OT6A 4O6JA 1NHAA 2HQNA 3IW7A 2A1AB 5CU0A 4KS8A 3I6WA 4RVMA 4GU9A 3OG7A 4B09A 1P4FA 1J0RA 1H8FA 1FYKA 1WMKA 4FIHA 4O21A 2WQBA 2QOKA 5J7HA 3TDVA 4BH9A 3WF7A 5KMLA 3VFZA 5AP2A 4EBVA 4RJ4A 4NM3A 4NM5A 2UUEA 3VHEA 1OIQA 3S4QA 4I22A 5M4IA 1SNXA 3EFWA 3Q9YA 3NSZA 2PZ5A 1OKRA 3WE4A 3JAMZ 3HRSA 4KIGA 2QZ8A 5EM7A 4OMZA 1O7LA 1OPKA 3ITZA 3R28A 2FEZA 2YR2A 4BF2A 4CVAA 5BVWA 5EHOA 5LVNA 2Z8CA 4C2VA 2VWXA 3KCFA 3PRFA 4EJUA 2JRTA 1YIOA 1OIYA 2Y7JA 4QT1A 2JKOA 3R8MA 4XP0A 5AIRA 4EH4A 3POZA 4ASNA 5ED4A 3QQJA 2C1BA 1YXUA 5BPDA 2QO9A 4AQCA 1ZHFA 3RM6A 2W4KA 3LLTA 2CG4A 1PXNA 3KU2A 3DFGA 4BCNA 4UZDA 4L18B 4O7LA 5CVFA 3UVPA 3GW2A 3F61A 4TL0A 1ZYSA 4NCTA 2Y75A 2JBOA 3GQIA 4O2ZA 1P92A 4TNBA 4ALWA 3KEOA 1OUYA 5CLSA 4YBKA 2YWPA 4ACCA 4B8MA 5EEGA 5CENA 2YIYA 3RPOA 2MD5A 1OL2A 2O8YA 4PDSA 4YIIA 4YLKA 2B55A 2XK6A 3A2CA 2BCJA 3TO9A 4IXAA 1PMVA 3ANRA 5CT0A 5HKMA 1KV2A 5GHVA 4WKQA 2W1DA 4N4SA 2WWYA 5AP3A 4EZ5A 4F9BA 4QTAA 1K2PA 5CVHA 3LFAA 3QQGA 2QOBA 3PXQA 5L2QA 5LRSA 3IO7A 3LCKA 4KUMA 1UHWA 1PKGA 3BV2A 2GNGA 2C6MA 5HE2A 4DTBA 2LKPA 5FGMA 4BDFA 2OZAB 3NMUF 4F0IA 3QXOA 3BHYA 1QNTA 3WZEA 2HTSA 3HIFA 1W7PB 4GL9A 4CDGA 2ZOQA 5BMMA 5I9WA 3FY2A 4GEOA 3RBWA 3V04A 5M53A 1U5TC 4FG9A 4GMYA 2HCKA 2ITYA 3O0GA 4ZLYA 4BGGA 4BCKA 1STZA 2XAFA 3MY5A 2VN9A 2WOTA 1UU9A 3BJAA 4CV9A 2UW8A 2PZPA 4BGHA 2Z3YA 4GUBA 4AA4A 2C0IA 5AP5A 4FKLA 3SDJA 3HYHA 2H6DA 1K3AA 2Y0AA 5AAEA 3VIDA 4FV9A 2C69A 1PYXA 5J95A 4IW0A 2X2LA 4U7ZA 3W8LA 4E73A 5B2KA 3D15A 3BWFA 2PVHA 5M4FA 1QO0D 1FVTA 1AOYA 3UOKA 3GU6A 3U55A 2KULA 4G7HF 4F70A 2GFCA 1F9NA 1J7LA 4XRFA 5CEMA 2C3JA 5TR6A 4I5HA 5HG5A 1G8SA 4ZSEA 5AV3A 2R0IA 4Z16A 4JS8A 2A68F 4GSBA 2G7UA 1YDRE 3T5XA 4NFMA 3I7CA 3EQBA 3QP5A 5AP4A 2QOLA 1W4MA 2W4OA 1REPC 4C36A 5C27A 4Q47A 3DEUA 4JBPA 3TZ9A 2QOCA 2WGJA 3HL7A 3VF9A 3VHKA 4I6QA 1PMUA 4WUAA 5JSMA 2PUUA 2O3PA 5J8CA 5L8LA 4I0RA 3SV0A 2VN2A 2L02A 4UV9A 3ZPLA 4KA3A 5J87A 4P9UA 2UZTA 4EOIA 3GGFA 3W1FA 4A7CA 3OXIA 1TQMA 3WZKA 4I4FA 4X6QC 3VAPA 2QG5A 3UNKA 2W7XA 4BDIA 2IPXA 1T6SA 2C6KA 4WNMA 4N57A 4LJZF 4BHNA 5JQ5A 4IVDA 3FMNA 1Q62A 3RVGA 1CTPE 1IASA 3FQEA 2IN6A 3IDBA 4AX8A 3D83A 4IWPA 1BI1A 5DOSA 3TWJA 5CNNA 3DV8A 5A6NA 4YGAA 5H8GA 4DINA 5L2SA 4RGUA 2ITXA 3ML6A 1O3TA 1W5TA 5HS7A 2ESNA 4EM2A 2HTJA 4FT3A 4EHGA 4BHZA 3QLFA 5EKNA 4DEEA 2A6HF 4O7YA 3I79A 4OIQF 4EH2A 3VODA 5HTCA 3MIYA 4LG4A 3Q9ZA 2WMRA 1SVGA 2YA9A 4V0GB 3BLRA 2VOPA 5CF5A 1F5TA 3LQ5A 4BWXA 3BE9A 2F5DA 4D1XA 5E1SA 2PBIA 5L3EA 3DLSA 2VTRA 4RGSA 4O1PA 5L3CA 1S7AA 3EQHA 3DY7A 4FV1A 4UY9A 4LOPA 1H0MA 3KCCA 5HLNA 4QTCA 3C0IA 5D4SA 3PPKA 4ZY5A 2HOEA 3OY1A 1YWNA 4ON0A 4USFA 2YIXA 2W4JA 3MFSA 4EUTA 5JZNA 3TNQB 2BILB 2ETHA 3F88A 2K27A 2ZM1A 3DOGA 2JTVA 4DFXE 4U43A 5IQIA 1FGKA 4L3PA 5CWZA 3EYGA 2ZMEB 2CO5A 1M7QA 3RHXA 1U3EM 4C61A 4G3GA 4IVNA 4H58A 3FMDA 3PIYA 4QYYA 2WQEA 3R1QA 5J7BA 1JWHA 5EW8A 5ANIA 2WIHA 1H1PA 1O3QA 4CKJA 4U5JA 5JQ8A 3EETA 4ASXA 1HKTA 5B7VA 3CBLA 4EOQA 4MX9A 4FVQA 1L8TA 4MNEA 1G3YA 3UO6A 3ZFYA 4MTAA 3GNIB 1Q24A 5LJJA 4FHTA 3DBQA 3QYWA 3LFFA 4ZTNA 3IC7A 3QX4A 4D0PA 2VGPA 3UYSA 4P5OA 4OBPA 4S31A 3BROA 3KXXA 4KYWA 4DLIA 4BHCA 5IQDA 2JIVA 4DH8A 1BJAA 3DZOA 1YXVA 1M17A 3ZOSA 5LGNA 3FX3A 4BCJA 5D41A 5HLIA 4FGRA 3K2ZA 3T8RA 2FBKA 4EEVA 5FTQA 4Q4ZF 1RZ4A 1SD6A 3MESA 4FKPA 1X8BA 1KQ0A 4FV6A 3DDPA 3A4PA 4G31A 4RQVA 4Q9ZA 2Q8KA 3ZXZA 4S05A 4W8EA 4M0ZA 3ZO4A 5J8FA 4HW7A 4J8NA 2BEOA 5EOLA 4A0XA 2OJGA 4DFUA 2ZO4A 4L9IA 4FKWA 1M2PA 3AC8A 4ERWA 3A62A 3EZRA 4A4XA 2IZRA 5KZIA 1W8CA 3MVMA 3BE2A 2P55A 2F5EA 1R5GA 3I1AA 3RM7A 2HR3A 4ITIA 2ZCWA 4BTKA 4L68A 3F5XA 4UZHA 1IRGA 1BX6A 4FOBA 4BDGA 1A06A 1ZZLA 3AC2A 3TKHA 2AC5A 4D2VA 3BCEA 2IW6A 4OIPF 1HQCA 5AV4A 3W2QA 4AP7A 3H92A 1AGWA 2K86A 2XNGA 4CG9A 4AWXB 3P23A 4BIBA 3REOA 3PY0A 3CR0A 3IQ7A 3MJ2A 2WV0A 4QPSA 3D5WA 4IX5A 2R2PA 2V5QA 4ZTHA 1H1QA 2EXEA 4BXUA 1KU2A 2UXXA 5CU4A 4EYMA 2HZTA 2F9GA 4TYEA 2BDJA 4E6DA 3LFCA 1C0WA 2KIMA 4JAJA 5CANA 4EQMA 4PDYA 4RLLA 1ULYA 4F0FA 3F2RA 4IJPA 4IDVA 5DR2A 3GQLA 4G7OF 1DUXC 3LCOA 3LJ2A 2RG6A 3G3ZA 4BKJA 3FBVA 1BL6A 4FF8A 4ANSA 3ACKA 3LAUA 3R9DA 4ESFA 2OAZA 2PQ8A 4LK0F 2BBYA 3CKXA 1QCFA 4DFYA 3ORMA 1TTYA 3MH1A 2NRUA 3Q2MA 5DEYA 3CTJA 4QLCU 3KK8A 2HELA 2EFQA 1WCCA 2VTHA 3Q5FA 3JY9A 5EFQA 2XASA 1P4WA 1J7IA 3IKAA 1J3HA 2XMYA 3SXYA 4WWCA 2PMLX 4N9IA 1YFHA 4MEXF 1FSEA 2J5FA 3RPVA 2UVYA 2PG4A 2OA4A 3BWJA 3RJCA 1PXLA 2X2MA 2E1NA 2VRXA 3TIZA 1UVRA 3F69A 3EQLF 5FG8A 3UQCA 1USSA 4FZDB 5D8LB 4P4CA 4PQNA 4XHKB 3IWFA 4ZSLA 4UXNA 1YI3A 3WTXC 1ZREA 4C4JA 4FEXA 4X2JA 5EDQA 2Y48A 4XSZF 4LMNA 2RGPA 4OGRA 4I24A 2X7GA 2R9SA 4AZWA 2P6SA 2W84A 3AMBA 3FLNC 3LVPA 2XYUA 4EHZA 4WXHA 5DUKA 4LFUA 1XHAA 1HSTA 4AOJA 3HTUA 2R3JA 5F20A 4EORA 2PE0A 2OO8X 3EYYA 5H9BA 4ZTLA 4FNYA 3BHTA 3BBTB 4FT9A 3WF6A 1EV7A 1HXDA 5ICCA 3VVHA 2WNTA 3B8RA 4CYJA 4FVPA 2QBYA 1D8KA 3OZ6A 3EN5A 4U80A 3QTSA 3RNIA 4JR7A 5ERIA 5D8KB 3U87A 2PFBA 5K1YA 3EQPA 3CO6C 5E7RA 5BVKA 4OUCA 5ANGA 4AIHA 2ETKA 3ZHPC 5M06A 2PU8A 3A60A 4HVIA 4ZSAA 2QNJA 3W18A 1Y6BA 4CHUA 4RGXA 3FSFA 1HKQA 4TXCA 3M1EA 2L3DA 2YZLA 4FEQA 1K7AA 1IN6A 2H6CA 2ZYBA 2ZNZA 2XJ1A 4BQAA 4M71A 2HW7A 4RIWB 4DGOA 5DT4A 1WAKA 1ZGJA 3QPTA 1MUOA 4R1VA 3NWWA 4UVBA 2OU7A 5EW9A 3ZC6A 3RKXA 5KBQA 5M57A 3ATSA 4QPAA 5ICFA 3ZLXA 3QWKA 5L2WA 5ANKA 4YBJA 3OS3A 1OVEA 3W6KB 3DPKA 4M66A 4QMVA 4YJPA 4IMYA 5DD4A 4DGGA 3GUDA 3BHVA 3PVGA 4I4EA 3OWKA 4CSVA 3RAHA 3ZQ7A 3TGNA 1DPUA 2YLEA 3NCZA 4GU6A 4B0GA 3NIZA 3JSOA 1R1TA 4TY1A 4RB2C 1MRYA 3C3WA 3FV8A 3HRCA 2WELA 5DEQA 2Y4IC 3WI6A 3NEWA 3IK3A 5E8YA 5L8KA 5EKOA 4FZFB 5BYYA 3VC4A 3PSDA 4YO4A 4I7HA 1Q8WA 5F6FA 4CICA 1WZYA 4G1WA 3T8OA 4JL9A 1ND4A 2BFXA 3JPVA 5LGUA 2P7VB 4IRGA 2BRNA 3PQJA 4B6LA 4EQCA 2HWOA 3WU1B 4FSYA 4L52A 3VW8A 1VTNC 3C4XA 5HIDA 4B8LA 4BNCA 4LLGF 4M9XA 1VZOA 5LHGA 4JRNA 3MCZA 4AG8A 3CPCA 5ICPA 2Z7RA 1LNWA 2CLQA 3GENA 3FLYA 3K1PA 1STCE 3ZRLA 3FUPA 4RSSA 4ASEA 4BZNA 2X7OA 2CGXA 2WB8A 4RX7A 4PMPA 5FLXK 3PVWA 2QUFA 2B7AA 2CN8A 4CXFA 5JHUA 1VR2A 2OD5A 1CF7B 4NL0A 1KA8A 4UYAA 4EBWA 4EOSA 1UWJA 4HZRA 2XRUA 2REIA 5E1XA 5GIOE 3ID6C 3Q32A 3DJ7A 3RHKA 4CMOA 2VUWA 2DO7A 3E87A 3DAKA 4EYJA 1YLFA 5BOXA 3VN9A 4XV2A 2DFIA 3Q6WA 5C03A 2JKMA 1UV5A 2C6IA 5AP6A 3WTSC 3F5PA 2Z60A 3FI3A 2YHVA 5H6QA 2VODA 3FZOA 5DUIA 1V0PA 4E4XA 3GXOA 3QKMA 3MH0A 2BUJA 3LAPA 3ZSGA 3QQKA 4ZXTA 4PGGA 2YU3A 4I0BA 3LPBA 2YM3A 1SFXA 3CC6A 5KKRC 3FMLA 5ANDA 3CTAA 2C47A 3EUHA 3L7WA 2PE2A 2QURA 4PMTA 4E5BA 5HORA 4CZYB 3Q2JA 2XKFA 4YTFA 5BPYA 3ZXTA 3GB2A 4AGCA 1FQ1B 4Y85A 4FV7A 4CNHA 1SD5A 4JX3A 4U40A 2FNPA 4C4HA 1ZYRF 2QKWB 3IG7A 2JSCA 3ZMSA 3SZTA 3DBFA 4XG9A 1IRKA 5HVYA 3L9MA 4G3DA 5ANJA 5HO7A 2BRBA 1FY7A 3JW4A 1W0XC 3ZDIA 4IAZA 3Q3BA 2ITPA 2Z9OA 3MZHA 2XK7A 3M2WA 1REKA 5C26A 3OUNB 4PNKA 3GOPA 4JT3A 4HW0A 3VS4A 5FXRA 2RKHA 4O0VA 2JIUA 2ZV7A 1NXKA 4YZ9A 4FA2A 3FYJX 4GW8A 1QPCA 4JOAA 3TACA 4HPUE 3ZLYA 5HOOA 4RIXA 3KA0A 2YCSA 4NT4A 5E8GA 4MXOA 2PVMA 2NO3A 2WOUA 2LSOA 3MJ1A 5IU2A 4V01A 3UNZA 3HZTA 5E17F 1U8RA 4L67A 1DM2A 4K1BA 4BIEA 3ZBFA 3V6SA 4G6NA 2VX0A 2E9UA 4CT1A 4BI1A 2CGWA 4TWPA 3OD6X 2K4JA 3U9CA 2RG5A 2WFYA 3REPA 2PZIA 3M1SA 1YOJA 1R39A 2XVDA 2OI4X 4IPAA 4D5HA 3K69A 5BVFA 3T9TA 4FYNA 4GT4A 2FRHA 4M14A 2EV0A 2DU9A 5EHYA 2JFLA 1E9HA 3V8SA 2UZEA 4LV5A 1J2XA 2CKOA 4EGZA 2ISYA 4ANNA 5HNBA 1KU3A 2X2KA 3MFRA 3P78A 3PIZA 5BVEA 3P9IA 4ITJA 3CLYA 3TDWA 2FSTX 3E62A 3E64A 1ZGAA 3KP5A 3WYYA 4DH1A 3R83A 2FE3A 1YDTE 4H3BA 2P5LC 2RC4A 2WMTA 3D0EA 3OY3A 4K2EA 2P3GX 1U5TB 4NYEA 3UC4A 5EYMA 3R8LA 2RN7A 3PA5A 2OZAA 5JI6A 5HQ0A 4RJ6A 2R7BA 5JGDA 1WRJA 5I9ZA 4K11A 2XVCA 4FIGA 4DEBA 3AOXA 5JN2A 2DYLA 3RYRA 4G5PA 2HAKA 5CALA 4GYGA 4D0WA 4OW8A 4GT3A 3HP5A 3ANQA 2LGCA 4ZSJA 1BI3A 4K77A 2W24A 5ACKA 2ITZA 3OEZA 3N4VA 5E18F 1Z9CA 2YCRA 2GXBA 5HGIA 2KKOA 3DXPA 3WF5A 3NYXA 4BCOA 4FTQA 3WGGA 2DLLA 3DKFA 2UW0A 1YHVA 2P6TA 3EFKA 3FM5A 1IN8A 3QCSA 3RPUA 3FY0A 3DA6A 3MY1A 2R7FA 3IKVA 4FR4A 1XSVA 4BDJA 3F7ZA 4C4FA 2HKOA 2OGVA 5KHWA 5IH4A 1I27A 5IQBA 2IO6A 3L9NA 1OGUA 1ZY4A 4L5IA 2ZDUA 5HX8A 3ZEPA 4O7NA 2R5TA 4RQKA 3II5A 5M51A 4CZUA 4KN7X 4G9CA 4BTJA 2J0KA 4HYSA 4XUFA 3TDZC 5BUEA 3HHGA 1H00A 3KVWA 3UO5A 3BIZA 2PVRA 3C5UA 1IA8A 3HUBA 5FDXA 3ORPA 2XYNA 3R7VA 4Z7GA 1M52A 5JKGA 3Q9XA 2X1NA 1S29A 3R1NA 3DBEA 5BVNA 4JDJA 5HCYA 2CHLA 3LA3A 3UQGA 3QXPA 4FMQA 3BU6A 5I0BA 3MA6A 4OINF 4DEAA 2XUBA 4KNBA 2A2AA 1IZ1A 2YAKA 2WTWA 5AAGA 1JSTA 3QRKA 4QPMA 2J0JA 3KMMA 4QP6A 3CQWA 4MBJA 4U88A 4O0WA 1FOKA 1EH7A 2JFMA 5H8BA 3QUDA 3V7CA 1M2RA 5D6FA 5CEOA 5K5RA 2XM8A 3ALNA 3GI3A 3RAWA 3W2OA 3VS5A 4C7TA 3UNJA 5C4LA 3SOAA 4FSTA 2YAAA 3HMIA 2STTA 2WPAA 3QKLA 3WGHA 3KN5A 3ZUUA 3R7IA 3SG8A 2W5HA 1OMWA 4LOOA 3E5XA 3V4GA 2IWIA 1L3LA 5I9XA 1K6OA 4FUYA 3OC1A 4UNOA 2H09A 4DFZE 1ZLJA 1GZ8A 3VUIA 4KKGA 4RRVA 1PP7U 4K8AA 4HVSA 4P96A 4NJDA 3JR1A 4FTKA 3V5JA 4D2SA 4LMYA 4IZ5A 3WGIA 2UZBA 3ACJA 5E1WA 1IN7A 4IB0A 5B2MA 3I5ZA 1YWVA 1Q61A 3NUXA 4ETSA 4H1JA 4AZSA 3HV3A 1J59A 3D14A 4W4VA 2C6YA 4M6XA 1MRVA 3TTIA 1PKDA 3GC7A 4J97A 4XBFA 3FLZA 5D10A 4XNEA 2CKEA 2R3NA 4ZP5A 4FKQA 5LCKA 1PXOA 3QQLA 3ZCLA 4N9HA 2VTPA 5CVJA 4YURA 1Z91A 3BLHA 4FGBA 1IUYA 4FUXA 2UW7A 3BPVA 1SM2A 2ZMCA 2PHKA 2OU2A 3A99A 2PYWA 1NW1A 3UJGA 4L45A 5HS9A 5AFVA 3HEGA 3CO7C 3LA7A 4JNWA 5A2QK 2BHEA 4DN5A 2WQOA 2JZYA 4BCMA 4PL5A 4ORKA 3C50A 3D5UA 5IZFA 5M09A 3RWPA 3ZMMA 3AGLA 3NGAA 4PMSA 2J5PA 1XBBA 4WXDA 3I0OA 3SW4A 4L46A 2A3SA 1PXPA 3G51A 3CEKA 5ILUA 3HMOA 3HV7A 2VO3A 1DPRA 2PMUA 1APME 2RVCA 3O8PA 1YW8A 4X3JA 2XP2A 3VRYA 2B9JA 4ANBA 4DF3A 1XH5A 4FG7A 3RK9A 5T3QA 3MGYA 4Y15A 5BNJA 2Y6OA 3LA2A 1MRUA 4FKUA 4EOJA 5DEWA 2OJJA 4HQEA 4HVDA 4HYIA 2XH5A 4DCAA 2HXLA 3VUKA 3I5UA 5E8TA 1ZG1A 4EQQA 4ZSGA 3CXWA 3ZMZA 3JY0A 3SXSA 4BFMA 2ZM4A 2E7WA 5D1JA 4IAAA 3WG9A 1BOAA 1GIHA 5LWMA 3JAMK 4BI2A 4IVBA 4D2PA 1YDSE 1O6KA 2VU3A 4LK1F 3WZJA 3R1YA 4AZFA 2VBYA 5CTPA 3R8PA 3I6UA 2OWBA 3HNGA 3ORKA 2IA2A 5CU2A 3T3UA 4ENNA 3HECA 3DXNA 5DR9A 4L44A 3KP4A 5CF8A 2PE1A 4O0YA 4DE4A 2YM5A 4AAAA 2QU6A 3GX4X 2ADUA 3BYVA 1P5EA 3DPLC 5GJFA 3KXMA 4ZLZA 3HVCA 4QYFA 4LL5A 4XG7A 4YC6A 4HYHA 4DQ2A 2HY81 2PMNX 2VNYA 3O7LB 3QZIA 1YG2A 3NCGA 4O7RA 3LSTA 3FLSA 2WU6A 1UKIA 1LVAA 5IMEA 3F22A 4DLJA 5LRRA 5ACBC 5EI6A 3SGCA 2LNBA 4KBKA 4DGMA 5BX0A 5HI2A 3F3VA 4YZCA 3KFAA 3GP0A 1XMKA 4LM5A 4RAZA 1Q8TA 1LEZA 2E2BA 3CKWA 4C8BA 5LMAA 2QM3A 4XMOA 1ON2A 3H0YA 4O6EA 3C9WA 3LQRA 4RA4A 2VBZA 5AV0A 5CYVA 1UB9A 4HDVA 1O6LA 2HWVA 3DFCB 3BHHA 2C6DA 1R1WA 5FB2A 3GWZA 1U2WA 3LMIA 4RWLA 4AZTA 1UWHA 4G17A 2XZSA 3UIBA 3FHRA 1UNLA 4YJTA 5FXQA 3C1DA 2QHNA 3C4FA 2ZJ2A 5DT3A 3LE6A 4RIXB 3PJ1A 4QMZA 4DEHA 1FOTA 3OHTA 4O82A 3PXZA 3FMJA 5EW3A 1JVPP 3OOGA 3V5LA 3RJPA 3I4PA 3I64A 5TO8A 1HW5A 4JG8A 1Q5KA 5FD5A 2BTSA 3SXRA 2ERZE 2IZUA 2BZJA 1TBXA 2E7XA 2RFNA 5LHIA 2W5BA 1XKKA 4ERKA 4RWIA 2JD5A 4RLKA 2OXXA 3RK5A 2QODA 2NRAC 2IG7A 3TCPA 4ZS4A 3HUCA 3F8NA 2B1PA 3R63A 5EYCA 3GFIA 3ZDUA 2EA4A 1BM9A 4IB5A 4FIIA 5L8JA 3I71A 5DRBA 3CJGA 3QTXA 2L54A 3JXWA 3ABTA 3UTOA 5GJGA 4RVTA 1V3FA 3U54A 2A61A 2EFWA 1FBSA 5KMKA 2ZBKA 3NR9A 3K5UA 4QMSA 3ERED 5AR2A 4O83A 3LFKA 1B1BA 4O96A 3Q96A 3CPBA 5CNOA 4I23A 3K2LA 3KZYA 4FKSA 4M6YA 3TZ7A 3ZRKA 4EHVA 2VGOA 2YJRA 3TUDA 2BVAA 4JXFA 1MKMA 4E6QA 2PULA 3WTVC 4FSZA 2VAGA 1QQIA 2B52A 5I9UA 4YTHA 4CZTA 1F0QA 2HGCA 3QAME 2IVTA 3BYSA 1XBCA 5FRIA 3MPMA 3NQOA 3R6SA 2HW6A 1FMKA 4KIFA 1H01A 5AM6A 2IVMA 2PVFA 2IZTA 2GQRA 4BGQA 3VBWA 4A0YA 2EFOA 1QL6A 1WSUA 2QR7A 4GKIA 3BEAA 5C8NA 2MBFA 3L9PA 3KN6A 1MJBA 2XIZA 4KICA 4TYHB 1TNTA 2XIYA 3UOHA 4ZMEA 4R8HA 3IW4A 5HCXA 4BDKA 2VV9A 4F7SA 5E8SA 2FA2A 3SXFA 1V1KA 3N97A 3ZMVA 4U7BA 4QWQA 5G6VA 4ESBA 3UO4A 3HYIA 5K0KA 3KE2A 4HGEA 5L3FA 3PXYA 5FXSA 4BRXA 3JTGA 2QQ9A 1KE8A 5CX9A 2BROA 4IANA 4QQ5A 1MJAA 4C59A 2X8DA 2NP8A 4EK6A 1S7OA 2R3KA 4YNOA 2I0YA 4J98A 4EH9A 1FT9A 3TQNA 3EN4A 4EJVA 5LBQA 2RGVA 2CCHA 3OROA 4QD6A 4M69A 4EK4A 4CFNA 3O71A 2XKCA 4GFMA 4R77A 3SG9A 4IX6A 1KE6A 2XBAA 1ZMWA 1XGOA 4KBAA 3GC0A 4AFEA 3QHRA 1IR3A 4NJ3A 3EL8A 2F2EA 4MQ1A 2YM7A 3V8LA 4HCTA 5CQUA 4Q5EA 3ETAA 5C9CA 2DWBA 3ULQB 2I7QA 4YFXF 2D45A 1Z7UA 4U0YA 1UNGA 3TKYA 4U3ZA 4ZYDA 2GNHA 5GZ9A 4WIHA 3VS0A 4ZYHA 2Q83A 5I4NA 4YTIA 1RQQA 3MPAA 3KRLA 3KP3A 5JH6A 4FKVA 4EH8A 2YIWA 3UMWA 5LVMA 3DNDA 4QP7A 3QU0A 3T3VA 4CTBA 1LUFA 3J80K 1IG1A 2O61A 3E6DA 2WMUA 3RINA 3SA0A 2JIIA 3L8PA 4TV7A 4IF4A 1OL6A 3O2PE 1KSWA 3QD2B 3NYNA 3EL7A 4MD7E 5EHLA 4A12A 3E97A 2XHKA 3C7QA 3U4UA 1I6XA 1YHSA 2IZSA 4DHFA 3HV4A 2Z02A 2PMOX 5IQCA 4BCIA 5J9LA 4YMJA 3V8KA 1YO5C 4CFXA 4F7ZA 1OUKA 4XRJA 4KD1A 3AC1A 3Q9SA 4P2KA 1JKKA 3OCBA 1ZAOA 4FKGA 4CTCA 4JAIA 1LDDA 3HP2A 1FZPB 3OTUA 3AXWA 4ZTSA 1CF7A 4GVJA 4RJ7A 3FYKX 2YCFA 4XV9A 3RIRA 2JKQA 4APCA 4C3RA 3BQCA 4GO1A 3FMHA 2CNVA 1I1SA 2DK5A 1LEBA 3ZZEA 1F5QA 1M7NA 3ZBXA 4AT5A 2V1UA 5L3DA 2H8HA 2XNNA 3OWLA 3M8EA 3C4WA 4GG5A 2C3LA 2OIBA 2XF0A 2OF2A 2F2UA 4QO9A 3SKCA 3BLQA 4XYFA 1MD0A 5HHWA 1ATPE 2OH0E 4M84A 3ORTA 2NYXA 4QP8A 3WARA 4CV8A 2F4JA 5JFWA 3LM0A 2Z99A 4NB5A 2A4LA 4DA5A 1SD7A 5DLSA 3VUTA 2V1XA 3FZSA 4TYHA 5LEKA 4S30A 5FQDC 2V22A 4LUDA 1K9AA 4OT5A 2Z7LA 5KBRA 2R3FA 2IPQX 4F08A 3EB0A 2UVZA 4R7BA 5CF6A 2OG8A 3FMSA 5FFZA 2R3PA 5A6OA 3BYOA 3FHIA 4RGJA 3BU3A 2ITNA 4KSQA 1KGSA 2DQ7X 1ZN2A 4NCTC 4FOCA 2PEXA 4ITHA 3HRTA 4XG8A 3TZ8A 2BKKA 3GO5A 2P5VA 1KOAA 5AIKA 1BMKA 3PQKA 3COKA 3M9AA 4IHTA 1XWSA 2YPRA 3UGCA 4QMNA 4C4GA 2GSFA 3OT8A 1ZYDA 1BL7A 5CF4A 4I0SA 3Q4ZA 4E70A 3B2WA 1AQ1A 3BHUA 5CXHA 4IE9A 1R3CA 1Q1HA 2C0TA 3QQUA 4ZZLA 4I6HA 3W2SA 3COHA 5KE0A 3QRTA 3MWUA 4FKIA 3S2WA 1OIRA 4J7BA 3TEIA 5CVIA 2OK1A 5CZIA
chains in the Genus database with same CATH superfamily
2BZTA 1WBSA 3I60A 4NM7A 1ZR2A 4FX0A 4YJUA 3G0FA 4O91A 3G6GA 4IZYA 2Z2SB 3C51A 4BDEA 1OCPA 3C13A 3MZYA 5HICA 1VEBA 2VBXA 4QP2A 3RCJA 4EKLA 3ZH8A 3DDQA 4NWMA 4DTKA 3MYGA 5FLMJ 5JZJA 1GNGA 2C30A 2OF7A 3WZUA 2HIWA 1JUSA 3VJNA 2ZJRF 1V5FA 4PTGA 3WE8A 3E63A 3GCVA 3CMYA 3JYAA 4PZJA 2DOAA 3NYOA 1G4DA 3KP7A 3QUPA 4CFMA 1REJA 2YEXA 4RFMA 3V01A 5HDKA 4G6LA 5JK3A 1QZYA 4G3CA 4KN4X 1XDUA 2XCKA 3ZYAA 2GQGA 1H24A 4FV0A 2E1CA 4X2NA 2I0VA 2R4GA 4XORA 1FMOE 4CFUA 5CI6A 3A4CA 4UVCA 1BUHA 1FPQA 1YITI 3DEEA 1PMEA 2PVYA 3DS6A 2XCHA 3IWZA 4WK8F 4KITB 3LSPA 1SZMA 4BE2A 4LV8A 4KMFA 4OTIA 4S2ZA 4IVAA 3D2IA 2GAUA 2PMIA 4YNEA 3ZRMA 3DGKA 2F6CA 4OBOA 2M45A 4GV1A 3MH2A 1XBAA 4UMRA 4CMUA 3RGFA 1JGSA 2OZUA 5HZNA 2AHQA 4NH1A 1FX7A 3BZ6A 4PPBA 3G5DA 4OU0A 4MCVA 3R61A 5JFVA 4G12A 1Z6TA 1R7JA 4BICA 2LKSA 2WADA 1E3PA 3BKBA 3S1MJ 2GNLA 4DHJA 1E17A 4O7SA 1VQKI 1LVKA 3RNYA 5CQWA 3L1SA 3GU7A 5DVRA 2EB7A 2K9SA 2L9NA 4IX3A 5L6WL 2HVRA 4DG3E 2NRYA 1R6RA 3CMAI 3DJ5A 5IEVA 2ITQA 1IO2A 1U8BA 4E5AX 4AIKA 1Q8UA 4EOMA 1OITA 4F1OA 4AN9A 3QPHA 3AT4A 2IAIA 3CCSI 2GIZA 4KIBA 2RFEA 3ZFMA 3QKKA 2J4ZA 3GTGJ 2WTIA 3S95A 3HSFA 1TQIA 5KCVA 2F7XE 2MW8A 3FXXA 4AIJA 1QBJA 1N77A 4Y52J 2CGUA 1UFMA 1Y0NA 1F4KA 4HV5A 4A5NA 5LARA 3ZN1A 3DTIA 4BKXA 4JQ8A 4LDTA 2O5RA 3QRJA 1FYMA 4BZOA 2CDZA 3L9LA 1H27A 4OOIA 4BY9E 3AMAA 3NNWA 4E4MA 2D1VA 1JUMA 4FL3A 1BC8C 1GZNA 1XDSA 3GU8A 2CUEA 4XKBA 3LSIA 4YRVA 4E8AA 5LFAA 4GS6A 1E2XA 5CPRB 3K1MA 1GY3A 5T68A 3DK7A 3HRUA 4A2UA 3GFJA 4IAIA 4R3RA 5H3QA 3I53A 1YOMA 4BAYA 3MKZA 3O8HA 5CAPA 4D7MA 1L3RE 2C6TA 1U59A 2GIVA 3QPLA 2ITUA 2CN5A 1OPCA 2DS1A 2HXQA 4NTTA 2YZAA 2Z7QA 3TM0A 1MQ4A 3SFIA 3JUHA 1GXPA 4G6DA 4S32A 5E91A 4U0IA 4CKRA 1XB4A 2KZVA 1NK3P 4F9YA 2J5EA 4DFNA 2DAOA 3VUDA 4BWPA 4OTQA 3JS2A 4MFDA 2ESMA 4Q5SF 4M7IA 3MVJA 5C4KA 2HOSA 3IW8A 1ZQ3P 3R9NA 3VB2A 3ZS5A 2I8DA 1R36A 3GTKJ 4XSXF 1TWAJ 2ZAZA 2HYYA 2GPHA 1XMMA 3DK3A 1ODDA 2NOGA 1YYVA 4GYIA 4LFIA 4W4WA 2ETRA 3BELA 5AA9A 2GHGA 1SYKA 5HBHA 1HF0A 1KWPA 2PLYA 4MXAA 3UDTA 2YDJA 4CRSA 4FK3A 3GLXA 1XX5A 4FT0A 3G90X 2VTSA 3RKBA 3RI4A 5IY5H 5AIQA 5JLXA 5CZHA 2ZV8A 1OYWA 4NIFB 3C18A 5JR3A 3CF2A 4FV2A 4RT7A 5DM6F 2WIPA 2V79A 5E20A 2H96A 4ZEGA 1KQ9A 2WHBA 1S6LA 5C4XJ 2ITWA 3CLOA 1YX5A 3KFWX 1H1RA 2OC6A 2X0PA 4YZDA 1K78B 2LRDA 1XH6A 4WNPA 4QPQA 2L7ZA 1YWRA 3AD6A 3QGYA 4FIFA 2R7IA 2E5NA 2AS5F 1A48A 4WXCA 3A02A 3F2NA 2PY3A 1BN5A 3SEZA 4FV8A 2M3AA 4XOZA 4WUNA 4PWNA 5EQEA 3NUYA 1SNUA 5FEEA 4E3CA 3DCFA 2C3IB 4AYBN 2JSPA 4MF0A 4IM0A 2JGZA 2DMPA 4WG5A 2J7TA 4HNFA 3GZ5A 5M55A 5IEYA 5E8WA 1F43A 4HZFA 3UKGA 2LREA 3NLBA 1W0UA 3R7UA 5CSWA 3TNPC 3E7VA 2Z5UA 4ZTRA 4IX7A 2YDKA 3LMMA 2EV5A 2B9FA 4BDAA 4DH5A 3OYNA 3I0QA 3EFJA 4XV1A 4KRCA 3D4QA 3J7ZI 1BI0A 2JPCA 3F6VA 4E4LA 1FBUA 2V6CA 2RF9A 1G8XA 3OYKA 4LB5A 2W99B 1ZYJA 3EQRA 3LJ1A 2GHMA 1I50J 2VKEA 2FBHA 3ORLA 5JFSA 1Y8GA 3CGFA 1Y91A 4YSMA 2BOLA 2GNJA 2HXOA 1TLHB 1D3YA 5GINE 5HG8A 4Y95A 5A14A 4D7NA 4AW5A 2FSOX 5DT0A 5I3RA 3QFVA 2R4BA 4QMYA 5LQFA 3VS2A 5L3AA 4DG2E 3W0PA 1X3ZB 3B8QA 1D5YA 3NUAA 3DU6A 1MBJA 3PG1A 2JDOA 2J9MA 1Q8YA 4HAMA 3LCSA 4X6RA 1B38A 1TWCJ 1T45A 1T0FC 5JFXA 2C4GA 2WXVA 4AZVA 3QCYA 3H1CA 3P79A 3VDXA 3KRWA 3ZMTA 3X2QH 4C4EA 5IG1A 3VS3A 3O8TA 4LGGA 2FSMX 4YLLA 4IC7A 5TF9A 5LD2C 4FSNA 5IA1A 4IFGA 3VYSB 5IUIA 3DB6A 5CAUA 4BL0B 1T56A 3QQFA 2J5OA 1JKOC 4HOKA 1G8KA 2XA4A 4DZJA 2ONLA 1KYWA 1LQ1A 1G3SA 2M8GX 3P0MA 4HPTE 2E9VA 2W1HA 1QRYA 5CLPA 4PP7A 1YW7A 1QVTA 3E8CA 4FKJA 1ZG5A 3OWTA 3ROCA 3QWLA 1NVRA 4L00A 3DKGA 4I3ZA 1JT6A 1U4DA 2GOXB 4X6AJ 3PXRA 4A5MA 3BZCA 4KIKA 4IJ9A 4JR3A 4A93J 3IDCA 3BCBA 1SMYF 4ZZNA 2LF7A 3OS2A 4OTRA 1GLNA 3ALOA 1SANA 2UW9A 4CYDA 3IGGA 3E6CC 5DYMA 1ZRZA 2OXDA 3VWBA 2VO6A 2ZSHB 3NAYA 1MH4A 1JJ6C 2VWYA 4U97A 5KAIC 4I20A 4M97A 2HK5A 5CSHA 2V7FA 3D5VA 2I10A 3K9TA 4LI5A 1Y57A 2VT3A 5IDNA 1BIBA 4CFVA 4O27B 2XIXA 3FKJA 4DT9A 5K7FA 4MBLA 3H0DA 1XJDA 4XRSA 2H6BA 2H27A 5EZHA 4HGLA 4F52A 3I54A 4D28A 4AQKA 3KQ7A 1FBNA 3UE4A 1GAGA 5KK1A 5IT9K 1UA2A 1YRNA 3CP9A 4A6DA 2I0HA 2BVLA 3MFKA 3G1LA 3MD2A 2VTOA 3BWGA 3QWJA 3F6XA 2YN8A 2QLUA 1OFCX 3PVUA 3QTIA 4BN1A 3DNEA 2DA3A 2MH2A 4AA5A 3EMGA 1JQHA 1SMHA 3UZRA 3FZPA 4QPOA 3BR2A 2WTKB 2YX7A 1FMVA 1ZYCA 4P55A 1FYLA 3V5WA 4ZK5A 4AS0A 3CJNA 3W10A 3V7SA 4IJAA 3HLLA 4CYIA 4EQUA 1B59A 2JLDA 2PMZN 2KDOA 2CNQA 5EQYA 1IGNA 1CSNA 4CG8A 1OR7C 2JPBA 3HV5A 4Z9LA 4HVHA 3MPTA 1IAJA 4X2KA 4E7IA 4AF3A 3E6MA 1QPIA 5HDNA 4FX3A 4A07A 1PY5A 4CUGA 3P5KA 3K54A 2DI3A 3ZP5A 3O7LD 2QLQA 3BGQA 3PJ2A 4PPAA 3SRVB 1ZYLA 4C38A 4USDA 1HOMA 4O4EA 4O5VA 1ST4A 4TT7A 2WD1A 4GRIA 1Q4LA 2XIKA 1HOWA 2FF4A 2ACXA 4EC9A 2VWWA 2EB3A 4FG8A 2QGUA 4IOCF 3VEPA 2WZJA 3DLZA 4LG0A 5HD4A 3QZFA 3D5LA 3PDTA 3L2UA 4DAWA 2KIFA 4HYEA 1TVOA 2PPQA 3QCXA 4TWCA 3KRRA 5M08A 1ZOEA 1RI7A 3BY6A 1L0OC 5IQGA 3LCDA 3R01A 2XRNA 3PSFA 4IVCA 4I02A 3HMNA