1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
5M07A 5D4RA 1DUXC 3DPLC 2C5YA 4YU2A 3U9CA 1NY3A 3ML6A 4OLIA 3HP2A 1PW2A 3DBFA 1U6GA 5AP1A 1ND4A 4XYFA 1BJAA 4AGDA 2V7AA 5L8LA 5CANA 2YCFA 3J81Z 5L8JA 2FGIA 1XH6A 4F1TA 2HZIA 1MRYA 5LRRA 4Y17A 3HDMA 5EQYA 2BTSA 2OZUA 3PLSA 4M69B 3FLSA 2BZJA 2ZMEA 4JBAA 4IM3A 5CEOA 4YTHA 3P5KA 4AP7A 3E6MA 4I5MA 1T6SA 4JBVA 5GINE 5AUUA 3CGFA 1EH8A 1H26A 2H96A 5D7VA 5LARA 4DH5A 1W4MA 1V0PA 3QAME 4FK6A 3NGAA 5LHIA 3MPAA 3L2CA 2BKKA 5TE0A 4ZSLA 4WK8F 5KUPA 2RQPA 1GNGA 2OU7A 4RAYA 5ERIA 1PMNA 4V05A 2VWVA 2WB8A 5AWMA 2O61A 2X81A 4CZUA 4E1ZA 3O96A 4EH9A 1YHWA 4ZSGA 2BVAA 4GYGA 3WTYC 4HF2A 2RKUA 3V8KA 3P9KA 1OI9A 3BU5A 2FBKA 5HVJA 3IS5A 4K18A 3OROA 4RVTA 3F2RA 5E8VA 2R64A 3GC8A 4UV9A 1BI8A 2BR1A 1S7OA 3RPRA 5HVKA 4C4EA 5ETCA 2A07F 4XEYA 4ESBA 1H8FA 2JDTA 5DCMA 4BRXA 2HZ4A 3VRZA 4GG7A 4WSQA 2VTMA 3JXWA 5EEHA 3UYTA 3WZUA 2YX7A 4QT1A 3U2RA 5EQPA 4LGWA 4F65A 4CSVA 4L43A 4JQ7A 4KUMA 1TW2A 3EYGA 3VUIA 4LD5A 2DPUA 4A4XA 2VOOA 2J4ZA 5HOAA 4FT0A 3FMDA 4BICA 1SNUA 1ZYJA 2BROA 3R7UA 3W2PA 4DF3A 1J59A 3S4QA 2OK1A 4LK1F 1YQAA 1UNLA 3PJ1A 5AR3A 3PYYA 3L8SA 1P6RA 2Y75A 3NAYA 2J90A 1PXKA 4EONA 4EJWA 5HLPA 5A6OA 5IDPA 3LIJA 5LVNA 2W05A 3L9PA 4YTFA 2KIMA 4ZTQA 1CF7A 2I40A 4F4PA 2XK3A 2QZ8A 2R3NA 2X6DA 5FG8A 3NUAA 2DAOA 2BFXA 2BKZA 4NT4A 3BJOA 4TPTA 2CDZA 3KULA 4O7YA 1F5QA 1IRGA 3C18A 2VTAA 2X8EA 5H8EA 4QQJA 3IHUA 3F69A 4RGUA 1SZMA 1EH6A 4KICA 5M4CA 1FYLA 2RGPA 4AG8A 3OCSA 1XMKA 2KJCA 3PRFA 3VIDA 3KRJA 5EYKA 3DB8A 4BIBA 3RCJA 2GNLA 1ZRDA 3PG3A 1E1XA 2CMWA 5J7HA 4QMZA 3LMGA 2IW9A 1PP7U 2A0CX 3MY5A 3O8TA 3PUPA 3AT4A 4HGSA 5JZNA 1R7JA 4MHGA 5I9UA 5ANDA 5HU3A 1KU2A 2GA1A 3GF2A 4II5A 4YJTA 5J87A 2PVYA 4X21A 3C50A 2MD5A 3UMXA 4UX9A 3EOCA 1FGIA 4NCTC 4HCUA 3MTFA 2YERA 3E88A 3PIZA 3OY3A 5D5WB 5IDNA 4USEA 2GDOA 4EUUA 5AR4A 1Q1HA 4DNCA 2H09A 1CSNA 3MAJA 3LKMA 1Q61A 3KE2A 4E6CA 5KBRA 4QP6A 3KVXA 5FM3A 5I9VA 1KUTA 3D0SA 4I09A 2EB3A 1K78A 2P4WA 4AIHA 5BVDA 5DH3A 4HGTA 3QYZA 4QMSA 2GHLA 2HOGA 3C0IA 3ZFXA 3FE3A 3FX3A 3EQDA 3FQSA 1FZPB 3LXPA 2J6MA 3AMAA 1P2AA 2OLCA 3J7AO 4FYOA 4U3ZA 3UPZA 4FT7A 2BZIB 3WF6A 3BBWA 2A4LA 3BDDA 4CDGA 2IWIA 3FJQE 4IIRA 4TWPA 3OC1A 3N97A 4LV8A 3PPZA 1PF8A 3ORPA 3PA4A 2FF4A 3H3ZA 4E4MA 4KIQA 2VWZA 1DS5A 4ZY6A 4XV3A 4FIEA 5HBEA 5KVRA 2YR2A 4OAUC 4ZOGA 4PTGA 3SXSA 3DFCB 3K5UA 2V62A 4O1OA 2P6TA 2WTJA 1EH4A 2ETKA 4TT7A 4IEBA 4ZJIA 1HW5A 1CGPA 1J0RA 2WQMA 1XO2B 5K5RA 3KLOA 5J5SA 3ID6C 2QONA 5F94A 5CT0A 4YJRA 5AAFA 2FU4A 2G9XA 4L3LA 4B09A 2HAKA 4MHAA 2RDPA 3WGHA 1HBXG 2RFSA 3DY7A 2JKKA 4NTTA 1DI8A 1ATPE 1WSUA 4ID7A 2VRXA 2OBJA 3M1SA 4EEVA 4A5MA 4JDKA 5K0XA 3IONA 4BCIA 2GWRA 1OZ1A 5AADA 3DQXA 4RBLA 4BB4A 3EUHA 4RWLA 3T8TA 3DAKA 1TW3A 5HO6A 4I5PA 3UVPA 3Q9YA 4BF2A 4F08A 4PDPA 4UXLA 3KB7A 1YHVA 3DLSA 4MBJA 3JS2A 5JSMA 4HX7A 5AP3A 4I5HA 5IH4A 3RINA 5KMIA 3RNYA 3ERKA 3FLYA 2C6YA 1GIHA 4RS8A 5T3QA 3C7QA 3NVMB 5JMSA 5I5ZA 4DEEA 3CR0A 4BDCA 1PMEA 5FUTA 4U0VA 4I6FA 1Y91A 3MPTA 4RIWB 2UW3A 1S3JA 2UZEA 5HLIA 1HKTA 2PQ8A 1SFEA 4DG2E 3DPKA 5J95A 3O50A 3QKLA 3QA0A 4Z3VA 4Q9ZA 2LGCA 2C3LA 4WD5A 1S7AA 1WVWA 1ZY5A 2TDXA 4FZ6A 4S32A 1J5YA 4TW9A 1GXQA 5I3OA 1D8JA 2GHGA 4BDGA 5GHVA 3DK6A 4JS8A 5KMOA 2W96B 3FZPA 4FSUA 4XLIA 4U88A 3QAHA 1JKSA 3DBCA 4OBPA 1O3TA 3QCYA 4CCBA 4HLYA 4FTAA 2Z99A 1J7UA 2GMXA 2EFWA 1K9AA 4BDFA 5B2LA 3G90X 3NRMA 5AUYA 2X8IA 2P2HA 5FLFA 2G2HA 2QOFA 4IFCA 3IW5A 2ERKA 4XG8A 4LM5A 3D2KA 4I20A 3P9CA 4NJDA 5M4IA 2VX0A 3IECA 3MVHA 2QENA 5FQDC 4USDA 4A06A 4LB6B 2PMNX 4WHZA 3PP1A 3RBWA 5KMKA 4RIXB 1H07A 5BQTA 3A7FA 5AP2A 3K54A 3QX4A 3N4VA 3TIYA 2CKOA 1IXSB 3DTCA 1GZOA 3A7JA 4Z55A 3MCZA 2Z7SA 1KU9A 2NRYA 4WBBB 4I4EA 3TUBA 3VS0A 3UJGA 4ZXTA 3TKHA 3I64A 3MESA 5T68A 2YAAA 4OW8A 3IDBA 4FIFA 4CFNA 4FBXA 2X6EA 2OZ6A 2ESHA 2C5VA 4KIOA 1ZREA 3EN4A 2CNQA 5E8IA 4IE9A 3QHWA 4EM0B 2B9JA 4QTCA 3PXRA 3VUTA 4L5IA 2JBPA 2Q0BA 1XGMA 4A0ZA 2C4GA 1W98A 5M4FA 5DR2A 5M51A 1G3WA 4BDJA 4FUYA 4CG8A 5CU6A 4ASNA 4PY1A 3ZYAA 2BV6A 1R23A 4G3CA 5HS8A 3FYJX 3ZZWA 5JEBA 5GZAA 4RJ3A 4WSYA 1OYWA 2YCRA 5HTCA 2Q2EA 2CCIA 3R7YA 3E6BA 3FLQA 1FVVA 1WQ2A 1I27A 4CEGA 1MQ4A 5H3QA 4DLJA 2J9MA 4MNEB 1OMIA 4HQMA 3JYAA 1FX7A 4I01A 4NQWA 2VTTA 3MZYA 2IN6A 4LFUA 2F57A 3HMNA 4LOQA 4AGCA 2Y8OA 4FX0A 3UIBA 4R7BA 4UALA 3LZBA 1UU7A 4ENJA 3EYHA 4XV9A 5DG5A 4EHGA 3HV7A 5BQ0A 3FZ1A 3LFFA 4Y13A 3NCZA 4U0IA 4D28A 2GCDA 3OT3A 3GFIA 4ZLYA 4Q47A 3NPCA 5JVTA 1IN4A 3NYVA 2QLUA 4UVBA 3H92A 4DA5A 1URWA 5M08A 5GIOE 4U41A 3P4KA 4QTDA 5DOSA 3M11A 5B7VA 3JTHA 4OTWA 3ULIA 4YO6A 3QZGA 1U46A 2XEYA 3D15A 4H05A 2NO3A 3DDPA 3NNVA 5CT7A 4KD1A 5ILSA 4FV0A 4HYEA 2ITPA 3LQ3A 2A61A 4EK4A 5DGZA 4CYJA 3DFGA 4JAIA 4ASDA 2VTQA 3O6BB 1PXJA 1BOAA 3GU6A 3MYGA 4MAOA 1X3UA 5J8CA 5FB2A 2E9NA 4JJRA 2YCQA 1JKTA 1IAWA 3DAJA 1L0OC 1FMKA 3T9TA 5IG1A 4LYNA 5L8KA 1KE9A 1ZYCA 4ENNA 4ZTRA 4ANOA 2M5WA 5KMJA 2DWBA 2K4BA 1WMKA 4R1HA 4MTAA 1OL7A 2J0LA 3QP5A 2PJPA 2K86A 2IA0A 4P90A 1GOLA 3Q4CA 4F7LA 3FXWA 5HEZA 1J3HA 4FICA 5CVHA 2QLZA 2BAQA 3K2LA 4PTCA 2XK6A 2ZB1A 2HYYA 3GUDA 4APPA 2WELA 5GJFA 4ORKA 2KULA 3V6SA 1IAHA 3OOGA 4I0AA 3RHXA 3HIFA 5A6NA 1B59A 4JVGA 4RC3A 2Y0AA 2XKPA 4EOSA 4NSTA 3UZRA 3IRQA 3SFZA 1REKA 3V8TA 1CTPE 3TKIA 3RMFA 5HQ0A 4OAVB 3DK3A 4YJNA 2ITZA 3A8XA 2FXAA 3OBJA 3PXFA 4H0EA 2FSMX 1MDMB 5ANOA 4K8AA 1R1WA 4QYHA 3G6HA 4CQGA 5AJQA 1KWPA 3PLAE 2CGUA 4MF1A 3R8MA 3VS7A 4MNFA 3FI8A 5HLHA 2O63A 4CT1A 4F9CA 1WBNA 1U59A 4AIKA 5D1JA 1XCVA 3DPTA 3LLTA 4L46A 2I0HA 3UOHA 3WTUC 4NWMA 3LFAA 3TNQB 3TDUC 2IVTA 4OR5A 3QTWA 4MBIA 5HIDA 1UB9A 1BC8C 3BLHA 3VHKA 1FBUA 3DNDA 1EH7A 5HOOA 2OQRA 1W7PB 4D1XA 2YISA 1DPRA 2VO7A 3IG7A 1O3QA 5EOBA 2XKEA 5L4QA 5K3YA 4IFGA 4C61A 2XS0A 5FGKA 1OKYA 4UMUA 4YSMA 1QQIA 3VBYA 2I1MA 4C4JA 4U80A 5DPVA 3GXOA 5ETAA 4KWPA 4BZDA 5ILVA 3VFZA 4FG8A 2X0LA 5HX8A 2C47A 3F3WA 1SVEA 3RJCA 4O6EA 3GU8A 3Q5ZA 3W55A 3LCSA 4BWXA 4HVDA 2C30A 4XSXF 2RG6A 4KRDA 4L00A 4O0WA 3G33A 2YIQA 4IVBA 3Q60A 5IQDA 4JQFA 4IX4A 5E92A 2X1NA 3WTSC 2ZM3A 2QWWA 3ZRMA 4WXDA 3ZQ7A 2B4SB 5KMMA 1I5ZA 1G6NA 4IRHA 3F7ZA 3PZHA 1B39A 3TKYA 1ZYDA 2XK8A 4B7TA 3ORMA 5BPIA 2UVXA 3LPBA 4Y72A 4IM0A 5HLWA 4A5NA 3MFKA 4BGQA 1R3CA 2CHLA 5TJJA 5CAVA 3W6KB 3C4ZA 3ZBFA 1KE5A 2RNJA 4UN0C 2ACXA 5AIKA 3ZONA 1JLUE 4IVAA 3DS6A 5H9BA 4O7SA 2Q83A 3ATTA 4JNWA 3PWDA 3MN3A 3NVKI 3CQUA 4IANA 3R8PA 1WRJA 2R5TA 1IF1A 3HV6A 4DAWA 5A4LA 4ESFA 1J1CA 1ZLKA 4AAAA 1ZAOA 4D4SA 2I7QA 4L6QA 4FGBA 2ZVAA 5DWRA 3JAMZ 5E1ZB 4D4VA 3RTPA 3NUNA 5CF5A 3UQFA 2OJ9A 2BRMA 4DFUA 5GZ9A 3BHUA 3E5UA 5CVFA 1I1SA 3FY0A 3V04A 2ONLC 4RB0A 5FFZA 5KHXA 3ACKA 2PUIA 5EHLA 2PWLA 3QUPA 4QTBA 5AP7A 3KY2A 3UC4A 2Z7RA 3CQEA 4YJPA 3B02A 3PFIA 3BYMA 4FA2A 2YPRA 1UKIA 4B8LA 2KIUA 2GQGA 2FYSA 1OKWA 4O7LA 3KZZA 4CICA 4D58A 4FSWA 4EJNA 3COKA 3QD4A 1TQIA 2L3DA 3H4JA 2HK5A 4BR3A 2CKEA 4X7QA 4D2WA 3GEZA 3QA8A 3FXZA 2PVHA 1H9TA 2QO2A 2UXNA 2FMLA 4RPVA 4QTEA 2VV9A 1F5TA 4M6YA 2WXVA 3UQGA 1ZMVA 2X0GA 5DFPA 3D2IA 3EHAA 2YDIA 4GW8A 2H94A 1XR1A 5JFVA 4ZY5A 5KMNA 4WT6A 2UZDA 5AV4A 2UW5A 4M3QA 3RCDA 2IRFG 4D4YA 2L02A 4BFMA 4AA4A 2HZNA 4OTQA 5CASA 3SLSA 4XCUA 4FL2A 1FOTA 5F9EA 3VBVA 1WZYA 5TR6A 3RPUA 4KKGA 4L3JA 2PK9A 2OFUA 2C1BA 1I44A 4YUQA 5EH0A 3ACJA 4DQ2A 4ANLA 4BCPA 1GVJA 4EJ7A 4XMOA 1AWCA 1YOLA 5IA3A 1ZARA 2CN8A 4KS7A 4LGDA 1FLIA 4EV0A 2K7LA 4Y5HA 3VW8A 2EK5A 3HLLA 4WA9A 3DNEA 4MD8E 4PMTA 3GOKA 2BZHB 2YWVA 3I71A 2JPCA 2XZSA 2PPQA 1O6LA 2J5PA 3EZRA 4AS0A 4JG8A 4G7ZF 4XBUA 5E8UA 1F0QA 5LOHA 4YZ9A 3N4UA 5AM7A 2KJBA 4YNOA 5J1WA 3P78A 1T46A 3SVVA 2KTYA 3ULZA 2PZIA 4HYIA 2HDCA 5A2QZ 4QO9A 3PJCA 3BX5A 4KDPA 2HELA 3D5LA 2XNBA 3K0LA 1HSTA 3MA3A 5I9ZA 3M42A 2A68F 2X9EA 3V01A 4L3PA 3TUCA 4QWQA 4QP1A 4TWCA 3MW1A 1XSDA 4EC9A 1J7LA 4CGZA 4FGRA 4CO8A 5AV3A 3ZBXA 1FSEA 2PZRA 5GZ8A 5IA4A 2XAFA 4GJ2A 3W2OA 4K0YA 4GJ3A 4DTKA 5IMEA 4FSTA 4U0WA 3E8NA 1XDUA 4M0YA 4BCOA 4UUVA 3AOXA 3IW4A 3JW4A 5FXSA 5FP6A 3NS9A 1FC3A 5DD8A 3PIYA 4BZNA 1IRKA 3KRXA 2UUEA 4G3EA 3ZMTA 4A0YA 3BYOA 4W9XA 1UU8A 2WGJA 5C1QB 4OTIA 1JGSA 5JGBA 4BI1A 5LMAA 3ORLA 4IBMA 2CN5A 3II5A 3A4OX 1K3AA 2ITVA 2Z02A 2ZBKA 2Y0MA 2HKOA 4WNPA 2B9HA 3DGKA 4C57A 2QNJA 2QOKA 3DA6A 4OOIA 1YXXA 4YC8A 2RC4A 1TVOA 4OMYA 2DU9A 4NFNA 1OYIA 4U5JA 3HL7A 5CF8A 4FEUA 4Y5QA 3BEAA 4XOYA 5BUIA 3LHJA 4YLKA 2F2CB 3H0ZA 3UBDA 2XUUA 4BDHA 2EV0A 5CU4A 5KKRB 5GNKA 2UV2A 2XKFA 1ZGAA 4DT8A 2OJJA 4ENMA 3GLXA 4G6QA 4QMLA 2JBOA 3HRMA 3QOPA 4Z7HA 3I79A 3HX4A 3ZLSA 3BLQA 2XMYA 4E5WA 1E9HA 3KQ7A 2VWUA 1QGPA 3FKLA 4D2PA 3SAYA 3HGKA 5M55A 3E7OA 1R58A 4A9TA 2WC2A 4UVCA 3TNIA 4ITJA 2ZDTA 2YCSA 2PVKA 4RIXA 3GXLA 4WRGA 4FKRA 4F1MA 3AGLA 4F7SA 3IWFA 3JSOA 2XJ1A 1OPLA 2EV5A 4EQMA 4DEIA 4BQAA 4YFKF 3FMNA 4FYNA 4PDOA 1XGOA 5CLPA 3KLNA 4NYEA 4FTMA 3FDNA 3IW8A 4ACDA 3C4CA 5CX9A 5IKWA 1SMYF 3Q5FA 2QOQA 4L42A 3CSVA 3I59A 4EH4A 4U43A 3UNJA 2L4AA 4UY9A 3BZ6A 4X3FB 4PRJA 4I0BA 3KMUA 4RLKA 2XK4A 1TBXA 4NZWB 2BIYA 3BBTB 4KKHA 4PMMA 4FTCA 3CJNA 2VGOA 1SYKA 2QG5A 1I09A 4YPSA 1YDSE 4PGGA 3QALE 4BCQA 2R3PA 3KP7A 3EMGA 2OIQA 5L2WA 5HE1A 1YWNA 4QYEA 2LF7A 2IA2A 3PXKA 1YS6A 3HKOA 2XUBA 2HEOA 3UTOA 2DTRA 4LL5A 3TDVA 1A04A 2R3LA 5JH6A 4J53A 4HZRA 4IAIA 4X6QC 1U78A 1Q8UA 2L4MA 2R9SA 3HHGA 1ZYSA 5E1EA 4C62A 4EJUA 3Q32A 1PDNC 3RZFA 3IC7A 4TNBA 5CLSA 4MXYA 4ACCA 3A2CA 1T0FA 5HNGA 3NQOA 4FT8A 2WTDA 4EBVA 4BHZA 4MNEA 5FD6A 3ZFYA 1OBDA 4EH6A 3LXLA 1HW2A 3ZO3A 3QRKA 3T3VA 1OITA 3CTQA 3O0GA 1PXPA 1LEWA 2P3GX 4U8ZA 4LJZF 2PU8A 2EFOA 3VEPA 2WNTA 5HKMA 4ANSA 5LMKA 1HKSA 2QKRA 3CUQC 4IAAA 1RW8A 3BJ6A 4TY1A 5IH6A 5JT2A 4L5JA 3V5JA 2HENA 3C4WA 4FTIA 4AZWA 5FM2A 4H36A 1K79A 3FUPA 3QXPA 3L09A 2RFDA 2JAMA 2YDKA 3WE2A 1AD5A 2XIKA 4UHTA 2YM6A 3BE9A 4D9TA 3MSSA 1P92A 4AE6A 5C9CA 2O0YA 4GMYA 3DZOA 2ITYA 4BCFA 5E18F 3RPSA 4QMNA 4DCEA 4E3CA 3C3WA 1TTYA 3WE8A 4YFXF 1Q4LA 5CSWA 1XCBA 4ACHA 1PYEA 1O6KA 2WV0A 3QYWA 4EQUA 5FGMA 4OUCA 3VS6A 3KRLA 4IDTA 2GXGA 3ZCLA 3LQQA 4GFMA 4NIFB 2OF4A 5TT7A 4RX9A 5CSXA 4J8NA 3DXJF 4BDKA 4FI1A 4XV1A 3F3XA 3S95A 3GP0A 4W4WA 1WAKA 3NLBA 1IEPA 4OTFA 3ZUTA 3DXQA 4PQNA 4CRLA 1H1QA 1U54A 3I54A 3R6XA 4KBCA 2E1CA 3EQCA 3OCGA 1JPAA 4G3GA 2WMUA 1YHSA 2VE9A 4NFMA 5HG7A 4LLGF 4AU8A 2Z7QA 4O96A 4FEQA 3VAPA 4RFZA 4FTLA 4PTEA 4PP7A 4NKSA 3QKKA 4L8MA 4OT5A 5LWNA 5JR3A 2OA4A 3OCBA 3AQVA 4KNBA 2JC6A 3ZHPC 4JOAA 4O81A 3HMOA 1V3FA 3NRVA 4LL0A 3SOAA 5HVQC 4FIJA 1IRFA 3AC4A 3G9NA 2DFIA 5M4UA 3B73A 2HXLA 4KN4X 1FGKA 4AZEA 4E70A 5CTPA 3HV3A 4TWOA 4JK1X 2WO6A 3P7CA 4DHFA 2J0JA 4YJVA 5L3GA 2C3KA 1MDMA 1VYWA 3KP4A 2Z8CA 1KGSA 4OIQF 3F3UA 5B2MA 1IXRC 3MVMA 4L0ZB 4HYSA 4AOIA 2YIRA 3G0FA 3QQJA 1FP2A 4GV1A 3BEGA 4H3PA 1MD0A 2VT3A 4L9JA 4CFVA 2ETRA 1UA2A 3EB0A 3PP0A 5CAOA 5DV5A 3BPRA 3JSPA 5F4NA 4IZ5A 5IU2A 2WTIA 1YXUA 3DBDA 4RRVA 3CUOA 1LUFA 3LM0A 4P4CA 2W1HA 2HYGD 4UMTA 4J52A 4NUSA 4UYAA 5DCMB 2R3KA 5HO7A 1W7PA 1IN7A 2EWNA 1GAGA 4M71A 4O6JA 4D0PA 1O9UA 1XH4A 3GU4A 4PPCA 5E8XA 5HIEA 2HKXA 3FL4A 5CF4A 2QO9A 4CXAA 3C51A 4G6NA 3V5PA 4MXAA 3VOEA 4KIFA 1BI1A 3VUKA 3WTTC 2WPAA 1RDQE 1XWSA 4FT3A 1GZNA 4C34A 5HESA 3UYSA 4DT9A 3BLRA 4IVCA 2H6DA 4TXCA 1JWHA 3VS4A 2FOKA 4PZJA 3ZC5A 1REJA 4BTMA 4MXZA 2C6MA 1JE8A 1J1BA 1Q8WA 4YZDA 4MQ9F 5C4KA 4BVUA 3NSZA 3BU3A 4EK3A 4BBMA 2Z9OA 4EYJA 5D5XB 1CF7B 2KKOA 4FZ7A 5AFVA 3R02A 3LA2A 5M06A 4ZY4A 2PMLX 2HYFA 3MFSA 1Z5MA 5L3CA 2UW6A 2HTJA 1Q99A 2B53A 3MEXA 5EYCA 4U42A 3VUMA 1EV7A 3BGZA 5AAEA 1WI9A 4CTCA 3GFWA 3TWJA 5DYJA 3RYRA 2HS5A 3WOWA 1OYYA 1FSHA 3DKFA 4X3JA 3DBEA 1YS7A 4I02A 2YA9A 3POZA 5A4TA 3RAHA 3D7TB 4DEAA 1SM2A 3ZSHA 3W6JB 4MCVA 3U9NA 4KNYA 4RJ5A 3WTVC 2JT1A 2C69A 1ZG1A 4XJ0A 1R1VA 1BI7A 3SC1A 2XNMA 4U0YA 4O22A 2VBXA 1J75A 4DYMA 3T0YA 2VXZA 2F5DA 3FI4A 1A06A 2VZ6A 3W1FA 4FSNA 1U3EM 3BHYA 2XIYA 4G6OA 3HUBA 3QRTA 3Q6WA 3L8VA 2VTOA 2JDVA 4MKCA 1U5RA 2WFYA 4BXUA 2V79A 3E63A 4FKTA 3HAVA 1W84A 1YLFA 4D5KA 3RIRA 1SAXA 5EW9A 4ZMEA 4FV6A 1B4AA 2Y4IB 4BHNA 3RDIA 3A99A 4Z2YA 5J79A 1UKHA 5CEPA 3FLZA 5CENA 3QC9A 4JL9A 4I4FA 2X8DA 4O82A 1XN7A 3F82A 3CD3A 5L3BA 4F99A 1HKQA 3SQQA 3WGIA 4UYNA 3AMBA 2ZOQA 3J80Z 2A1AB 3OEFX 1D3YA 1XKKA 3G6GA 3IDPA 3F5XA 3W32A 2PZYA 4FZAB 3F6VA 5ANEA 3DV8A 4RA5A 4LG0B 1GIIA 4RJ4A 1UNHA 2VBZA 3REPA 2O2UA 4XG2A 4DG3E 2YN8A 4YR8A 4FVQA 2W84A 4FKSA 2P5LC 4A9UA 5L3DA 3R21A 3R22A 4BAYA 3MJ2A 2W1IA 2JDOA 4A07A 2GQSA 3OHTA 1E17A 5KZ0A 3BU6A 3PXZA 4CCUA 4WO5A 4IACA 3I6WA 3LFQA 4UB7A 3ZPLA 3ECHA 3CC6A 2QHMA 3K3IA 5HBJA 5C4LA 4L44A 1TQMA 3BELA 1I6XA 4BGHA 3MV5A 4BBEA 2CWEA 4DINA 2HR3A 4IQ6A 2OJGA 3VWAA 4LRJA 4J1RA 3CE3A 4ZYDA 2FVDA 4BC6A 1U5TB 2CSNA 4G17A 1YG2A 4KMFA 1PUEE 1GY3A 5K5XA 1QPMA 3ZU7A 1MRUA 2PUPA 3HMIA 2MA3A 2EA4A 2GNGA 4CFFA 3FPMA 5DUKA 3LMHA 4QOXA 4E4NA 3U54A 2XIRA 3R1QA 4TKSA 3ORZA 4GU9A 1R36A 1STZA 4DBNA 4RJ7A 4F6WA 4ZIMA 4EH5A 1NXKA 4FV8A 5BMMA 3TN8A 3R00A 3MJ1A 4HVSA 1ZN2A 4AN3A 2DO7A 3PSCA 3PDTA 5EDQA 3TQNA 4FK3A 2B9IA 3EYYA 4V0GA 3HA8A 4ZTMA 4IJAA 4ZJVA 5HS9A 3ORKA 2WMTA 4U9AA 5AP6A 4H39A 1FPUA 5HG8A 3CXWA 2X4HA 3WF5A 1K7AA 1WBOA 3OUNB 4CTBA 1KYWA 1KE7A 1ZH5A 5E8TA 1BN5A 2NP8A 1LEZA 3SHFA 5IT9Z 3LFDA 5CZHA 2ZXJA 3RKWA 3QGWA 2XVCA 4IZAA 2EXMA 3U55A 4LMNA 3R8ZA 4R3CA 1Z1DA 5I9WA 4G5JA 2FO0A 3UIXA 4EGYA 3GU5A 4OIRF 5H8BA 2A2AA 3PA3A 2OXDA 4W4VA 3GC9A 5FFXA 3V7SA 4FKIA 5LVLA 4G9CA 4FNZA 4IM2A 3N4MA 4P7EA 1Q41A 3LQ5A 4ESJA 5ANGA 4O2ZA 3CY3A 2NPQA 2JFLA 4P5QA 2BHEA 2JGZA 3RI1A 2YSRA 1ZOHA 3CD8A 3GBZA 3F6XA 1CKPA 2R7BA 3UVQA 3E8EA 3EQRA 3PA5A 1RE8A 4BNCA 5AEPA 3TEIA 4FF8A 2X4ZA 4HNIA 3E64A 2VX1A 3QPTA 3DF8A 1IG1A 4D55A 4BI0A 3KCFA 3IQ7A 3RAIA 2AC5A 3UO4A 5JQ8A 5J8FA 4G31A 3BOQA 5DRBA 4DFBA 4P2KA 2BDFA 3V51A 5KCVA 2GNJA 1ZMUA 4JR7A 3FMSA 2UZUE 4IZYA 4F6SA 3QRIA 4GL9A 3RNIA 5CSPA 4EOIA 3ZO4A 5IUIA 2PUNA 2OG8A 1BI2A 3BKBA 3FHZA 3QQHA 3U8WA 4JX3A 4ZAUA 2EU9A 1ZZLA 5CNOA 5ICEA 5L2SA 3W18A 3K3JA 1FVRA 5AP4A 2QCSA 2Y48A 1CM8A 4S34A 3E92A 4I6BA 4HZFA 1YXVA 2WMBA 4XLPF 1KYZA 5FBOA 3QQFA 3TZ7A 3DLZA 4XP0A 5D4SA 3I0OA 3KREA 1LVAA 1S6LA 4PPAA 3S2WA 1P4OA 3R1SA 2V1DA 5CQWA 1IUYA 4UV0A 4IHPA 3EWHA 4CFMA 4W8EA 3GFMA 3S00A 4RZWA 4QMVA 2J50A 3FXQA 3EQHA 4EM2A 4PMSA 1S8NA 4RIYB 4KB8A 5F1ZA 3O23A 5H8GA 2VWWA 3DXNA 4EH8A 4IC7A 1ZRFA 4O38A 4XS2A 5HLGA 3L9FA 3KP6A 5EQEA 3FBVA 4JIKA 1F9NA 4F9WA 4BCKA 1USSA 4FHTA 1W7PD 2K27A 2NS0A 4AIJA 1R22A 3MIAA 4F7JA 5DT3A 4AUAA 4G1WA 2CLQA 5HORA 5IA0A 4B9DA 3CTHA 1ZGJA 2WHBA 2C6LA 4P96A 4BDAA 1E2XA 1USTA 5E8YA 3QPHA 4ZSJA 4EOLA 4EMSA 4RA4A 2WKMA 3LQ8A 5EEGA 4L53A 5ANIA 3EZVA 4LV5A 4XOZA 5E8SA 4B8MA 4BCNA 5K1YA 4NB5A 3BHVA 4W9WA 2E9UA 3ZLYA 2E1NA 2YACA 3SW7A 5E90A 1T98A 4D1ZA 5ICFA 3D14A 5HTBA 1UVRA 3C5UA 1X8BA 3BROA 1OIUA 3I4BA 3LQRA 4ON0A 4I24A 5JN2A 4RIOA 3BWJA 3ZDUA 2Y9QA 5IQHA 2XP2A 3F5GA 1U2WA 2XBJA 4FVPA 5HE0A 4AF3A 5J5TA 4PL4A 5L6OA 2Z2WA 3WE4A 1IASA 4X2FA 5B2KA 3QRFF 1OVEA 2XCKA 4ZS0A 4ZS4A 4BCHA 3T3UA 4NIFA 5DCFA 4TYHA 3ABUA 4BN1A 4J99A 3H9OA 1G5SA 3D7ZA 3ALOA 2WTVA 5LVMA 1FVTA 3KL8A 1ZYRF 5KK1A 2GQQA 2XROA 5A4QA 3CPBA 3KXHA 4CKIA 3E8DA 3IDCA 5FTGA 2OI4X 1JSVA 4AFEA 4YJSA 1DP7P 5HDNA 3U87A 2XRNA 4K11A 4I23A 3NNWA 2YIWA 4FOCA 1LP4A 3FPQA 2BALA 2WWYA 5AV1A 2IZSA 3FY2A 1KQ9A 5C03A 4YBKA 1Q8ZA 5AV0A 2ZYBA 3FC1X 4O1PA 2XNPA 4ETSA 5T6KA 5HG5A 2PVRA 4WX9A 3ZXZA 3CQWA 1YXTA 4L45A 3ZUVA 4MF0A 4HQEA 4O7RA 3NW5A 5FD5A 4FSQA 3KETA 3F22A 3HRSA 5FTQA 4U7BA 2QC6A 3UOJA 4N4SA 4U97A 2PVJA 4EZ7A 2I0VA 2MLGA 2A5YB 3U51A 3SXFA 3R61A 2ADUA 3F8NA 3F9NA 3ROYA 4M66A 2EV6A 3AD4A 3R9DA 1KU7A 3RI4A 2R7DA 4U3YA 2UZOA 4C37A 3HEGA 2ETMA 5L6WL 4ZZMA 1QBJA 1T39A 2CNVA 4ZEGA 3EQPA 5BX0A 1JHFA 4ZYHA 4MYGA 4EHEA 1OB3A 3EQGA 3HNGA 1ON1A 1JOWB 2IW8A 1JXSA 1H25A 2W9ZB 4FV9A 5IQCA 2J51A 4ZTSA 4S2ZA 2O3FA 3M1EA 2R3FA 4HPUE 3FSFA 3DT1A 4PV0A 1PMVA 3VULA 4RX7A 4N0BA 3P7AA 2XH5A 2CSOA 2DLLA 1ZG3A 3VQHA 1FT9A 3BJAA 3UO5A 2IG7A 3L9MA 4IZ7A 1FP1D 2DUVA 4K77A 4L01A 4UWYA 1R1TA 3UQCA 3I4PA 3TZ9A 4U79A 4GT4A 4KS8A 1FQ1B 4RB2C 4QPMA 3PY0A 4F9BA 3QU0A 4MXCA 4U6RA 1H0WA 4X6RA 1OIRA 1BI0A 5FBNC 4FEXA 4W4XA 4MQ1A 2FQ3A 3IGGA 4N9HA 2C6DA 2FA5A 3ODYX 4J95A 4G6LA 4Y15A 5AR2A 1TNSA 3P79A 2F49A 4BDBA 1IN8A 1HCLA 4IXAA 2IVVA 4GVJA 1PJKA 3PVUA 2HWOA 3E3BX 4MD7E 4DCAA 2W5BA 1UCRA 3F2NA 4Q2AA 2BPMA 2PMOX 3KMMA 3LMIA 1YW8A 5FLXK 3KXZA 5LBQA 2QBYA 2BBYA 2QVOA 3D7TA 4BH9A 2ESMA 3OW3A 3QRUA 1RQQA 4IB1A 2G9WA 2ONLA 5IEYA 3JR1A 3WF7A 2JIUA 4DFNA 3HRBA 2PMUA 5ILUA 4UMPA 3LFEA 1ZHFA 2W9FB 5D8KB 1IN6A 4XP2A 2M87A 3SOCA 5DLSA 3TO9A 4IDVA 3H0YA 1LNWA 4L7FA 3PY1A 4M72A 4ANNA 3ORNA 1BUHA 3RVGA 2XNNA 2A6EF 3EFWA 3HRFA 3NIEA 5EG3A 2OXXA 4O91A 4KA3A 2CCHA 4QMYA 2IJLA 4XRFA 4ZZDA 4IWPA 2PMIA 2LNBA 4QYFA 3T8OA 5BS6A 2OSCA 5JFSA 3RAKA 5ETIA 1QPCA 3OMVA 2CFXA 3OP5A 3WILA 4AZSA 4J7BA 4P9FA 4P5ZA 4PCQA 2BAKA 2DYLA 3NYXA 1YQJA 1SFXA 4TZRA 2XGXA 1R5GA 5M09A 3C9WA 2G2FA 4X2NA 2GFSA 2W4JA 4FIIA 2ZNYA 3SKCA 2XJ2A 1HSJA 3NYOA 4D1SA 5HE3A 3OG7A 5EDPA 3IKAA 2E9OA 4JDJA 4MQVA 3OCTA 3IL2A 3M7GA 4LG0A 5DIAA 4DE4A 3O8UA 3OD6X 4LGGA 1V0BA 3NUPA 2VE8A 3QQUA 4FOBA 2YHVA 3UC3A 3V7RA 5E20A 4R7IA 2J0KA 1URCA 2ZAZA 5CWZA 5CVJA 2VU3A 3RM6A 3BPXA 1XB4A 5C26A 1ZXEA 2JKMA 4CMOA 4NW6A 5EI8A 5D11A 4MEYF 2FH9A 3HSRA 1ZY4A 2EVAA 1LPUA 3PSBA 1LJ9A 3PWYA 4ZMFA 3ANRA 1IA9A 1VEBA 3EJ1A 3R01A 2F5EA 3WYXA 4NM7A 1XGNA 4UNOA 4L18B 2UVZA 2H6CA 2XIXA 4RAZA 4I0TA 4IAKA 1XH8A 4JAJA 3OWKA 3M8FA 4I0SA 2ETHA 3VBQA 4JBQA 3VS2A 3HA6A 3U1DA 2P0CA 4QQTA 4GCJA 2OH4A 5DEYA 1U5TA 5E1WA 1OIQA 1XBCA 4IWOA 4GS6A 4FIHA 3CKXA 3L9NA 3G9LX 1SMHA 1KOBA 3MA6A 1VJYA 4AOJA 3LE6A 4PDYA 1LB2A 2XAQA 2R3MA 2Z7LA 3BI6A 2VODA 3NUYA 5L2IA 5B0XA 1OECA 4ERWA 2PVMA 3OW4A 4I93A 3HHHA 3OEZA 4AWXB 3THBA 3WGGA 3TGNA 2C1AA 4YTIA 4DG0E 5A14A 3ZM4A 2FBIA 2DQRA 4H58A 2XRUA 2ZJWA 4ALVA 5CU2A 4D4RA 1W0XC 2YITA 3UP7A 5HDKA 3O7LB 4GO1A 3HECA 1KU3A 3R0TA 2YU3A 4EH7A 3SA0A 1H0VA 4PF4A 4CYDA 5DYMA 4C7TA 4D0WA 1SD5A 5DVRA 3DP7A 5EW8A 4CRSA 4WRSA 3I0QA 2C5OA 3K2ZA 3D5XA 2XAJA 1PXIA 2C5XA 3R9OA 2IVMA 2J2IB 3D9VA 1ZLJA 4E6QA 2WMAA 3RPYA 3Q3BA 5M53A 1MUOA 2AC3A 2JAVA 1WWXA 3KP2A 2VBWA 3WZEA 3OXTA 3PPKA 4C2VA 5GJGA 3ZN1A 4RSSA 5JRQA 1Z9XA 3GB2A 1YVJA 3KRWA 3R6SA 3MVLA 5K4IA 4AN9A 2P33A 3IOKA 4EHZA 3GI3A 4O7WA 2ZDUA 4CHUA 3ANQA 5IUHA 1SD6A 2FEZA 4DN5A 5IA5A 4I94A 4LQMA 4LB5A 3AG9A 2R3OA 2B7AA 2Y7JA 4R79A 1H08A 5AUVA 1YYVA 1UHMA 2W5AA 5A46A 3WIKA 2WZJA 4GFGA 4RB3C 2VWBA 4ZSEA 4EGZA 3J80K 3G2FA 3H30A 3OTUA 3FQHA 2ITWA 3WBLA 1BIBA 1VTNC 5K9IA 4R3RA 4GXOA 5AR7A 3ERED 3I59B 4A4OA 1YI6A 3VBXA 4FKJA 3DQVC 1O57A 3I7BA 3VJOA 2R3JA 5TKDA 2BIKB 3NNXA 1QL6A 4EZ3A 3RTRA 1ZOEA 4MTEA 3NDMA 3RPOA 4KSQA 3CLYA 3SRVA 4AA5A 2EB7A 5CAQA 4KUJA 3FM5A 4FMQA 4LOOA 3R60A 2F9GA 1BYGA 1APME 5J9ZA 4MQ2A 2XRWA 3ZSGA 5EKNA 3MFRA 2F7XE 2UZVA 2PMHA 4EOMA 4U81A 3F61A 2HWPA 1J9IA 3FC2A 2DPDA 4ENYA 4PMPA 2F4JA 4BKYA 2F5FA 4QP8A 3KU2A 2W1GA 1W7HA 2B9FA 4AFJA 1Z05A 1P4AA 5D6EA 2GS6A 3MH1A 4UEUA 4IAZA 2O64A 2KRFA 4ALWA 4I7HA 4HDUA 2AYPA 2C6KA 2LSOA 1AGWA 4OTPA 4RVLA 2WTKB 3KK9A 5BMSA 1XGSA 3MY0A 3T9IA 3TZ8A 3GYHX 3MS9A 3CUQA 4RIYA 3FQEA 3G15A 4XNEA 5KBQA 4DGNA 4APCA 4MGRA 1NVSA 4QQ5A 2FBHA 3ROUA 3E87A 4AZVA 3QTQA 5J9YA 1B6AA 2G01A 4FL1A 4JX7A 3TM0A 2I6LA 1WBTA 1OPCA 4IB3A 5HCXA 3RWQA 1JSUA 1WBPA 4QMWA 2DK8A 1YI4A 3IGOA 3KF4A 1P2FA 1Q5KA 3G3ZA 2GA2A 4EOOA 2W1CA 1YOMA 3O2PE 4UBAA 1DI9A 2OZOA 2C6IA 1JBPE 3RPVA 4EVIA 5FXQA 4S04A 3QTRA 3CO7C 3F6OA 3LA7A 2PVFA 5IQAA 2A6HF 4Y85A 4B6LA 4BTKA 4CQEA 3ZMMA 3E7VA 2JDSA 3FXRA 2XNGA 2VC1A 2XNEA 3FWEA 4C4IA 2QOCA 4QP3A 3NR9A 3HYIA 3HYHA 4L67A 4PDKA 4AA0A 3ELJA 4BHBA 3RAWA 1BI3A 2OZAB 5IT9K 1U54B 1H0MA 3QRJA 1UFMA 4EHVA 5EHOA 3TZMA 3Q96A 3FXXA 5J1VA 4MBLA 3MFUA 2R7FA 5IEXA 4RQVA 5HU9A 3KFAA 1OIYA 4I3ZA 3CCNA 1OGUA 2GZWA 2RKHA 4XBFA 3NUUA 4A6EA 3F8CA 5EKOA 2OIBA 4G2FA 3UGCA 4IHTA 1KV1A 4L7SA 1K2PA 5M56A 3BWGA 4FV5A 4CVAA 3P0MA 2RL5A 4AZTA 5F20A 4O7TA 4AVPA 4H3QA 4DEHA 2MH9A 1NW1A 4O21A 4BY9E 4EKLA 5HGIA 4L68A 2EFNA 3SGCA 4ZTHA 2XEZA 3LCKA 5FEQA 1V4RA 4IB5A 1YTYA 5BVFA 4HLXA 4YP8A 4ALUA 5A4CA 3TDWA 3KP3A 2NYXA 3DXPA 4EL9A 3KCKA 4EQCA 2BRHA 5K4JA 5LMKC 2QR7A 2LKPA 3HUGA 2OJFE 3CEKA 3FLNC 2VGPA 3QZHA 4HVHA 5CU0A 2D1HA 3FMEA 4QYGA 4YZMA 2FNAA 2M1BA 4YMJA 2IVUA 1KQ8A 3KEQA 1PYXA 2WEIA 4CKRA 5I9XA 4GKHA 4CZTA 1J7KA 2WEVA 3Q4ZA 2XA4A 4KINA 5FWKK 4E93A 2LDUA 3SD0A 5CSHA 2A3SA 3EQBA 4R1YA 4ZZOA 4QNAA 3R9HA 4R3PA 5EM8A 3QQKA 5ANJA 4LOPA 2OD5A 3A60A 1UWJA 3ZOSA 3IK3A 2QHNA 5HS7A 4CFUA 4D2RA 5DD4A 1REPC 5AM6A 5L3FA 2IZUA 4FTNA 2V55A 4M13A 2DQLA 4BDDA 2CQKA 3AT2A 2AUHA 2OIDA 2X2LA 4KN7X 3BWFA 3PIXA 2OXYA 2XIGA 5J6XA 4ACGA 2HZ0A 4MD9E 3K5VA 4EH3A 3F72A 3VHEA 2O03A 4ANBA 3QLGA 3ZDIA 1JQHA 5HDGA 4IXPA 3SW4A 5JQ5A 4QMUA 2ACJA 4Q48A 4A9YA 2JIIA 2PE0A 3GCQA 4YURA 5DBXA 1H1SA 4CG9A 1W83A 4TYEA 2GXBA 4AT3A 4GH2A 2Z33A 2CGWA 2VT2A 3UIUA 4RVKA 4A2UA 2XK7A 4YTCA 1AQ1A 4XHKB 3FZRA 3R1YA 4S31A 4NHJA 3PRIA 3GVAA 3KMWA 3DAEA 2X2KA 2YM4A 5HNBA 3I81A 4TRLA 5EM7A 5BPYA 4WG3A 5KHWA 4ZTNA 3DCVA 5TOZA 1ZWSA 2C6EA 3ZMSA 2IZTA 4OTGA 4EWHA 3QTXA 2MBFA 1KA8A 3OXZA 1ONVA 1JKKA 1S29A 2F7ZE 3A8WA 3I5NA 3ENMA 4IRGA 2RIOA 2M45A 3CO6C 3O3KA 4ARKA 2Z5UA 4LRKA 3O17A 3NMUF 1J91A 2UW7A 2V0DA 2W0JA 4CV8A 4MH7A 1BBYA 3EN5A 3KXNA 3FSKA 4M7IA 1U8RA 4G94A 3EN9A 4G16A 2Y6OA 3KC3A 2CKQA 3F5UA 1TKIA 4WUAA 5EM5A 3M2WA 3TG1A 3BPVA 4FUXA 3R2BA 1L8TA 2QOIA 3CTJA 4R8HA 2G2IA 2XK9A 3H9RA 5EW3A 4FKPA 3U6JA 3QHRA 3ZMDA 2YM7A 1XH7A 4QMPA 3BHHA 1JHHA 1ZRCA 5E8WA 3V5WA 3RGFA 2EB2A 5CAUA 4MXOA 3TI1A 3R7IA 3QD0A 3RHKA 4FTTA 2W4KA 4OU0A 3ZLXA 2RV8A 4J71A 4E6AA 2I0YA 4NU1A 4XG3A 3W16A 3WI6A 1S9JA 4IMYA 2YM3A 4DLIA 1OBGA 3DEUA 2GNHA 2REIA 4JXFA 4QD6A 1HOWA 3I6UA 3BQRA 4RJ6A 4ZP5A 3KK8A 3GC0A 4FTQA 1FMOE 3PQJA 2QQAA 4EORA 3F8FA 2Z60A 2JITA 4QYYA 2VTRA 3GOPA 5HCZA 1PXLA 4DITA 5TO8A 2LAVA 3CLOA 1ZRZA 1ERKA 4C4HA 3COHA 4ZZNA 4BKJA 3TNPC 4XG6A 4RVMA 2RVCA 5CJ9A 5CEKA 4TYGA 2RFNA 4FSRA 4N9IA 1PXMA 1RUOA 1YDRE 2EFQA 4LMYA 4EOKA 4I2OA 2GAUA 3QU3A 5H6QA 4ITHA 4E20A 4D2VA 5HHWA 5C27A 5FP5A 4EQQA 4NL0A 3V4GA 4XBRA 2FNPA 5JFXA 3C13A 4FEVA 1V0OA 4BDEA 5ED4A 2ZJ2A 2UZNA 3PZEA 5L2QA 1W8CA 5EHYA 5KZIA 5AAGA 2W1ZA 3OZ6A 4S05A 1QCFA 3Q4TA 1R00A 4MNUA 5DR6A 3MFTA 3V5LA 3FMRA 2W1DA 1U5QA 5ETFA 1FPQA 4U45A 3HZTA 1Y8YA 3U6IA 5BUJA 3R2YA 3BZ3A 4EC8A 5FDXA 2VX3A 2G15A 1QPEA 2EFPA 3OFMA 3RYPA 1IAJA 1TNTA 3FI3A 3W2SA 2P6SA 4RX8A 2R3QA 4JRNA 1YWVA 3PY3A 1CDKA 5F64A 3Q52A 4XX9A 5KNJA 1FYMA 2ZV9A 4HOKA 4R1VA 3FKOA 3S3IA 5BYLA 3V5TA 4FV4A 4Q9SA 3W10A 4W4YA 4UXNA 1ZYLA 5I3RA 1OL6A 2ITUA 1Q8TA 3ELKA 2VWIA 4K6ZA 5H6RA 4NW5A 3KA0A 5AV2A 1LDKB 3MWMA 3I58A 4FODA 4CKJA 3LA3A 1OPJA 4AW5A 3T5XA 3IW6A 4WF2A 1XMAA 4K1BA 2BRBA 1K6OA 5J9LA 2XF0A 1Q97A 3RK5A 4XH6A 5HD7A 4V0GB 3DBQA 3CP9A 3IKTA 4ZH4F 5IQIA 4E5AX 3TNHA 5EI2A 2WQOA 2F2UA 4ASZA 3FI2A 4BHPA 5IZFA 3U6HA 1W5SA 5LVOA 2XKCA 4ASEA 4BTJA 3W33A 5GIPE 3LFSA 4DFLA 5ACBC 4CFWA 3PFQA 5CVVA 3FZOA 3PXYA 4XV2A 3EL7A 3LLAA 5JI6A 1H28A 3KRRA 3SXRA 2IP2A 1PKDA 2BYVE 4RLLA 2VNWA 4Y83A 2GTMA 4QLCU 2BCJA 3JPVA 3FL5A 2EWAA 4BL1A 5D10A 3RZBA 4FNXA 4NM5A 5A9UA 4ENXA 2UW8A 1H27A 2FSWA 3BIZA 3D0EA 4Z16A 3ZO1A 3ZH8A 3QWKA 1M2PA 2X7OA 2OW3A 4BWPA 1G8AA 4R5YA 3KP5A 1TQPA 4M68A 4EWQA 3DFAA 2C0OA 2HY81 4V04A 3WF9A 2C68A 3MB7A 3F5PA 1IW7F 3OF0A 3FYKX 1LEBA 5E9EA 3BYVA 4C33A 1JNKA 1P14A 1XJDA 1GZKA 4QTAA 3WF8A 2DT5A 3WZJA 3QX2A 1ZMWA 3SG8A 3ZMVA 5IQFA 1YW7A 5E91A 4ZZLA 4GUBA 1UV5A 4F7NA 5DEQA 3JTGA 3DQWA 3DJ7A 3NNUA 3FF5A 3R8VA 3VUHA 3E8CA 5AUZA 1RI7A 3WU1B 4Y95A 4GK2A 4RC2A 3RJPA 4CZZA 1P5EA 4HPTE 5M44A 4EK6A 4OINF 2HOEA 1STCE 1YIOA 3Q9VA 4TTHB 3LCOA 3TIZA 5D8LB 4NTSA 3C1XA 4ZYGA 4KIPA 1BMKA 3T8RA 3EL8A 5TRDA 3R4KA 3MTLA 4WNOA 4QRCA 4BZOA 2OU2A 3LFNA 3MQ0A 4LGHA 5DUIA 5AMNA 3K1NA 4YIFA 1IZ1A 4M67A 3WTWC 1PRYA 3VODA 4R77A 3QUDA 2UWMA 3A62A 2ESNA 4GG5A 2YAKA 4DGLC 5E8ZA 5ANKA 3VQUA 4X0MA 3O71A 4RGXA 3BYSA 3ZSIA 2W24A 4QPSA 4DH8A 2OGVA 4B8XA 3AC8A 5CYIA 3HMPA 4Y73A 2PLYA 2WOTA 4KYWA 3AC2A 1H9GA 5JK3A 5HICA 2A69F 4O27B 3B8QA 1V1KA 4K33A 2CKPA 4FE2A 4RJ8A 1Z57A 4RFYA 2IT0A 2NNWB 2P55A 5H2UA 4O0XA 3JY0A 2E2BA 3UZTA 4RT7A 3V7CA 4QNYA 3TJDA 1PMUA 1O7FA 2WOUA 2DI3A 2VUWA 4DBXA 4EJOA 2HZTA 1D5VA 1O6YA 5EDRA 5KKRC 3KN5A 3RK7A 1T38A 3H9FA 4RQKA 3U4WA 4CGAA 4ZJJA 2UXXA 1F3MC 2E7XA 3JVSA 3FZTA 2W06A 3H3UA 3A4PA 5LHGA 3QD3A 4A0XA 2QU6A 2ZO4A 4DC2A 2QD9A 4IH8A 1FWZA 2HY0A 3EH9A 2IW5A 4CXFA 4FIGA 3EYIA 2BAJA 3EDPA 3FMLA 2YABA 1HW1A 1YW9A 1YKRA 2YM8A 3V3VA 2VN2A 3OBGA 2WD1A 3WG9A 4E7WA 2XAHA 4NH1A 4OBQA 3ZC6A 5D6FA 2XYUA 3VF9A 2QOBA 3KCCA 5FLXZ 1UU3A 2R0IA 4DFYA 1QZZA 4PPBA 4TYHB 5FDPA 2NAZA 3E5AA 5JGDA 2VTSA 4BCJA 2RGVA 4NM0A 2ITQA 4QMOA 4IPAA 4HCTA 1CMKE 2ZB0A 2QVSE 4X3FC 4L52A 3E62A 3IRRA 2OZAA 2ZV7A 2PZ5A 3K69A 5E1XA 5LCJA 3B2TA 3OUKA 4W8DA 3D5WA 2VONA 4MTDA 4NK9A 3CGOA 2GQRA 3SXYA 4CLIA 3FZVA 3CS9A 1YRPA 4YIIA 1KQ0A 5K5OA 3SX9A 4FG7A 3LFCA 3OOMA 3GWZA 3NZ0A 4YC3A 1J2XA 4MX9A 2IA1A 4KIBA 4F6UA 5LJJA 4WOVA 1W82A 3JUHA 1XBBA 2R3IA 3R0JA 1MGTA 5I4NA 3C0HA 1WBSA 2R4BA 3UDBA 3UNKA 4YZNA 3Q9ZA 1DM2A 3RPQA 1QMZA 4A7CA 3P23A 5G6VA 3ISPA 5FXRA 4BYJA 2QQBA 4K2RA 4TYJA 5BYZA 5D5VB 2CNUA 1IN5A 1NHAA 4KSPA 2PZPA 5BPDA 3PTGA 4YJQA 2UZBA 1RNLA 4V01A 3NW7A 3NX8A 2J5FA 4O0YA 2AXLA 3TV4A 4BIEA 2BFYA 2VN9A 1ULYA 3QCXA 4YNEA 2COMA 4O0RA 5JHUA 4O5VA 5CAPA 1UNGA 2PULA 2CGXA 4GSBA 5HBHA 4EKKA 2UW4A 4D2TA 3H10A 2WIHA 4HYHA 5AX9A 5CEIA 1BX6A 1KE8A 3A61A 5CALA 5K5NA 5J7BA 2WTEA 3I1AA 3MWUA 4Q5HA 4TYIA 3UG1A 3AC1A 1SVGA 3QTSA 4BWKA 4KMUX 1Z6RA 4BDIA 1M17A 5DNRA 3EFLA 5LEKA 2XM9A 4QP7A 1RZ4A 3ZXTA 2H8HA 3BHTA 3KFWX 3AGMA 3V6RA 5AIPA 3MH3A 5C8MA 1L3RE 3TL8A 1E1VA 2LF8A 4BCGA 2X9FA 4YG2F 2W4OA 3GFJA 2J5EA 2QG7A 4FKUA 4EJTA 1M14A 3S0OA 4PWNA 4FSZA 4F0FA 4ZSAA 3GQIA 2VTNA 4WXHA 1B9MA 4M14A 4GKIA 2GNFA 4DGOA 4DTAA 3RK9A 4C3FA 2OWBA 5HZNA 5BVKA 4GYIA 3UG2A 2X4FA 3W2RA 5LHHA 4GEOA 2OH0E 3TT0A 3LWFA 3L1SA 4AD9A 3BGQA 3L8PA 5CXZA 2YIXA 4JG6A 2O65A 3P86A 4DTBA 1GXPA 1PKGA 4GIIA 3R04A 2X2MA 2VO6A 5CF6A 3GCUA 3QUEA 2PI0A 4M69A 1VR2A 5IH5A 3WYYA 3UOLA 3K9TA 1HQCA 3C4XA 4GIHA 2B55A 2ITOA 4G7OF 4Q5EA 4I1ZA 4X2JA 4HV5A 2W7XA 2V1UA 4HX8A 2YM5A 3VF8A 2QBYB 3TTIA 5C8NA 5AR5A 1U4DA 4MEXF 4R8QA 4RG0A 5KE0A 3GUBA 1QZYA 3HMMA 3QWJA 3JVRA 3O2MA 3R63A 4FR4A 1PY5A 2Q8KA 4C58A 3KXGA 1MJAA 3CDHA 5F1RA 3DTWA 4KIKB 5BVWA 1R0EA 1Y6AA 3HTUA 2VWYA 3R8LA 4EI4A 3UE4A 2WMWA 3VRYA 5IF1A 1BKXA 3RKYA 4M73A 2B0LA 2XHKA 3UOKA 4QP2A 2C5NA 3QGYA 1Z9CA 2VC0A 1XD7A 2GTNA 3IW7A 1B1BA 4NCTA 3PJ2A 3TJCA 3LAPA 1SD7A 2NRAC 2VTIA 3SV0A 1BL7A 4QP4A 2QUFA 4EBWA 5LQFA 3S2PA 4GCVA 3AC5A 4ONAA 2IVSA 4GUEA 5C01A 3QU6A 4G8XA 5E7RA 4M12A 2CYYA 1RJBA 3GENA 3SQNA 4PX6A 3QL8A 4JT3A 4R7HA 3O7LD 3W2QA 1J7IA 4N0SA 2GFCA 3KN6A 5IEVA 3FEGA 4FT9A 2V6CA 3EQFA 2FUMA 2QURA 2DK5A 1ODDA 4O84A 3QD2B 2O3PA 2C6OA 1G8SA 1ON2A 5HI2A 4F09A 2Z3YA 3I60A 1BLXA 2WIPA 5HLNA 4J98A 3ALNA 5HIBA 4XP3A 3ZM9A 2ERZE 4DH1A 1XSXA 3EETA 5E8GA 5CY3A 5DE2A 3AXWA 2WQEA 3HTSB 1R39A 4FTRA 1Q8YA 4NJ3A 3HSFA 2OQGA 1BC7C 4KRCA 5M57A 5JRSA 3CKWA 4WWCA 3SDJA 5F95A 3BP8A 5IMXA 2YDJA 4G3DA 4G3FA 3AD6A 3LAUA 4CD0A 3OVVA 4XRLA 2XIZA 3ZRKA 2PUUA 3ORXA 3RKBA 3QBNA 5H20A 4EOJA 2JEDA 4KT5C 4A6DA 2R3GA 1OM1A 3UNZA 3QCQA 3E6DA 3LAJA 3HRCA 4E4XA 2B1PA 4I0RA 1P4XA 3VUDA 2FRHA 3QCSA 4M15A 4DEGA 2E9VA 4O6LA 3HV4A 2CW0F 3QKMA 3WIGA 3ET7A 4S33A 1YOJA 2J7TA 2QM3A 6PAXA 2M30A 2WAJA 1H01A 3AD5A 3J81K 2YJSA 2QOHA 1F4KA 2BZKB 4MEDA 1LDJA 4WCGA 1R0PA 2EUFB 4EK8A 2QLQA 4HA8A 3DJ5A 3HAMA 2A27A 2ZFWA 3IO7A 1YXSA 4LUDA 4DGMA 5AA8A 2XKDA 4XLNF 5AP5A 3RWPA 1FY7A 2ITNA 2ZM4A 2PN6A 3I0TA 1JAMA 4RWJA 4F0IA 3Q53A 4K9YA 4HW7A 4G7HF 2ZKZA 1VYZA 1G3SA 5DA3A 5AUWA 4OIOF 3OY1A 4AXAA 3DKOA 3PG1A 2Y4IC 3FXUA 5IPJA 4C8BA 2R0UA 1KV2A 3QTIA 4FKQA 2HCKA 3U4UA 3IWZA 2KIFA 2QOOA 3QTZA 1R1UA 2D2WA 3D4QA 2GIVA 4JIAA 3OOPA 1YDTE 3VJNA 1MRVA 4DEDA 4RFMA 2P2IA 4BIDA 4RC4A 3MH2A 5DEWA 1MKMA 4UVAA 3GU7A 3ZS5A 1A48A 2UW0A 3I7CA 2QKWB 2F5CA 4C59A 1Y6BA 2IZRA 3GZ5A 4PP9A 4WUNA 3F23A 1ZG5A 4FZFB 2JLDA 2H9VA 1OL1A 4IX5A 3TOAA 3AMYA 4IC8A 2V22A 1CKIA 5JGAA 3NUXA 3L8XA 3UZPA 3D94A 4BTFA 4OTDA 4YZCA 2VTJA 3C4FA 3K1MA 1G3NA 2M8EA 1WCCA 3POOA 2NRUA 1LR4A 1SFUA 3EKNA 1H1PA 3ENHA 2BTRA 3PVGA 2OKRA 1D8KA 4PGHA 3E6CC 3NW6A 4UWBA 3A7GA 3W8QA 4EK5A 3QQLA 3MGYA 4IRIA 4TNDA 3Q9XA 4KABA 4NKAA 4JLCA 3LXNA 5EFQA 5DN3A 2WU7A 4IJ9A 4C4GA 5A4EA 2W99B 4CNHA 1FBNA 3CJGA 2RG5A 1U5TC 3R9RA 3GCSA 3NWWA 3I5ZA 2XBAA 4DFXE 3SRVB 4IJPA 2PG4A 3GNIB 3V8SA 5IQEA 5ICPA 3V5QA 2UVYA 2R2PA 4HW0A 2VBYA 1OKZA 3F3TA 3Q6UA 4XRJA 3MIYA 1YI3A 4ITIA 4JQEA 4FKLA 4C3PA 2J0MB 1WVYA 4RIWA 4BKZA 2B54A 4AT4A 5D9HA 4O7ZA 4C4FA 4LMUA 3WZKA 1DPUA 3E5QA 5D41A 2HIWA 1OPKA 2PL0A 2W17A 2W25A 2VNYA 1FBSA 3F2AA 3W2CA 2D45A 1T2KA 1L3LA 5L2TA 3G73A 2H27A 2FA2A 2EXEA 3EFJA 1GIJA 4I92A 5DI1A 2R3SA 4WG4A 2WMSA 5BNJA 3ZMZA 1FYKA 4RWIA 4Y46A 3E5XA 3LCDA 3B2WA 2QYOA 2JZYA 4YPDA 2RSVA 4M6XA 4QP9A 3WODF 5L3AA 2VAGA 5ICGA 5CVRA 3VUGA 3IKVA 4FZDB 4H3BA 5CXHA 3CUQB 2JSCA 5AIRA 4I41A 4JDHA 3UP2A 3GW2A 2X39A 3VBTA 4JR3A 2XVDA 3FWQA 5CI6A 5LRSA 3GFEA 5ACKA 4FNWA 4FTOA 4GVAA 1SD4A 2GPHA 5TF9A 4AWIA 3KKVA 4AQCA 4DGGA 3ITZA 2OF2A 4LLLA 4KIGA 4OTHA 3ZTXA 2R7IA 4F1OA 3SZTA 3F88A 2O5KA 3Q9SA 1YO5C 5EI6A 3CBLA 5FD2A 3MH0A 4AW0A 3DK7A 3GT8A 3DKCA 4B4LA 1WBWA 4GRBA 4U40A 4FC0A 4TN6A 3P9JA 3P7NA 4U7DA 2NNNA 4L9IA 3E3PA 4FSMA 2RF9A 4BYYA 4G9RA 2HFHA 4RX5A 4AGUA 4JQ8A 3QTUA 4C0TA 3FMQA 2UZTA 4P55A 5D7AA 3DU8A 2YLFA 3ABTA 5A54A 5IISA 2P8TA 2XCHA 2HW7A 4A12A 1PP8F 3COMA 4EOQA 4O0TA 4PL5A 3A7IA 4D5HA 5HO8A 3BV2A 1H1RA 3NCGA 4X2KA 3DV3A 4D9UA 3BQCA 3VS1A 5FTOA 2J5OA 4TV7A 2IO6A 1PHKA 5FEEA 4CMTA 1UU9A 2GU8A 4AX8A 5CU3A 5DDGA 4J97A 3ULQB 4F63A 2GS7A 2HGCA 1OKVA 4ZLOA 2JD5A 4F0GA 3ZP5A 4G9YA 4FNYA 2QOLA 3PJ3A 3HP5A 4UXQA 2L01A 3C4EA 3VS3A 2XASA 4IWDA 4B0GA 4HJOA 5EYMA 4L0YB 4EYMA 3QXOA 2GSFA 4PDSA 2QR8A 3TOBA 2JTVA 1M52A 3DKGA 5E1SA 3OS3A 4IHSA 2Y6MA 2C3JA 2HWVA 3FM3A 4LUEA 4FL3A 5ICCA 1B6CB 2GS2A 4U44A 4Y8DA 2CGVA 3E93A 4ZTLA 2FSOX 5BYYA 5IA1A 2ZMDA 3EKKA 4R5SA 4YZBA 3SG9A 1FINA 4M9SA 3GGFA 1O7LA 2VD5A 2ISYA 4C3RA 4YHTA 4F70A 1RIOH 3EN6A 2FSTX 2PYWA 2P5KA 3R73A 5CNNA 5FO5A 3TXOA 4A9SA 5J8IA 1PXOA 4O0SA 5AONA 3GEQA 4FV7A 1QPDA 2HXQA 2QO7A 2P4IA 5IUGA 4HX4A 3NEWA 5HG9A 2STTA 4N57A 2K4JA 4XG4A 4ERKA 3LJ1A 4JDIA 3DB6A 5I0BA 4E6DA 4DH7A 3BYUA 3ECOA 2HQRA 4J8MA 1M7NA 2JKQA 3PE1A 3EIDA 4YHJA 5LGTA 4HVIA 4AACA 2C0IA 3OTVA 5BVNA 4E8AA 4ACMA 2Q0NA 4NEUA 3R7EA 3BE2A 3CIKA 4CMUA 4IF4A 2OJIA 3R0AA 2ZMCA 3VNTA 3HSEA 4G5PA 5AIQA 3QZIA 4F7ZA 4P5OA 1IA8A 2AS5F 2CPKE 2V5QA 3R8UA 3R83A 3LFKA 2BRNA 5EYDA 1BL6A 4WNKA 3DZQA 4M9XA 3N51A 2X7FA 5CZIA 3ZN0A 4PNIA 4R78A 3QQGA 4RGSA 2MLKA 2JKOA 5D12A 3ZUUA 2WTCA 5IT3A 4HV6A 1OUKA 2STWA 4BHCA 2CLXA 3RKXA 3KVWA 1DAWA 4O0UA 2DW4A 2PVLA 4FKOA 1M2RA 4RGRA 3FV8A 3AC3A 5CI7A 2UZLA 1SVHA 2ZMEB 4IX3A 3F66A 2FB8A 1H4LA 5LGNA 5HTIA 3ZMUA 4IX6A 4YLJA 1XSVA 4D0XA 4N6ZA 3DKWA 4C38A 4FV1A 2D1VA 1DDNA 4KFCA 3R1NA 2A19B 4UZDA 4F64A 3WTXC 4QMQA 5G1XA 3EQLF 4L9VA 2WMVA 1OKRA 1LEAA 2UZWE 5KX8A 4FT5A 2VO0A 4EJVA 3G51A 2QODA 4XG7A 4OMZA 1G4DA 4JRVA 4QMXA 3FMJA 5AR8A 4CV9A 4QQCA 2DQ7X 2O6GE 2P7VB 3E97A 4FKWA 2W5HA 2ZNZA 2F2EA 2RN7A 4LLNA 4MVFA 1Z91A 2XNOA 3D83A 3ORIA 2JPBA 3F7WA 4OT6A 4LI5A 2WQNA 2YJRA 4I22A 2L54A 4CT2A 3UPXA 5CVGA 3V8JA 4YGAA 3FHIA 5KMLA 5JZJA 2CG4A 3LJ2A 3TCPA 5BMZA 1XHAA 4YO4A 4AOTA 3P7BA 4GT5A 5K0KA 5HVYA 3GCPA 5CVIA 4KIKA 3C1DA 3Q4UA 4A4LA 1Z6TA 1OMWA 3GVUA 2EA2A 4L9NA 4FX3A 4IW0A 2PEXA 2B52A 4GK4A 5LWMA 4Z9LA 3ETAA 3LVPA 3ROCA 5EOLA 3PJ8A 2ITXA 4YLLA 3IOPA 1ZLTA 3VBWA 1MZBA 3I53A 5DT0A 1P4WA 3CTAA 4F9AA 1ZOGA 2FE3A 3DDQA 1S9IA 3TTJA 4YC6A 4JG7A 3PQKA 1LDDA 3NUSA 3VO3A 4M0ZA 4I6QA 4GU6A 4HGLA 1H24A 1KE6A 3NIZA 1BIAA 3QFVA 4OTRA 3GO5A 4E73A 2ISZA 3AT3A 5A3XA 1B9NA 5BVEA 3BRBA 4CYIA 3AAFA 5CSVA 2GNIA 2EJRA 3UVRA 4C02A 5HD4A 3P08A 4IWQA 4HZSA 1TLHB 3R7VA 5E4HA 2PFBA 2MH2A 3ZLWA 1WVXA 2F7EE 1NA7A 2YLEA 3KULB 4CFXA 2ZV8A 3ZO2A 3E3VA 4MK0A 4YSJA 3WZDA 3C5IA 4FG9A 2UZKA 4BI2A 1I1GA 3VS5A 4WXCA 3HRTA 2QI8A 1A9UA 3LOKA 4ZYEA 5AUTA 4WBOA 5LCKA 5HNIX 2R3RA 2XB7A 4AE9A 2DBBA 4HF1A 3NEUA 4O0VA 2VTLA 4HF0A 2BGCA 5LEJA 4M8TA 4M84A 1KSWA 3W8LA 1WFCA 3TV6A 1XH9A 4FX4A 3NAXA 3RP9A 1OL5A 4XSZF 3HVCA 5LVPA 5AX3A 4OBOA 3DOGA 2BE5F 2E7WA 3CJFA 2W1EA 4O83A 2BUJA 3BGPA 2JRTA 2HW6A 1OUYA 3LFBA 3BV3A 4KBAA 4F9YA 3WE3A 1YW2A 4IVDA 2QU5A 4A9RA 4N6YA 2XV4S 2YFXA 2OFVA 2C3IB 2WMRA 4X2GA 5FEDA 5L6PA 5I9YA 3FMHA 4RWKA 3KEOA 4I21A 2BILB 3BCEA 3HRUA 3M9AA 1K78B 3PPJA 1W5TA 1MQBA 4ZK5A 1JSTA 4FV2A 3COIA 3RALA 2ZV2A 4C36A 4MWHA 3N4TA 5EK7A 4E5BA 4HCVA 4M74A 3TDZC 4HDVA 1GJOA 2XJ0A 4DEBA 2G7UA 5DT4A 4YJOA 4FSYA 4M97A 4O7NA 2O8XA 2YEXA 3U9GA 4U7ZA 4WIHA 1G3YA 3MY1A 4K2EA 3QZFA 3R71A 4YFNF 3N9XA 3HV5A 1GHCA 3F3ZA 3V8WA 3VW6A 2OAZA 2BRGA 2O0UA 3F3VA 5FRIA 1Q24A 4LG4A 1Y0UA 3M8EA 3I5UA 5EM6A 2WTWA 4O2PA 4ENKA 1QPJA 2VO3A 1R5HA 5AA9A 1Q3WA 3A7HA 1OR7A 1YWRA 1LQ1A 2J0IA 3LJ0A 4YJUA 3ODZX 1UHWA 2ZCWA 2SRCA 3R28A 1GZ8A 4B99A 3L7WA 3L9LA 4GT3A 2G1TA 4PNKA 4Q4ZF 3C7JA 3F21A 1RUNA 5BUEA 4JBOA 3QLFA 3Q04A 3CY2A 4AW2A 4ASXA 4CLJA 4BBFA 2WQBA 5AUXA 4RZVA 4USFA 4RMZA 3QF9A 4HGEA 3Q9WA 2PE2A 4ANQA 4PUZA 2YIYA 3WARA 4AT5A 4IAFA 5K5QA 4KA4A 3FMMA 1QNTA 3WU0A 4M9ZA 5L3EA 2PY3A 1HXDA 4O86A 2MC3A 4GFOA 3GX4X 4EUTA 1SNXA 4DH3A 2CJMA 4IB0A 2ELHA 3GCVA 3PVWA 4O3MA 4HOBA 3D5UA 1YFHA 4FKGA 4FTKA 5LXMA 2FMYA 2PE1A 4WKQA 4L9TA 4P9UA 3OWLA 2H6BA 1XH5A 4FEWA 2IPQX 2OBPA 4ZLZA 4G6DA 1M7QA 4JBPA 1QO0D 3KEXA 3OT8A 2DS1A 2EXCX 2C0TA 2W1FA 3KXXA 1JKLA 2R3HA 2V7OA 1VZOA 3TV7A 4TL0A 3PSDA 4LFIA 4DFZE 3FMKA 1P4FA 4OIPF 2O8YA 2YZLA 3IPHA 3EN7A 3MVJA 3FHRA 1XBAA 4C35A 2JFMA 4G34A 3Q5IA 5LGUA 5HCYA 2XYNA 2V1XA 3QC4A 3OV8A 4I98B 4FVRA 3LM5A 2JDRA 2IW6A 3UIMA 3JAMK 2BHHA 2XKOA 2FSLX 1G3TA 1KOAA 4RB1A 1Q62A 2IJMA 5DHJA 1WKMA 5CS6A 3COAC 4QPAA 2GHMA 5JFWA 2ZM1A 1FOKA 3HOSA 2PHKA 2YX4A 3TO7A 3ZEWA 1XQZA 4KKEA 4JI9A 4QMMA 5DRDA 2HTSA 3MDYA 4BYIA 2PTKA 4MWIA 3KF7A 1MJBA 5DMZA 2JIVA 2XM8A 1B38A 2WU6A 2CGPA 5D5UB 3ZRLA 1O3RA 2P7CB 4HNFA 4LRMA 5ITAA 4HAMA 5CVUA 5LMBA 3P9IA 4MXXA 2VTHA 1T45A 4AZFA 5C8KA 3ATSA 5E17F 3KZYA 1HCKA 4EH2A 4NM3A 2B0QA 2WMXA 1Y8GA 4Q5SF 4H1MA 5CQUA 2V9VA 5DR9A 3TKUA 3TNWA 4I5CA 5BOXA 4GK3A 2WMQA 4OGRA 3ORTA 4EZ5A 5CEMA 3OWJA 3KXMA 3MB6A 3B8RA 4RGJA 2BDWA 2VTPA 2QQ9A 4QMTA 1R78A 3KGAA 1Z7UA 3TO6A 3RM7A 3G5DA 4E4LA 4E26A 3R30A 4XUFA 5GJDA 4IADA 3V8LA 4FV3A 4EOPA 4FTJA 4CZYB 4UV8A 4FKVA 3T1BA 1M2QA 2Y4PA 4UMRA 2H34A 2C6TA 3F8MA 3VN9A 3R7OA 3MZHA 4BGGA 3C0GA 4X3FA 3EQIA 5KO1A 1NT2A 4EM1A 3GC7A 2E9PA 3H3CA 2YZAA 3CPCA 1PXNA 4HYUA 3O51A 5LLQA 2I0EA 4O7VA 4YBJA 5CEQA 2OO8X 4FTUA 2ITTA 3F8BA 3GZ6A 1SMTA 2RFEA 4AW1A 2Q0OA 3Q2MA 3HDNA 5HE2A 3BY6A 3FZSA 4HVGA 3L00A 3TACA 4LK0F 5BVOA 5A2QK 2XAGA 3D5VA 3MPMA 3P1AA 5HX6A 3LW0A 3LSTA 4H1JA 5IA2A 1FBQA 3G0EA 3OXIA 1MJ9A 4XLVA 4XG9A 5AP0A 2UW9A 3Q2JA 3DJ6A 5JKGA 4UZHA 4N70A 1NVQA 3K1PA 2BMCA 3FAAA 4R6VA 1NVRA 2IPXA 3PE2A 4ANMA 4TWNA 3MBLA 1FNNA 1Q3DA 4Z7GA 2CO5A 4D2SA 2WTKC 3OWPA 3HOTA 4HBLA 4PL3A 3PXQA 3HUCA 3R7GA 2P5VA 4UWCA 3UMWA 4GGGA 1Y57A 1DAYA 4BCMA 2BEOA 1CKJA 3ZFMA 4S30A 2YWPA 2PBIA 5IQBA 4I6HA 3SHEA 2W85A 3MI9A 2PVNA 2VWXA 3VC4A 1H00A 2K02A 1IXCA 2QQ7A 3LCTA 2HQNA 1OL2A 1O3SA 4KBKA 3FKNA 1MP8A 3NYNA 3FLWA 3R9NA 3UO6A 3ZEPA 1H1WA 4WG5A 4IAYA 1C0WA 5IQGA 2G7HA 3S1HA 1WBVA 4C2WA 4AGWA 1BM9A 4IVNA 3VVHA 2W57A 4YHFA 3LXKA 3TUDA 1JVPP 2PSQA 5JFRA 5F6FA 3REOA 4KAOA 4AN2A 1XDSA 4UMQA 4J96A 2X7GA 1F1ZA 1IR3A 1AOYA 2OICA 5CYVA 3GQLA 4WNMA 2VOPA 3WTZA 3JY9A 3QP6A 3VB2A 3O8PA 3SZPA 3UODA 3PVBA 2BDJA 1UWHA 1ZZ2A 2NNYA 3ZZEA 3GFLA 3EFKA
chains in the Genus database with same CATH superfamily
5M07A 4A3FJ 5D4RA 1DUXC 3DPLC 2C5YA 4YU2A 3ZCOA 3U9CA 2HDDA 1NY3A 3ML6A 4OLIA 3HP2A 1PW2A 3DBFA 1U6GA 5AP1A 1ND4A 4XYFA 1BJAA 4AGDA 2V7AA 5L8LA 5CANA 2YCFA 3J81Z 5L8JA 2FGIA 1APLC 2E2HJ 1XH6A 4F1TA 2HZIA 2HNHA 1MRYA 5LRRA 4Y17A 3HDMA 4MFEA 5EQYA 2BTSA 2OZUA 3PLSA 4M69B 3FHNA 3FLSA 2BZJA 2ZMEA 1NK2P 1P7JA 4JBAA 4IM3A 5CEOA 1X1AA 4YTHA 1D1AA 3P5KA 4AP7A 3E6MA 3W0OA 4I5MA 1T6SA 4JBVA 5GINE 5AUUA 3CGFA 1EH8A 1H26A 2H96A 1R49A 5D7VA 5LARA 4DH5A 1W4MA 1V0PA 2IGMA 3QAME 4FK6A 3GTLJ 3NGAA 5LHIA 3MPAA 3L2CA 2BKKA 5TE0A 4ZSLA 2IGNA 4WK8F 5KUPA 2RQPA 1GNGA 2OU7A 3K7AJ 4RAYA 5ERIA 4E7HA 1PMNA 4V05A 3VYTB 2VWVA 2WB8A 3S14J 5AWMA 1OCPA 2HVSA 1MH4A 5LD2C 1IV8A 2O61A 2X81A 4CZUA 4E1ZA 3O96A 4EH9A 1YHWA 5E3OA 4ZSGA 2BVAA 4GYGA 3WTYC 4HF2A 2RKUA 3V8KA 3P9KA 4AAYA 1OI9A 3BU5A 2FBKA 5HVJA 3IS5A 4K18A 3OROA 4RVTA 3F2RA 5E8VA 2R64A 3GC8A 3H0DA 4UV9A 1BI8A 2BR1A 1S7OA 3RPRA 5HVKA 4C4EA 5ETCA 2A07F 4XEYA 4ESBA 2V6EA 2VJIA 1H8FA 2JDTA 5DCMA 1UZCA 4BRXA 2HZ4A 3VRZA 4GG7A 4WSQA 2VTMA 3JXWA 5EEHA 3UYTA 3WZUA 2YX7A 1WJAA 3KIOA 4QT1A 3U2RA 1ZR4A 5EQPA 4LGWA 4F65A 3S3OA 4CSVA 4L43A 4JQ7A 4KUMA 1TW2A 3EYGA 3VUIA 4LD5A 2DPUA 4A4XA 2VOOA 2J4ZA 5HOAA 2HVRA 4FT0A 3FMDA 4BICA 4DDIA 1SNUA 1ZYJA 2BROA 3R7UA 3W2PA 2QGUA 4DF3A 1J59A 3S4QA 2OK1A 4LK1F 1YQAA 1UNLA 3PJ1A 5AR3A 3PYYA 3L8SA 2DA7A 1P6RA 2Y75A 3NAYA 2J90A 1PXKA 1D0XA 4EONA 4XRSA 4EJWA 3IAS2 5HLPA 5A6OA 5IDPA 3LIJA 2QSGX 5LVNA 5FROA 2W05A 5J1UA 2JA8J 2DA4A 3L9PA 4F3QA 4YTFA 2KIMA 2EPFA 4ZTQA 1CF7A 2I40A 1WI3A 2XANA 4F4PA 2XK3A 2QZ8A 2L9SA 2R3NA 2X6DA 5FG8A 3NUAA 2DAOA 2BFXA 4I6LA 3DBHB 2EINH 2BKZA 4NT4A 3BJOA 4TPTA 2CDZA 3KULA 4O7YA 1F5QA 4RM2A 3H0GJ 1IRGA 3C18A 2VTAA 2X8EA 5H8EA 3PUFC 4QQJA 3IHUA 3F69A 4RGUA 3KYLA 4HNTA 1SZMA 1EH6A 4KICA 5M4CA 1FYLA 2RGPA 4AG8A 3OCSA 1XMKA 2KJCA 3OWTA 3PRFA 3VIDA 3KRJA 5EYKA 3DB8A 3EPZA 4BIBA 4PJMA 3RCJA 2Y2ZA 2GNLA 3OMYA 2V1NA 1ZRDA 3PG3A 1E1XA 4DDGA 1IDZA 2CMWA 5J7HA 4QMZA 3LMGA 2IW9A 1PP7U 2A0CX 3MY5A 3O8TA 3PUPA 3AT4A 1V5GA 2XSJC 4HGSA 3M07A 5JZNA 1R7JA 4MHGA 5I9UA 5ANDA 5HU3A 1KU2A 3AKKA 2GA1A 3GF2A 4II5A 4YJTA 5J87A 2HPIA 2PVYA 4X21A 2F4OB 3C50A 2MD5A 3UMXA 4UX9A 3EOCA 1FGIA 5J40A 4NUBA 4NCTC 4HCUA 3MTFA 2YERA 2ZFYA 1MBGA 3A02A 3E88A 2FJ1A 4JX4A 3PIZA 3OY3A 5D5WB 5IDNA 4USEA 2GDOA 4EUUA 5AR4A 3FK7A 4AYBN 1Q1HA 4DNCA 2H09A 1CSNA 3MAJA 3LKMA 1Q61A 3KE2A 3VYRB 2NS8A 4E6CA 5KBRA 4QP6A 1DU6A 3WHBA 3KVXA 5FM3A 5I9VA 1KUTA 3D0SA 4I09A 2EB3A 1E3OC 1K78A 5IP9J 3BZCA 2P4WA 2BW3B 4AIHA 5BVDA 4Y52J 5DH3A 4HGTA 3QYZA 4QMSA 2GHLA 2HOGA 3C0IA 4PK4A 3ZFXA 3FE3A 3FX3A 3EQDA 3FQSA 1FZPB 4E7ZA 3LXPA 2J6MA 1I3AA 4PFPA 3CCLI 2YU9J 3AMAA 2E1MC 1P2AA 2OLCA 3J7AO 3BTIA 4FYOA 4U3ZA 3UPZA 4FT7A 2BZIB 3WF6A 3BBWA 2A4LA 3BDDA 4CDGA 2IWIA 3FJQE 4IIRA 3OYBA 2XF6A 4TWPA 3OC1A 3N97A 2VQCA 4LV8A 3PPZA 1PF8A 4RDUA 3ORPA 3RKQA 3PA4A 2FF4A 3H3ZA 2HYJA 3LNQA 4E4MA 3MKZA 1T8IA 4KIQA 2VWZA 1DS5A 4ZY6A 4XV3A 4FIEA 5HBEA 5KVRA 3BR1A 2YR2A 4OAUC 4QIWN 1OFCX 4ZOGA 4PTGA 3SXSA 3W0SA 3DFCB 9ANTA 3K5UA 2XGCA 2V62A 4O1OA 4PJJA 2P6TA 2WTJA 1EH4A 2ETKA 4TT7A 4IEBA 4ZJIA 1HW5A 1CGPA 1J0RA 2WQMA 1XO2B 5K5RA 3KLOA 5J5SA 3WHCA 3ID6C 2QONA 5F94A 3NFGB 5CT0A 4YJRA 4II3A 5AAFA 3PIOF 2FU4A 2G9XA 4L3LA 5EYRA 4B09A 2HAKA 4MHAA 2RDPA 3WGHA 1HBXG 2RFSA 3DY7A 2JKKA 4NTTA 3AKJA 1DI8A 1ATPE 1WSUA 4ID7A 5JLXA 2VRXA 2OBJA 3M1SA 4EEVA 4A5MA 4JDKA 5K0XA 2HQAA 3IONA 4BCIA 2GWRA 1OZ1A 5AADA 3DQXA 4RBLA 2P0WA 3W0RA 4BB4A 3EUHA 4DHZA 4RWLA 4E4HA 2F5VA 3T8TA 3DAKA 1TW3A 5HO6A 3K2AA 4I5PA 3UVPA 3Q9YA 4BF2A 4F08A 4PDPA 4UXLA 3KB7A 1YHVA 2ELKA 3DLSA 2K3FA 4MBJA 3JS2A 5JSMA 4HX7A 5AP3A 4I5HA 5IH4A 3RINA 5KMIA 2JK3A 2F4MB 3RNYA 3ERKA 3FLYA 2C6YA 1GIHA 2B9SA 4RS8A 5T3QA 1BR4A 3C7QA 3NVMB 5JMSA 5I5ZA 4DEEA 2DJNA 3CR0A 4BDCA 1PMEA 5FUTA 4U0VA 2JWTA 4I6FA 1Y91A 3MPTA 4RIWB 2UW3A 1S3JA 2UZEA 5HLIA 3GTOJ 1HKTA 2PQ8A 1SFEA 1W0TA 1OISA 1JTYA 2EBIA 3DU6A 4DG2E 3DPKA 1ETXA 1TWFJ 5J95A 3GTJJ 3O50A 3QKLA 3QA0A 4G12A 4Z3VA 3E7LA 4Q9ZA 2LGCA 2C3LA 3DBRB 4WD5A 1S7AA 1WVWA 4AQKA 1ZY5A 2TDXA 4FZ6A 4S32A 1J5YA 3BLAA 1W2FA 4TW9A 1GXQA 5I3OA 1D8JA 3ZGKA 2GHGA 4B43A 4BDGA 5GHVA 3DK6A 2NOGA 4JS8A 4RBOA 5KMOA 2W96B 3FZPA 4FSUA 1XX5A 4XLIA 5J1YA 4U88A 3QAHA 1JKSA 3DBCA 4OBPA 3MN2A 1O3TA 3QCYA 4CCBA 4HLYA 4FTAA 2Z99A 1X3WB 1J7UA 1VI0A 2GMXA 2EFWA 1ZGWA 1K9AA 4BDFA 3VONA 5B2LA 3G90X 3NRMA 5AUYA 2X8IA 2P2HA 5FLFA 2G2HA 2QOFA 4IFCA 2Y69H 3IW5A 2JVGA 2ERKA 4XG8A 1EKEA 4GDFA 4LM5A 3D2KA 1POGA 4I20A 3P9CA 4NJDA 5M4IA 2VX0A 3IECA 3MVHA 1WJ5A 2QENA 4A93J 5FQDC 4YIRX 4USDA 4A06A 1OCOH 4LB6B 2PMNX 4WHZA 2IBDA 3PP1A 2W82A 3RBWA 5KMKA 2WAQA 3TP0A 4RIXB 1H07A 4JX6A 5BQTA 3A7FA 5AP2A 3K54A 5B1BH 3QX4A 3N4VA 2KDZA 2H1LA 3TIYA 2CKOA 1IXSB 3DTCA 1GZOA 3BR2A 3A7JA 4Z55A 3MCZA 2Z7SA 1KU9A 3CF5F 2NRYA 4WBBB 4I4EA 1ZELA 3KX2A 3TUBA 3QQAA 3VS0A 5CPRB