1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
b'NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
molecule tags Transferase
source organism Archaeoglobus fulgidus
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
2BFXA 4I41A 2PZYA 2J5EA 3DNDA 3HOTA 3QHWA 2XAGA 3KP5A 2ZDUA 2C5OA 2GHLA 3V8KA 4EH7A 3AGMA 4BGQA 4CZTA 3VF8A 1U8RA 3PJ1A 3TJCA 3FLSA 4ZMEA 1RJBA 1GOLA 5IEYA 2IG7A 3SGCA 4IE9A 4FKIA 3CPBA 2ZMEA 4ZZLA 4RQKA 5FLXZ 2B9HA 2NNYA 2C6DA 2OKRA 1TNSA 5H8GA 3R7VA 2MBFA 1BIBA 2QG5A 4B7TA 2QCSA 1IXSB 2FEZA 2JKOA 3ORIA 3KXNA 4FODA 4RZVA 3HA6A 3FI4A 2K02A 3QYZA 3PIZA 4G6QA 2WIHA 3KGAA 4Y15A 4U0YA 3UNZA 2BALA 4RB0A 3GU7A 5DNRA 5J1VA 4MD8E 1WVWA 4XJ0A 3MH1A 1T45A 3RIRA 1ATPE 3VJOA 5IQBA 3WTVC 3LMGA 3MBLA 3GWZA 4DF3A 4YZBA 4F70A 2RN7A 2JITA 4LLLA 4H1MA 5HVJA 3VS0A 1H9TA 2PVKA 4L7SA 5AUXA 4HF2A 1W5TA 2MA3A 5H9BA 3L2CA 4ANBA 1Y6BA 5M07A 4XG9A 3RI1A 1GY3A 1FVTA 2BZKB 4O1OA 4U6RA 3ZMMA 4EOPA 3NIZA 4OW8A 3ZOSA 2ZDTA 3LVPA 2DT5A 4LGDA 4YC3A 1J3HA 2OU7A 1ZG5A 5IEXA 3HUCA 5IQFA 1QPMA 3PQJA 3FLNC 5BYZA 3IWFA 4IB0A 2WQBA 5J9YA 3VHKA 1OPCA 1YO5C 4G1WA 3BYUA 2FNPA 4JIKA 4PDOA 3D14A 5JRQA 5KMLA 3UPXA 3UMXA 4FKSA 1OYYA 3KEQA 4B8MA 2O03A 3ZLWA 2LF8A 2VONA 2CHLA 1WRJA 5AV2A 3NRVA 3RCJA 2BBYA 1HCKA 4AA5A 1V0BA 1JQHA 2IVMA 5FGMA 4EVIA 2OW3A 4NWMA 3IKAA 3BGZA 4MK0A 1YHWA 1K6OA 3RTRA 3E8EA 5CYVA 3UE4A 5KKRB 1F3MC 1OI9A 4MBIA 3W32A 5HO7A 4O7LA 4JJRA 4ZTHA 4FTRA 4FEUA 3BE2A 5HNIX 1UU9A 3HSFA 4YLJA 4DT9A 1WI9A 4EZ7A 3J7AO 4PP7A 3HAVA 3BCEA 1DPUA 2JPCA 2WEIA 4EGYA 1Y8GA 2C3IB 5DD4A 3VBYA 4U0WA 2O8XA 4DBXA 4FBXA 5LHHA 4ZSJA 2UXNA 4X0MA 3C5UA 3DK3A 3QD4A 4EOQA 5BUIA 2CFXA 4L46A 1K3AA 4HVGA 5HHWA 2CCHA 4G9YA 3HSEA 4OGRA 3OZ6A 1FBNA 4QWQA 5HD4A 3SC1A 1Q3WA 5C8MA 1TQMA 5ICEA 4FSTA 2P55A 3I59B 5HS9A 3IO7A 3IDBA 3PJ2A 3DPKA 4PPCA 3RPRA 4E4NA 4L5IA 3DU8A 3KULB 2XRWA 2YCFA 4OTQA 3VS5A 5AFVA 3D7TB 4M0ZA 2ITZA 2L4AA 4RC4A 4TKSA 3IW4A 3V5WA 3MFKA 4GL9A 4FYOA 5ETIA 3AMBA 3RM6A 3LA2A 3FXUA 2XK3A 4O83A 3DKGA 3EOCA 1ZGJA 3W10A 3OUKA 4JQFA 3BQCA 3O8UA 1YKRA 1KU7A 4BDGA 4U45A 3BLHA 3NNWA 1H8FA 3WILA 4OTRA 4M68A 1PMNA 3CY3A 3EQPA 3NLBA 2W06A 2GSFA 3TO7A 4GUEA 4G3CA 5KZ0A 2P6TA 2Z8CA 4IHSA 4YURA 4O7YA 4FTOA 4LFUA 1YG2A 1Z6RA 2OI4X 1ZOEA 5F95A 1S9IA 1W83A 5IUGA 4I1ZA 4BRXA 1OIQA 1BBYA 3O17A 3R71A 1A48A 2PL0A 1S6LA 3TDUC 4AZSA 4ANSA 5K5XA 1GIIA 5LVNA 3D2IA 4D28A 5D5XB 3MFSA 2Q2EA 4KKHA 3KU2A 3R9HA 2X7OA 4UV0A 3TOAA 3E8NA 1FNNA 4OINF 1UNLA 2YM3A 5DE2A 4DNCA 4HVDA 1KE9A 2IJMA 4FMQA 5AJQA 5CNNA 2CW0F 2J51A 4ZSEA 3HRCA 4XP2A 4DC2A 4RS8A 2X7FA 4C4EA 3NEUA 4JG7A 4TYEA 3MN3A 3KN6A 4I24A 5M09A 4U7ZA 3L09A 4CQEA 1PY5A 1JAMA 4CFWA 5LQFA 4KA4A 4QNAA 4DTAA 2H6BA 5DWRA 3KXXA 3G0EA 3QYWA 2VUWA 4OLIA 4EQCA 4ZYEA 4GKHA 3V8JA 2XAJA 2OXDA 5C01A 4O5VA 2G2HA 4BWXA 3PLAE 2C4GA 5LMKC 4BTFA 4IADA 5J7HA 1HKTA 3GCVA 4DQ2A 3K2LA 3QCXA 3QGWA 3ENHA 3MH0A 4YHFA 1L8TA 3O0GA 2R3NA 1W8CA 1LPUA 5DEYA 1HKSA 4JK1X 3BJAA 3AG9A 1GZ8A 2R9SA 2JT1A 3EQFA 3MV5A 3H9FA 1ZYJA 4JT3A 4R7IA 3SHFA 1OGUA 4LFIA 2W5HA 1W5SA 2UZUE 5L8JA 4AGUA 2RGPA 2W25A 1WBWA 3PLSA 3OBGA 4YPSA 3T9IA 3TDWA 4FEVA 4UHTA 3LKMA 2H8HA 1R39A 4C36A 4DH7A 4GJ2A 1PHKA 1BI1A 2UW4A 1RZ4A 3BROA 3RPYA 4LL0A 3GU4A 5KZIA 2HYFA 3GP0A 4B9DA 3R22A 3SG8A 2VXZA 3VEPA 3R73A 5FM2A 2ITQA 1O3RA 2Y4PA 2IA0A 4I5MA 2XUUA 2OWBA 1XH5A 4IVCA 1Q8ZA 4EK6A 3QCSA 4EHGA 3ROYA 1FY7A 2J6MA 3Q2JA 4BZNA 2QOIA 3BEGA 4CLJA 4WG3A 1B9NA 3CIKA 3MFRA 4R1VA 5AR8A 2OQGA 2WMTA 2QOQA 1YXXA 1YOLA 1BL7A 1L3RE 5HOOA 2AC5A 3ZO2A 3ERED 5DOSA 4BIEA 2GNLA 2WQOA 3FI8A 3UYSA 5F4NA 2BAKA 3RAHA 2WPAA 3HHGA 1S7AA 2GAUA 2ZBKA 3PXKA 2CGVA 2XBAA 2QI8A 4IZ7A 3OV8A 2IA2A 3GUDA 2OK1A 2WTVA 2FA5A 3NEWA 3OS3A 5L2WA 4CFXA 1IW7F 1JNKA 4PDKA 1Z05A 3BPXA 3P23A 4DT8A 1SMHA 5KBRA 1YRPA 3V5PA 2F5FA 4WG4A 3AD4A 1PMEA 5J8FA 1KE7A 4GT5A 2DWBA 3FMSA 4DN5A 3P1AA 4O2PA 2EXEA 3SOAA 2PN6A 4RRVA 4CRLA 1NHAA 4KKEA 1VYZA 1SNXA 4ZEGA 3ZMSA 3CJGA 4JG8A 4UEUA 3KEXA 2ZO4A 2CN5A 4OTHA 3TTJA 2DU9A 2Y8OA 2WO6A 3TGNA 3FY0A 1RI7A 5CF6A 4GGGA 1HW2A 3R61A 4JIAA 3D0SA 2HDCA 1KQ9A 4I4FA 2O0UA 1G3WA 2ZB1A 1J7UA 4X7QA 4BZDA 3QUEA 1HSTA 2RFEA 2R3LA 3U9CA 4KIQA 4RJ3A 1MDMB 3QLGA 4FSZA 3S95A 3QHRA 4S31A 4FIEA 2C68A 1J91A 4ENXA 3KETA 4GVJA 5GIOE 2BKKA 4DBNA 1XH4A 2VZ6A 3OWLA 4LD5A 1UU3A 2FO0A 2QBYB 4FI1A 1RIOH 3K5VA 2X81A 3NRMA 1UU8A 2P4WA 1JSTA 2FUMA 3QRFF 2L01A 4ZZDA 1H24A 3Q5FA 5TRDA 1LP4A 3P78A 1YXSA 5I5ZA 3QQJA 2IVSA 3LFSA 4JBVA 3IS5A 3JY9A 5TKDA 4FGRA 4CD0A 4F1TA 2GHMA 5EI2A 2WMSA 4CNHA 3S1HA 2G01A 2OZ6A 4HZSA 4UZDA 2XIYA 4FK3A 5E1ZB 4RA4A 4IAYA 1WBNA 2Q0NA 5J8IA 3IECA 5KMNA 2VOOA 3ZSIA 5E92A 4FOBA 2QM3A 3IK3A 4MTEA 1F5TA 2Y4IC 1BN5A 3LQ8A 2VAGA 5BVOA 4L0YB 3QTWA 4AS0A 4U8ZA 3MAJA 3DJ7A 4QMQA 2XCKA 4E6QA 3VAPA 4Z9LA 3O2MA 4R3CA 1YW7A 4FEQA 4A9YA 3W33A 3TQNA 4CLIA 5DUIA 4FK6A 4G3GA 3F3UA 3MB6A 4NM5A 5BPDA 3K5UA 4DG0E 3JY0A 2UW3A 5LVPA 3V5QA 1WBOA 1QZYA 2ESMA 1LEBA 4CMUA 4XOYA 1FSEA 1IN4A 4DEBA 5HDNA 4NJ3A 2VWBA 5K5RA 2O5KA 2H34A 4I23A 2XNMA 3UZPA 4EQUA 5CAUA 1SM2A 5ICFA 4MQVA 4YMJA 3MJ1A 4BICA 2VWXA 1FYMA 4YTIA 2X8DA 1VJYA 4QQJA 3TNIA 2HOEA 1D8KA 1MZBA 5CX9A 3FF5A 1YFHA 5BQ0A 3FQHA 4USFA 4YUQA 3GGFA 1G3YA 1USTA 1D5VA 4GKIA 4NIFB 3TCPA 1PXPA 4HYIA 4FT0A 4CT2A 2CN8A 4E5AX 5ACBC 3K9TA 2YIXA 1K78A 4HX8A 3F7ZA 4IM0A 4M9XA 4DAWA 4QMWA 5J5TA 3E5AA 1WWXA 3LCSA 1H28A 2OZOA 2V7OA 5HTIA 3RCDA 5CT0A 2O65A 3DA6A 3PZHA 1MJAA 4CQGA 3EN4A 4EJTA 1U54A 4F99A 3SX9A 2K4BA 4G3EA 2R64A 2J0IA 4XS2A 2WMWA 4A4XA 2QG7A 3ZRLA 1HQCA 3GZ5A 5E8ZA 4G16A 1G8SA 5K9IA 3HP5A 5CAOA 4K8AA 2XEZA 2JIIA 4LMYA 4F9CA 4BDKA 5DBXA 1YWRA 5TE0A 2BRHA 3SRVA 3QTSA 3TM0A 2WELA 4KIKA 3KRWA 1URCA 2XK6A 4P96A 4LLNA 3LFEA 3SG9A 4RJ8A 3WYXA 3DQXA 3WZUA 4UBAA 5E7RA 2X4ZA 4D5HA 4LGHA 2YIWA 2B9FA 3TTIA 4UUVA 4DE4A 2ZM1A 3SQQA 3CUQB 1JHHA 2P5LC 4FNWA 2X4FA 1SD6A 4F65A 3E93A 1URWA 3FZVA 3FC2A 3VIDA 3EHAA 5BMSA 1YW9A 3EN7A 4QPMA 1YW8A 3VRYA 4W4XA 5CU0A 2Z7QA 1U4DA 3PY0A 4DH3A 4L01A 5ILVA 3SOCA 4LJZF 5GINE 1XB4A 4FZ6A 2TDXA 2OIDA 4AA0A 4IRGA 3EIDA 4O7TA 1Q5KA 2NS0A 3ZFXA 1ZYCA 4IEBA 3LCOA 1UNHA 4BFMA 3ALOA 4C7TA 5LRSA 4NTTA 1Z57A 2Y9QA 5HX6A 1AD5A 3QCQA 3T9TA 4CFFA 4TW9A 1S3JA 1JKKA 3G5DA 4NFNA 3ML6A 3Q9SA 4BCKA 1P4WA 5FBNC 3CDHA 3WOWA 1J59A 3I5ZA 4ANOA 2RFDA 3ZONA 1P6RA 2JBPA 4FSQA 3PJ3A 3WZJA 5DT3A 4FV8A 4FOCA 2A27A 1SMYF 1Z9CA 3JPVA 3FZOA 4XBUA 4DGNA 4BBEA 3C0GA 3TI1A 3W18A 1UKIA 2HXQA 2CKOA 4UMTA 4U43A 2KIUA 4RWLA 4WX9A 3VJNA 2ETKA 1XR1A 1PF8A 3DV8A 4RWKA 1SD5A 4R1HA 4NJDA 4M69A 1H25A 4GT3A 5ILSA 5JFVA 5D8KB 3I4BA 1GXQA 2BRMA 5BS6A 4EH4A 4EC8A 4WK8F 3LZBA 1WAKA 3F2RA 3UO6A 1S29A 5D1JA 2IW6A 3FKOA 3WG9A 4AF3A 2XHKA 3BLQA 1BMKA 2STTA 2Z5UA 4F64A 3CD8A 4H3PA 3NGAA 4F9BA 3ZU7A 4BCMA 2FMLA 2VX3A 2R3OA 5AX3A 5HI2A 2W99B 1OIUA 1JWHA 3F3VA 4QP6A 2F57A 2OSCA 4EYJA 2HWPA 4XHKB 4FE2A 1W7PB 4JOAA 2I40A 4ZMFA 2R5TA 5KHWA 2I0EA 5HBJA 3PA3A 5EOLA 3NNXA 3GC0A 5DVRA 4UY9A 4X6QC 3KB7A 3DB6A 4QO9A 1M7QA 4Y5HA 2HOGA 4G5JA 2A2AA 1RW8A 3HV4A 5D5WB 4AOIA 1JLUE 5AM7A 4DTKA 5CSPA 4AQCA 4P5QA 4O7VA 4PDYA 4MYGA 3FSKA 1OIRA 5JFWA 5CU4A 1KYZA 3GQLA 1LEZA 4JQ8A 4O0VA 5I3RA 2VTSA 4V0GB 2YIQA 3HTSB 5CEQA 5KHXA 2HS5A 1H1PA 2HFHA 1LVAA 5M51A 1TQIA 1ZZLA 5CEMA 3I60A 4WD5A 3D5XA 3FBVA 4F7NA 3PQKA 4M74A 4F6WA 3KCFA 3T8OA 2DQLA 1M2PA 4IACA 3N4TA 1CKIA 3R21A 2YPRA 5BVDA 4EJ7A 3R0TA 3ZMTA 4Q5HA 3JAMZ 4FGBA 3UJGA 2ZV8A 2REIA 3DEUA 1XWSA 3QLFA 4KKGA 4DGGA 4QP2A 3CTQA 1OKVA 4YPDA 2XK4A 4ZTSA 3BYVA 3GFEA 3ZSHA 4I5PA 3UVQA 3SRVB 5D5VB 5CVJA 4G5PA 4YHTA 2BV6A 1FLIA 4RFYA 3QTZA 1OPLA 2BDFA 3QTUA 3FLWA 1Q99A 4AGWA 2CLXA 3WF5A 5ETFA 4CSVA 2J0KA 3H92A 1JVPP 3MA6A 4M6XA 4DFXE 3UOHA 1YS6A 3ZUVA 3CGOA 4QNYA 4GMYA 3R7EA 5H2UA 1YOMA 4A0YA 2UZBA 2CKPA 5A4TA 3UODA 3KMUA 3LWFA 2C6EA 4OT6A 3AOXA 4I09A 4DH1A 1Z91A 4L0ZB 4WNPA 3NYNA 3I5UA 4UVBA 1J7LA 1JGSA 1TLHB 2HKXA 4CFVA 4F7SA 2GQSA 3Q9ZA 4A0ZA 2HZ4A 4AW1A 4QTAA 4XV1A 3WE3A 3FXXA 5BVEA 4YC6A 1U5TC 3DK6A 4NK9A 4ASDA 2VN9A 3JSOA 2VWYA 5HVQC 3DJ5A 4ACDA 3LSTA 4GS6A 4HDUA 5LGNA 3R83A 4QMMA 3Q4CA 4I2OA 3CLYA 3BV3A 4QT1A 2FRHA 4PPBA 1A06A 2L54A 1G3TA 2YZAA 3HYIA 3NVMB 1REJA 1ZHFA 4MXCA 1UB9A 4D4RA 3ATTA 4W8EA 1OL6A 4IJAA 2EFNA 1QPCA 2B0LA 2DAOA 1XH7A 2X7GA 3HMOA 1R0EA 5L3AA 4ESFA 4LRMA 4EOIA 4ANQA 4A7CA 3HSRA 5EYCA 2HZIA 3V5TA 4D0WA 5EQEA 4E26A 3PXQA 2QYOA 4ZXTA 3W2QA 3DKWA 2WTEA 1IF1A 2PY3A 1LEAA 3U51A 3EQRA 1P2AA 4C59A 4DGOA 4D2RA 4IWDA 4AP7A 4YNOA 1YI4A 3KF4A 2QNJA 3GFWA 4RVLA 5FEEA 2HWOA 3RI4A 3Q04A 3CS9A 1YYVA 2Q0BA 3REOA 3BYOA 4DHFA 5EHOA 3FMQA 4CICA 4XG7A 2G9WA 3QU0A 1E1XA 4JVGA 4O7NA 3N4MA 2C3LA 2YCRA 3F5XA 3QWJA 4IJ9A 2GNJA 2J50A 4D2PA 3FL4A 4GU9A 3KA0A 4RG0A 2XNPA 1ZLJA 5E1SA 4O91A 2W4JA 5CLSA 2JPBA 1U2WA 4PNKA 4NYEA 4Y72A 2QU6A 2FSOX 5AIKA 3QU3A 3BWJA 4EEVA 5FXSA 3AMYA 1IXRC 2QU5A 2E9PA 1K79A 2VGPA 3O96A 4FKWA 4BCGA 3PDTA 3NUXA 3SD0A 4P9UA 2R3IA 4C3FA 1OL1A 1Q8WA 2OZAA 3TDZC 2XKPA 4OIPF 4W9XA 4EBVA 3ACJA 3FZPA 4BHCA 4BCNA 5GJFA 4AW5A 4GYIA 2QBYA 1KE8A 2PZ5A 1XH8A 3DGKA 5LWMA 4XYFA 3EMGA 1B4AA 2PSQA 4ALWA 1QGPA 4D1SA 3QTQA 5GJGA 4XBFA 3R6XA 4V01A 4N70A 4OUCA 4WBOA 4ZLZA 1LJ9A 4KBCA 3EQGA 3G0FA 2DLLA 4FL2A 5EHYA 3QD3A 5FFZA 3EKKA 4MBLA 3IDPA 3R8LA 1PMUA 5AR4A 2WOTA 4BCQA 1Y57A 1O9UA 3GEZA 1GAGA 4D1ZA 3IKTA 1FGIA 5FTOA 1CGPA 2WMQA 2RV8A 3NW5A 2NYXA 5HLGA 4ASEA 5IA1A 4J53A 2XEYA 2GQGA 5LGUA 3PVWA 2OIBA 4BYYA 3ORLA 3MESA 1XSVA 2QODA 2YABA 1CKPA 1E1VA 3KLOA 2C5YA 3ZLYA 3VS2A 3V5JA 4RLLA 1HXDA 5AADA 4JDIA 1KSWA 2XYUA 4KAOA 5BMZA 4QMOA 4OTIA 3NW6A 1BUHA 4YZDA 4DFNA 5IT3A 3LMIA 4Q9ZA 3HLLA 1PYXA 4R8HA 1QL6A 5GNKA 2WAJA 3T0YA 2UW9A 2V62A 4F63A 5HE2A 1WCCA 4J1RA 3AD6A 3ZMUA 4R1YA 1I6XA 2PMUA 5J5SA 3EDPA 5BX0A 5T3QA 4NW5A 3OCSA 4JBOA 2XF0A 3ZHPC 5J7BA 3LFBA 2VBZA 3UIUA 3MDYA 3WU1B 1I09A 1YIOA 4AE9A 2K4JA 3DS6A 4ASNA 3VS4A 4GCVA 2E1NA 3POOA 2P0CA 3AXWA 3ZO1A 3BX5A 2F5CA 3OWKA 4LQMA 2QO7A 2CKEA 4E5WA 4KN7X 3WE2A 3O51A 3FI3A 3C4WA 4RFZA 4EK3A 3EB0A 3MZHA 2R3MA 4QP9A 1BOAA 3JSPA 4ZS4A 3GU6A 2XKOA 5K5QA 1O57A 4WXHA 1XSDA 1ON1A 3TNHA 4IHPA 1H1QA 2JKQA 1DAWA 2XNNA 4YTCA 3MTFA 5I9YA 5H6QA 4PMTA 1XCVA 4J95A 4CFUA 2W1HA 5CQWA 4O7ZA 3CE3A 5AIRA 2C0IA 4AN3A 5DYMA 2OO8X 2E2BA 5JT2A 2G2FA 3R6SA 1YQJA 3HV7A 4I6BA 4ANMA 2BILB 2CG4A 2EV5A 5E8WA 2M1BA 2IPQX 5KE0A 5FUTA 2Z7LA 2IPXA 5FEDA 3WF8A 1ZH5A 4PX6A 1YVJA 4G6NA 5AUZA 2KIMA 4O3MA 3RAKA 3BHUA 3GCPA 4ITIA 4LMUA 2HEOA 4DEAA 4EH5A 5JH6A 4MXZA 3R9DA 4L45A 3UQCA 3BWFA 2XM9A 3O8PA 2X2KA 5ANEA 3ANRA 3IW8A 2XIGA 4BDIA 1KOAA 4TPTA 2HZNA 3LW0A 4TN6A 2GIVA 3DFCB 3QZHA 4L52A 4G7OF 3QTIA 1BYGA 5FD5A 1YW2A 3ZDIA 4BI0A 2XV4S 4N0SA 3VBVA 2FBHA 4RMZA 3VUIA 2VTTA 4AT4A 1R1TA 4B8XA 3IGOA 3WTSC 1H1SA 4Q47A 2XNGA 5IUIA 5C4KA 5F1RA 4IZYA 4YSJA 2W84A 3Q4UA 5HNBA 3GYHX 2O2UA 2JSCA 3NWWA 4FTCA 4GFGA 3QALE 1BC8C 4G3DA 4BCFA 3ZMDA 3E5UA 2Z33A 1NXKA 1ZREA 4M14A 2BROA 5FM3A 5AP7A 1W7PA 2PULA 4OT5A 4BY9E 2ITXA 4IB3A 3PG3A 5JK3A 3OHTA 3VW6A 4CMOA 3BRBA 5CSWA 5IA3A 2VTNA 4U42A 1W4MA 1IXCA 5EI8A 3A7JA 2DK5A 1KUTA 5IH6A 1YHSA 1QZZA 5A4CA 4YGAA 2JIUA 3R60A 3FZSA 3ZM4A 4ERWA 2GA1A 2X1NA 3EYHA 1OZ1A 4RIYA 2GU8A 4DFUA 2XIKA 2MH2A 3OXZA 3EYGA 3OROA 4C61A 4EI4A 1SFXA 2XROA 3IC7A 3I71A 2LNBA 4EOKA 2RIOA 2UZOA 3ULIA 2XCHA 4BL1A 4BKJA 4O7SA 1IN5A 5A4LA 4WHZA 4BI2A 4BGGA 3IOKA 1AOYA 1IA8A 2WQNA 2A0CX 3SA0A 4P7EA 3DXQA 4QMVA 1FT9A 3M11A 4OTPA 1BM9A 4MEYF 3F8CA 4WBBB 4RJ6A 5KBQA 2QVOA 3HRMA 1M7NA 4ZY5A 4BDAA 4YIIA 2W1ZA 4I01A 2A6EF 3AD5A 1WVYA 1J5YA 1ZGAA 3I64A 3T3VA 4A4LA 1KOBA 5JFSA 2YWPA 2ZKZA 4CO8A 4I5HA 2W4OA 3DXNA 2BZIB 4RAZA 1LQ1A 2RFNA 1OKYA 1HSJA 4KIFA 5E20A 2VO7A 1E9HA 2DW4A 4RPVA 5I9XA 4L67A 4JBQA 3ELKA 2ZOQA 3QX2A 2DTRA 2WC2A 4DEGA 2J4ZA 2CSOA 4QYYA 3VWAA 2C6MA 5AUTA 2EJRA 3F22A 3RPOA 4TWNA 1JBPE 4JRNA 3O23A 4EHEA 4YJQA 3CCNA 4TYHA 3ZFMA 5M44A 3E8CA 3HP2A 2WQEA 5J9ZA 1JE8A 3ZZWA 4A6DA 5DV5A 4GT4A 5HIEA 1GVJA 2QZ8A 4ENJA 3E3PA 2R3JA 2FMYA 1ZYSA 3TIYA 4WNMA 6PAXA 4G7HF 4G94A 3IONA 3QAME 2M8EA 3RMFA 3ZZEA 4UALA 4HW0A 4A5MA 4M9SA 1TW2A 3G90X 3NZ0A 2GCDA 3TKHA 3VO3A 4MHGA 5DYJA 3BEAA 2J5OA 1ZRDA 4LV5A 3KMWA 5CVIA 3SDJA 5D7VA 4IVNA 2NPQA 3F8BA 5CU2A 4PMMA 2PE2A 4G31A 5LVOA 5HTCA 2V9VA 4S30A 1OPJA 2WU7A 4FKOA 5IA2A 4LM5A 4NEUA 4PNIA 1ONVA 2R7DA 1YI3A 1LR4A 3F6XA 3LFDA 4ZLOA 3FV8A 2WOUA 2WTKC 1XMAA 2FH9A 2PMNX 4MWHA 3OD6X 2WNTA 3RPQA 2ONLC 5AA9A 4DG2E 2VX1A 2P5VA 1T6SA 3MVHA 4CZUA 3OF0A 3Q53A 1EH4A 3KP3A 2W5BA 4BHNA 3P7BA 2WHBA 1T2KA 3DTCA 3LAUA 3QCYA 1JKSA 2V1XA 2YACA 5HCZA 2V1DA 4FTKA 5E8YA 3TN8A 4FKVA 5LMBA 1KQ0A 5JGBA 4U97A 4R7HA 3WGIA 4FTJA 4YJNA 3I7CA 2YCQA 4GG5A 3P0MA 3Q60A 5TF9A 2B7AA 2EV0A 2H09A 3O8TA 4HYUA 3SQNA 4EH9A 3BPVA 2QURA 4YFKF 2IP2A 3MB7A 2XAQA 1ZMWA 5FD6A 5K0XA 4IWOA 4WRSA 3EYIA 2W1GA 2R7FA 4A07A 3HV6A 2V22A 2QHMA 4TXCA 4EM2A 4JQEA 2X0LA 3DBDA 2RG6A 2BDWA 4C0TA 4XNEA 4AFJA 1KE5A 5ANDA 4O7WA 1ZOGA 4IX6A 4JBAA 4EOLA 3PXZA 3NUYA 3TNWA 2ITTA 5H3QA 3HRSA 2YISA 3FWQA 3NR9A 3F5UA 4TT7A 3OY3A 2PZPA 3F3TA 2JAMA 2VU3A 3KFWX 4HVHA 1C0WA 4XEYA 1U59A 2G7HA 5H8EA 1BIAA 4DINA 2WTWA 4HLXA 5EM7A 4YFNF 5G6VA 2DQRA 4DYMA 2LGCA 3S00A 2HW7A 3DKFA 1Z1DA 3JYAA 2O61A 2WV0A 4FT9A 3SXYA 2CDZA 3T5XA 3MIYA 4RFMA 1ZRZA 4FKPA 4HLYA 4FIFA 3ISPA 4G9RA 3KRLA 1OUYA 4WKQA 5I3OA 3ORPA 3JXWA 4XV9A 1XMKA 4FUXA 4XLIA 3ULQB 5CXZA 3FM3A 2PVNA 4GO1A 3ZPLA 1OKWA 4BWKA 1U6GA 1R1WA 3LCDA 1UWHA 1XD7A 2P2IA 5LXMA 3FXQA 1OL5A 1MUOA 2JEDA 2J9MA 3AC2A 5IQCA 3RALA 1XBAA 5E4HA 4KBAA 2E9NA 4MNEA 4IAZA 4BZOA 5D4RA 3GCQA 2PVLA 2PBIA 4K18A 3A60A 4IFCA 2GS7A 2Z7RA 2VWVA 3Q6UA 3PSCA 3VQHA 4KWPA 4FZ7A 1XJDA 4Z3VA 3E62A 3WGHA 4KA3A 3F3XA 3MPTA 5HIBA 3G2FA 1WSUA 4W4YA 2WMAA 3UNKA 2XBJA 1IN7A 3LXKA 4XSXF 4ZOGA 3GNIB 2HQNA 3ZEPA 4HW7A 4Q48A 3V8LA 3EQLF 2PTKA 4PMSA 2P6SA 3QKKA 2BZHB 3LCKA 4TTHB 4IF4A 4YZCA 3I58A 4AZFA 4S05A 2PVFA 4RIWA 1NVQA 5CF4A 4YJVA 1CTPE 3MYGA 5F1ZA 4FX4A 4QMXA 3NUUA 4FNYA 4CXAA 4XMOA 2A6HF 2YWVA 5EYDA 5AAGA 4ZAUA 4XG6A 4TL0A 3OT3A 3FMJA 3R2BA 2YLEA 2DQ7X 2J0LA 3I5NA 3MY0A 5FG8A 4Y83A 5K4JA 2AS5F 5DCMB 3RPSA 4FIJA 4UVAA 4M73A 3UP7A 1H4LA 4L3JA 2OG8A 3GEQA 3QD2B 3QTRA 4QPSA 4QYGA 1ZZ2A 3L8VA 1WVXA 3JTGA 4MBJA 4HX7A 2VNWA 3KFAA 2XGXA 1YWVA 4ZSAA 4EV0A 1O6KA 3ZO4A 4EJWA 3ITZA 2PUIA 4MTAA 3EL8A 2WIPA 4PPAA 1TNTA 5CVGA 4BCPA 4LV8A 5H20A 3VN9A 4RGSA 1B59A 4PWNA 4MF1A 3EN6A 4FEWA 2XVCA 3PYYA 5IISA 3C4ZA 5F6FA 4QPAA 2Z02A 3TZ7A 3V01A 2B9IA 3HGKA 4C4GA 5JN2A 3FKNA 4LL5A 3ULZA 2JIVA 4F7JA 1KGSA 3R01A 3EUHA 1QQIA 3F66A 3D5UA 4XLNF 1BC7C 3M42A 4OTDA 4BTMA 1Z9XA 2QR8A 4RGJA 1TVOA 5KO1A 4AU8A 4MXXA 3NYVA 3R8VA 3QGYA 3FXZA 2BUJA 4QQCA 2C6YA 3BZ6A 3KK8A 5AIPA 2FU4A 4CTBA 3OC1A 4X2FA 4XP0A 2YHVA 4QMZA 5E8UA 2IZRA 2CNQA 3B73A 4FKQA 4C34A 3QWKA 2YERA 4IIRA 3V7CA 4QTBA 4IDTA 5LLQA 3ZRKA 5HVKA 2QLQA 4CG8A 3NAYA 4AXAA 5DH3A 3EZVA 3II5A 4AA4A 3H9OA 4M0YA 2GHGA 2IO6A 5DG5A 2W24A 3SFZA 2C0TA 1V3FA 4RC3A 4KRCA 2PFBA 4IAKA 4HVSA 2VTRA 3UO5A 3DZOA 4YZMA 3FZTA 3IL2A 3BIZA 4Y5QA 1ZWSA 2GXBA 4N57A 4GH2A 4ENYA 3JTHA 4YJRA 3BJOA 2PZIA 3QOPA 4GV1A 3AC1A 5E8XA 5AUVA 2DO7A 2HY0A 1GXPA 3R7YA 4FNXA 3WTYC 4EYMA 1EH8A 5J6XA 2XJ2A 3REPA 1STZA 3IW6A 1P2FA 5KK1A 2ITNA 4TYJA 2EUFB 3GU8A 4AZVA 4I0RA 4KS8A 5M06A 1V4RA 5FXQA 2IJLA 3AC4A 3BPRA 4AGDA 1Q4LA 4P5OA 5CNOA 4JR3A 1OM1A 1J0RA 5E9EA 1JXSA 1T98A 2OU2A 4PL5A 4BIDA 4O0TA 3ZH8A 1K9AA 3WIGA 3F8MA 3K3IA 5KMJA 1LDDA 3DCVA 4L00A 4NT4A 3UIBA 4DEDA 3FMNA 4ERKA 1YLFA 5JFRA 3HNGA 3I79A 4JBPA 5AV1A 4HYSA 4E20A 3QKLA 3D83A 4EZ3A 4L53A 1ND4A 3ZN0A 4ANNA 2I6LA 2XK7A 2CO5A 1BI2A 4GXOA 1ZRFA 3PSBA 4BTJA 3R30A 2QO2A 1V0PA 4PCQA 4YIFA 4I3ZA 3R04A 1R3CA 4K77A 4QP3A 4KD1A 4HZRA 4AT3A 2F5DA 2RNJA 4AE6A 1PUEE 4Z2YA 2WTKB 4F0GA 4C38A 1Y0UA 1CSNA 4MKCA 5HU9A 2BE5F 5EH0A 2DFIA 3BHTA 4A0XA 5CF8A 3HZTA 4MAOA 4OAVB 3HUGA 3LMHA 4S2ZA 4A9RA 3KCCA 4BYJA 5GJDA 2RVCA 5HLHA 2IN6A 4L9TA 3RHKA 4FV1A 4ZTNA 4PL3A 4ZYGA 1J2XA 4ZTMA 3VFZA 4FKUA 4M69B 4KMUX 2PJPA 3JW4A 5EKNA 3Q4TA 1WMKA 5AV3A 1ZAOA 5LEJA 2JBOA 5IZFA 3CC6A 3VNTA 2GQQA 2IA1A 3COMA 3RZFA 2YJSA 1ZG3A 4QMUA 3RPUA 1KQ8A 4O7RA 1PJKA 4BIBA 3A8XA 5I9ZA 4G9CA 3OOGA 3OG7A 4O21A 1PMVA 5HG8A 3WTUC 4IHTA 3U6JA 5I0BA 3E3BX 1BI3A 3GI3A 3N4UA 3BLRA 2V1UA 3R9NA 3LE6A 5JQ5A 3N51A 3PG1A 1J1BA 3LLAA 1FBUA 3I59A 2JKMA 3WIKA 4ZYDA 4O22A 5LARA 2VWUA 4CKRA 3OXTA 5A4QA 2VTMA 2FVDA 1FMKA 1P4OA 4RX8A 3FYJX 2CWEA 1P5EA 4MQ9F 4R5YA 5L6OA 4CV9A 5KNJA 2XJ0A 3W6KB 4DFBA 4NM7A 5DD8A 2DPDA 3UDBA 2Q8KA 4IM2A 3O6BB 3LOKA 2LF7A 3Q3BA 4MGRA 4BDBA 2B52A 5CSXA 3L00A 2SRCA 3PIYA 2VTHA 4IAFA 3TZ8A 5DCFA 4RVKA 5LBQA 4IAAA 1WFCA 1U5QA 3P9KA 1OECA 4P55A 2UZLA 4M71A 3LCTA 3PXYA 2BAQA 3CQUA 3ORNA 2VE8A 4FICA 3E7VA 1I1GA 4EOSA 2I7QA 2HZTA 3P5KA 5K0KA 2J7TA 4E4MA 3MQ0A 3KXZA 4CHUA 3GCUA 3EQCA 4UWBA 2C30A 3HEGA 2GNHA 3TKYA 3CKWA 1JHFA 1U46A 3FL5A 5HO6A 4F9YA 3CUQA 2XIRA 3BU5A 1FX7A 3K2ZA 4ENMA 3GVAA 1V0OA 4J8NA 2B54A 4CVAA 2WZJA 4Q9SA 1H08A 4L9VA 2HK5A 2I0YA 2LSOA 3TV6A 1HOWA 2QOKA 1TW3A 3ORZA 4B4LA 1AWCA 2R7IA 3VOEA 4QMYA 3W6JB 2G2IA 4O86A 1D3YA 5TO8A 4EJUA 1FSHA 1WBVA 2COMA 2OAZA 2RL5A 3CUQC 3CBLA 3F2AA 2XNOA 3A61A 3OUNB 3GW2A 2OJGA 1NVRA 2YU3A 4CXFA 2BRGA 4CGAA 3NYXA 2UZVA 3TO6A 5ICCA 3NSZA 5AV4A 5DDGA 1DP7P 3AC3A 4FTUA 2C1AA 1MJBA 4WA9A 2QENA 1R5HA 3BBTB 3FMHA 1FMOE 5HU3A 3RTPA 4JX3A 2RG5A 1Y91A 4PTCA 4LI5A 4EUTA 3JUHA 4KS7A 5ETCA 3V7RA 4QYFA 3K1PA 3G51A 4HYHA 3PFQA 3RKBA 3Q9YA 1F0QA 2ELHA 2BRBA 3TZ9A 3EYYA 3FE3A 3V3VA 3RAIA 5B2KA 3HRBA 4OIRF 3ROCA 1G5SA 5FDXA 4I0AA 2ZV9A 4LG4A 5E8GA 4NL0A 4BCIA 4MEDA 1T38A 2XK9A 4YLKA 1TTYA 1EV7A 5KMKA 3R1SA 4YO6A 2B4SB 4HPUE 4DEHA 4DGMA 5ANKA 3P4KA 3R0JA 1XHAA 1QPDA 3QF9A 2UZEA 1UU7A 3CJFA 4E6DA 1JKTA 1QCFA 2CJMA 4HDVA 4R7BA 4LRJA 3JS2A 1STCE 3P9IA 5T6KA 5ICPA 3W8LA 2UVXA 1YDRE 4TY1A 5L2QA 4OBQA 4EGZA 5HS7A 3RWQA 1JOWB 4BI1A 3PPJA 2IWIA 3WTTC 2FA2A 4N6YA 4XG3A 4D1XA 5C8NA 3RYPA 3OTVA 4FTMA 4Y8DA 5AP5A 4D9TA 1KA8A 1I1SA 2KULA 5A54A 5HO8A 3DFAA 4H1JA 4APCA 4EL9A 4LB5A 4N0BA 5CEOA 3H4JA 1JKLA 3KE2A 2PVHA 4AIJA 4ZS0A 2ZVAA 2F5EA 5HLIA 4CCBA 5L3DA 5HG9A 4ZZNA 4ONAA 5DEWA 4RIWB 5K5NA 5BVWA 5BPIA 3COAC 3TUBA 4IB1A 4MNFA 2BFYA 3GC7A 3G6HA 3PIXA 3KULA 4K2RA 3R00A 4FSWA 5CASA 3UNJA 2UW5A 5CVRA 1SFUA 2XB7A 3OWPA 5M53A 4P90A 1H0VA 3MSSA 4C2VA 4F7ZA 3D7TA 4X3FB 3C5IA 3TKUA 1V1KA 1IN8A 2GTNA 1JPAA 4CMTA 3DKOA 5GZ9A 3R0AA 3W55A 3R9RA 3ZFYA 3VC4A 1IG1A 5HG7A 1MRUA 5J87A 2UW6A 1IAJA 4FSUA 1ULYA 4USDA 4EK4A 4N9IA 4BC6A 4TWPA 3K1NA 2ITWA 5E8TA 4OR5A 2F2EA 2R3RA 2VX0A 2QVSE 4C2WA 3FMRA 2W1FA 4PL4A 3SVVA 2ADUA 5LMKA 3LAJA 3RM7A 3FQEA 3LFCA 2L3DA 5IQGA 4YU2A 3P7AA 1R1VA 2DPUA 1ON2A 2X4HA 3Q9WA 4A9UA 4IMYA 2W7XA 1GZOA 2FF4A 4I94A 3MH2A 4Q5SF 4FKGA 4IB5A 4XG8A 4X6RA 1YOJA 3BOQA 1KV1A 2FYSA 3FUPA 4R3RA 3NX8A 3QUDA 2IVVA 2X39A 3SXSA 3Q5ZA 3C4XA 4FIIA 4R3PA 2PVRA 1J7KA 2NRUA 4EH2A 5F64A 2OH4A 3ET7A 4MF0A 3ABTA 3PXRA 2E9OA 2GDOA 1LUFA 3KP7A 2PU8A 2A61A 4AN9A 3V6SA 4GRBA 4RQVA 2WWYA 3SXFA 1KU3A 3U54A 5CSHA 5FDPA 4ITJA 4YJUA 2FSLX 3FMDA 3ZTXA 3ZQ7A 2GFSA 2KJBA 3LM5A 3ZDUA 3KXHA 5BYYA 4ALVA 5M56A 3KP6A 2W96B 5L8LA 3MGYA 4EK8A 3VS3A 4DFZE 2GFCA 4QQ5A 4O82A 1I5ZA 2P7CB 2QD9A 2JFMA 3RAWA 5JZJA 3O7LD 4ZSLA 5GZ8A 4CZYB 3EJ1A 1IRFA 4FF8A 4LLGF 2XM8A 3BJ6A 3F21A 5L3CA 3OCBA 3UPZA 5FQDC 2HKOA 4FKLA 5AUWA 3NPCA 5CAVA 2QOCA 4JS8A 3KRRA 3MI9A 1QMZA 2C3KA 4CV8A 3KP4A 5IQEA 2XP2A 3R1QA 4FSRA 3EETA 2P2HA 2PI0A 1OKRA 3PP0A 3QRJA 5HNGA 2HYYA 4D2SA 4KNBA 2QOBA 5E1XA 3E92A 3ID6C 4GFMA 2C5XA 3GFLA 5ACKA 3MWMA 2VWWA 3ACKA 3Q32A 3OBJA 3QPTA 1W82A 4FKRA 4F9WA 3WI6A 2W1DA 4RWIA 1RUNA 4FT8A 2WTDA 3I53A 3M2WA 3GVUA 4EKLA 2RSVA 1Y8YA 5JGAA 5IMXA 5E91A 3TWJA 3KKVA 4O27B 3C1XA 4MWIA 2ACJA 3DTWA 2F2CB 3IPHA 2ITUA 4FC0A 1S7OA 2XKEA 5AP3A 1O7LA 2QQ9A 3EFLA 1L3LA 4F6SA 2A07F 4WF2A 3D9VA 4QYHA 2HYGD 1IR3A 4RT7A 3SHEA 5HDGA 3LFQA 4EQQA 5B7VA 2X9EA 2FOKA 4IBMA 3QRKA 4QLCU 5JI6A 2YDJA 3RKYA 3LLTA 5FB2A 3A7FA 1IA9A 5FO5A 2VTAA 2JDSA 4HBLA 1ZLTA 4ESBA 2FXAA 1M14A 3QPHA 5EM6A 1O7FA 3GXLA 4RVMA 4TV7A 4R6VA 1GIHA 2HWVA 3BHVA 3E5QA 1R36A 1ZOHA 1B1BA 3FHZA 2UW8A 3NS9A 1WZYA 1T46A 4W4WA 1XBBA 3N4VA 2DBBA 4YP8A 5JZNA 4RSSA 3KCKA 4IXPA 4FG8A 2ZV2A 4JRVA 2OZAB 3R8UA 3GOKA 4H05A 1S9JA 5LOHA 4W4VA 5JVTA 5IDNA 4MQ1A 4OIQF 4KUJA 2BMCA 3RBWA 5HQ0A 4HA8A 4YNEA 2BIYA 4XLVA 4M9ZA 2L02A 3BP8A 3BZ3A 3GF2A 3SV0A 1RUOA 3DB8A 2I0HA 4HX4A 5M4UA 4BAYA 1DI9A 5LCJA 4LOOA 4UXQA 2P33A 3QZIA 2A69F 1HW1A 2XNEA 5HDKA 5IMEA 3NUPA 5CEKA 2UZDA 5IKWA 5LRRA 5FP5A 1O3SA 2M30A 3CP9A 5BNJA 2IVTA 3M8EA 2I0VA 3MJ2A 3F5GA 3RHXA 2BHHA 2WGJA 4WOVA 1PKDA 3ZMZA 3SAYA 3HYHA 3B2WA 4AG8A 2BVAA 5CS6A 4EQMA 1TBXA 2CSNA 2YIRA 3C50A 4MX9A 4AOJA 4TNBA 4GK4A 2MD5A 3IHUA 1ZY5A 2KTYA 4QTDA 4LMNA 1PRYA 4WG5A 4D0XA 2R3SA 4U41A 5JKGA 3Q96A 4ZZOA 2G15A 1CDKA 5HICA 4OIOF 2R0UA 3SXRA 5CTPA 4MHAA 3EN5A 3TXOA 4RX9A 3G15A 4R78A 5CU3A 3D0EA 2XA4A 3GQIA 3F3ZA 2C5VA 5DT4A 1XSXA 1JSUA 2CQKA 2XIZA 3CD3A 4QMLA 1DDNA 5BMMA 4O81A 3DF8A 4DLJA 4LRKA 3E3VA 5B2MA 3R8ZA 3F8NA 4A2UA 5JEBA 2R0IA 2JC6A 1REPC 4G7ZF 4PP9A 2BTSA 2YITA 5D11A 4I6QA 2WTCA 4L7FA 3W1FA 5GZAA 2GTMA 4GEOA 5FLXK 1BX6A 3MVJA 2E7XA 4HQMA 3VHEA 3WE4A 3ZLSA 1U54B 4XP3A 3E7OA 3ODYX 4LYNA 1RE8A 1W7PD 1YXUA 3LHJA 3KVXA 4I02A 1AGWA 2Z99A 3BY6A 3ANQA 3FMMA 4I5CA 3KP2A 2PQ8A 5AX9A 4KIKB 2Y48A 4NKAA 3D5VA 5HLNA 2WEVA 4ZY4A 3GFIA 3IW7A 5CVHA 5B2LA 3RWPA 5L3FA 3FSFA 4IWPA 3ORTA 2HENA 5DT0A 4J98A 1KWPA 3TO9A 3RGFA 3U1DA 2KIFA 1OYIA 3MA3A 1KU9A 5CEIA 2BAJA 3DXPA 1XH9A 3K3JA 4D4SA 2J90A 3RYRA 5IPJA 1ERKA 1ZMVA 3TV4A 3D5WA 2VN2A 3MTLA 5AMNA 2OF4A 3F2NA 4MD9E 4A4OA 4IRIA 5CANA 4DCEA 2PPQA 3HX4A 1UNGA 4J8MA 2YM6A 2XASA 3LXNA 3ZEWA 4O6EA 4AN2A 4G6LA 2OICA 5IF1A 3HAMA 5C1QB 1K78B 2J5PA 2OFUA 4LGGA 4FL3A 2BIKB 3FDNA 3RZBA 2VO3A 5FRIA 4LG0A 3HOSA 2QLUA 3VW8A 4UZHA 5JMSA 4KSPA 5DRDA 1NVSA 4WSYA 4DTBA 3TUCA 2PZRA 3Q6WA 3A4PA 3OCGA 4G8XA 3SW4A 2C6KA 5EOBA 5FXRA 3WZDA 2R7BA 3GCSA 5CVUA 3U87A 3IWZA 3C13A 3M8FA 3V5LA 5IH4A 1EH7A 4C57A 1CM8A 2RFSA 4PV0A 4CKJA 3COHA 3RJCA 1Z6TA 1MRVA 4PTEA 2OIQA 3POZA 4QMNA 2ZB0A 5CYIA 2QQAA 4QTCA 4CCUA 1LNWA 4GCJA 5KUPA 1Q8UA 4IXAA 4U88A 3CQWA 3I0TA 4HZFA 1H9GA 3THBA 4NU1A 2DK8A 2VTOA 4JDJA 3A8WA 4UXLA 4X3FA 2WTIA 3EQIA 3FLYA 1SNUA 4E5BA 1R78A 3FI2A 1VZOA 4RB3C 2HIWA 3K1MA 3UP2A 4O6JA 4H58A 4UWCA 2PVJA 3U8WA 2ZXJA 4TWOA 4XRLA 4RIXB 4FG9A 4TYGA 1ZLKA 3E64A 1CKJA 2CPKE 2CCIA 1NA7A 3W2PA 2BYVE 3DY7A 3T8TA 1OBDA 2IVUA 2DUVA 2CNUA 4K2EA 5IQIA 2X8IA 2JTVA 1HW5A 4C4IA 3GFMA 4BR3A 5JRSA 3F82A 4I22A 4HJOA 4X2JA 3UMWA 3IQ7A 4FV2A 2LAVA 5BYLA 4M72A 4M15A 5EFQA 4FTTA 4I6FA 2C6OA 2PUNA 3KC3A 2XKCA 3IW5A 2EFOA 5ILUA 2XZSA 4FT5A 3KQ7A 3PWYA 3HTUA 2JDRA 3NCGA 3RDIA 3VBQA 3NCZA 3E5XA 2O0YA 4MEXF 3ALNA 2OD5A 4FV6A 1G8AA 4HGEA 1K7AA 3OOMA 5CEPA 4D4VA 5K3YA 3DBCA 3HDNA 4N9HA 5I4NA 3FPMA 1BI8A 2O8YA 4HAMA 4JAIA 2O3PA 3SZTA 2YDIA 5L2SA 3DZQA 4BDHA 3BU3A 4U79A 1L0OC 2BPMA 4O0XA 1O3TA 2V55A 5DEQA 3ATSA 1XN7A 3KF7A 2ITYA 4ENKA 2VBYA 2IZSA 5HE1A 3PVGA 3KRJA 5L3GA 3HHHA 3UQFA 5TOZA 3E6MA 3COKA 4FEXA 1FP1D 3PJCA 3R2YA 4ID7A 5FP6A 3OCTA 3AT4A 2UZNA 4KBKA 2WMUA 4WUNA 3PVUA 3FM5A 4Z7GA 5EW3A 1FP2A 5CALA 4L6QA 2W1EA 1MGTA 5C03A 2K27A 1DI8A 2UUEA 3A7GA 4LOPA 2OZUA 3V8WA 5IA4A 5A9UA 1VR2A 4X2KA 4IFGA 2ETMA 1F5QA 1UKHA 2OLCA 1H27A 3HMMA 4EM0B 4FYNA 1FZPB 3U9NA 3EFKA 4JL9A 4XV2A 3QZFA 3KRXA 4G6OA 3VBXA 4FTNA 1MKMA 4U5JA 4FV4A 3I54A 3PY3A 4FZDB 4H36A 5IDPA 2E1CA 2YX4A 2VTQA 1ZN2A 4GIIA 1FPUA 3FLZA 4BCOA 2ACXA 2QKWB 4GVAA 3O50A 2R2PA 4CYDA 4KYWA 5D10A 4G6DA 2EWNA 1B9MA 2BDJA 2AXLA 2MLKA 3HKOA 1R1UA 4JG6A 3QUPA 1MDMA 3R9OA 3WODF 5L6WL 3O3KA 3VB2A 3MEXA 4W9WA 5BQTA 2QKRA 3TNQB 5I9VA 3KK9A 3PSDA 5ANIA 4WIHA 5BUJA 4KICA 3MCZA 4I6HA 4DFLA 4FA2A 1OL7A 3PTGA 1UCRA 4J97A 4KRDA 4OTFA 1IRGA 1XQZA 4WXCA 4ASZA 3AGLA 5D5UB 2OA4A 1SVHA 3BHHA 3UZTA 2C0OA 1WKMA 4E1ZA 2IW9A 4KABA 3RNYA 4X21A 2V5QA 1MJ9A 2C6LA 4PZJA 2AC3A 4AZTA 2MLGA 5IH5A 5DR2A 4F6UA 2XAHA 3B8RA 4LUEA 4NM0A 4NZWB 2GZWA 2V0DA 4LB6B 4KT5C 3VUDA 3V7SA 2ZFWA 3PY1A 3A7HA 5BVNA 2A5YB 4C8BA 3FHIA 3F6OA 3AMAA 1ZYLA 3QQLA 4PTGA 3E6DA 3DOGA 3OWJA 2RGVA 1Q8TA 5AR5A 1ZG1A 3CLOA 5CSVA 2OJFE 4RIYB 2CKQA 3DK7A 4GG7A 2H6CA 4DCAA 1FYLA 4AW2A 3S0OA 4JX7A 4F08A 5DCMA 3CO6C 4NHJA 3AQVA 5JQ8A 4GIHA 4M12A 2P5KA 4JAJA 1NT2A 4PY1A 4X3FC 5AP4A 4DGLC 3UIXA 4C02A 5K4IA 5C4LA 4O0SA 2CLQA 2D2WA 4BN1A 2V7AA 3G73A 3WF6A 1DUXC 1ODDA 4C4HA 4TWCA 2VBXA 4TRLA 3AT2A 1FOTA 2Y0AA 3L8SA 3DJ6A 5IG1A 2OJIA 4HOBA 3ZLXA 2JDTA 2NAZA 3OEFX 2MH9A 5G1XA 2WD1A 4WRGA 4U7BA 3NMUF 3RJPA 2PK9A 4F4PA 2EB7A 1Q61A 4ZJJA 4HCUA 3PE1A 2M5WA 4L3PA 2PEXA 4ARKA 2EK5A 4YO4A 4Q4ZF 5IA5A 3R7UA 3QAHA 1G4DA 4I92A 2NNWB 4XLPF 3I6UA 3SKCA 2WKMA 2ETRA 3N9XA 3TZMA 1O3QA 1YDSE 5M4IA 4NIFA 4B99A 1SVGA 5HG5A 3LIJA 4BDDA 4AIHA 2UVZA 5IA0A 3UO4A 3HMPA 4IDVA 4L68A 3PJ8A 3PZEA 2A19B 1X3UA 2JAVA 1FOKA 3C4FA 5AONA 3B02A 4PMPA 1R23A 4IAIA 3TOBA 3EQDA 4JDKA 2R3FA 4YBJA 4M66A 5BUEA 4EC9A 2STWA 3RPVA 2VOPA 2EB3A 1S8NA 4BWPA 3WARA 4QMTA 4RBLA 3MFTA 4CEGA 3CTHA 5LMAA 2VTLA 3E97A 5EDRA 3PVBA 3DQWA 4MQ2A 3D15A 4FV9A 4YJPA 3FMEA 3GBZA 2C6TA 1R0PA 4QP8A 5LWNA 4P4CA 3I0OA 5C27A 3S2PA 3ZXTA 5CY3A 4O1PA 4B0GA 2M87A 3GU5A 3FC1X 5HX8A 3FMLA 3KY2A 2VT2A 2PVYA 5CU6A 4IQ6A 4D5KA 2H27A 3NYOA 4YJOA 3VUHA 3P08A 3VS1A 4E7WA 2YFXA 1B6AA 4IW0A 4BGHA 3CTAA 2WTJA 3CXWA 3WTWC 4D9UA 2JZYA 2QUFA 1BI0A 3DAJA 3OXIA 3RNIA 2BRNA 2C47A 3C0IA 1LDJA 2EFQA 1MQ4A 2YCSA 4FT3A 4B09A 4ACMA 3LFKA 3HRUA 4JR7A 2KKOA 1DS5A 1UFMA 3GENA 2YAAA 4IC7A 2R4BA 1H0MA 3H3UA 2NRYA 3OEZA 3R7IA 2Z9OA 3NNVA 3ZRMA 4X3JA 4JLCA 5GHVA 1Y6AA 4RVTA 3E88A 3M1EA 1OPKA 2EB2A 1BJAA 3PP1A 3ZSGA 2VO6A 3CUOA 2L4MA 1W0XC 1Z5MA 3B8QA 4OTWA 3EQBA 3LQQA 2LDUA 4UV9A 4HGSA 4M6YA 2PHKA 4RWJA 1A04A 4TNDA 1HKQA 5CVVA 3P7NA 3UVPA 3W2SA 3D4QA 4MXYA 2QLZA 4I93A 4EUUA 2EFWA 4H3BA 4QP4A 4ACHA 1OBGA 4I4EA 2X2LA 4HNIA 4PGHA 3U6IA 3R1NA 1BLXA 5M4FA 1CF7A 4AT5A 3CQEA 2PVMA 4CRSA 2XYNA 4MD7E 2W9FB 3NIEA 4BDFA 4DITA 4L18B 4LUDA 2FQ3A 4P9FA 3Q9XA 4I7HA 4YG2F 3FJQE 4EMSA 4O0UA 1OMIA 4KFCA 4U80A 3BE9A 1B38A 4ZTLA 4FHTA 5A2QK 3GT8A 5AP0A 2F2UA 2QC6A 2X9FA 2WMBA 4IJPA 2QQBA 3R63A 5L2IA 2E9UA 1P4XA 3ETAA 4ZSGA 4RJ5A 5E8IA 3PPKA 4MNUA 3NUSA 2OFVA 4U0IA 5F9EA 1OUKA 4QYEA 4U3ZA 4IX3A 1LEWA 3L9FA 3GO5A 1PYEA 1FQ1B 2XS0A 3OOPA 4YZNA 4N4SA 2GS6A 2X8EA 4PDSA 2B53A 3VS7A 4AAAA 4AZWA 3E8DA 3EFWA 2ONLA 4UN0C 5E17F 3VULA 5E18F 5EQPA 2PE0A 5A6OA 1CF7B 4H39A 2VD5A 2YEXA 5KMMA 1AQ1A 1GZKA 1FBSA 4KB8A 3QP6A 3K69A 4I0BA 3UOKA 3WTZA 4AVPA 1FGKA 2UZWE 1SVEA 1XDSA 3R1YA 3IOPA 5D12A 3HV3A 1H1WA 4S34A 2JDOA 4RB2C 1OB3A 3CPCA 4C3PA 4APPA 3WYYA 4IPAA 3JVSA 4C33A 4X2GA 4B8LA 3NDMA 5J8CA 2QOHA 1H01A 2Y6OA 1F1ZA 1RQQA 4A9SA 4K33A 4RB1A 5H6RA 5EHLA 4C37A 2PWLA 3K54A 4GFOA 3QQFA 1QPJA 4C4JA 1K2PA 3ABUA 5DA3A 4NCTC 4FTIA 3LFAA 2D45A 5BVKA 2F49A 4EJNA 3BV2A 1XGOA 4UMQA 5JFXA 3DP7A 3DLSA 2ZNYA 3P9JA 1W84A 3H0YA 3MIAA 3ORKA 4O0YA 2OH0E 4ZLYA 3TL8A 4XG2A 4U3YA 2YAKA 5HBEA 3MZYA 1F4KA 3I4PA 2J2IB 3CGFA 2O63A 4DFYA 4EOMA 3LXPA 3FZRA 5FTQA 2F9GA 2UZKA 3KVWA 2EVAA 3ZO3A 4NSTA 2W57A 4ZH4F 4EH6A 3U55A 5HEZA 4UYNA 5DGZA 5KMOA 3ODZX 3L9LA 5A46A 3VF9A 3QQUA 4UX9A 3PWDA 3BQRA 3MPMA 3ZYAA 2PMOX 4U9AA 2FBIA 3IG7A 4YFXF 4QMSA 5EDQA 5D6EA 3MW1A 3ROUA 4E3CA 3R4KA 5DIAA 3CR0A 4WNKA 2V79A 3H0ZA 5E8VA 3MY1A 4FSNA 3DV3A 2V6CA 4FSYA 3PE2A 3QQGA 3RKWA 4Y17A 1MD0A 4UMRA 4WCGA 3ZUUA 5E8SA 4LK1F 2B1PA 2ESHA 3I81A 3A2CA 4ZJIA 4E6CA 3O71A 4ENNA 3NAXA 3LQ5A 4Z55A 4RIXA 1XH6A 2ITPA 1UWJA 5AUUA 3WF9A 4IWQA 1R5GA 2WFYA 1X8BA 3PRFA 4II5A 4Y95A 3QRTA 4ZIMA 1M2QA 2CGWA 4YTHA 1XCBA 4U7DA 4A06A 4FTLA 4AD9A 4QTEA 5F94A 5EW9A 3RK9A 2EU9A 5DLSA 1WBTA 1EH6A 5HTBA 4ANLA 3F72A 2HY81 3ZCLA 3FPQA 2NP8A 2BEOA 3DPTA 2HTSA 3T1BA 4S04A 5KMIA 2QHNA 4IZAA 4Y85A 5DR6A 5BPYA 4EWQA 4K11A 3DFGA 2W0JA 1DPRA 1TKIA 2ITVA 4C35A 3FAAA 3L9NA 3S4QA 3AC5A 3E6BA 4RGXA 5CXHA 3V6RA 1XO2B 1D8JA 3OY1A 3GZ6A 5TJJA 4F9AA 3J81Z 1U5TB 4WO5A 2EA4A 4FR4A 4QOXA 2CNVA 5CZIA 4O6LA 4ZTQA 3UQGA 5EEGA 5ICGA 4R5SA 1WBPA 3I0QA 2K7LA 5A2QZ 4FSMA 2ERZE 4YJTA 5I9WA 3G9NA 2H9VA 2YM8A 3GLXA 4CT1A 2Y7JA 3QXOA 2C1BA 4RGUA 3Q9VA 5CVFA 2VTIA 5AP6A 2O6GE 4QMPA 2HW6A 1JSVA 1OYWA 1SZMA 3E63A 2F7EE 3A7IA 4FG7A 5LEKA 5CJ9A 1OL2A 4P2KA 2NRAC 2PMLX 3QX4A 3GOPA 4YR8A 4FTAA 2D1HA 4I20A 2YSRA 2Q83A 4W8DA 1GNGA 1APME 4FKJA 5D4SA 2XK8A 3DQVC 4HQEA 2ISYA 3T8RA 3P7CA 1WQ2A 5T68A 4EJOA 3H9RA 1PP7U 4DH8A 3HRTA 1YHVA 2E9VA 4X2NA 1QNTA 3E6CC 1W7HA 3FXRA 5AAFA 3VBTA 2Z7SA 4D2WA 3WZEA 3EQHA 3KMMA 1MQBA 3TKIA 4HCTA 4CYJA 4BF2A 5FTGA 4IH8A 1RNLA 5IU2A 2YJRA 4FX3A 3UG2A 5LCKA 2RQPA 5IT9Z 4M84A 4O0WA 3GB2A 5D41A 2X6EA 4KINA 4TYIA 2ITOA 5F20A 2A68F 5AIQA 5EQYA 4OMYA 5DHJA 3OVVA 4NFMA 5CF5A 3MWUA 4AGCA 2C3JA 5EDPA 3F6VA 3AAFA 5AP2A 4FVQA 3KN5A 2WQMA 4JXFA 4CTCA 4PUZA 4ALUA 3TG1A 5DI1A 4KIPA 2QONA 2VWIA 3LJ0A 5E1EA 3ZC6A 3DXJF 2GPHA 3V8TA 3BHYA 3JVRA 4KIGA 5HE3A 1M52A 3VRZA 3ZMVA 4HGLA 5HCYA 3C9WA 5M4CA 3TIZA 4K9YA 4XG4A 4M13A 3F23A 5AUYA 3UBDA 5L2TA 4IANA 3CJNA 1ZMUA 4WUAA 1SD4A 2A1AB 2OF2A 1YWNA 3VUKA 3WGGA 5L8KA 3BGPA 2WU6A 3ENMA 4E4XA 3SZPA 3F3WA 3DLZA 3MPAA 1GZNA 4WNOA 2XRNA 4Y46A 4BCHA 2VGOA 5E90A 3O7LB 3BYSA 2F4JA 2W1IA 2VE9A 3QZGA 4FNZA 2OBJA 4DEEA 1UA2A 3KZZA 3VBWA 4MVFA 3QD0A 4IZ5A 1O6YA 1FBQA 4UB7A 3BI6A 1HCLA 5AM6A 2BCJA 3DNEA 1OR7A 1IZ1A 2W4KA 4YHJA 3DAKA 4RJ4A 1E17A 3ORXA 5DFPA 2ZNZA 5D9HA 3WBLA 2HZ0A 4OOIA 4XRFA 3NUAA 1XDUA 2M45A 4XBRA 4Y73A 4H0EA 2UV2A 2AYPA 1ZARA 2ISZA 4QQTA 4YC8A 2W05A 3GFJA 2RC4A 2Q0OA 4HVIA 4IVDA 1KV2A 4FIGA 4AIKA 1NY3A 1GHCA 4Q2AA 4UWYA 3S2WA 2RDPA 4L3LA 4LGWA 2B0QA 4BBMA 3HUBA 5A14A 3ZC5A 1IAHA 2W5AA 2KRFA 4DEIA 4L9IA 1Q62A 4C4FA 4EM1A 2EFPA 1J7IA 2Z2WA 2G9XA 1QO0D 3LM0A 1IRKA 5HGIA 4ACCA 2ZMCA 3ERKA 5CWZA 2P4IA 3NUNA 3BWGA 5DMZA 4G3FA 3P79A 5JGDA 2PUPA 4V05A 2PUUA 2UW0A 4F0IA 4MH7A 4AZEA 5A4EA 3LA3A 1ZRCA 4S32A 2HXLA 5ETAA 2X0GA 5IEVA 2C69A 2GA2A 4A6EA 3EL7A 5FWKK 3WU0A 2QR7A 1OIYA 1J9IA 4ON0A 5ITAA 1FVRA 3QXPA 4Z7HA 2PYWA 3FLQA 5CENA 4ETSA 2BKZA 2VC1A 2G7UA 2QWWA 4L9NA 2H94A 2VBWA 1YQAA 4HV6A 2CGUA 4NCTA 4YSMA 3VODA 4BNCA 5C9CA 1E2XA 2OQRA 3IRRA 3TT0A 5EEHA 3A4OX 3QRIA 3RINA 4HF0A 4FV7A 5HLPA 2I1MA 2R3HA 1H07A 2B55A 5HKMA 4BBFA 3K0LA 1UHWA 3D94A 4PDPA 1PXNA 3OMVA 3QQHA 4ZJVA 3LQRA 5M08A 4HPTE 1VYWA 2KJCA 5HE0A 4ASXA 3V8SA 5HCXA 3TV7A 1PKGA 1UHMA 4E93A 4BQAA 4L43A 3HL7A 5EKOA 4OU0A 1Q8YA 3DAEA 5EI6A 3LJ1A 4FUYA 2XAFA 1Q97A 2VWZA 2OJ9A 2XKDA 3LPBA 4FVPA 1PP8F 1VEBA 4KIOA 1ZYRF 3G9LX 2CGXA 2DI3A 1G3SA 2NNNA 3HIFA 1IUYA 4L8MA 5AA8A 3N97A 4OMZA 2A3SA 1XGSA 2QQ7A 3AT3A 4BYIA 3ZBXA 2AUHA 2EXMA 3JAMK 4DH5A 5FBOA 3U4UA 2R3KA 5ANJA 1IN6A 2F7ZE 3G6GA 2VODA 3R8MA 4YZ9A 2YN8A 2VNYA 3F5PA 2HAKA 4YJSA 3TDVA 3KEOA 1XGNA 5KVRA 3FMKA 4H3QA 4EOJA 5C8KA 2C6IA 4EK5A 4ESJA 1P4FA 5HZNA 1Q24A 2HELA 4AWXB 4KDPA 2YM7A 4J7BA 4P5ZA 4XSZF 3H3CA 4XUFA 1FC3A 4WSQA 1PXKA 4FX0A 3M1SA 3EH9A 3W8QA 4BDJA 3H10A 4BTKA 1YXVA 1FWZA 3W16A 3CKXA 4BKYA 2RKUA 3Q4ZA 3C4CA 3FKLA 5D8LB 4IVAA 4JNWA 3ECOA 4L44A 4EKKA 3HVCA 4F0FA 4IVBA 2IT0A 4CZZA 2PMIA 3L8PA 3TACA 1M17A 3COIA 2QOFA 4RA5A 4UMUA 4Q5EA 4HOKA 2IRFG 2GQRA 3QP5A 4C3RA 4NQWA 5LJJA 1FINA 4PF4A 1BI7A 5HS8A 5JR3A 2WB8A 5IQDA 4WWCA 4KNYA 3V04A 3A99A 4QD6A 2OXXA 4EOOA 2ERKA 3C7JA 1OKZA 3M9AA 3TEIA 3PXFA 4D0PA 5K5OA 3A62A 3UC4A 4ITHA 5LVLA 3LA7A 1B6CB 4MXAA 1G6NA 3O2PE 3F69A 2XJ1A 4B6LA 3UIMA 2UW7A 5HD7A 3C18A 4GSBA 5H8BA 1OITA 3PUPA 2FNAA 4RZWA 5I9UA 4FL1A 1PXLA 1LB2A 3TJDA 3R8PA 4TYHB 3QC4A 2ZJWA 3WF7A 4CFMA 3F8FA 1Q1HA 4D2VA 4D58A 3WZKA 4XX9A 4U40A 3E87A 3UTOA 3RVGA 3G3ZA 2PG4A 1T0FA 1PXMA 5EYKA 4RIOA 4YLLA 4FIHA 1O6LA 5ED4A 1PXJA 4M3QA 5ERIA 2WMRA 4I0TA 2VTPA 2UZTA 3VVHA 3RP9A 2ZCWA 4YBKA 5L3BA 2OGVA 2QOOA 2J5FA 2O3FA 2QOLA 2WXVA 3W2RA 5DRBA 1IAWA 1W98A 5IUHA 4PRJA 1B39A 4V0GA 1H0WA 3F7WA 4QP7A 3SLSA 3D2KA 3RKXA 4J71A 5L4QA 3GC8A 4ZP5A 2XIXA 4CKIA 3CTJA 1LDKB 3OT8A 4D2TA 2X6DA 2XRUA 4EHZA 3LJ2A 1KU2A 4NH1A 3S3IA 2XMYA 5CQUA 4BCJA 2R3QA 1MRYA 2ZYBA 4CG9A 4XCUA 5CI7A 4R79A 2HTJA 5BOXA 3ZS5A 4LOQA 1FVVA 4NW6A 5J9LA 4UNOA 4RX5A 1Z7UA 5JHUA 3ZP5A 4K6ZA 4GK2A 4JI9A 2JD5A 1BKXA 4AX8A 2WMXA 4UV8A 2UXXA 4K1BA 1RDQE 1BL6A 2FGIA 3F88A 5HVYA 4KUMA 1I27A 5LGTA 5TT7A 2Y0MA 4F09A 4BDEA 2W17A 4L42A 4TZRA 4EJVA 1KYWA 3C51A 3FY2A 5AP1A 4GUBA 5M57A 3MVLA 3C4EA 3RK7A 2E7WA 4FV3A 1F9NA 3DBFA 4PQNA 4HF1A 1IASA 3QTXA 5AR7A 3BBWA 2ZMEB 4USEA 3OFMA 3FZ1A 5EK7A 2Z3YA 2VC0A 4NM3A 2ZM3A 5HESA 4HNFA 2BGCA 3I7BA 3L1SA 3UYTA 1G3NA 4O0RA 3J81K 3U4WA 1R22A 3V51A 1Q3DA 4EH8A 3SW7A 3B2TA 2GNGA 4RGRA 2FSWA 5J1WA 1VTNC 2VV9A 4BVUA 2FSTX 4NTSA 1R00A 2VTJA 5KCVA 4MXOA 3EZRA 3MH3A 2BTRA 4EZ5A 1FPQA 2UVYA 5HLWA 3UZRA 2K86A 4OAUC 3R28A 5E1WA 4J99A 5CI6A 3HMNA 3QRUA 3LXLA 4NKSA 3W2CA 3OP5A 1MP8A 4BB4A 1NW1A 2HGCA 3WTXC 3TNPC 3BGQA 3P86A 2OBPA 3V4GA 4IRHA 2OXYA 3FX3A 4ZZMA 4HV5A 4J52A 3KXMA 2W9ZB 3PA5A 2XH5A 4XH6A 3HRFA 3U9GA 3PRIA 1Q41A 1SFEA 3EFJA 4A9TA 3DPLC 2CYYA 2WMVA 3T3UA 5AV0A 3ZXZA 2BHEA 4FZAB 3VQUA 4FTQA 3KLNA 5B0XA 5GIPE 1XKKA 3HMIA 4FT7A 4KN4X 4AFEA 1PDNC 5J95A 3UVRA 2IZUA 5AWMA 5J79A 5IQHA 4NB5A 4XV3A 4A5NA 2FBKA 3QFVA 3IKVA 4U81A 5DN3A 5ANOA 1ZYDA 3IRQA 5EG3A 3IDCA 3EKNA 2FE3A 2OJJA 4BHBA 2JDVA 3KL8A 4FV5A 4G34A 4CYIA 3C1DA 2O64A 3BKBA 1DAYA 4AOTA 3LFNA 4F7LA 3ZN1A 3CO7C 4E8AA 3GXOA 4D55A 3KREA 2BR1A 4U0VA 3VUMA 5TR6A 3Q2MA 3LAPA 3CEKA 4AWIA 1QBJA 4GU6A 4AUAA 5IQAA 5JSMA 3TUDA 2LKPA 2PE1A 1SD7A 3HA8A 3ECHA 4KIBA 2Z60A 5BVFA 1P14A 4GYGA 1J75A 1REKA 2RF9A 4M7IA 5EM8A 3NVKI 4IC8A 2HR3A 4IX4A 3VUGA 3PA4A 1J1CA 1SYKA 4G2FA 4MTDA 4GJ3A 4M67A 5A6NA 5K1YA 3MVMA 2YM5A 5CAQA 3OW4A 2YZLA 3DDPA 5HIDA 4DG3E 1USSA 3H3ZA 5A3XA 4GK3A 3AC8A 1ZXEA 3DBEA 5AAEA 5LHIA 3H30A 5CLPA 4GW8A 4FKTA 4I21A 2DYLA 4V04A 2YR2A 5HORA 4IX5A 4S33A 4M8TA 4ORKA 4QP1A 2P7VB 4E6AA 3LFFA 4LG0B 1PXIA 4RX7A 5AEPA 2FSMX 5L3EA 4E73A 3FWEA 2CMWA 1IEPA 2XNBA 3J80Z 3PPZA 1FYKA 2HQRA 5KKRC 4A12A 3R7GA 4BHPA 3UGCA 4OTGA 3DT1A 4L9JA 2EXCX 2GXGA 2UWMA 4XOZA 1SMTA 3QA0A 3F9NA 2H96A 2X2MA 3DKCA 3VUTA 4HCVA 2GNIA 3WE8A 2YDKA 4BKZA 5AR3A 2BZJA 4E4LA 3GC9A 3QKMA 4ZY6A 1OVEA 3L8XA 4R8QA 2ZV7A 2G1TA 3UOJA 2ZJ2A 1I44A 5HOAA 5HBHA 3KXGA 4L5JA 3I1AA 1TQPA 3KZYA 3JR1A 4ZK5A 2XKFA 5D7AA 5C26A 3ZUTA 4U44A 4M97A 3L9MA 4OBPA 4EHVA 4HYEA 2GWRA 4I98B 4R77A 3EWHA 2VRXA 3ZM9A 4CGZA 4DA5A 1YS7A 5CZHA 2QO9A 5DR9A 5M55A 3NNUA 2JLDA 2JFLA 4AACA 2YIYA 4EH3A 3FEGA 3P9CA 1WBSA 4XRJA 2J0JA 2A4LA 1P92A 3R7OA 3EN9A 2R3GA 3QC9A 2CGPA 4K0YA 2GNFA 2VO0A 2XUBA 5IT9K 3OTUA 3CY2A 1R58A 3UOLA 3D5LA 3ELJA 3G33A 3C0HA 1ZY4A 2JRTA 4Y13A 5EM5A 1YXTA 4IM3A 2Y4IB 2ETHA 4YTFA 5DUKA 4HGTA 2Y75A 2D1VA 1M2RA 5CAPA 2VT3A 1H26A 4FVRA 4WT6A 4DLIA 1R7JA 3CSVA 4AW0A 5EYMA 4CDGA 2PMHA 4MCVA 4KMFA 4RAYA 3NW7A 2EV6A 5FEQA 4PGGA 3F61A 2ESNA 2YA9A 2GMXA 4O96A 4FV0A 4F1OA 1XGMA 5EW8A 5DPVA 4O2ZA 2YLFA 1PXOA 3GX4X 1U5TA 1YDTE 4RC2A 3J80K 1KE6A 2MC3A 5FLFA 2ZAZA 3UG1A 1P4AA 5AR2A 3I6WA 2Y6MA 3QQKA 3IGGA 3PFIA 4F1MA 3GUBA 3MS9A 3QA8A 4JQ7A 4ACGA 5LVMA 4UYAA 4N6ZA 4UVCA 1XBCA 1YI6A 2GS2A 3BDDA 4RLKA 2YX7A 1U3EM 3D7ZA 2IW8A 4J96A 4UMPA 3HECA 4FZFB 2J0MB 4KSQA 4RJ7A 3Q52A 3C3WA 3UC3A 3LQ3A 5CT7A 2P8TA 4C62A 2H6DA 5FFXA 4NUSA 4EORA 1GJOA 3BYMA 2EA2A 5FGKA 2PLYA 4EONA 3W2OA 3VS6A 2W1CA 2IW5A 3FQSA 3FXWA 4MNEB 2IZTA 4UXNA 3QU6A 2C5NA 3DDQA 4ZYHA 4I0SA 3MFUA 1DM2A 4E70A 5L6PA 3HDMA 2B9JA 3L9PA 3BELA 1YTYA 3M7GA 4LK0F 3ZBFA 3FYKX 2NO3A 3R02A 3U6HA 3NQOA 4C58A 4D4YA 3C7QA 2EWAA 1QPEA 4BHZA 1GIJA 1SAXA 1HBXG 3FHRA 3RK5A 2JKKA 2DS1A 2HCKA 4O38A 1UV5A 4BDCA 1A9UA 1U78A 4OBOA 3BU6A 1T39A 4ZTRA 5KX8A 1H1RA 3QBNA 4Z16A 1PW2A 3DBQA 2ZMDA 1H00A 2XVDA 5ANGA 4CFNA 5FD2A 3Q5IA 1CMKE 5D6FA 1U5RA 4EWHA 4EBWA 4JDHA 2FB8A 2P3GX 3L7WA 4BH9A 4QRCA 2RKHA 1OMWA 5LHGA 4O84A 3OW3A 3HV5A 2YM4A 2ZM4A 3ORMA 2F7XE 3QL8A 4G17A 2W85A 4BXUA 3MY5A 4WXDA 2JGZA 1UVRA 2R3PA 3U2RA
chains in the Genus database with same CATH superfamily
2BFXA 4I41A 2PZYA 2J5EA 3DNDA 3HOTA 3QHWA 2XAGA 3KP5A 2ZDUA 2C5OA 2GHLA 1VQKI 3V8KA 2LYCA 4EH7A 3AGMA 4BGQA 4CZTA 3VF8A 1U8RA 3PJ1A 3TJCA 1Q1VA 3FLSA 4ZMEA 1RJBA 1GOLA 5IEYA 4RM2A 2IG7A 3SGCA 4IE9A 4FKIA 3CPBA 2ZMEA 4ZZLA 4RQKA 5FLXZ 2CUZA 2B9HA 2NNYA 2C6DA 2OKRA 1TNSA 5H8GA 3R7VA 3RQIA 2MBFA 2AQFA 1BIBA 2QG5A 4B7TA 3SJMA 2QCSA 1IXSB 2FEZA 2JKOA 3L2QA 3ORIA 2O9LA 1BR1A 3UKGA 3W0PA 3KXNA 4AQKA 4FODA 4RZVA 3HA6A 3FI4A 2K02A 4LV7A 4F52A 3QYZA 3PIZA 4G6QA 2WIHA 3KGAA 4Y15A 4U0YA 3M1CA 4BEHA 3UNZA 2BALA 5E79C 4RB0A 3GU7A 5LD2C 2DMTA 5DNRA 5J1VA 4MD8E 1WVWA 4XJ0A 3MH1A 1T45A 3RIRA 1ATPE 3VJOA 3PO3J 2MD0A 3MN2A 5IQBA 3WTVC 3LMGA 3MBLA 3GWZA 4DF3A 4YZBA 4F70A 2RN7A 2JITA 2KT0A 3S8PA 4LLLA 4H1MA 2WY8Q 2UV1A 5HVJA 3VS0A 1H9TA 2PVKA 4L7SA 5AUXA 3L2RA 4HF2A 1W5TA 2MA3A 5H9BA 3L2CA 1ITYA 4D7MA 4ANBA 1Y6BA 5M07A 4XG9A 3RI1A 1OQYA 3W0OA 3AG1H 1GY3A 4F92B 1FVTA 2BZKB 4O1OA 4U6RA 3ZMMA 1SVMA 4EOPA 3NIZA 4OW8A 3ZOSA 2ZDTA 3LVPA 2DT5A 4LGDA 4YC3A 5KHDA 1J3HA 2OU7A 4UUTA 3IV5A 1ZG5A 5IEXA 1YI2I 3HUCA 5IQFA 1QPMA 3PQJA 3FLNC 5BYZA 3IWFA 1IC8A 4IB0A 2WQBA 5J9YA 2L5QA 3VHKA 2DFEA 1OPCA 1YO5C 4LOCA 4G1WA 3BYUA 2FNPA 4JIKA 4PDOA 3D14A 5JRQA 5KMLA 3UPXA 2WB1A 3UMXA 4FKSA 1OYYA 3KEQA 4B8MA 2O03A 3ZLWA 2LF8A 2VONA 2CHLA 1WRJA 5AV2A 3NRVA 3RCJA 3B6CA 3O5AA 2BBYA 1HCKA 4AA5A 1V0BA 1JQHA 2IVMA 5FGMA 4EVIA 2OW3A 4NWMA 3IKAA 3BGZA 4MK0A 1YHWA 1K6OA 4FE7A 3ZQLA 3RTRA 3E8EA 5CYVA 3UE4A 5KKRB 1F3MC 1OI9A 4MBIA 3W32A 5HO7A 4O7LA 3AL0C 4JJRA 3OR2C 3W0NA 4ZTHA 1WJCA 4FTRA 4FEUA 3BE2A 5HNIX 1UU9A 3GTKJ 5H2FC 3HSFA 4YLJA 4DT9A 3CJRB 1WI9A 4EZ7A 3J7AO 4PP7A 3HAVA 3BCEA 1DPUA 2JPCA 2WEIA 4C9YA 2KLOA 4EGYA 2GM4A 1Y8GA 2C3IB 5DD4A 3VBYA 4U0WA 2O8XA 5IYDJ 1W2DA 4FBXA 4DBXA 5LHHA 4ZSJA 2UXNA 4X0MA 3C5UA 3DK3A 3QD4A 4EOQA 5BUIA 2CFXA 4L46A 1K3AA 4HVGA 1OCTC 5HHWA 2CCHA 4G9YA 3HSEA 3RSNA 4OGRA 2AXTC 3OZ6A 1FBNA 4QWQA 1FMWA 5HD4A 1GUUA 4E7SA 3SC1A 1Q3WA 5C8MA 1TQMA 2DJIA 5ICEA 4FSTA 3PJRA 2P55A 3I59B 5HS9A 3IO7A 3IDBA 3PJ2A 3DPKA 4PPCA 3RPRA 4E4NA 4L5IA 3DU8A 3KULB 2XRWA 2YCFA 2KRCA 4OTQA 3VS5A 3A1YA 5AFVA 3D7TB 3BCBA 4M0ZA 5FKOA 2ITZA 2L4AA 4RC4A 4TKSA 3LSMA 3IW4A 1OFCX 3K4JA 3V5WA 1NG7A 3MFKA 4GL9A 4FYOA 1GDTA 1XG1A 5ETIA 1FEXA 3AMBA 3RM6A 3LA2A 3FXUA 2XK3A 4O83A 3ML1A 3DKGA 4IHVA 3EOCA 1ZGJA 5GPAA 1PJRA 3W10A 3OUKA 4JQFA 2HOTA 3BQCA 2R7UA 3O8UA 3OYEA 1YKRA 4CA0A 1KU7A 4BDGA 4U45A 3BLHA 2ID3A 2LVSA 3NNWA 1H8FA 3WILA 1IG7A 4OTRA 2IBDA 4M68A 1PMNA 3CY3A 3EQPA 3NLBA 2W06A 2GSFA 5JLWA 2ZXHA 3TO7A 4GUEA 1MSEC 4G3CA 5KZ0A 2P6TA 1GVDA 2Z8CA 4IHSA 4YURA 4O7YA 4FTOA 3P5JC 4LFUA 1TWCJ 1YG2A 1Z6RA 2OI4X 1ZOEA 3C2GA 5F95A 1S9IA 1W83A 5IUGA 4I1ZA 4BRXA 1NK2P 5B3SH 1OIQA 1BBYA 3O17A 3R71A 1A48A 2PL0A 1YX5A 1S6LA 3TDUC 4AZSA 4ANSA 5K5XA 1GIIA 5LVNA 3D2IA 4D28A 5D5XB 2NOGA 4RDUA 3MFSA 2Q2EA 4KKHA 3KU2A 3R9HA 4KJZA 2X7OA 4UV0A 3TOAA 3E8NA 1FNNA 4OINF 1UNLA 4PJNA 2YM3A 4AIDA 5DE2A 1Z77A 4DNCA 1KE9A 2IJMA 4HVDA 2M0MA 4FMQA 5AJQA 5CNNA 4BE2A 2CW0F 2J51A 4ZSEA 3HRCA 2W00A 2LFBA 4XP2A 4DC2A 4RS8A 2X7FA 4C4EA 3NEUA 3S1RJ 3K70C 4JG7A 5KCMA 4TYEA 3MN3A 3KN6A 4I24A 5M09A 4U7ZA 3L09A 4CQEA 5M3FJ 3CP2A 1PY5A 1JAMA 4CFWA 5LQFA 4KA4A 4QNAA 4DTAA 2H6BA 5DWRA 3KXXA 3G0EA 3QYWA 2VUWA 4OLIA 4EQCA 4ZYEA 4GKHA 3V8JA 2XAJA 2OXDA 5C01A 3CZ6A 4O5VA 2G2HA 4BWXA 1A5JA 4XICA 2K3FA 3PLAE 2C4GA 5LMKC 4BTFA 4IADA 5J7HA 1HKTA 3GCVA 4DQ2A 3K2LA 3QCXA 3S16J 3QGWA 3ENHA 3MH0A 4YHFA 1Y56A 1L8TA 3O0GA 4NBQA 2R3NA 1W8CA 4XLCA 1LPUA 2LY9A 5DEYA 3Q0WA 1HKSA 4JK1X 2WADA 3BJAA 3W2AA 3AG9A 1GZ8A 3BZCA 2R9SA 2R5YA 2JT1A 2QQ8A 3EQFA 3MV5A 2MGQA 3H9FA 1ZYJA 2E2HJ 4JT3A 4R7IA 3SHFA 1OGUA 1FMVA 4LFIA 2W5HA 1W5SA 4A3DJ 2UZUE 5L8JA 4AGUA 2RGPA 2W25A 1WBWA 3PLSA 3BZKA 4EATA 3OBGA 4YPSA 3T9IA 3TDWA 4FEVA 4UHTA 3LKMA 2H8HA 1R39A 4C36A 4DH7A 4GJ2A 1PHKA 1BI1A 2UW4A 4HNTA 1LVKA 4XRSA 1RZ4A 3BROA 3RPYA 4LL0A 3GU4A 5KZIA 2HYFA 2WY7Q 3GP0A 2B7EA 4B9DA 3R22A 3SG8A 2VXZA 3VEPA 3R73A 5FM2A 3HB9A 1Z67A 3SDBA 2ITQA 1O3RA 2Y4PA 3PO2J 4BACA 2IA0A 4I5MA 1E0EA 2XUUA 2OWBA 4A3MJ 1XH5A 4IVCA 1Q8ZA 4EK6A 3QCSA 4EHGA 3ROYA 1FY7A 2J6MA 3Q2JA 4BZNA 4F55A 2QOIA 1V5FA 3BEGA 4CLJA 4WG3A 2DA7A 1B9NA 3CIKA 3MFRA 1A35A 4R1VA 5AR8A 2GXAA 2OQGA 2WMTA 2QOQA 1YXXA 5M5XJ 1WJ5A 1YOLA 1MMAA 1BL7A 1L3RE 5HOOA 2AC5A 3ZO2A 3ERED 5DOSA 4BIEA 2GNLA 2WQOA 4A3JJ 2DDBA 3FI8A 3UYSA 5F4NA 2BAKA 3RAHA 2WPAA 3HHGA 1S7AA 2GAUA 2ZBKA 3PXKA 2CGVA 2XBAA 2QI8A 4IZ7A 3DTIA 3OV8A 1MMGA 2IA2A 3GUDA 2OK1A 2D5VA 2WTVA 2FA5A 3H9JA 3NEWA 3OS3A 5L2WA 4CFXA 2OTJI 1IW7F 1JNKA 4PDKA 2VKVA 3GTPJ 1Z05A 4B3AA 3BPXA 1OCCH 3P23A 4DT8A 1SMHA 5KBRA 2DMNA 3DU6A 1YRPA 3V5PA 4BJJA 2F5FA 4WG4A 3AD4A 1PMEA 5J8FA 1KE7A 4GT5A 2DWBA 3FMSA 4DN5A 2W4SA 3P1AA 4O2PA 2EXEA 3SOAA 2PN6A 1DQUA 2LR8A 4RRVA 4CRLA 1NHAA 4KKEA 1VYZA 1SNXA 4ZEGA 3ZMSA 2BY2A 3CJGA 4JG8A 4UEUA 3KEXA 2CUFA<