1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
1A9UA 2ELHA 5EFQA 3PP1A 3ZSGA 5L2IA 5EEGA 2W4OA 3GXOA 4C4EA 4PMMA 1FT9A 2PZYA 3VO3A 2UVZA 4EQMA 3VQUA 4LOPA 2UZUE 5L3FA 1LDJA 3OV8A 2QU6A 3LQ5A 4CFVA 4F7SA 5AR4A 4HCTA 3C3WA 2CGUA 1G5SA 3O8UA 2C6OA 2GSFA 5C4LA 3PJ1A 4RGSA 3CR0A 2WMAA 4EZ7A 3QC9A 3RPVA 3K2ZA 2W7XA 2BRMA 1PY5A 4TWCA 4HGSA 4CGZA 4DFUA 5FUTA 5GIPE 2ZB0A 4J8NA 4FSMA 2CN5A 4D58A 4YU2A 5CWZA 4EYMA 4OTRA 1W82A 3MVMA 1XQZA 3WODF 5FTQA 5M57A 2YERA 5IDPA 2BRNA 3WU1B 2ZM1A 2ITTA 3QTZA 3OOPA 4FTKA 2V1UA 3LQRA 4F1MA 2ZYBA 1YWRA 4FV0A 5BMMA 1LDDA 2OG8A 2HZTA 2Z8CA 3FPMA 3TNHA 3HIFA 4KS7A 2ZM3A 5IQFA 5DN3A 1A04A 4OT5A 3V04A 3FZ1A 2B0LA 3Q4CA 4L18B 3V8TA 4OBOA 3Q3BA 5HS8A 3HHGA 5FFZA 3A61A 3UODA 2E1NA 5B2MA 3KP2A 3DNEA 5LHGA 5F9EA 4FKJA 2C4GA 3ZRLA 5EQPA 3IDCA 3LVPA 5T3QA 3FWEA 2CG4A 2UZNA 4QTAA 3ZFXA 3KXGA 4QMWA 4HV6A 2XK4A 4L52A 2VOPA 4RGXA 2C6IA 4XLNF 4TYJA 4MQVA 4M68A 4QRCA 5BUEA 4FZFB 3LFCA 2HWPA 2WMWA 4AW5A 3U9GA 3RM6A 2XK7A 3CDHA 2XROA 2VTHA 3FHRA 1YOLA 5LCJA 4HYEA 4M69B 3U9CA 5C03A 3RK9A 4D9TA 4C34A 3MB7A 4BGGA 1OMIA 2C0OA 4BYJA 2ITWA 3IW5A 4CLJA 1SD6A 5BVNA 3K1MA 3MS9A 4ZOGA 5ED4A 1X3UA 5E8ZA 3ORNA 4UYAA 1XR1A 5FXSA 3WTWC 5EQEA 3PQJA 3HRBA 4H1MA 3HP2A 1PMNA 3R04A 1O6YA 4A9UA 4BI2A 3ZXTA 3PP0A 1J2XA 3QZFA 3BHTA 2B55A 4PDPA 5L6WL 4DF3A 1FNNA 4ENYA 3NVKI 1W4MA 4AN3A 3AAFA 3OCSA 2E7XA 4LFUA 1U54A 4KIQA 3E7OA 5FEDA 4RT7A 5F1RA 2XVCA 3FI8A 1GXQA 2W1DA 1RZ4A 1V0BA 4R5YA 3WE2A 1R1TA 1W5TA 1FC3A 3FZPA 3N4VA 4ZTNA 2WMTA 2BZIB 5JSMA 2EFOA 3R0TA 3UIUA 1H24A 2C5YA 2NRUA 5EYCA 4AOTA 3GXLA 3FYJX 3R83A 4L01A 4M6XA 3G2FA 4XP0A 5J87A 4EM1A 3IW7A 4XP2A 4E26A 4KA4A 2VO6A 4KIGA 1A06A 4G3DA 2XCKA 1S29A 1J1BA 1YLFA 2YN8A 3NDMA 3W8QA 2DQ7X 5HU9A 4O7ZA 3D83A 4IF4A 4XOZA 4BDAA 4A4LA 1XN7A 1KQ0A 2JIVA 3AC3A 3OEZA 3P4KA 4F7ZA 3A7IA 2P7VB 3I5NA 5E1SA 4EH4A 1UHMA 4IWDA 2WU7A 5KHWA 2JLDA 3ABTA 4OTPA 5FRIA 2CSOA 4YFXF 4DN5A 2FMLA 2PVJA 1KU3A 2ZMCA 4JX3A 2Y4PA 3W55A 4H0EA 2W4KA 4O2PA 3KRLA 1CTPE 2Z5UA 2VNWA 2BV6A 3EYHA 3ZDIA 4MK0A 2HOGA 3RPRA 5L2QA 2BGCA 2CQKA 2NP8A 1XH8A 3FXWA 3KXZA 3WOWA 3BELA 5BYZA 4ACHA 2KKOA 3IONA 4JBOA 5HNBA 3MA3A 4GUBA 3ECHA 4EOIA 4ZXTA 3QPTA 4RGRA 3DPKA 4KB8A 3P78A 4HDUA 1TW2A 5ILSA 5AP0A 1FINA 4LV8A 3EQDA 4IDTA 3UJGA 4ERKA 4CO8A 3V5TA 3LPBA 4RB0A 2ESHA 2JT1A 4O1PA 4GKIA 2BZJA 4UUVA 2V62A 3HV7A 1B59A 3PXZA 3TZ7A 3R60A 3JAMK 3PQKA 3LA7A 1J7KA 3BIZA 3CY3A 3Q9WA 3SV0A 2YACA 2ESNA 3PPKA 3VBXA 3R2YA 3VHKA 3ULQB 4CEGA 4ZYDA 4G94A 4J1RA 3REPA 5F64A 3LSTA 1FVRA 1WAKA 4ZTHA 3P9CA 5IUGA 5HG5A 2G2HA 2HQNA 4YHJA 4B8XA 3C4XA 2H27A 4CQGA 2ZAZA 3PA3A 4YUQA 5A2QK 3TACA 4O7SA 4UZDA 1BUHA 3E8NA 2P6TA 4CYDA 1XH7A 2VBWA 3C4CA 4YLKA 2VTRA 4M69A 4HYUA 3ZLXA 3MFSA 4L3JA 4EM0B 1HXDA 5H8EA 4NJDA 2UWMA 5TOZA 4GJ3A 1DI9A 5CSHA 5M4FA 2QLUA 4GV1A 1H1QA 4DFNA 4ZSJA 2VWWA 4LQMA 4OT6A 4ZSAA 3AGMA 3QX2A 5IMXA 4O86A 3KREA 3H9OA 5IEYA 1CKPA 4IANA 4G6NA 3CQWA 3PZEA 4XCUA 4ZSGA 5BPIA 4CV8A 4RWKA 5I4NA 2Z3YA 5FTOA 2OJFE 2PVKA 1GZKA 2CHLA 4OU0A 3LAPA 3U51A 1WQ2A 4HLYA 3BYOA 3UIBA 2C3LA 1CKJA 3QD3A 4FV6A 5BVWA 3C18A 2PK9A 3RPQA 2W1GA 4EJWA 2WNTA 2I0HA 4EHGA 3AD6A 2EB2A 1H1PA 4QP7A 3FQSA 1ZRZA 4PCQA 1PP7U 1P4OA 4E7WA 4V01A 3OD6X 3NYVA 1ZMUA 2UW6A 1AD5A 4GG5A 4KKEA 3QU3A 2DW4A 4BZDA 2H96A 2OXXA 3IQ7A 4YJOA 4CSVA 4JAIA 3KN5A 5I5ZA 3ZUUA 5KVRA 4YSJA 3QWKA 3F8FA 3EN5A 5KE0A 1U5TC 5A4LA 3RCDA 1L3RE 2XYNA 3MVHA 3OY3A 4RA4A 5KO1A 1RI7A 2OO8X 1GIJA 1MJBA 4DTBA 3EUHA 2A0CX 3DXPA 3I53A 4IXAA 4EOMA 4MNEB 4BQAA 2HTJA 3NZ0A 5HIEA 3LJ0A 3QC4A 3R02A 5L3EA 3IS5A 3F9NA 2B0QA 5DH3A 5AADA 4FZDB 2PE1A 2R7BA 4WIHA 4FKQA 4R3PA 2F5DA 4KIKA 3FMQA 4NB5A 5HBHA 3UP7A 4FIJA 2OGVA 1BIAA 2XNMA 1ZZ2A 5M4IA 1BX6A 3F66A 4IAZA 2X2LA 4QTDA 4PY1A 3L1SA 3C0GA 3F5XA 5JVTA 1H07A 2X9EA 2XBAA 3KEXA 3FLWA 3CD8A 3N4UA 1IRFA 1I5ZA 1OR7A 2IW8A 1ZOGA 3BE9A 1FOTA 4RIYB 3BWFA 3VOEA 3B8QA 3UZPA 3DBFA 3TZ9A 4FZ7A 2CNVA 5JRSA 5GJDA 4BICA 5K4JA 3VAPA 5DGZA 2WMUA 5CANA 4IC8A 5B2KA 3O7LB 1F4KA 2PVFA 2IWIA 3HUBA 3CD3A 4G1WA 4C4HA 1KOAA 2VGOA 4RC3A 5KMLA 2GFSA 5BVOA 4ACDA 1JKLA 3B2WA 3HL7A 5CVJA 5GJFA 4FKVA 5CXHA 2BHEA 1PYEA 2ZM4A 3PXFA 1WBVA 3RKWA 3BGQA 3FI3A 5A9UA 2BR1A 3ZSIA 3RGFA 3DTCA 4XG9A 2X8IA 5AX9A 2ISZA 4IB3A 4D2VA 4Y72A 1YI6A 1OZ1A 3D7ZA 1FP2A 1PDNC 4XYFA 3C4FA 1WVWA 1H1RA 3EHAA 3VC4A 1KSWA 3TIZA 4JBAA 4MF0A 1PXNA 3I4PA 3LE6A 3MJ2A 3E3PA 3LFBA 1X8BA 4FTOA 1ULYA 4G8XA 2XNOA 5HQ0A 2GTNA 3LZBA 1KYZA 2W57A 4KSPA 4O0VA 3BROA 4EWQA 3P0MA 4XRFA 4I22A 5IT3A 5DT4A 3NW5A 3NUAA 1EH6A 1PMEA 3HEGA 2EFWA 2UUEA 4DBXA 5ILVA 1OL2A 3KULB 1UVRA 1XGNA 1DUXC 4YTCA 2PUNA 4ZJJA 3MI9A 4XG2A 2BTRA 3G73A 2GU8A 1OECA 4OW8A 3C5UA 2C6KA 4UMUA 4DG3E 1R36A 2ETMA 5D5UB 3HGKA 3MSSA 1OYIA 3E6DA 4PP7A 4TYHA 3FI4A 4FKPA 3Q6WA 2X4HA 3SXYA 3DXQA 1ZRCA 3G3ZA 4Q4ZF 4AU8A 4F0GA 1B4AA 5ACBC 3FQEA 4S05A 4L44A 3OUNB 1J7IA 1KV2A 4D2RA 4RIOA 2ITPA 2R3MA 5FEQA 2K02A 3GW2A 4GH2A 2XA4A 4GRBA 2JKMA 4EQCA 1G8AA 1I09A 3BZ3A 1KGSA 4K6ZA 4BCQA 3CPCA 1XSXA 2GHLA 5TF9A 1NHAA 1DM2A 1VJYA 1K7AA 1GAGA 4F64A 4ZZMA 1BI3A 4FTTA 4PL5A 3CJNA 4QYHA 3SKCA 3P08A 5LWNA 4I93A 4RGUA 2BHHA 4GW8A 4RIXB 4YZNA 5LGTA 3CY2A 2OK1A 1O6LA 4FZAB 3FYKX 3BJAA 4C4GA 1M7NA 2CFXA 2G01A 3UOLA 4FICA 3O7LD 2JKQA 3CTJA 5GHVA 1E1VA 3IECA 2CWEA 1Z7UA 2EU9A 1NW1A 1LEBA 3QU6A 3EIDA 4WNMA 2XKDA 5BYLA 1AOYA 1BL6A 3GFLA 4X7QA 4RS8A 4JVGA 4BYYA 5DRBA 1BI2A 4U0IA 1BLXA 3R8MA 2QG5A 5DCFA 3DCVA 5DNRA 3VUIA 4QD6A 2J9MA 3R01A 2UW9A 3RZBA 2ERZE 2HZNA 4P5ZA 2EFPA 5K0XA 1O7LA 3I59A 2W1HA 1YXVA 1Y91A 2DUVA 3LJ1A 1PHKA 3ULIA 3KP5A 4NJ3A 5I3OA 3L8XA 3UOJA 3SAYA 4PWNA 3W16A 3BDDA 3MAJA 3FBVA 3FMLA 2C0IA 4XOYA 2GHGA 4UY9A 3WF8A 4IAAA 4AN2A 3IDPA 5EI2A 4R7IA 3KZYA 2P5VA 4CMTA 1E1XA 4LMUA 2FSMX 2X39A 4MEXF 2VOOA 3QGWA 3R00A 2JPBA 4C02A 4YJVA 4ZJIA 2VTTA 4LL0A 3KXHA 2R3KA 4AP7A 1HQCA 1ZGAA 3ZBFA 4EJUA 4WKQA 4QP2A 3ZMSA 2XZSA 2WAJA 3D0SA 1J3HA 3DP7A 2VN2A 5GNKA 3EQLF 1UU7A 2ZB1A 3GGFA 4NEUA 2Q8KA 4ORKA 4JIAA 4U8ZA 4USFA 2QKWB 3UNJA 4AX8A 1GZOA 3Q32A 4IEBA 3AT3A 4WNPA 4JS8A 2OZ6A 1TVOA 4BCIA 4UZHA 3VS2A 1OYWA 3D0EA 3D7TA 2Y4IC 2YDIA 2ACXA 4R78A 4GT5A 1YS7A 3QD0A 2P4WA 4TKSA 3AC1A 2J0KA 3IGOA 4AFEA 4Z9LA 2YCRA 4FIEA 3K3IA 2XVDA 2E9NA 3E6MA 1VYZA 2QHNA 3PY3A 4M73A 5EYDA 4F99A 1OBGA 1FBSA 4WX9A 1GHCA 4FC0A 3OMVA 5CJ9A 3FHIA 2OH4A 2JITA 4I1ZA 3ORIA 4JLCA 2W9FB 3AGLA 1UU3A 4O0RA 2MBFA 4X6RA 5CLSA 2OBJA 3R6SA 3UVQA 3UG1A 4KMUX 3ISPA 2UW3A 2QOLA 4YPDA 1H0MA 3H3UA 3RI4A 2GS6A 2R3GA 4FIHA 3I7CA 4NM5A 4FKIA 3E5AA 1ZG3A 3ZM4A 4QMUA 5DI1A 3IOKA 4FSQA 4EH6A 5FDXA 3QOPA 2IZSA 5CSWA 4ZMEA 1W7HA 3K5UA 1Q24A 3EB0A 4WRSA 5C01A 5GIOE 5I0BA 2QHMA 5HU3A 4JX7A 4OTQA 4ESBA 2O61A 4UWCA 2OD5A 2A3SA 3RPSA 4JQEA 4C3PA 4O7NA 1NY3A 1I44A 3HMIA 4QT1A 1IN5A 4AZWA 5A6OA 3M11A 3KFWX 5M44A 4FVQA 4LV5A 3SRVB 3EOCA 4EBVA 1BI8A 2C3IB 4BFMA 3C5IA 3KMUA 1TKIA 3E5QA 3WTVC 5E8WA 1ON1A 5M07A 2F7ZE 4RZVA 4D4RA 5HS9A 2FSTX 3MA6A 3V51A 3EQGA 4XG4A 1JSTA 4H36A 3A7FA 4FTQA 4WBBB 4ANSA 2IO6A 5FM2A 4O2ZA 1UNHA 3PJ3A 3PJ2A 4E5WA 5CZIA 4HZSA 4MTAA 5CAUA 3QUEA 2WTDA 2PY3A 1V0OA 4BGHA 3V7SA 1VTNC 4CYJA 4EH8A 2QQ9A 1YRPA 3DB6A 3JY0A 5HS7A 5D5XB 4GU6A 3QP5A 3HV6A 1TBXA 4ASNA 4AW0A 4CKJA 4ZYGA 4MVFA 4EWHA 3MH3A 3RHXA 1B9NA 2KTYA 3PPJA 3G5DA 1ZZLA 4QO9A 2K7LA 3I1AA 5IH4A 3RNYA 3GI3A 4KA3A 2HYGD 4ANQA 4B7TA 2H6BA 4G7HF 1FYMA 4C2VA 2OXDA 2QCSA 3RHKA 3VUDA 3M8EA 3NCGA 4GKHA 2QLZA 4D2WA 5HKMA 5H2UA 1U5TA 5JGDA 5E7RA 2XRUA 3WIGA 3QQFA 2R2PA 3ZYAA 4RC4A 3DBQA 5I3RA 2C5XA 5E20A 5K1YA 1YHWA 5FTGA 4LG4A 4CZUA 2RFSA 1BI7A 5AP4A 4ON0A 1R58A 4S31A 2OJGA 1V0PA 5L6OA 4JDJA 3RM7A 4DFZE 4FR4A 4R6VA 1V4RA 4CV9A 2QWWA 4UMTA 4YURA 3P7NA 5KMMA 4KNYA 4DAWA 2UW4A 4ESJA 3P23A 2PTKA 1FSEA 4FTUA 4FHTA 4RMZA 2CPKE 2YDKA 4AWXB 2W24A 1ZY4A 2R3RA 4LLLA 2ACJA 2YCFA 4V0GA 3BHHA 4DBNA 1MRVA 4F9YA 5CVIA 4OLIA 4M71A 4ANMA 2OF4A 3BPXA 1QPJA 1TQPA 1P2FA 3Q96A 4IHSA 2W1FA 3POZA 4F08A 4AOJA 1SFEA 4L9NA 3BYUA 2V79A 2ZJ2A 4XUFA 2VD5A 3H3CA 2JPCA 3JUHA 3FLNC 4IWQA 5EH0A 5KNJA 5HLPA 4EUTA 4U3ZA 4A9SA 1LEZA 4F0IA 1Y6AA 1QBJA 3GT8A 3PDTA 2WTWA 3JTHA 2J5EA 3RVGA 2RNJA 1T2KA 4EOPA 1MJAA 1LNWA 4E4XA 1H0VA 2XGXA 4CKRA 4P5OA 2VTOA 4HZFA 2ZJWA 2OXYA 1LDKB 2TDXA 5M55A 3WYYA 3QUDA 3PSBA 3QBNA 3L8SA 2JIUA 4FSYA 1R3CA 1QPCA 2EXEA 3E8DA 5CSVA 1EH4A 2OZOA 1XD7A 2L3DA 5LQFA 3K1PA 3AT2A 2BTSA 3LXLA 3DY7A 5AIQA 4OIRF 1LB2A 4IVAA 3PZHA 3ULZA 5AUWA 3R71A 3NVMB 1ZH5A 5JT2A 3IW4A 4ZYEA 4FV7A 4RIWA 2X2MA 3J81K 4D0XA 1H8FA 3ZRKA 2C6LA 4WUNA 3OWJA 2YWVA 2DQLA 5HI2A 1OI9A 3HECA 3W2RA 3QL8A 3GYHX 2RG5A 4O0YA 4FA2A 4J95A 4W4VA 3TKIA 4CVAA 4IJPA 2BFXA 3ELJA 3H0YA 2UW5A 5AP1A 4BBEA 1UHWA 5BOXA 3IDBA 2IVVA 3J81Z 1J91A 4NM0A 4AZEA 4IZYA 3CUOA 5KMOA 4EGZA 3QZIA 4F09A 3TEIA 3I54A 3QTUA 4HZRA 3CC6A 3ORXA 3Q4UA 1LQ1A 2VT3A 3I71A 5L3DA 3QGYA 4P5QA 3ZO1A 1QQIA 3HAMA 4XHKB 1C0WA 2IVTA 2ZOQA 4QP1A 1ZWSA 3MY0A 4LUDA 4O83A 3P9IA 3FZOA 4QQJA 3ERKA 4I92A 3ZHPC 3SG9A 1WRJA 2HOEA 4P7EA 4RJ6A 3U2RA 4EH5A 3DA6A 3EYGA 3ZQ7A 1U4DA 1W8CA 3FHZA 2R3NA 2VWIA 4FTRA 5GINE 4KS8A 4I09A 3GO5A 2R3LA 3A4OX 4Q5SF 1BJAA 2UZBA 3ZONA 2QC6A 3ZMZA 3VF8A 3BEGA 5AP5A 2C5VA 4J98A 3PWDA 5AV1A 1H27A 3QTSA 3B8RA 3LW0A 4K77A 4NM7A 1TNSA 3UP2A 1HW2A 2NYXA 2JFMA 4FUYA 3F69A 4MQ2A 3SHEA 5EK7A 4ASDA 3E5XA 3S1HA 2XKPA 4ENJA 2Y6OA 2DAOA 2VE8A 2WGJA 3TXOA 5BUIA 3ROUA 2HZIA 4GSBA 3DQVC 4CT1A 2RVCA 3L9PA 5AWMA 2HR3A 4BGQA 5I9YA 5JKGA 1P4WA 4NFMA 1JHHA 1H00A 4I20A 3PVWA 3BPVA 1FMKA 3L8VA 4FTCA 2XNEA 3MN3A 3HHHA 3TOBA 2HGCA 5FLXZ 3OCGA 4TYIA 2PVYA 4ACCA 4I2OA 4TW9A 4E6CA 5TJJA 3PG1A 5F94A 5HD7A 3E63A 3LM0A 3SX9A 2R3OA 4NKAA 1EH8A 4O1OA 3N51A 3LFEA 3V5QA 2QURA 2MLKA 4O38A 3T8RA 1H1WA 3R9NA 3OWPA 2CCHA 3EQFA 4FK3A 2G1TA 3PIYA 5DD4A 1YI4A 2UZWE 3GC8A 4NT4A 2R3HA 2BDFA 2B53A 2BIKB 3G51A 3NIEA 4D4SA 2B52A 4FEXA 2J50A 3NUUA 3FXRA 4TNBA 4LB5A 2O8YA 1K78B 4HF1A 4UHTA 1RUOA 2QOHA 2RFDA 3KGAA 4JG6A 4HNFA 3HTSB 4EZ5A 4WBOA 4LRMA 2EWAA 4O3MA 3W2SA 1DAYA 2XIGA 3BRBA 4FZ6A 5E1WA 4MBIA 4NWMA 2QVOA 5HO6A 2R7FA 2WB8A 2G9XA 2JD5A 3C0IA 3NSZA 3DU8A 1IN8A 3EDPA 3UOHA 4KBCA 5M08A 3UNKA 4JBQA 4LG0B 4ZMFA 1QZYA 1UB9A 1J9IA 3KMWA 2GWRA 4RA5A 3PPZA 2CKOA 3MDYA 3MJ1A 3NUNA 1P4AA 1AQ1A 3BU3A 2VAGA 1USTA 2V9VA 1WWXA 1NVSA 3WTYC 1FPUA 1GOLA 5EKNA 2GXBA 3E87A 5ETIA 3KMMA 2W96B 2RGPA 5JFWA 2WELA 1G4DA 4G3EA 2R3PA 3CQEA 3DBCA 4BIBA 1R5GA 3NUSA 2OIBA 3I4BA 4RAZA 2GTMA 4EKLA 3H4JA 4B6LA 4FF8A 5LGUA 1ODDA 4U43A 5HDKA 4ETSA 2STWA 4AZFA 5CU4A 3V01A 3ODZX 4RVMA 4OUCA 1PXLA 4XSZF 3TO7A 1Z1DA 2FU4A 2J5PA 4F7JA 1E17A 4UVAA 3J80Z 4YZBA 4I6FA 1BYGA 1XB4A 4MTEA 2FSWA 1FGKA 5IKWA 3T9IA 3ZRMA 3FZTA 4RB3C 4L0ZB 3PVGA 1VZOA 5K5QA 5BMZA 5FGKA 5KCVA 4MQ1A 4O7TA 3RCJA 4L9VA 4O0TA 2XAGA 3LAUA 2OI4X 1K2PA 1SMYF 3QF9A 3NW6A 3P9KA 1G8SA 2VTMA 4C35A 5CU0A 3SLSA 3FL4A 4RJ4A 2A2AA 5D4RA 3V5PA 1BI1A 1XSDA 3QAME 5AA8A 1XGOA 3ENHA 3CP9A 3UBDA 2CCIA 4I5CA 4QPSA 4LGDA 3ET7A 1DS5A 2GDOA 4XG8A 2GQGA 3LCSA 4IAYA 3JSPA 3O96A 1ATPE 4MBLA 3DPLC 5E18F 2YWPA 2JAMA 1BM9A 3CKXA 1Q62A 5JH6A 4H1JA 1K79A 2F7EE 2E9VA 1MRUA 3DV3A 4H39A 3DXNA 5JFVA 3RAKA 3FLYA 3JXWA 3ORLA 2UW8A 2YZLA 2VO3A 2PE0A 2DTRA 4L5IA 2FO0A 2IJLA 4FG8A 5DHJA 4FUXA 4HGLA 3B2TA 2CJMA 1UU8A 5I9WA 2EJRA 1OIQA 3A60A 2BFYA 3GZ5A 1H08A 4OTDA 1STCE 4FKWA 4BCGA 2IJMA 1YDSE 4J7BA 3GFJA 5JN2A 2B4SB 1W0XC 4ZTLA 1XCBA 5F6FA 3UIXA 3COIA 1NA7A 2C6TA 5C1QB 4G3GA 2DPDA 2I40A 5IUHA 3CEKA 4FL3A 1XBAA 4JK1X 4MEDA 4ZY5A 4N6ZA 3DB8A 3G90X 4YZCA 1R39A 4FV4A 3D5VA 4JBVA 2L4MA 4ZK5A 3N97A 4FV9A 3LA3A 5F1ZA 1H1SA 2YJRA 3UNZA 4EOLA 4YLJA 2Y9QA 4ASXA 1B6AA 2ZMEB 2PMUA 2GMXA 3NRVA 4TWNA 3QLGA 2XYUA 3LKMA 3FF5A 4ZSLA 2BZHB 2YZAA 3PVUA 4CMOA 3RPYA 3ZM9A 3Q9SA 4D0PA 5LEJA 4P96A 3VUKA 4PPAA 5HD4A 2QD9A 3ORMA 5A4TA 3HVCA 4ALUA 4BWKA 2C69A 5BVKA 3ZMTA 5CVUA 1ZG1A 5K5XA 3VUGA 3LHJA 4RPVA 5DV5A 1O3SA 4W4XA 4QMOA 5AAGA 1JSUA 2IPXA 3DZOA 1OUKA 2DLLA 4EGYA 2O03A 4JL9A 3F72A 1CGPA 4NTSA 5HLWA 3OEFX 2DBBA 1QO0D 4YJNA 3GEZA 1YXSA 5EG3A 5J7BA 3QTWA 5E8SA 2RL5A 1PKDA 4B0GA 4U0WA 4GK3A 3R7YA 3MIYA 4LK1F 5FBNC 4FGBA 4JIKA 3UO5A 5CEIA 3AT4A 5AUUA 2O3FA 1IG1A 4L6QA 1PXIA 3NYXA 4EHEA 3TUDA 4YC3A 4NIFA 1OM1A 3M1SA 4FNXA 3LMIA 3VRZA 5D11A 3F2AA 4UV9A 3L9NA 4O5VA 3HYHA 4QNYA 3QUPA 2XUBA 2YM6A 2Q2EA 1WVXA 3PJ8A 1O9UA 4NQWA 1YW2A 4AGWA 3E93A 3CJFA 3EN7A 5IQBA 5E8TA 4XEYA 4BXUA 3LFSA 1XSVA 4EK4A 3WZJA 3ZS5A 3ZC6A 1I6XA 4ACGA 3FI2A 4D4YA 1W7PB 1T39A 5DDGA 2R3QA 1TNTA 4YG2F 4AF3A 2XF0A 4PTCA 3U4UA 1IR3A 3QHWA 2HAKA 3LCTA 4YJUA 2KJCA 3R7OA 1OKZA 2A19B 3UOKA 3NUPA 4HLXA 4YO6A 3EN9A 3FQHA 3DJ5A 3R6XA 1BN5A 3PY0A 3ZZEA 3TUCA 5LVOA 4O0SA 4A4OA 1J59A 4GIHA 3PSCA 4JAJA 5FDPA 4FL2A 1WFCA 4QYFA 5DCMB 3JR1A 5ETCA 1PJKA 3E3VA 5D5VB 1U78A 4EJTA 4KRDA 3EN6A 4BCOA 3BP8A 3GVUA 5DBXA 3HDNA 4YFKF 1IASA 4UWYA 2VBXA 3FX3A 3SOCA 3PVBA 3QA8A 5AR7A 5HORA 3FSFA 1L0OC 1OKWA 2UW0A 2A6HF 2J0LA 4GYGA 2OSCA 3Q2JA 2X2KA 2XNNA 2XEZA 4D1XA 2VXZA 3AC4A 5KZIA 1HOWA 5JFRA 3KCFA 3U55A 4FYNA 5AEPA 4FKRA 2UZOA 3JPVA 3R7EA 3RI1A 3H10A 1XH9A 2FB8A 1BIBA 2E9OA 5HCYA 2GHMA 4M14A 3F3TA 3KF4A 4YP8A 4KDPA 5FO5A 4G6QA 3COKA 3UTOA 2KJBA 3IC7A 2W05A 2JEDA 3EJ1A 2G15A 3TV6A 1YG2A 3ECOA 4L46A 3OBJA 3PRFA 4OR5A 4R8HA 4HV5A 3FY2A 3PJCA 3EZRA 2ZCWA 4U3YA 3GFMA 2P33A 2O65A 4UX9A 1OITA 4YZMA 1SFUA 2R9SA 1FYKA 3QQJA 1PUEE 4ITHA 1MDMB 5J8FA 3HMMA 4XV9A 1T38A 3UMWA 4UWBA 2DI3A 5LHHA 4C33A 5EQYA 4EEVA 3HMNA 3BU6A 2RG6A 4CNHA 4AE6A 1ZN2A 1YHSA 1YW8A 4YFNF 4I0BA 3ZSHA 5EHLA 5HG7A 3OG7A 1W7PD 2Z9OA 3IRRA 1XMAA 3B02A 3F5GA 4TRLA 1ZAOA 3DBEA 4HGEA 3D9VA 3IKVA 1M2PA 4D2SA 3AC2A 3FZVA 4E4LA 4C59A 3ZC5A 1O3TA 4WG5A 3D94A 4MQ9F 3K69A 3COHA 3FLZA 4I94A 2CYYA 3FMKA 2V22A 4KIPA 5DOSA 3WE3A 5AIPA 3EETA 5L3AA 4NHJA 4F70A 2QENA 4ESFA 3V5LA 3RINA 3GQLA 3AOXA 3M9AA 2FBIA 5HOOA 3Q5IA 5E91A 3R7GA 2QOQA 3MV5A 4J53A 3KL8A 4IM0A 4YO4A 4PTEA 4D55A 4DFXE 4E3CA 5L2SA 1H9TA 2XHKA 3CSVA 2O0YA 3HAVA 4U6RA 2V7OA 1OUYA 1B6CB 4N9HA 2C1AA 1M14A 4BI1A 3AMAA 2XM8A 1G3YA 2H34A 5FXRA 4IHPA 2HY0A 2PL0A 2WC2A 3DGKA 2ZBKA 4FI1A 5ANGA 5A3XA 3VNTA 1F1ZA 4W9WA 4X2NA 2O6GE 3RYPA 4FYOA 3OY1A 4ERWA 2C30A 2XCHA 3HX4A 1UWJA 5E1ZB 5H9BA 2VBZA 2FSOX 3K2LA 1M52A 4IFGA 3LOKA 4H3BA 2WIHA 5LARA 3QX4A 4TTHB 4AN9A 4XH6A 2RGVA 3PFIA 4G2FA 1U46A 4KAOA 3TL8A 5I9ZA 4FIFA 5C26A 4TZRA 5BQ0A 3DJ6A 4DH1A 4JDIA 1G3NA 3WE4A 4WT6A 4AVPA 3KQ7A 4AA0A 3K9TA 3N9XA 4IZ7A 3ZO4A 5A6NA 3V7RA 3W6KB 2WHBA 3R4KA 3MYGA 4X6QC 4TT7A 5ACKA 2NNNA 4M67A 2D45A 3NCZA 4APCA 4E93A 3TTIA 5J5SA 3ZMUA 1L8TA 4IZ5A 2Q83A 3BI6A 4AD9A 1P5EA 4MBJA 4GGGA 3VS1A 2F5CA 1YVJA 3GWZA 3TOAA 2HENA 3BU5A 4C0TA 3K1NA 4MYGA 2C5NA 5KBQA 1PMVA 1GIHA 3ALOA 2E2BA 4J96A 4IDVA 4BY9E 3QXPA 2FBHA 5BS6A 4L7SA 3RIRA 4DTAA 1QPEA 1QNTA 1LPUA 1G3SA 4BDKA 4W8DA 2HW6A 2GNJA 1OKRA 4XS2A 5EHYA 4LGHA 2QOOA 4PDSA 1IA9A 2YM3A 3VBYA 5C8MA 2F5FA 4CTCA 4TYGA 4DEIA 4GFOA 4U44A 3WTSC 3P5KA 2O8XA 3Q9VA 1KE5A 1HW5A 5AIRA 3DBDA 1Z9XA 3F82A 1IUYA 3RALA 2ZDUA 5IA3A 4E5AX 3QLFA 2WTVA 2WQEA 4A7CA 3SQQA 2QQ7A 3Q60A 5CENA 4J52A 4HYSA 1H28A 2EWNA 2MLGA 1F3MC 4UB7A 2FSLX 3HRMA 3GEQA 3AD4A 4RB1A 3LFAA 2XAQA 3GC0A 2O64A 2PSQA 3KN6A 2Z99A 3KZZA 4HQMA 4G9RA 3R63A 3DT1A 3CO6C 4IQ6A 2V5QA 4APPA 3U6IA 2Y8OA 3I0TA 2QNJA 4TV7A 3QTXA 3GC7A 2JDOA 3MY5A 5ICCA 3NEUA 3KRXA 4HOKA 2JDTA 2Q0NA 2BKKA 2ZXJA 5ILUA 4DA5A 3R9DA 1TTYA 1O3RA 1TLHB 4LMNA 3PRIA 1S3JA 4OMZA 1TW3A 1PXOA 3R0JA 3ZO3A 5HE0A 2JSCA 3SGCA 5FD6A 3BOQA 4RX5A 4CRLA 4YGAA 5J9YA 2F2EA 2WMSA 4X2KA 4FBXA 4C7TA 2CKEA 3TJCA 3PG3A 3ABUA 3E62A 5IT9K 2A69F 5CVFA 2GQQA 3C4EA 2CKQA 5ANEA 4Y95A 2XAJA 5D1JA 2W06A 2GPHA 2HQRA 4FODA 4GK2A 3NMUF 4U7ZA 1NT2A 4GIIA 4KUMA 1XH4A 2XNBA 5EM7A 3IGGA 1OYYA 4RWJA 1DPUA 2FF4A 4LK0F 5M53A 4AOIA 3U6JA 4AXAA 3C7JA 3FAAA 4E4MA 3FJQE 5AJQA 5IT9Z 2PUPA 4PL3A 3NX8A 3ZXZA 5B7VA 3UC4A 4HF0A 4PDOA 1CM8A 5IQAA 4BWXA 2VWBA 1I27A 2DK5A 4UMPA 1REPC 3KVXA 5TR6A 1YOJA 3FXUA 4JDKA 1XHAA 3VS0A 3V8WA 4M13A 4Z3VA 4EJVA 4CG8A 4X0MA 3QRTA 1YOMA 4I98B 4LB6B 2OQGA 3ETAA 4CT2A 1SD7A 5H8BA 2PVMA 4I3ZA 3RWQA 2O0UA 3GQIA 2OA4A 5CNOA 3R8UA 2L02A 1JXSA 2QG7A 3QRIA 3ZZWA 3QKKA 5M56A 4A6DA 4CD0A 1W5SA 3I6WA 2QI8A 2VTPA 3MPTA 3ROYA 5A14A 4CGAA 2GNFA 4I0TA 1QL6A 2YAAA 2DU9A 4DHFA 1MD0A 3QTQA 3VODA 2ZDTA 5AAEA 4JBPA 4P4CA 1PRYA 3R7UA 5BNJA 4O0UA 3AMYA 3DF8A 2QR8A 4W4WA 1USSA 2Z33A 4CFUA 5ANKA 5CNNA 4CDGA 2J51A 3POOA 4AW1A 1VR2A 1D5VA 2GIVA 4TY1A 5K5RA 1MP8A 3VBTA 3KFAA 5D6EA 3K5VA 4G9CA 3G33A 5JRQA 4B8LA 4IADA 4EOOA 4DEAA 1CF7B 4HPTE 4D0WA 2QKRA 4FEQA 4W9XA 3NNWA 3OROA 2FE3A 1Q8UA 3MH1A 4M8TA 1RNLA 2IZUA 3QRUA 2ADUA 4S32A 2X4ZA 2P2IA 4AGCA 4IRHA 1RUNA 3EFKA 2PU8A 1GJOA 2W1CA 5AUZA 2BAQA 3MFUA 3QCQA 4FGRA 4FVPA 2WQMA 4TL0A 4D5HA 3DKWA 5HNIX 1DAWA 1JQHA 3RMFA 2X81A 4WOVA 4K33A 4A0ZA 2XK8A 5EDRA 3P7CA 2K27A 2KRFA 1FYLA 3DDQA 4IM2A 4MAOA 4BVUA 4E4NA 3FLSA 4QYGA 4I0AA 2A4LA 2ESMA 1OPKA 4DFYA 1YKRA 3CLOA 2PZRA 3ACJA 3OHTA 3DOGA 3GOPA 4O7RA 2A68F 3TKYA 1SVHA 2BEOA 3GC9A 5DT0A 1R1WA 3KA0A 3KLNA 5T6KA 2B54A 4FKTA 5DWRA 5D6FA 2XAHA 4FV1A 4ZSEA 3QZHA 4M7IA 2V6CA 4BKJA 1CMKE 3EMGA 1Q99A 4LJZF 3Q9YA 5BPYA 4WCGA 4BKYA 2R3IA 5CT7A 3O71A 3QYZA 3TO9A 3G0FA 2E1CA 3QQGA 3KB7A 1QZZA 2GXGA 4F9CA 1Z05A 1OIUA 4R79A 2EFQA 2C47A 4F4PA 5M51A 3JY9A 4R77A 1YW7A 3ORZA 3OCTA 3F23A 5HCXA 5IDNA 3UMXA 1HSTA 3V6RA 2BRBA 2BYVE 2YM5A 3DV8A 4BB4A 3M8FA 3MVJA 5HX6A 2UZDA 3BYSA 3WF5A 5JHUA 4RJ8A 1ZRDA 2F49A 2J7TA 3D14A 5FM3A 4FV5A 1Q8TA 4DINA 3TV7A 4M9SA 4YJQA 1ZMWA 2REIA 2LSOA 1IAJA 3COAC 2Y6MA 2XS0A 1V3FA 4AAAA 1Z9CA 1YXTA 2H09A 4A9RA 3VVHA 3KXMA 4Q5HA 3UDBA 3ZEPA 2XIRA 4FNWA 2IPQX 5J9LA 2UXNA 2GCDA 3DQWA 2YIWA 3RKYA 3OVVA 1YIOA 4M66A 3HMPA 3F22A 4USDA 4MXOA 4C4IA 4L3PA 5JEBA 2WPAA 4F7LA 1H9GA 2ZFWA 1W84A 3DKOA 3OW4A 1M7QA 2ZNYA 1G6NA 4Y73A 1Q41A 2VWYA 3G6GA 2DYLA 4BCHA 4A2UA 4CZYB 4HF2A 3KRJA 5L2TA 1J7UA 4I0SA 5IEXA 5IA2A 3H9RA 3BJOA 3V5JA 4BR3A 5AUTA 3F3UA 4KT5C 5D4SA 2O3PA 5L4QA 5HNGA 3S3IA 1UKIA 1IRKA 2QQBA 3SHFA 5E4HA 2A61A 4OGRA 4TWPA 5LVNA 4FX0A 4ARKA 4BNCA 2Y0AA 4FTJA 2B7AA 4RB2C 4KNBA 5AP2A 4G17A 3E7VA 3I6UA 2O63A 3WZDA 4I5PA 4IB5A 4DFLA 2VE9A 1Y0UA 4MXXA 2PZ5A 4XNEA 2BMCA 4LOOA 3DTWA 4I4FA 4QOXA 4WSQA 5ETFA 3E64A 1JKSA 5A4QA 1H0WA 4QP8A 3L7WA 3I5UA 4X3FB 3FKOA 5DYMA 4EOQA 5CAVA 3VF9A 2AC3A 4GO1A 2R4BA 3MTLA 3C4ZA 4IBMA 4PPCA 2PBIA 2X0GA 4HJOA 4CTBA 3O2MA 2WOTA 5HVKA 3E92A 1ZYCA 4DT8A 2HFHA 3IW8A 4U7DA 3FL5A 1T0FA 3HP5A 4IWOA 2PVRA 3MFTA 3KXNA 5HTBA 3SOAA 1WMKA 5AR5A 5EHOA 4MTDA 3VS5A 2FXAA 3EQHA 5CAOA 5ANDA 2PULA 1KQ8A 4AA4A 1ZOEA 4IWPA 1P4XA 1LR4A 4ENXA 4HW7A 1XBCA 4OBPA 1H4LA 4L45A 3NUXA 4FMQA 1JKTA 4B9DA 1YWNA 2YFXA 3EYYA 3ZLYA 4BWPA 5DR2A 4J97A 3EKNA 3MY1A 5EOLA 2H6CA 2Y0MA 3PSDA 4A07A 4XG3A 1M2RA 4ZS0A 5L2WA 4MCVA 4OAVB 2YM4A 2D1HA 1JBPE 3ANQA 3BKBA 5IQDA 3ITZA 5L3CA 4E8AA 3OW3A 2H94A 5HGIA 4TXCA 4IVDA 1JVPP 4QMMA 5DR6A 2QONA 3G15A 3PYYA 4WXCA 2MH2A 4EONA 2PMHA 2VN9A 5ITAA 3V8KA 3CBLA 5BPDA 1SNUA 3CUQB 3HOTA 4UNOA 2VRXA 5CU3A 3TWJA 3H0ZA 1MQ4A 4Q48A 2PMOX 2X7GA 3WZKA 2Z7SA 4WF2A 1ZREA 4EH7A 3QZGA 1OGUA 5EYMA 3I7BA 4FKUA 1O57A 4FT9A 2WTKC 2ITOA 4FK6A 2XRWA 5E1XA 2RIOA 5CALA 3GBZA 4CXFA 4KMFA 4GXOA 4M6YA 3Q5ZA 4Q5EA 2HYFA 4USEA 3P79A 1BKXA 3GNIB 2BAKA 1OPCA 3HV4A 3NIZA 2WWYA 3DNDA 2P55A 4KN4X 3H9FA 5DEWA 5FQDC 5KBRA 4Y17A 3M7GA 3E8EA 2CGPA 3TDZC 1ZLJA 3MCZA 3BEAA 2CLQA 1K6OA 2DO7A 5J5TA 4NH1A 5CU2A 2PMNX 3GCVA 1I1GA 2QLQA 2HKXA 5J8CA 3QRJA 2J5OA 2QOKA 4I21A 4FT5A 2A5YB 2MH9A 2QU5A 4R1VA 4P9UA 4RGJA 3E88A 2HXQA 2QOIA 3MB6A 3F21A 2HCKA 5LLQA 1UU9A 5CTPA 5AV0A 2X8DA 4K18A 4IB1A 3C0HA 2FNAA 4HCUA 2VWZA 4FNZA 4B4LA 3FMMA 5K3YA 3R61A 3T0YA 1ZRFA 5FG8A 4BAYA 5AM7A 3K3JA 3NYOA 3TI1A 4MNEA 2A1AB 2IW5A 2C3JA 4QYEA 4N0SA 2ERKA 5DT3A 2STTA 5HO8A 4AW2A 1JKKA 4ZZDA 4HX4A 3FC2A 3O8PA 2V1XA 3IW6A 3HYIA 5I9VA 4QQTA 2K4BA 3R9RA 3GUBA 1A48A 4FSWA 1M2QA 4Q47A 1FVVA 2XIXA 4O7VA 2YHVA 5AA9A 3QKLA 4RIYA 2I1MA 5HVQC 4BKZA 4EK3A 5EI8A 3JW4A 3QHRA 3L9MA 1PXPA 4ZLYA 4DGMA 3MQ0A 4CZZA 3VN9A 3SG8A 2ETKA 3C50A 3QU0A 4BDDA 3QTIA 2X6DA 4O7YA 4CXAA 3A8WA 2VTIA 4YBKA 2J5FA 2BIYA 2W25A 5LCKA 2UZTA 3L2CA 3P7AA 1R5HA 4Z2YA 2YPRA 3DKCA 2BKZA 2QM3A 2O5KA 3RJCA 3LQQA 4O7WA 1RJBA 3UGCA 2P4IA 3KC3A 4FG9A 4OTFA 3MESA 4MF1A 3EQBA 2QOBA 4IVNA 4ENKA 4MWIA 2X8EA 3WBLA 4N0BA 1SNXA 3H30A 3EQIA 2QOCA 3QFVA 3PLAE 2WMQA 5IMEA 3FM5A 4PDKA 2VTJA 4F0FA 4A6EA 3M42A 3CTAA 3TUBA 4AT4A 2NO3A 4O27B 4FSTA 2UZEA 2PUIA 4X2JA 3QCYA 3JTGA 3KULA 2C1BA 2XJ0A 4U5JA 2P2HA 4Y5QA 3RAIA 4PP9A 4UMQA 3LCKA 1XWSA 1R23A 1U6GA 5HBJA 2VTNA 1U54B 3BWJA 3KU2A 2M5WA 5LEKA 5IPJA 1HKSA 3F3XA 4JOAA 1JPAA 4XP3A 5AUYA 3RNIA 2OU2A 4C38A 2FA5A 2AYPA 1BMKA 4YHTA 3RP9A 3R1YA 4UMRA 3ATSA 2ZVAA 4MEYF 2BUJA 1SZMA 4S34A 4L43A 4UXQA 2FMYA 2IA2A 2I0EA 5I9XA 1T46A 2UZKA 5IU2A 1KV1A 2H6DA 4WWCA 4PPBA 3R8VA 3MH0A 4EK6A 2XAFA 4L9IA 2B9HA 2ZNZA 3R8PA 2EA4A 4XRLA 3TNIA 3VBVA 5LGNA 4RIXA 1TQMA 3TIYA 2W5BA 1Y6BA 5IQIA 3E6CC 3LIJA 4FTMA 5D7VA 4WK8F 2OICA 4U80A 2W17A 4MXCA 4KABA 3LMHA 4G3FA 2OF2A 4PMTA 2ZV2A 4WG4A 4PRJA 3A2CA 2HYYA 2YIQA 4EOJA 2WMBA 1ZOHA 4MNFA 2VZ6A 3FUPA 3BWGA 4PNIA 2C0TA 5DLSA 5JQ5A 3IRQA 3R30A 4QMZA 3KK8A 4IW0A 1YXXA 5BX0A 5FB2A 4BCPA 5JZJA 2WEIA 3MVLA 2COMA 4YMJA 3ORKA 1NXKA 4HCVA 1UCRA 4RQKA 4FIGA 3K0LA 5M09A 4IACA 2WTKB 5ETAA 5J8IA 4QQ5A 4OMYA 4JI9A 4NUSA 4QNAA 4L3LA 4ZTSA 4GEOA 3WG9A 4DEHA 3NLBA 3TKUA 4UXNA 1JSVA 1STZA 2WIPA 4D2PA 4G7ZF 4AFJA 4KIOA 4FT3A 2VTSA 4IFCA 5G6VA 5AP7A 5ICEA 2W4JA 4KBAA 3MH2A 1Q3WA 3ORPA 2FGIA 3UIMA 3TNQB 2M1BA 3ZP5A 3VW8A 2ETHA 1ZYJA 3O51A 3QKMA 1R0PA 5DG5A 2HY81 5AV2A 3ZFYA 5C8NA 1K3AA 1S9IA 2B9FA 3ZO2A 1O6KA 2RSVA 4DGOA 4E70A 1J7LA 4AQCA 2OAZA 4RFZA 3NUYA 3VUHA 5IUIA 3FMNA 3F61A 4BBFA 3NRMA 4IMYA 4F7NA 3R0AA 2DT5A 4LRJA 3A62A 1MJ9A 2W5AA 3A7GA 4AIKA 3ZDUA 3CQUA 2JDVA 5KKRB 2UVXA 4CYIA 1XBBA 5LMBA 3UE4A 2CN8A 4ZJVA 1FSHA 1WCCA 2VTLA 3O17A 1KU7A 3OP5A 3ZPLA 4O82A 1ZMVA 4QMLA 4LD5A 2CGXA 3V8SA 3HV5A 3KF7A 3Q2MA 2A07F 5AV3A 3EQRA 4Y8DA 5HIDA 4CFMA 1REJA 5KZ0A 4EORA 2C6MA 1IZ1A 3MZHA 4DEEA 5H6QA 1UNLA 3FMSA 5E1EA 3SFZA 5K5OA 4EJ7A 3S2PA 3GCQA 2PFBA 1SD5A 4ANBA 4DGNA 3WIKA 1OL6A 1ERKA 3SA0A 3KCCA 4BIDA 4YC6A 2OWBA 4PGHA 4OTIA 4EMSA 2HZ4A 3VUTA 5D10A 5E9EA 2HEOA 5HE1A 5KMIA 3D4QA 5D5WB 3T9TA 2HS5A 5HG9A 1Y8GA 4G6DA 2C6EA 4BHZA 2W9ZB 5ANOA 4KICA 2XJ1A 1J1CA 4PZJA 3BQRA 1XH6A 4FOBA 3IOPA 2GQSA 3UPZA 3S00A 5LVMA 3ZN0A 5B2LA 3PE1A 4RVKA 4OTHA 4YHFA 5ICPA 2L4AA 4RJ5A 5J1VA 4KIKB 3RZFA 4L67A 3GF2A 1WVYA 2Z7QA 1U2WA 2QUFA 2RDPA 4HVHA 3F8CA 2IW6A 4FTNA 2PVHA 3FV8A 3SRVA 3ELKA 1JOWB 4DEDA 1NVQA 4HAMA 3GX4X 1G3WA 3E8CA 5EM5A 4F9BA 4FTIA 4RLKA 2XMYA 3CIKA 5LMAA 4BTJA 4DH7A 5AR3A 3AG9A 2RC4A 2C5OA 3W2QA 2PMLX 3O8TA 3FY0A 3S4QA 1MUOA 4LGGA 2YX7A 4P2KA 3R8LA 3BZ6A 5IQGA 2ZKZA 3CGFA 1OB3A 4TPTA 1LVAA 2Y75A 3OZ6A 1OKVA 2XKCA 4CICA 4KYWA 3RK7A 4FOCA 4UBAA 5BMSA 4I6HA 3FM3A 4DITA 2IT0A 2BBYA 2R7IA 4QPAA 4EHZA 4N6YA 2CGVA 3DAEA 3ZOSA 4DNCA 4BDGA 3UO6A 4F1OA 4GFGA 3JAMZ 1KWPA 5KHXA 2IP2A 1Y57A 4K0YA 3PWYA 1GZNA 1WBNA 3LLAA 4HVDA 2CMWA 1YS6A 3GB2A 1D8JA 2Z7LA 3QRKA 1WSUA 2HTSA 3O3KA 3OCBA 3FMJA 2JAVA 4ALWA 3G9LX 5KK1A 3TGNA 4BCMA 4I23A 2WTJA 2WMXA 1F0QA 1KA8A 3HSRA 4O6EA 3II5A 2XM9A 2J90A 4A9TA 3LQ3A 5A2QZ 1XCVA 2I0YA 3OXZA 1SMTA 3VQHA 4ZAUA 3GU7A 2FQ3A 5HX8A 4OINF 2NAZA 2PEXA 2R64A 4YJRA 3I81A 2BAJA 5E8YA 1PW2A 1PXJA 4U45A 5LOHA 3M1EA 2GAUA 5TO8A 3PXRA 3KLOA 2OW3A 4I5MA 3FXXA 1S7AA 4TYHB 3QP6A 2LAVA 5LVPA 2VTAA 1F5QA 2Q0BA 2EB7A 1SM2A 2AUHA 4XV2A 3KY2A 5L8LA 2G9WA 4EJNA 4ENMA 5FD2A 3ZN1A 1IN7A 4BZNA 3FSKA 1U5RA 5AAFA 2ITZA 5CYIA 3SW4A 2XV4S 4EH3A 3OT8A 3NPCA 4A5NA 5AFVA 3GZ6A 1UV5A 1FPQA 1HBXG 2XUUA 3HNGA 4N4SA 3JS2A 3VEPA 2BILB 1JWHA 4G5PA 1KU9A 2V55A 4GVJA 5FLXK 3NWWA 1PF8A 2CO5A 3ERED 1Z5MA 4FKGA 1ZG5A 5L3GA 4IX3A 2GS2A 2Z60A 4BZOA 2IRFG 3QQLA 4NW6A 2IZRA 1WBPA 3UQFA 2HXLA 4KIBA 3V6SA 5DPVA 3P7BA 3QXOA 3R9HA 3S95A 3NNVA 4B8MA 2WTIA 4AZSA 4BCJA 3FEGA 3ID6C 1UNGA 4I5HA 4HVSA 1HKQA 3I60A 4OTGA 1IN4A 3EWHA 3WTUC 3JSOA 5CVGA 3C13A 4R7BA 4C4JA 1I1SA 5JI6A 2M87A 3WARA 2YM7A 3V7CA 1OPJA 3R28A 3MWMA 2E7WA 3MIAA 1UA2A 5D9HA 4NL0A 3I59B 1KU2A 2OQRA 3O23A 2WZJA 2GFCA 4CKIA 3F8NA 3ML6A 2IA1A 5HVJA 2W1EA 4A0XA 4GS6A 1ON2A 3Q53A 4WNOA 3HSFA 3SD0A 5FXQA 4FEVA 5A4CA 2VX1A 4HX8A 4QMQA 3EQPA 4S04A 2WEVA 3G0EA 3GU6A 5AR8A 4YJPA 4DC2A 4X2GA 3DJ7A 5C9CA 4Q2AA 2WV0A 5LHIA 1SYKA 3ZUTA 1PXMA 4RX8A 4U79A 4G7OF 3WTTC 4GMYA 4D28A 2GNLA 5HLIA 1ZYRF 3PA4A 4HPUE 3DAJA 3OXIA 2VONA 3DXJF 2JTVA 5IZFA 3T3VA 4QP6A 2O2UA 1FP1D 3EZVA 3DLSA 5FLFA 3M2WA 5CS6A 3CS9A 3DK3A 4QMSA 2G2FA 3COMA 3VULA 2XJ2A 2YM8A 1Q61A 4R1HA 5DD8A 3VJOA 4MGRA 4FX3A 2NRAC 3J80K 2BE5F 4QMVA 1JGSA 2CKPA 5TE0A 4PMSA 2WMVA 3D7TB 1PXKA 4II5A 4A9YA 1U5QA 3Q5FA 4NYEA 4BF2A 2OJIA 2C3KA 5CSPA 4L9JA 2R3FA 4GFMA 5K9IA 5EDQA 4ZZLA 4NSTA 3V8JA 3V4GA 1PKGA 3KVWA 1FLIA 3PE2A 1XO2B 3BLHA 4QP3A 4GVAA 4ITIA 4ZLZA 2NNYA 4O6LA 4IAFA 2UZVA 3C4WA 2WQOA 4NU1A 2BROA 5E8UA 1XDUA 5JK3A 2BRHA 1QPMA 4UEUA 3ZBXA 5AR2A 5EW9A 3RTRA 2Z2WA 3HV3A 2BZKB 3E6BA 4ZH4F 3TO6A 4F1TA 4I7HA 4XLIA 1R7JA 1HCLA 1R78A 3Q04A 1OKYA 5CVRA 4IM3A 3ENMA 4EJOA 2EVAA 5HDGA 2G7HA 4GUEA 2FOKA 1Z57A 4IH8A 4M74A 4ASEA 4P55A 5H3QA 1AGWA 2PQ8A 4FSNA 3IK3A 1EH7A 4M97A 3LXPA 3MFRA 4RSSA 3W2PA 1Q3DA 4RC2A 3MTFA 3GFWA 3VS3A 3K54A 5B0XA 1IW7F 5HHWA 5IH5A 4AGUA 1B38A 4RX9A 4U41A 4B09A 2WQNA 2WXVA 4S33A 2EK5A 3IPHA 1OL1A 2HDCA 3R1NA 1P14A 4FT8A 2BDWA 3HA8A 1JAMA 3WYXA 2W85A 4LGWA 4I24A 3F88A 1WBSA 2X4FA 4NCTC 5HZNA 4ZTQA 3VS7A 4BHBA 1LP4A 4M84A 3IKTA 2F57A 4L0YB 4F6WA 2YABA 4DH8A 4ENNA 3WGIA 2FUMA 5CZHA 3VJNA 2J2IB 4GCJA 3ZEWA 3BGZA 1QCFA 3F7WA 1KE9A 4CQEA 4DCAA 1K78A 3NW7A 4EI4A 4RFMA 3GVAA 4K1BA 2RFEA 2IVMA 2VC1A 4FTLA 4XG7A 4AA5A 3LCOA 4YTIA 3HLLA 3U6HA 5IF1A 5LXMA 4NK9A 3IKAA 4QQCA 2XKOA 3KKVA 2XRNA 2XK3A 3L09A 4DGGA 1UKHA 4JRNA 2UZLA 5CF4A 4E20A 3EFWA 2R3SA 4HOBA 1KUTA 4U0YA 5I9UA 2QBYB 4PV0A 4HVGA 3EL7A 1ZARA 4ITJA 4LG0A 2GA1A 1ZYDA 5AV4A 3A99A 1LJ9A 3BBTB 4DH3A 3I58A 5ANJA 5KX8A 5G1XA 3HDMA 3TT0A 2F5EA 2YCQA 4J8MA 3WTZA 3RJPA 4LL5A 1XGMA 3G6HA 4DEBA 2R3JA 5LRRA 3ZMMA 4IC7A 4ZY4A 1FY7A 4YIFA 2LNBA 4NFNA 1ZLTA 3BGPA 5DR9A 1U5TB 3ACKA 1HSJA 3WZUA 1APME 3DFCB 5TKDA 2Y7JA 3KCKA 4QMTA 3ORTA 5L8KA 2UW7A 1WBOA 3BE2A 4AACA 5DMZA 3HRCA 3MW1A 3W6JB 3J7AO 3DZQA 3D5UA 3TKHA 5JQ8A 4TYEA 2VX0A 4XV3A 3CKWA 1ND4A 3MWUA 3W8LA 3ODYX 1CDKA 4L7FA 4MXAA 5AUXA 4CRSA 4MWHA 3O50A 4RJ7A 4LUEA 2W84A 4F63A 4DTKA 1Q1HA 4UYNA 3GLXA 4I0RA 5IA5A 2YX4A 4A0YA 5BVEA 3R22A 5CEOA 5EDPA 5E8GA 4LM5A 4HGTA 2RFNA 4QMPA 5EM6A 1H25A 4V0GB 2JGZA 2RKUA 4N70A 2K4JA 2R7DA 2Z02A 3Q4TA 3VB2A 4I6QA 3GU8A 3FPQA 4H3QA 2W5HA 4ZIMA 3HMOA 1KYWA 4BTMA 3QRFF 3AQVA 2XK6A 4WRGA 4RLLA 5HTIA 4AWIA 2NPQA 4GK4A 5IQCA 4YSMA 3GCSA 6PAXA 3R1QA 2R0IA 3L00A 4YBJA 4FSRA 3BYMA 4M0ZA 4K9YA 3VIDA 3GCPA 4UVBA 5H20A 3HA6A 4BRXA 3QCXA 4DGLC 4GCVA 4U81A 5EI6A 2IG7A 3O6BB 3QD4A 4U7BA 3TTJA 3GUDA 4QYYA 3WU0A 2GA2A 5CF8A 4X21A 3QYWA 4IX5A 5ICFA 4H05A 2RQPA 2XH5A 3LJ2A 4KWPA 5LVLA 3T8TA 4IZAA 4KUJA 4HA8A 4F6UA 4HYHA 1QMZA 2MA3A 5CSXA 3R8ZA 2W1ZA 2VWVA 3OUKA 5CF5A 1XGSA 2NRYA 3R1SA 3UC3A 3BCEA 3ALNA 4Y83A 2J0JA 4FEUA 4RIWB 4EKKA 2EFNA 1B1BA 2ITQA 4PX6A 4FE2A 4MH7A 2PPQA 4OIOF 4DQ2A 3S2WA 3U4WA 3WF9A 3LFKA 4NZWB 3ZU7A 3GU4A 3CO7C 4ZTMA 4O91A 5CX9A 4QPMA 2KIUA 3D5WA 5E90A 3PUPA 4IJAA 3DDPA 4PUZA 1ONVA 4YPSA 5J1WA 3S0OA 2XK9A 2QBYA 2OKRA 4IXPA 4L42A 5C27A 2OIDA 4EUUA 3WZEA 4R3RA 5KMKA 3GENA 2J0MB 3SXFA 2ZMEA 3LAJA 1IAWA 1RIOH 3LWFA 4QMXA 1GZ8A 1BOAA 4N57A 4FIIA 2QVSE 4OTWA 5IH6A 3NR9A 2V1DA 2V0DA 3C51A 4AT5A 2BCJA 5AP6A 1Q97A 3VWAA 4G34A 3C1DA 3ZLSA 3BJ6A 3GFEA 2WD1A 4E1ZA 4GT4A 2XIYA 5D12A 4CFXA 4DYMA 1UFMA 4U0VA 3GP0A 4WNKA 4LYNA 4BI0A 2OZUA 2OJJA 2PG4A 4BDFA 3RK5A 4AS0A 3PXYA 1SD4A 2XP2A 5L8JA 3CTQA 3KXXA 3FLQA 4Y15A 3OOMA 1OMWA 4ZZNA 2J4ZA 3DAKA 4IX4A 2HWOA 4CG9A 3ZLWA 5JGAA 3GFIA 1YQJA 1LEWA 1O3QA 1JE8A 2VWXA 3I64A 4V05A 4RWLA 3IWZA 4WD5A 1JHFA 1IN6A 5CT0A 4JG7A 2DK8A 4RG0A 4IAIA 2CDZA 5EKOA 3W1FA 5E8VA 4E5BA 4DG0E 4UV0A 1D3YA 1XKKA 3TV4A 4IRGA 4M0YA 3IG7A 4EV0A 3FWQA 5CAQA 2JKKA 3AMBA 2W0JA 4O7LA 2PMIA 5FP6A 1H26A 5FD5A 2EV6A 3TG1A 2QQAA 3WE8A 3N4MA 1TQIA 2YIYA 1W7PA 1GY3A 3D5LA 2HZ0A 3PXQA 3R21A 1NVRA 3WGGA 1YTYA 5CI6A 5CEQA 1FOKA 1U59A 2X7FA 2ONLC 1SMHA 4XMOA 4RRVA 3FKLA 3VHEA 4KSQA 2VNYA 1XDSA 2PJPA 1T6SA 1IRGA 4BBMA 5D8KB 1KE8A 4EOSA 4GJ2A 2JDSA 3T1BA 4DG2E 3LQ8A 3MPAA 4RZWA 3DK6A 5DCMA 4Y46A 2CLXA 5HG8A 4K11A 3PIZA 1S8NA 2C6DA 2UXXA 4KBKA 5F20A 4LLNA 2YIXA 1FBQA 2G7UA 4IVCA 3LFFA 5BVDA 4IHTA 3VRYA 5J95A 2JDRA 4KRCA 2JBOA 4BIEA 1Z91A 2CSNA 3FMDA 3AC5A 4C3RA 2JRTA 4C62A 1MKMA 1R00A 2M30A 1Z6TA 4M12A 4O96A 1KE6A 3HUCA 4GT3A 4EQUA 2Y4IB 5J7HA 2HIWA 1Q4LA 2QO7A 3U9NA 4TWOA 1MZBA 1FBNA 2C6YA 2OH0E 4V04A 3H92A 2LGCA 3VBQA 3DFAA 2C68A 4IVBA 2E9UA 3CE3A 4N9IA 5CI7A 4MHAA 2HWVA 1IF1A 3F5UA 3SVVA 3KETA 2PN6A 3KK9A 3HZTA 5TT7A 4BDBA 4IRIA 4AT3A 1AWCA 1WBWA 4BCFA 3F2RA 4XSXF 3PLSA 1ZGJA 3F8BA 2AS5F 5DFPA 3RKXA 1Q5KA 4JXFA 4IE9A 3ZH8A 2H9VA 4R1YA 4BDIA 2QZ8A 1YFHA 2DFIA 1DDNA 2PHKA 5EEHA 4BCNA 4FKOA 2VUWA 4QLCU 1YO5C 2NNWB 2RKHA 3VFZA 5AUVA 3TQNA 4KKHA 1MDMA 2ITXA 5GZ8A 4HDVA 4FEWA 4EH9A 4OAUC 1Q8YA 3IL2A 3HRTA 2KIFA 2ISYA 3KE2A 3GCUA 2DQRA 4ZTRA 2XBJA 3DEUA 4L53A 4NKSA 1IA8A 3F6OA 5CVVA 3O0GA 2SRCA 3A4PA 3P86A 3QQHA 4IB0A 4R8QA 3A7HA 5HICA 1W83A 2VWUA 3FZRA 4U88A 3I0QA 2BPMA 2PZPA 2XNPA 3BBWA 3I0OA 3Q52A 4RFYA 5IG1A 5ANIA 3FMRA 2MC3A 3FXQA 4U97A 5CQWA 2YEXA 1W98A 2P5KA 3MFKA 3RTPA 4Z7GA 2L54A 1GIIA 4BHPA 4CZTA 4QTEA 3RAHA 2FEZA 2X1NA 4E6DA 2QO9A 5HIBA 5FEEA 4YNEA 1O7FA 2A27A 3REOA 2OBPA 4H58A 4MD7E 1F5TA 4NCTA 2L01A 3V5WA 4D4VA 4NW5A 2H8HA 4EZ3A 2QO2A 4G3CA 4MX9A 1Z6RA 4PL4A 4JG8A 4I4EA 1FQ1B 1CKIA 1YHVA 5E8IA 2YU3A 5DE2A 3F5PA 2VC0A 2FA2A 5J79A 1WZYA 3TNPC 3QQUA 1OL5A 2KULA 5CY3A 3IWFA 3KP4A 2ZV8A 2CNQA 5HCZA 4JQ8A 4XG6A 4ZP5A 5EM8A 3EFLA 1D8KA 4LI5A 4C3FA 5KUPA 1YYVA 4U9AA 3C9WA 3LXNA 2DS1A 1DP7P 2BDJA 5BQTA 3U8WA 4AE9A 5HBEA 3LLTA 4RJ3A 2W99B 3RDIA 2FH9A 3HRUA 1PP8F 3UQGA 3WF6A 4I02A 3EKKA 3RBWA 4D1SA 3W10A 3FKNA 2OJ9A 1E2XA 1T45A 4EYJA 5TRDA 1JLUE 3SXRA 4LFIA 3U87A 1OL7A 3E5UA 3LA2A 4KKGA 5E92A 3D2KA 2XNGA 3E3BX 3OTUA 1LUFA 4CFNA 5JZNA 3BV3A 2IW9A 1S9JA 5AP3A 2AC5A 5HVYA 5IEVA 3UZRA 2F4JA 3OFMA 4TN6A 4FSUA 4X3FC 5A4EA 3DQXA 2OIQA 2G2IA 3ANRA 5JR3A 4RVLA 3OF0A 4W4YA 2BALA 3PY1A 4YTFA 1FZPB 2Q0OA 1H01A 3KP3A 3FE3A 4O81A 4O22A 1CSNA 5M4CA 1OBDA 2CNUA 4WG3A 2W1IA 3GU5A 4D2TA 4U42A 5C8KA 3THBA 3OWLA 3F8MA 3UQCA 4UALA 1JNKA 3IHUA 1BC7C 5H6RA 2ITYA 3LM5A 4R5SA 3U1DA 4EOKA 3HKOA 2VT2A 1SAXA 1OVEA 1OPLA 4ZYHA 5HE2A 4YNOA 5C4KA 4M9ZA 2OZAB 4GG7A 4CMUA 5AONA 2UVYA 3WILA 5JFXA 3TDWA 4YZDA 5LMKC 4WXDA 4MNUA 1MRYA 4P9FA 3ZTXA 3BPRA 5HO7A 2PVLA 2B9JA 3JVRA 2VO0A 4C36A 1ZYSA 1ZXEA 3EFJA 4Z55A 2LF8A 2EA2A 2QOFA 5HTCA 4FV2A 4JT3A 3C7QA 4AIHA 4L8MA 5M06A 4JR3A 2PZIA 3D15A 4MHGA 4ANNA 2YLFA 3RWPA 2E9PA 3L9LA 2YSRA 4IAKA 3G9NA 1YDRE 1URCA 2I7QA 5HDNA 3T5XA 4FV3A 2B1PA 1J0RA 4Y85A 5IA0A 5BVFA 4Z7HA 3OWKA 3CUQC 4NIFB 2RV8A 3NNXA 3RYRA 3RPUA 2JKOA 1YWVA 4I6BA 4FX4A 4MKCA 4XV1A 4PQNA 3MPMA 4EQQA 5L3BA 1YDTE 4FKSA 2XEYA 4WSYA 2BRGA 2QR7A 2YITA 4DT9A 1RE8A 1R1VA 1BL7A 3BHUA 3OT3A 4YTHA 3DKGA 5H8GA 4QMNA 1ZHFA 3NYNA 3L9FA 4BC6A 2EV5A 5FWKK 3Q9ZA 5T68A 4BTKA 3OS3A 5DEYA 4O21A 5J9ZA 3PIXA 3BLQA 2F2UA 4G16A 1U8RA 4HVIA 2ITUA 3KP6A 3Q4ZA 4BN1A 2VX3A 2YR2A 3OTVA 1R1UA 3T3UA 1PMUA 4ZLOA 3KEOA 3QWJA 3PFQA 2HW7A 2WU6A 4ZS4A 5AIKA 3R9OA 2GNHA 4EHVA 1B39A 3R73A 1U3EM 3UYSA 4BL1A 4C37A 2D1VA 4IX6A 5FBOA 5HESA 2M45A 3TDUC 4JQ7A 1MQBA 2J6MA 1BC8C 2EXMA 2XIKA 3FMEA 4WXHA 5FP5A 5GZAA 4WHZA 2YLEA 5E8XA 2P0CA 1E9HA 3UZTA 3A7JA 4F9WA 3SZPA 2AXLA 1UWHA 2Z7RA 2EV0A 2M8EA 5D7AA 3RPOA 3F3VA 4XBFA 4EC8A 4QTCA 2YAKA 3VBWA 2YDJA 5GZ9A 2PLYA 5IA1A 3BQCA 4ID7A 2GZWA 1B9MA 5HOAA 4AZTA 1YQAA 2WMRA 4FT0A 4G31A 4JNWA 4RAYA 1Q8ZA 3QQKA 1LEAA 3W33A 2UV2A 2ZV7A 5D8LB 1IEPA 4D9UA 3UYTA 4FT7A 5JMSA 5JFSA 4L5JA 2CW0F 4LLGF 4ACMA 3AXWA 4G6LA 4PF4A 4A12A 1SFXA 2DPUA 2PWLA 4M9XA 5ERIA 4X3JA 3WTXC 4KINA 5EW3A 2XASA 1FGIA 2IA0A 4JDHA 2OZAA 4FKLA 1J5YA 4XBUA 3BHYA 4JR7A 4BYIA 4HNIA 2YCSA 4D1ZA 4HYIA 4O6JA 1S6LA 4JJRA 2K86A 5DUIA 3DPTA 4TNDA 4XBRA 4FG7A 3FMHA 5L6PA 4YZ9A 5KMJA 3TCPA 3F3ZA 4L00A 4U40A 4EK5A 2WTCA 1K9AA 3TDVA 2GNGA 5HE3A 3CJGA 3ATTA 4ANLA 3NEWA 3HRSA 4E6AA 3FC1X 5CASA 3VS6A 5A54A 4D5KA 3UPXA 2ONLA 5DA3A 2PUUA 1J75A 4ALVA 1YI3A 1CF7A 3O2PE 5AMNA 2ETRA 2Y48A 5CEPA 2WO6A 4DCEA 3I5ZA 4EK8A 2CGWA 4YIIA 4OOIA 2FBKA 2VTQA 4HBLA 4FL1A 3CGOA 4M3QA 2WQBA 1BBYA 2A6EF 3SDJA 4NM3A 3ZFMA 5DEQA 4KFCA 1URWA 4QP9A 3HSEA 3ZMVA 3HRFA 2JZYA 3QAHA 3AD5A 2HKOA 4CFFA 3WGHA 3QTRA 5AX3A 1V1KA 5D41A 5M4UA 4R7HA 2I6LA 2LDUA 4QMYA 3UVPA 2XB7A 1ZLKA 3Q9XA 4GYIA 4ASZA 4ZEGA 4M15A 4MD9E 2OLCA 4G6OA 1XMKA 3ZCLA 3LFQA 3D2IA 4XLVA 2GNIA 4XJ0A 1G3TA 2J0IA 2FRHA 4DE4A 2VV9A 2IN6A 3R2BA 2F9GA 3EN4A 3LFDA 4YR8A 1IXRC 5LBQA 2VO7A 2R0UA 5CVHA 4DFBA 4MXZA 5EYKA 5FFXA 4A06A 4K2EA 4O0XA 4F9AA 4UN0C 4EBWA 3I79A 3V8LA 3ZMDA 3OBGA 3QA0A 2F2CB 5EW8A 4IIRA 1HW1A 4JRVA 3AC8A 3DS6A 2JBPA 3TZ8A 3LFNA 4XLPF 4ONAA 2I0VA 4IJ9A 4PMPA 5HEZA 4RBLA 2WFYA 3VW6A 1WI9A 4AGDA 4BHCA 3W2CA 1SVEA 3TM0A 1PYXA 3WF7A 3VS4A 4QTBA 5K5NA 1R22A 1OIRA 3UVRA 2P6SA 2YA9A 5HLHA 5GJGA 3CLYA 5A46A 4QP4A 1FMOE 2EUFB 2GS7A 2X7OA 3R7IA 4PGGA 3L8PA 4WO5A 1ZYLA 3EYIA 2VODA 1R0EA 3UG2A 3E97A 5HLNA 3F2NA 3SXSA 4LOQA 3OXTA 4RWIA 4AIJA 4KIFA 3Q6UA 4C8BA 4YJTA 5CEKA 3W18A 3C1XA 4EL9A 1RQQA 2B9IA 5F4NA 5CEMA 2X6EA 4FVRA 4Q9ZA 2XIZA 2WOUA 1IXCA 2DWBA 1KOBA 4DLIA 4LMYA 3EH9A 4F65A 4WUAA 4X2FA 2ITVA 2D2WA 4BDHA 4XRJA 2OU7A 2WTEA 2ZV9A 1Y8YA 2VGPA 4DEGA 3QD2B 3SW7A 4OIPF 2XKEA 1KQ9A 3H3ZA 4FV8A 1XH5A 1YXUA 4BHNA 2RN7A 2IVSA 1RW8A 3W2OA 3ZUVA 3SZTA 2PVNA 3LMGA 4EVIA 4CCBA 5ICGA 5DUKA 2LKPA 3BHVA 3MGYA 1QGPA 4C2WA 4I01A 4RVTA 2ZMDA 3OOGA 2X9FA 3PXKA 2PE2A 4YJSA 4BDJA 2PI0A 3NGAA 1YW9A 4O84A 4C4FA 3QCSA 3BY6A 2XKFA 4J71A 2X0LA 2ITNA 4CCUA 4K2RA 4FTAA 2EB3A 3HTUA 2BVAA 3ROCA 2P8TA 2RF9A 4AG8A 4IPAA 5BUJA 3QALE 2YJSA 4PDYA 4BH9A 5HLGA 3JYAA 4F6SA 3RKBA 4EM2A 3W32A 5BYYA 4LRKA 2R5TA 4P90A 4GU9A 3MBLA 3P1AA 4RQVA 5CU6A 2EXCX 4O0WA 2JC6A 4AUAA 5K0KA 2F7XE 2VU3A 3MZYA 3EL8A 1BI0A 2QODA 4G9YA 3NAYA 2V7AA 4UVCA 4EH2A 1WKMA 4DH5A 2MD5A 5K4IA 2PYWA 3N4TA 2OFVA 3CXWA 1HKTA 5E17F 1GXPA 4I41A 4HQEA 4YLLA 4PNKA 4EC9A 3CPBA 4YC8A 5KKRC 4A5MA 1FX7A 3CTHA 1KE7A 3A8XA 3NNUA 4Q9SA 5AM6A 4X3FA 5LJJA 4E73A 4RX7A 1P92A 1L3LA 1SVGA 3TNWA 1P6RA 1FBUA 1S7OA 3U54A 1T98A 1IAHA 3WI6A 1FWZA 4B99A 2NS0A 4GL9A 3JVSA 4PTGA 3TN8A 4M72A 1DI8A 3BV2A 5CXZA 2LF7A 2VBYA 4QWQA 2JIIA 1VYWA 4FNYA 4KN7X 3BYVA 4UV8A 4S2ZA 3F3WA 2KIMA 2IZTA 3OC1A 2YIRA 4Y5HA 5KMNA 3MEXA 3RAWA 3HOSA 2YISA 4MXYA 1OIYA 1P4FA 4G5JA 3CCNA 3DFGA 4H3PA 4W8EA 1VEBA 5FGMA 5LMKA 4HX7A 3FDNA 4WA9A 1MGTA 5CAPA 4L9TA 3T8OA 2FVDA 1IXSB 2WKMA 2GQRA 1EV7A 5DYJA 5IA4A 4L68A 1RDQE 4CLIA 3F6VA 3F6XA 5LRSA 2IVUA 1DPRA 3F7ZA 4R3CA 3FZSA 2JFLA 3DKFA 4C58A 3LCDA 5J6XA 5IISA 5DVRA 2ZO4A 1GNGA 3CUQA 3KRRA 3DK7A 4J99A 4MD8E 4FSZA 1REKA 1F9NA 2FYSA 5CLPA 4K8AA 4C61A 3BLRA 5DIAA 2OFUA 4BDEA 1WBTA 3IO7A 5DRDA 4HW0A 1ZY5A 5JGBA 4AZVA 4ZY6A 3KP7A 4NTTA 4OIQF 4BCKA 2QYOA 3DLZA 5IQEA 3NS9A 3QPHA 4KD1A 3NAXA 4Z16A 5CYVA 3KRWA 1QPDA 4Y13A 2HELA 1XJDA 3UO4A 2P3GX 4XX9A 1GVJA 4DLJA 4CHUA 3B73A 4UXLA 3EQCA 3LXKA 4ZZOA 5IQHA 3PTGA 5CF6A 3P9JA 2FNPA 1P2AA 4BDCA 4S30A 4ANOA 3FXZA 1FVTA 3SC1A 4OBQA 3R7VA 2HK5A 3PA5A 5EOBA 3NQOA 3VUMA 3TJDA 5CQUA 3KEQA 3HUGA 3V3VA 4BTFA 4C57A 3BX5A 4E6QA 1HCKA 2P5LC 2P7CB 3D5XA 5F95A 4A4XA 1M17A 4JQFA 3SQNA 4CFWA 3GOKA 3TZMA 5LWMA 1Q8WA
chains in the Genus database with same CATH superfamily
1A9UA 2ELHA 2JUCA 5EFQA 3PP1A 3ZSGA 5L2IA 2VQLA 5EEGA 2W4OA 3GXOA 4C4EA 4PMMA 1FT9A 2PZYA 1W2CA 3VO3A 2UVZA 4EQMA 3VQUA 4LOPA 2UZUE 5L3FA 1LDJA 3OV8A 2QU6A 3G2BA 3LQ5A 2W00A 4CFVA 4F7SA 5AR4A 4HCTA 3C3WA 4BE2A 2CGUA 2DA4A 1G5SA 3O8UA 2XALA 2C6OA 2GSFA 5C4LA 3PJ1A 3MKWB 4RGSA 3CR0A 2WMAA 4EZ7A 2HI3A 3QC9A 3RPVA 4I6ZA 2HPMA 1D0XA 3K2ZA 2W7XA 5F08A 1PY5A 2BRMA 2VPLA 4TWCA 2V7FA 4HGSA 4CCKA 4CGZA 4DFUA 5FUTA 5GIPE 2ZB0A 4J8NA 2LKSA 4FSMA 2CN5A 3W0SA 4XL9A 2E2HJ 4D58A 4YU2A 5CWZA 4EYMA 4OTRA 1W82A 3MVMA 1XQZA 3WODF 5FTQA 5M57A 2YERA 5IDPA 1ZR4A 2BRNA 3WU1B 2ZM1A 2V26A 2ITTA 3QTZA 3OOPA 4FTKA 2V1UA 3LQRA 4F1MA 2ZYBA 4MO7A 1YWRA 3ASNH 4FV0A 5BMMA 1LDDA 2OG8A 2HZTA 2VQCA 2Z8CA 3FPMA 3TNHA 3HIFA 5IYDJ 4KS7A 2ZM3A 5IQFA 2X85A 1W36D 5DN3A 1A04A 4OT5A 3V04A 1R4MB 3FZ1A 2B0LA 3Q4CA 4L18B 3V8TA 4OBOA 3Q3BA 1PVEA 5HS8A 3HHGA 5FFZA 1EKEA 3A61A 3UODA 2E1NA 1TL8A 5B2MA 3KP2A 3S1QJ 4KITB 3DNEA 5LHGA 5F9EA 4FKJA 2C4GA 1HDPA 3ZRLA 5EQPA 3VYTB 3IDCA 3LVPA 1P9QC 5T3QA 3FWEA 2CG4A 2UZNA 4QTAA 3ZFXA 3KXGA 4QMWA 3U21A 5HLTA 2JA8J 4HV6A 2XK4A 4L52A 2VOPA 4RGXA 2C6IA 4XLNF 4TYJA 4MQVA 3IH2A 4M68A 4PFOA 2JA2A 4QRCA 5BUEA 4FZFB 3LFCA 2HWPA 2WMWA 4AW5A 3U9GA 2L7ZA 3RM6A 2GOMA 2XK7A 3CDHA 1FOYA 2XROA 2VTHA 3FHRA 1YOLA 1Y6IA 5LCJA 4DBQA 4HYEA 4N4OB 1XX5A 4M69B 3U9CA 5C03A 3RK9A 4D9TA 4C34A 3BZKA 3MB7A 4BGGA 1OMIA 2C0OA 4BYJA 2ITWA 3IW5A 4C9YA 4CLJA 1SD6A 5BVNA 3K1MA 3MS9A 4ZOGA 5ED4A 1X3UA 4UYAA 3ORNA 5E8ZA 1XR1A 2MABA 5FXSA 3WTWC 5EQEA 3PQJA 3HRBA 4H1MA 3HP2A 1PMNA 3R04A 4XLFA 1O6YA 4A9UA 4BI2A 3ZXTA 1DP3A 3PP0A 1J2XA 3QZFA 2ZXWH 3BHTA 2B55A 4PDPA 5L6WL 4DF3A 1FNNA 3H9QA 4ENYA 1W4MA 4AN3A 3NVKI 3AAFA 5EG0A 3OCSA 2E7XA 4LFUA 4CCJA 1U54A 4KIQA 3E7OA 5FEDA 4RT7A 5F1RA 1Y0NA 2HVQA 2XVCA 3FI8A 1GXQA 2W1DA 2YUSA 2NVUB 1ERDA 1RZ4A 1V0BA 4R5YA 2ZSHB 3WE2A 1FIAA 1R1TA 1W5TA 1FC3A 5GAHJ 3FZPA 3N4VA 4ZTNA 5CKTA 2WMTA 2BZIB 5JSMA 2EFOA 3R0TA 3UIUA 1H24A 2C5YA 2NRUA 5EYCA 4AOTA 3GXLA 1VQOI 3FYJX 3R83A 4L01A 4M6XA 3G2FA 4XP0A 5J87A 4EM1A 3IW7A 4XP2A 4E26A 4KA4A 2VO6A 4KIGA 1A06A 4G3DA 2XCKA 3CJTB 1S29A 1J1BA 3BTJA 1YLFA 2YN8A 3NDMA 2XF7A 1I3QJ 3W8QA 2DQ7X 5HU9A 4O7ZA 3D83A 4IF4A 4XOZA 4BDAA 4A4LA 1XN7A 2KQRA 3TYKA 1KQ0A 2JIVA 3AC3A 3OEZA 3P4KA 4F7ZA 3A7IA 2P7VB 3QPSA 3I5NA 5E1SA 4EH4A 1UHMA 4IWDA 2WU7A 5KHWA 2JLDA 3ABTA 4OTPA 5FRIA 2CSOA 4YFXF 4DN5A 2FMLA 3OY9A 2PVJA 4IHYA 1KU3A 2ZMCA 4JX3A 2Y4PA 3W55A 4H0EA 2W4KA 4O2PA 3KRLA 1CTPE 2Z5UA 4HPQA 2VNWA 2BV6A 3EYHA 3ZDIA 4MK0A 2WB1A 2HOGA 3OSFA 3RPRA 5L2QA 2BGCA 2CQKA 1WGXA 2NP8A 1XH8A 3FXWA 4IHVA 3KXZA 3WOWA 3BELA 5BYZA 4ACHA 2KKOA 3IONA 4JBOA 5HNBA 3MA3A 4GUBA 3ECHA 4EOIA 4ZXTA 4C3IJ 3QPTA 4RGRA 3DPKA 4KB8A 3P78A 2KMUA 4HDUA 2JQ7A 1TW2A 5ILSA 5AP0A 1FINA 4LV8A 3EQDA 4IDTA 3UJGA 4ERKA 4CO8A 3V5TA 1T8IA 1OCPA 1F43A 3LPBA 4RB0A 2ESHA 3TMOA 2JT1A 4O1PA 2VI6A 4GKIA 2BZJA 4UUVA 2V62A 3HV7A 1B59A 3PXZA 3TZ7A 3R60A 2K5CA 3JAMK 3PQKA 3LA7A 1J7KA 3BIZA 1VQ8I 3CY3A 3Q9WA 3ZQGA 2NVYJ 3SV0A 3S3MA 2AQEA 2YACA 1SVMA 2ESNA 3PPKA 3VBXA 3R2YA 3VHKA 3ULQB 2VKHA 4C30A 4CEGA 4ZYDA 4G94A 4J1RA 3REPA 1H89C 1HC8A 5F64A 3LSTA 1FVRA 1WAKA 4ZTHA 3P9CA 5GTHC 5IUGA 5HG5A 2G2HA 2HQNA 4YHJA 4B8XA 3C4XA 2H27A 4CQGA 2ZAZA 3PA3A 4YUQA 5A2QK 3TACA 3ASOH 4O7SA 4UZDA 1BUHA 3E8NA 2P6TA 1BR4A 4CYDA 1XH7A 2VBWA 3C4CA 4YLKA 4A3EJ 2VTRA 4M69A 4HYUA 3ZLXA 1X19A 1LFPA 3MFSA 4L3JA 3BG3A 1ZGWA 4EM0B 1HXDA 5H8EA 1VQ6I 4NJDA 2UWMA 5TOZA 2DODA 1DI9A 4GJ3A 5CSHA 5M4FA 3TW6A 2QLUA 1Y1WJ 4GV1A 1H1QA 4DFNA 2PJRB 4ZSJA 2VWWA 2IAIA 4LQMA 3CZ6A 4OT6A 4ZSAA 3AGMA 3QX2A 5IMXA 3PUFA 4O86A 3KREA 3H9OA 5IEYA 1CKPA 4IANA 4G6NA 3CQWA 2VKDA 3PZEA 4XCUA 4ZSGA 5BPIA 4CV8A 4RWKA 5I4NA 2Z3YA 5FTOA 2OJFE 2PVKA 1GZKA 2CHLA 4OU0A 3LAPA 3U51A 1WQ2A 4HLYA 3BYOA 3O8GA 3UIBA 2C3LA 3BTLA 2R5YA 1CKJA 3QD3A 4FV6A 5BVWA 3C18A 2OC6A 2PK9A 3RPQA 2W1GA 4EJWA 2WNTA 2I0HA 4EHGA 4J01A 3AD6A 2EB2A 1H1PA 3DBHB 4QP7A 3FQSA 1ZRZA 4PCQA 2LBFB 1PP7U 1P4OA 4E7WA 3OL4A 4V01A 1DU0A 3OD6X 4OAZA 3NYVA 1ZMUA 2UW6A 4Y33A 2EBIA 1AD5A 1V5EA 4GG5A 3KPHA 4KKEA 3QU3A 2DW4A 4BZDA 2H96A 2OXXA 3IQ7A 3W0QA 4YJOA 3L2QA 4CSVA 3OYDA 4JAIA 3KN5A 5I5ZA 1B72A 3ZUUA 5KVRA 4YSJA 3QWKA 3F8FA 3RSNA 3HG9A 3EN5A 5KE0A 1U5TC 5A4LA 3RCDA 1I50J 1L3RE 2XYNA 3MVHA 3OY3A 2CW7A 4RA4A 5KO1A 1RI7A 2OO8X 1GIJA 1MJBA 4IOAF 4DTBA 3EUHA 2A0CX 3DXPA 3I53A 4IXAA 4EOMA 3CDLA 4ABZA 4MNEB 4BQAA 4BBRJ 2HTJA 3NZ0A 5HIEA 4AXDA 4B47A 3LJ0A 3QC4A 3R02A 5L3EA 3IS5A 1JJ8C 3F9NA 4FETA 2B0QA 5DH3A 5AADA 4FZDB 2ID6A 2PE1A 2R7BA 4WIHA 4FKQA 4R3PA 2F5DA 4KIKA 3FMQA 4NB5A 5HBHA 3UP7A 4FIJA 1OCTC 2OGVA 1BIAA 2XNMA 1ZZ2A 5M4IA 4D1QA 1BX6A 3F66A 4IAZA 3H3VK 2X2LA 4QTDA 4PY1A 3L1SA 3C0GA 3F5XA 5JVTA 1H07A 2X9EA 2XBAA 3KEXA 3FLWA 3CD8A 3N4UA 1IRFA 3TW7A 2RREA 1I5ZA 1OR7A 2IW8A 1ZOGA 3BE9A 1FOTA 4RIYB 3BWFA 3VOEA 3B8QA 3UZPA 3DBFA 3TZ9A