1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
1ZOGA 1L3RE 1U4DA 1FVRA 4ZZDA 2QI8A 3U51A 1P4AA 3O8UA 3LQ3A 5HU3A 3FQHA 3SXRA 5D11A 3QKMA 1PMVA 3E62A 3F21A 3FL5A 5ACBC 4HCUA 3ZO2A 1YWVA 4EJOA 4HBLA 4A9TA 4I23A 3Q5IA 3DCVA 4CFWA 4IX6A 1E9HA 2CG4A 1OUKA 3RZFA 5M57A 3A60A 3Q04A 4FV9A 2KRFA 4E6AA 3HGKA 1HW5A 2GQSA 3GUDA 2UW0A 3FMNA 3MH1A 1ZG3A 3FMDA 2PMLX 4DGGA 4FTTA 2JGZA 3HKOA 3F5UA 5IA3A 3ZP5A 4LLGF 2DI3A 5J5TA 1RUOA 4WNOA 5CU0A 1A48A 4ZH4F 3N4VA 3ZDUA 2UVYA 4I6HA 1G8SA 1T2KA 5LVPA 5CEQA 3WZDA 4R77A 4CLJA 5L3AA 3VULA 3KCCA 3HRBA 1U5QA 3QZHA 3OCSA 4I4EA 4IX3A 4FKPA 5AV0A 4AT4A 2VWXA 5CU6A 5IT9Z 4L0YB 2GHGA 3K54A 1BI8A 3QTZA 3RM7A 3CJFA 4RZVA 4BIDA 3PJCA 2IZSA 3ECOA 3TNQB 1WI9A 5G1XA 3SAYA 2QU6A 4ARKA 4QQTA 5KNJA 4MGRA 5BOXA 5FEEA 1OIQA 1PP8F 2GHMA 4QNAA 3IW7A 4KFCA 3BBTB 2R7BA 1YOMA 4QMQA 4DAWA 2C6TA 2CNQA 3O96A 2HW7A 4FV2A 4HAMA 3KEQA 1GXPA 4M9SA 3DS6A 4IZYA 4A4LA 4TNDA 4I0BA 5H6RA 4V0GA 4AW5A 2F2CB 1GHCA 1WMKA 2W5BA 4JOAA 1FBQA 3WBLA 5HTIA 1U5TC 4O5VA 4ZTNA 2QHNA 1X8BA 2DQRA 2WMBA 5ERIA 4KN7X 3F5GA 3HMOA 4A0XA 4X21A 4FSWA 5FB2A 1QPEA 3ACJA 4L42A 2OICA 1VZOA 3QC4A 3QAHA 4FSZA 1ZWSA 4EOKA 2PN6A 4WSYA 3HOSA 3ROUA 2V1XA 4O2PA 3SC1A 3RMFA 2V22A 3HV4A 5K1YA 4JIKA 4QMWA 2FO0A 4JR7A 4IB3A 2HDCA 4HYIA 2FH9A 5AP5A 2C3JA 2YX4A 4FNWA 1TW3A 2V6CA 3GU7A 2JKMA 2PMIA 1UFMA 4UXQA 3R9RA 5E1EA 4FT0A 3RM6A 3DF8A 3ZUUA 5DUKA 2Z99A 3JTHA 4DEEA 2FF4A 3ECHA 3UG1A 4GKHA 1FINA 2XHKA 3BHHA 4F64A 2QQ7A 1YIOA 4L68A 4QMOA 4RFYA 5DR2A 5IQEA 3F3TA 4ZJJA 5ETIA 2VTOA 5H8BA 2HW6A 3MTLA 1KSWA 3NUXA 1IA9A 4KB8A 4NM5A 4QMNA 3DQXA 3NNUA 1ZREA 3Q9XA 2J5EA 3AT3A 3R22A 1OIRA 3CUOA 4GCVA 5GNKA 2YM7A 3BROA 4KNYA 5EFQA 1L3LA 3V8SA 4ZSGA 4MNFA 3E3VA 4N6ZA 3UZPA 1XSDA 4IM3A 4ACDA 4C8BA 4YG2F 3LCDA 3WG9A 2EJRA 2FSWA 3P86A 4NIFB 1YWNA 1PXJA 4H3QA 4ITJA 2ERKA 1PKDA 3KCKA 3S4QA 1H9TA 4ANBA 4S30A 4CYDA 2BCJA 4OBOA 3EQHA 4X0MA 5AP7A 2OSCA 4DEGA 3LCOA 5EM5A 4H3BA 4MXAA 3WODF 3KXGA 3M11A 3W2OA 3LKMA 3N4UA 4FSMA 4C33A 3JSPA 3UC4A 1Q3DA 3QX4A 1X3UA 1CGPA 4YFKF 2K7LA 5M4IA 1FOTA 1PRYA 5H8GA 4HNIA 3EYIA 4YC8A 4ALWA 3P08A 2Y7JA 4Q48A 3HUBA 2FRHA 2HYYA 4QP2A 5LMAA 4EC8A 4EM0B 4DH5A 3KA0A 4MQ2A 4WUNA 4OGRA 1WSUA 5LVLA 5HGIA 4ANMA 4M73A 4EM2A 4YJQA 4QMMA 4FT7A 4JAIA 4E4NA 4RIOA 4ZMFA 4Q4ZF 3FJQE 3C0IA 3TNPC 1T6SA 3K2ZA 2PL0A 4RX8A 3HA6A 5ANDA 3ORMA 2D1VA 5ILVA 4E3CA 4P9FA 2V7OA 1R78A 3W8LA 5GJGA 3DOGA 3IK3A 2HFHA 3KXHA 1I5ZA 2PZYA 3MB6A 4DITA 1H28A 4I2OA 3HTSB 4X7QA 4DLJA 1TNSA 3R6SA 4OTQA 2CKOA 1SMYF 4E6CA 1OPLA 5HNBA 1ND4A 1JOWB 4FUXA 3CIKA 2KKOA 5BVWA 4OTPA 3O2PE 1YHWA 2CFXA 5DEYA 5CVGA 2PZPA 2K4JA 3SG9A 4LOPA 2X0LA 5EYMA 5BVDA 2WQEA 4Y72A 3NVKI 1GIIA 4USEA 5HE0A 3NZ0A 4YO6A 1P14A 1QPDA 4F0GA 2RV8A 4LD5A 2Z8CA 4NM3A 1K6OA 3L9FA 2XIGA 2OK1A 4RC2A 5IA5A 4AF3A 1ZGJA 4I4FA 4QQ5A 3COIA 4HOKA 2JBPA 4DG3E 3FZTA 4C4GA 5E1ZB 3FC2A 3RKYA 1SFXA 5J95A 4X2FA 3SDJA 2HOEA 4QYFA 2Q83A 2R3KA 4RWLA 2ZJWA 2KULA 1O9UA 4JAJA 2FOKA 2Z2WA 1Q99A 3NLBA 5LHIA 3H9FA 3HZTA 4NM0A 4FTKA 5A3XA 2Q8KA 1IRFA 2GNFA 5HO7A 3PRFA 1GVJA 5DG5A 4QP1A 4BZOA 1H00A 4YZDA 3DAKA 3MW1A 2GA1A 2VX0A 2HZ4A 4JJRA 4GKIA 5DE2A 4C57A 2E1NA 2Y4IC 3OVVA 2CSOA 5LMKA 4M97A 3EN7A 4UMQA 3SHEA 4FIJA 2QO9A 2DYLA 4EOJA 5D5WB 1WZYA 3SHFA 2HZ0A 4AE6A 2HWOA 3Q9YA 3AD5A 3CUQA 2G15A 4I01A 3L8SA 3U4WA 3KVWA 4RX5A 3MA6A 4HYSA 1Q24A 3DDPA 1Q4LA 3T3VA 4BDCA 3HSRA 1REJA 2WZJA 3ELKA 4MBLA 2H94A 2XJ0A 5ED4A 1G8AA 3DBFA 2R64A 5J7BA 4O86A 2XM8A 2D1HA 4PNKA 5HX6A 4EOLA 5FG8A 5ILUA 2BZIB 4RG0A 2WU6A 2V5QA 2O03A 4ZTQA 5FXQA 2ZMCA 3WE3A 1MRYA 2HYGD 2XF0A 1WBWA 4D0WA 4I21A 3CJGA 4D9TA 1ZH5A 4LG0B 3G33A 5AV1A 3MGYA 1SAXA 2RIOA 4CV8A 2VTNA 2G9XA 2BR1A 4IANA 4O0YA 2WOTA 3HRFA 1BX6A 3NQOA 1U8RA 3TTJA 5FFXA 1OECA 2BRBA 4UXNA 1OZ1A 3NCGA 4DH1A 4QTCA 2YJRA 2HY0A 1ON1A 4MD8E 5ICGA 5CANA 2XKCA 4E8AA 2Z7QA 5C9CA 3PA3A 3KZYA 3FMHA 3QCQA 2OO8X 4NW6A 3NIEA 4OINF 3NSZA 3PRIA 5AUWA 3IRRA 3LFDA 2YCQA 1SFUA 3F69A 4PNIA 2OGVA 3DBQA 3I60A 3RK9A 3F88A 4FR4A 4HV5A 3JS2A 3V5JA 1K79A 1PYEA 4KINA 2PVLA 3LQ8A 3T0YA 4PDSA 1KU2A 1RNLA 3RWPA 1Q61A 2YLFA 5AEPA 5BUEA 3FBVA 2RF9A 1ZARA 3P9IA 5CAQA 2ITNA 2XUUA 3BPRA 1TKIA 4NT4A 4NTSA 1G3TA 2JT1A 4JLCA 4YC3A 4Q9SA 1SVEA 3R7IA 1LQ1A 4UN0C 4EEVA 3D0EA 2P4WA 5HBEA 5BVEA 2YIRA 5BX0A 2K27A 2W7XA 3LLTA 5HNIX 2JPCA 2UZBA 4LG0A 1F3MC 1JVPP 3HRSA 3RIRA 2HWVA 4A9UA 2OZ6A 1AD5A 5CVUA 1V0BA 2G7UA 3SD0A 3C7QA 2YPRA 5AX3A 4GEOA 1YW7A 5HO8A 5CVVA 5IMXA 1URWA 3II5A 3SOCA 4FGRA 4EORA 1XMAA 4ZYDA 4EK8A 4KIPA 4M0ZA 4WA9A 3GC7A 4KIGA 2ZDTA 1H25A 4NK9A 3BGPA 2RKHA 3F72A 4FNXA 4NKAA 4YU2A 1ZZ2A 4TW9A 4C3RA 5BS6A 1W84A 2KJBA 5EG3A 4UVAA 3ROCA 3GVAA 2QLQA 3GQLA 4BXUA 3NRVA 3Q4TA 4QP9A 1YHVA 2YSRA 2OZAA 4QTDA 2D45A 3CUQB 4FT9A 5GINE 4FTQA 5ETCA 5LVOA 1O3QA 2XK3A 4KBKA 4F9CA 5KVRA 2UZKA 3EQIA 2BILB 3ENMA 5AMNA 2IW5A 3BV3A 4BDBA 4L9VA 1PMEA 2BEOA 4BTJA 1FBNA 2JBOA 4NYEA 4E5WA 4ZSJA 3OW4A 4O7YA 1KGSA 3OCGA 1RQQA 2EFQA 5IQFA 2EXMA 3BU5A 3EYYA 4NZWB 4PPCA 3GCSA 3MI9A 1MZBA 4UWYA 4QYGA 4DF3A 5CT0A 3TO7A 1GJOA 3I53A 3FAAA 3WE4A 5JFXA 2VWVA 1CM8A 2RFSA 2A68F 1P4XA 2KIUA 4FV0A 1C0WA 5D5XB 4MTEA 2E7XA 2YAAA 4EKLA 4MD7E 5HX8A 2QLZA 3IOKA 4F7SA 2GNGA 2VUWA 3U2RA 2R3JA 3ZS5A 1H01A 4OTHA 5T3QA 3ZC5A 3VEPA 3MVHA 4G34A 4L5JA 2ETMA 3WF5A 1QBJA 4L7SA 4CICA 5HHWA 3TG1A 2HOGA 3B8RA 4O7TA 5LVMA 5KKRC 4K2RA 5JQ5A 5HEZA 1WWXA 2PJPA 4TYGA 2YCRA 3R4KA 2HY81 4X2NA 3NUYA 3VJOA 4RQVA 4CFVA 3RKBA 3Q6WA 3R8PA 5C26A 3Q60A 2PU8A 2PG4A 3VAPA 3ATTA 5FTQA 2JDOA 4AS0A 4FKJA 4BCMA 1TNTA 1YDSE 2OIDA 1A06A 3A4OX 4AGDA 1PMNA 3CQEA 2BDWA 4G31A 1U54A 2PVJA 4UMUA 2W99B 1K7AA 2OI4X 5BMSA 5FXRA 3VRZA 3W8QA 2UZOA 3RPVA 1P2AA 1JHFA 3PQKA 4BCOA 2LDUA 1FYKA 4FV6A 1P4FA 3TZMA 4L5IA 3UNKA 3F9NA 4PQNA 3GEQA 3VBQA 4IWQA 4WKQA 2L02A 3ULIA 5M4FA 1OL6A 4L46A 3FLQA 2QOHA 1UV5A 3PVGA 5K4IA 2QLUA 4V01A 3N9XA 2VT3A 2X9FA 4CYIA 2VONA 1OR7A 2VTJA 4EHVA 2XK4A 3ERED 3FLYA 3VJNA 4QP6A 3W18A 4CD0A 4QMTA 5TO8A 5E92A 3PDTA 3ZH8A 3BYVA 1IN6A 4MBIA 2VC0A 2XASA 4GIHA 1OPCA 3K2LA 4EYJA 3E5UA 3CR0A 4TNBA 4IC8A 1MRUA 4I1ZA 2XUBA 1J7KA 4RA4A 2OXXA 1FVTA 3DXJF 4GFGA 4Z7HA 2BZKB 3CTQA 3C13A 3DA6A 5DEWA 3KKVA 4U0YA 3U1DA 1NW1A 3OXTA 4FEUA 4EUTA 4BCGA 1Z6TA 3EN6A 3KL8A 4HYHA 4P2KA 4ZY4A 4A5MA 4RIWB 1XB4A 3WU0A 3ORNA 5A6NA 5BVKA 4GCJA 2ZNZA 1Q5KA 3QLFA 4M14A 4USFA 3O17A 3SXYA 4R78A 2DU9A 2GXBA 3IDCA 5IQDA 4GK2A 4BDKA 4ENJA 3RK5A 3R63A 4E5AX 1Z9XA 2R3PA 4IFGA 2PMUA 4ZP5A 1IXRC 3QRFF 2FVDA 4IWOA 4M66A 2XAFA 3QQHA 3FKOA 3NAYA 3W2CA 5KMNA 2DT5A 4G16A 1SVGA 3NUAA 2W5AA 3SV0A 4IEBA 2XK9A 3FHZA 3G73A 3OFMA 4HDUA 3MTFA 3CD8A 5KUPA 3A99A 2H9VA 1A9UA 4BHNA 4BHBA 2V1UA 2AUHA 1MD0A 2C30A 3QTSA 2OF2A 3T1BA 2YITA 4YHTA 4PWNA 1U46A 4HX4A 3FMKA 4O1OA 3BU3A 3COAC 3L2CA 4M0YA 4TZRA 2GQQA 1QGPA 1DUXC 3PPKA 3GX4X 4RIWA 1R1VA 4K6ZA 4R5SA 2WEVA 4LGHA 4FVQA 4TN6A 4XG2A 5CQWA 2J7TA 3UC3A 1QCFA 4C3PA 3B02A 4G17A 2X2LA 5IDPA 2PPQA 2Z3YA 5JKGA 4RVTA 4G7ZF 2XCKA 2WTVA 3QALE 3ZXZA 3NW7A 3C4ZA 2ZNYA 4EOSA 1FBSA 4WNKA 4JQEA 1WBVA 3OS3A 3EFLA 4TYEA 3PP1A 1AGWA 1O6KA 2FA2A 3LAPA 4BCQA 3TDZC 2GMXA 4D4RA 2P5VA 3POZA 4FSTA 1S29A 3FXUA 3RBWA 4A4XA 4DFLA 3LA7A 2Y6OA 2CNVA 1I1GA 4FSRA 5B2LA 2H27A 2JRTA 3RVGA 4HW0A 4NJ3A 5FM2A 4DFBA 1ZLKA 5CF4A 1YDTE 2PVYA 2M5WA 4ANNA 2C3IB 2Y0AA 4O83A 4NL0A 3R8LA 2GS2A 2WHBA 1R5HA 3P0MA 3E6CC 3V5LA 3D4QA 4DEDA 5E8WA 3ZONA 2ETRA 4CRSA 4F08A 1SD6A 5JMSA 4FIHA 3LOKA 3VUIA 3R21A 2QBYA 5ITAA 4USDA 4XV9A 1S7OA 2WU7A 2L4MA 2CO5A 4L0ZB 3WTVC 3CJNA 3NYVA 5HVKA 2VNWA 4FTIA 3OV8A 2XVDA 2DLLA 4XBFA 3V8LA 3JW4A 5HOOA 4XP3A 1SMTA 4L9JA 3JTGA 3IC7A 1GIHA 4BI0A 3I5UA 3R71A 4V0GB 3JR1A 3LLAA 4MXXA 5M51A 5HE2A 3TDWA 3UMXA 1ZYJA 4DEAA 1OMIA 4L43A 2B1PA 3I59A 5L2TA 3VIDA 3R01A 5AADA 3GOKA 4I7HA 4NB5A 4ANQA 4C37A 3HA8A 1G3NA 3UBDA 2XEYA 3E5AA 3MPTA 4EJUA 5B7VA 4TT7A 3AC4A 4UVBA 2AC3A 3L7WA 3GT8A 2W1GA 4ERWA 4O0TA 2O3FA 2C6DA 3BPXA 4RMZA 5CF6A 3D94A 3I64A 2OIQA 3UVRA 4U41A 4U3ZA 5ETFA 5JGAA 5A4EA 4QMYA 4WNMA 2ETHA 4BKYA 4AN3A 4IWDA 2EB2A 3SVVA 4OT5A 4L9IA 4KIFA 4DN5A 1K2PA 4KBAA 4OIQF 3PWDA 4BBEA 4PGHA 3D5VA 3AMYA 2PMHA 3MQ0A 2OBPA 1YFHA 4E70A 4CGZA 1UU7A 4GXOA 3NYOA 3V3VA 4F1OA 2PUUA 4U79A 5GZ8A 2ELHA 3N4TA 2NP8A 4JK1X 5HNGA 3Q5ZA 4YHFA 4WCGA 5L6PA 2CQKA 4X6QC 1J1CA 4UXLA 1GOLA 4FYNA 4BCFA 5ICFA 5CXHA 5DCFA 2H34A 1HXDA 1QO0D 2YABA 3ANQA 2QZ8A 2F2EA 2XBAA 3EJ1A 5D8LB 3NIZA 1YRPA 4BL1A 4HNFA 3WTXC 1YTYA 4BWKA 2FGIA 3MFSA 3ODZX 4AOJA 3CO7C 2VBXA 5E9EA 3POOA 2IJLA 2BKKA 5EKOA 2X9EA 2FB8A 3TKYA 3FF5A 4FX3A 3QLGA 4PUZA 2NNWB 4Z55A 5DHJA 1R1UA 1P92A 4AOIA 1H1RA 3L9MA 3SXSA 2Y6MA 4J97A 3QRJA 3UO4A 3QP6A 1REKA 4ACGA 1IN4A 2X6EA 3C5IA 4I02A 5LLQA 4I6FA 4FKUA 3PJ3A 1ZAOA 2DTRA 4GS6A 4BKJA 5HD4A 2WTDA 3D5UA 3B73A 2B9FA 1ZRFA 3PE2A 4EGZA 4FG7A 4LL0A 3MJ1A 5A9UA 1GAGA 2YIWA 5AP2A 5I5ZA 4CG8A 4KIOA 1K78A 4YJTA 3UOKA 2QODA 3F8BA 4DBNA 5ANEA 1BI2A 2QOIA 2O8YA 2R7IA 4P4CA 5C03A 1FOKA 4LQMA 3EZRA 3UTOA 2XNBA 1OYWA 3WIGA 2OAZA 2G1TA 3VQUA 2RGPA 2ISZA 1BIAA 3R28A 2CNUA 3MPMA 4IXPA 3CTAA 4GMYA 5EYKA 4AT3A 5GHVA 3D7TA 2XNEA 1J5YA 3CTJA 1H1PA 3OXZA 5F1RA 5FGMA 4MCVA 4R8HA 3VO3A 4CT2A 2R7DA 1ZOHA 2GQGA 3BX5A 1OL2A 4UZHA 4B8LA 2J0MB 2EV6A 3BGZA 2VE9A 4N0BA 1XH9A 4HW7A 3NUSA 4TKSA 5FGKA 1B9NA 2A2AA 3D9VA 2DQLA 3W33A 4FX4A 3C4EA 4XG3A 4YIFA 3ZO1A 5C8KA 3SLSA 3QQLA 4QPMA 4ZOGA 4YMJA 1S7AA 2W0JA 1SYKA 4F9YA 2QR8A 4YPDA 3F2AA 4PMTA 2PULA 2DPDA 4UMTA 2YIYA 3L8PA 3DU8A 2ONLA 5FTOA 2VBWA 2YM3A 3I71A 4EJTA 1ERKA 5D4RA 5LHGA 5LGTA 3HP5A 4CCBA 4DE4A 1H08A 4PL4A 4XNEA 5EQPA 4I6QA 3QYWA 5BNJA 4LFUA 3IGOA 5JT2A 4EMSA 3H9RA 4QYYA 2VTLA 3EYHA 3DT1A 4KIKA 4FG8A 4F1TA 3C1XA 5H2UA 2R9SA 4XLNF 3EMGA 3VUKA 4IVDA 4I5MA 1YI3A 2C5NA 4C35A 3LA2A 2WTEA 1Q41A 4MQ1A 2XRUA 5C8MA 1S3JA 3BOQA 3E8NA 2WMVA 3VQHA 2QOOA 2W9ZB 5LXMA 3QUPA 4X2JA 3MIYA 3F7WA 3AC8A 3MJ2A 3RHXA 3AQVA 3F22A 2ITWA 4RT7A 3BJAA 3IS5A 2XJ2A 4TWNA 3K5VA 3QRKA 4P5ZA 2ZVAA 3FMEA 3WILA 1D5VA 2Z9OA 2EWNA 2C68A 1F9NA 3TWJA 3HV6A 3HVCA 4O7VA 4RLLA 3EQGA 2A5YB 2WTKC 1Z6RA 3H3UA 4EH7A 4HV6A 5E8IA 4TYHB 4ZZOA 2YDKA 1G3YA 3F8CA 2QNJA 5DEQA 4FIFA 5I9ZA 4L9TA 3CGOA 5H20A 2J5PA 1JSUA 3Q6UA 5LEJA 4BYYA 2V9VA 4CHUA 2R3MA 4H0EA 4FNZA 2PSQA 4YGAA 4CNHA 2ITVA 1NVRA 4WIHA 3R9OA 1K9AA 3BLHA 5IT9K 1T39A 4RBLA 3GU8A 4X3FC 2VWWA 4ZY6A 4BH9A 1OVEA 4GT5A 1T45A 5ICPA 4EOOA 1E1XA 1KA8A 2GZWA 4XG7A 2XS0A 3GUBA 3HHGA 4F7NA 2C0OA 2R3RA 2WTCA 1SNUA 3KFWX 3CY2A 4E6DA 4BF2A 1JSVA 3DK7A 3NYXA 3QA0A 1J2XA 5IMEA 3E93A 1FNNA 2ZFWA 5JK3A 3ZDIA 4RVKA 1LB2A 3U8WA 3I79A 3FY2A 3P9JA 3JY9A 3I81A 4O7LA 4Y5QA 1TQIA 3HMIA 2UZVA 4IQ6A 4C4FA 3M1EA 5AR5A 2QOFA 3OY3A 4U6RA 3WYYA 4IRIA 3O0GA 4YSJA 5HIEA 3KE2A 1D8KA 5HLPA 3ZUVA 4AACA 3MPAA 1S6LA 3LXLA 2ZV8A 2JC6A 4FGBA 2XZSA 2FXAA 4K33A 3MFUA 5IG1A 4B8XA 5CEIA 5FXSA 3C0GA 2JKKA 3GBZA 5D6FA 2PE2A 3PLSA 1SD5A 4A0YA 3L00A 3NUPA 3I5NA 3W10A 4QNYA 1M2PA 3PXQA 5FD6A 3OWKA 2C69A 5HDGA 4G94A 3VS3A 4FEQA 2QCSA 3QUDA 4II5A 4NFMA 1Z05A 4CQEA 3OUNB 5CU2A 4DLIA 4W4YA 4QMLA 1JKLA 4JG7A 3DZOA 5HG7A 3KCFA 3DB6A 4OTFA 2H8HA 4C02A 2ITQA 4AP7A 3LMGA 3EIDA 2HIWA 2Y4PA 3LW0A 4JDHA 4I3ZA 4L52A 4BDAA 5BVOA 3K1NA 3PFIA 3ZFMA 4DH7A 3MZHA 3FYKX 4FOBA 4EK5A 4EZ7A 3E5QA 4BVUA 3P78A 2HXQA 3KP3A 2O3PA 2I0HA 4I24A 3IW8A 4TRLA 1GZNA 5DR6A 3PXRA 5L2QA 2PQ8A 2BALA 3ZXTA 3N51A 2R3FA 3R1NA 3V7CA 1XH4A 2PUNA 4L01A 4R5YA 3UNJA 1RE8A 3I6UA 4S2ZA 3BU6A 3CPBA 4FKOA 4C2WA 3KEXA 1LP4A 5M55A 3QOPA 2XNPA 3T3UA 5CLSA 1R36A 3GI3A 3KFAA 2BYVE 4FVPA 4CFXA 2QD9A 4RJ6A 2X1NA 4DGNA 4GO1A 4P5QA 4IJAA 3PJ1A 5FEQA 3FSFA 3LJ2A 1ZXEA 4FTOA 4A2UA 2CKPA 1RDQE 4OMYA 2IVTA 2B54A 1DPUA 2EA4A 3QU3A 4PP9A 1PJKA 2PTKA 3QTQA 3KRJA 2CLXA 4DGMA 2CGUA 4DGOA 3F3VA 3V51A 2X8IA 4I0SA 2YWPA 2WC2A 2UXNA 3VW6A 3Q96A 2JSCA 1CMKE 4UEUA 2WMXA 4CEGA 3G6HA 1ZHFA 5HESA 4JQ7A 3B2WA 2WEIA 3ZTXA 2IVSA 2IVUA 2XNNA 4DT8A 4IB0A 1J3HA 4XMOA 5ETAA 2FYSA 2IPXA 2VWBA 1MJBA 2VD5A 3UO6A 2M30A 3E7VA 3ORXA 1O3TA 5AUVA 3FE3A 1WQ2A 3BHYA 2GU8A 3NR9A 3IRQA 1ZMWA 4JXFA 4FOCA 5E8GA 1IAWA 2JITA 4UB7A 5KBRA 3JPVA 3T9TA 1ZGAA 2QWWA 3N97A 3OHTA 2A19B 5I3RA 4BBFA 3HP2A 5KMIA 3QD3A 4EH9A 3QZGA 1Q8TA 5TKDA 3FZ1A 2ZO4A 4HF1A 3NRMA 3Q9ZA 2R3QA 3ITZA 4KRDA 1WBOA 2M45A 2YA9A 1EH6A 2FUMA 4CFUA 2CWEA 1A04A 2FBIA 4ACHA 1DI8A 3WZEA 2E9UA 4BDDA 5LWNA 3PIZA 5DN3A 4WG5A 4HVGA 4MF1A 4IC7A 2CCIA 3T9IA 2W85A 3W55A 1R23A 4F70A 4RZWA 4E7WA 4CRLA 1KQ8A 5JH6A 4A9SA 1MRVA 2BAQA 2ACXA 3QHRA 4U7ZA 2UV2A 4AX8A 4HZSA 5CSVA 3ZOSA 4DFZE 4XV1A 2A3SA 5ACKA 3MEXA 4FL1A 2VWZA 5HBJA 4ANLA 1RJBA 5DCMB 3MY5A 3ZSIA 3BYSA 3KN6A 3ZN1A 5I9WA 2NNYA 2C6LA 3C50A 3TZ8A 2PZRA 3NAXA 1WRJA 2RL5A 3WIKA 1KE7A 2F5DA 5EDPA 4FV3A 3HAVA 5L3GA 1FZPB 4ANOA 2FNAA 3C1DA 4FC0A 3ZEPA 3G3ZA 1BBYA 1U6GA 2I6LA 1YXTA 1LUFA 4L45A 4OAVB 4LFIA 1KE6A 4YLKA 2HAKA 4G2FA 4IM2A 4R8QA 1XBCA 3HOTA 2O0UA 2ZB1A 4AUAA 1U5RA 3OTUA 4Y85A 3MCZA 4O82A 2E2BA 2R3OA 4BICA 4CT1A 1HOWA 3R1SA 1DI9A 5IPJA 3MB7A 5DUIA 3PXZA 3TNWA 4EK6A 4DEBA 1H0WA 3REPA 3ZMVA 3E92A 1GZKA 4R1VA 5FDPA 2LKPA 3HX4A 3QBNA 2QU5A 5EOBA 4AW0A 3MSSA 5K9IA 3RPSA 4YO4A 4M12A 4CO8A 3BYUA 3ZZEA 3GNIB 4S04A 3H0YA 1OYIA 3RNYA 1ZY5A 3KMMA 2VGPA 4AA0A 2OBJA 4CKRA 3RPUA 1SVHA 1GZOA 5EDRA 2CSNA 4EH3A 3S1HA 3TDVA 4O6EA 3A7GA 1UU9A 5IQAA 2B7AA 3QP5A 2CW0F 4DA5A 2EFWA 3UODA 3KN5A 2CMWA 2KIMA 2W1ZA 2HELA 2XV4S 3LFSA 2XAGA 4FK3A 3PXFA 5FD2A 5HBHA 4DCAA 2XIRA 3A2CA 3CY3A 5AV2A 3HMNA 5HLNA 2BIYA 4RIYA 2ZM4A 1KQ9A 4XRLA 4Y5HA 3MH0A 3D5WA 4MAOA 3SOAA 4ERKA 3LM5A 2ITZA 1H4LA 2PVKA 2IVVA 1IRKA 2ZXJA 3MA3A 3RCDA 4UYNA 5A4CA 5DDGA 1KU7A 3G9LX 4JVGA 5HICA 3VUMA 4JIAA 3GZ6A 3TGNA 2XKFA 3ML6A 4APPA 3ODYX 5D7AA 4UUVA 4RVLA 2RC4A 3DDQA 2HGCA 2V55A 4FICA 2IZRA 3RHKA 3I7CA 4O0VA 4TY1A 4UV9A 2JIUA 4G6LA 3AOXA 3MY1A 1LVAA 2P5KA 5HQ0A 3QTRA 3GYHX 4OIOF 3Q5FA 4PTEA 3SGCA 2GPHA 2PVHA 3I4PA 3IG7A 4KA3A 4NHJA 3ZFXA 5C01A 4O2ZA 2LGCA 3R04A 3PVWA 4WXDA 1IXSB 3E6MA 2OJJA 3EQPA 2FSOX 4FKGA 4ZAUA 2W5HA 1NT2A 2ZMDA 1ZYCA 3E6DA 3M1SA 3A62A 3I0TA 2DWBA 1ZYRF 3D2IA 4FEXA 1AQ1A 2XP2A 5M07A 3P4KA 3OUKA 1YWRA 4W4VA 1PW2A 2BTRA 4CMUA 2AYPA 4ASNA 2JAVA 5J7HA 5H8EA 1TQPA 3A8WA 3CQUA 4LGWA 2I0EA 1P5EA 3D7ZA 2XNOA 4WNPA 2DW4A 2W4JA 2V1DA 5CAOA 3FLNC 4JG6A 3NEWA 2ITOA 1Z7UA 2J5FA 4LGGA 3CCNA 2VBZA 1R39A 4RA5A 3MV5A 4EKKA 1IXCA 4IHTA 1Q3WA 3V8WA 4UVCA 3DKFA 5HE1A 4E26A 2BBYA 5TJJA 3H9OA 4CQGA 3LFBA 3BY6A 4NW5A 4PZJA 4MD9E 3C4FA 2VGOA 5FUTA 2YM5A 2WO6A 2QKWB 4ZSAA 5AV4A 4JS8A 2ITPA 3KMUA 3LXKA 3DXNA 4RAYA 2WD1A 3IDBA 5FFZA 1M17A 5HTBA 4EOPA 5F64A 3TO6A 2XRNA 2HQNA 3FMLA 3RDIA 3KK9A 4JX3A 3L9PA 2CGWA 3GCVA 4M8TA 5DLSA 3KK8A 3OOGA 3PJ2A 4IIRA 3GFMA 1U3EM 4R3RA 4KUJA 1DDNA 3HV3A 3U54A 4LRJA 4BHZA 4LJZF 3PQJA 3VS4A 3AMAA 2VTAA 3PUPA 2M87A 2AC5A 4I92A 1YXUA 4AU8A 3DPLC 4C62A 4D5KA 2IWIA 2LF7A 3R02A 4BZDA 3LQRA 4RS8A 4BGHA 3W2RA 2WB8A 3ZLYA 1H26A 1WVWA 1W5TA 5IUIA 4DINA 4N57A 2Q0OA 3H10A 3BZ6A 3PA4A 3Q53A 3QQUA 4Y73A 1EH7A 5EW9A 4WWCA 3MH3A 3FSKA 3PE1A 2OF4A 3FMMA 1IR3A 1CKIA 4K0YA 4BIEA 1FSEA 3GF2A 1O7FA 4FV4A 3VW8A 4OW8A 1G4DA 4DEIA 3KEOA 1LJ9A 2YU3A 3UQGA 2J9MA 4WHZA 3UOLA 4M7IA 5AIRA 3T8RA 3KULA 4L44A 2OH0E 4D0XA 4GV1A 4CFNA 4YZBA 3FZOA 4S33A 4D4VA 1XGMA 2HXLA 3R0JA 4AZWA 2O64A 1ZOEA 4I20A 2GNJA 4YZNA 3C9WA 3QXPA 3OG7A 3ATSA 5FLXK 1B4AA 1BL6A 4RGSA 3WGIA 2QO7A 3BE9A 4FSYA 4QYEA 4FTRA 4U5JA 3UIBA 2K4BA 4ZS0A 2OQRA 3RKWA 4BDHA 2OQGA 4EQCA 2W4OA 3J81K 3ZMDA 5DV5A 3KZZA 2QQ9A 2E9PA 3DPTA 3PPZA 1BI0A 3F5PA 4CMTA 1WBPA 1BJAA 4F65A 3TIYA 2YERA 1HKQA 4A12A 5M44A 2VO7A 2STTA 3FZRA 4XOZA 2VO6A 2RG6A 1HCKA 3I58A 3DKGA 4TWCA 2P4IA 2BHHA 4EQMA 4MHGA 1Z5MA 4QP4A 4KIBA 2XRWA 4LMUA 4KBCA 3KP7A 5CSHA 5GIOE 4BCIA 4G7HF 4RGJA 1SZMA 2ZYBA 4ZJVA 4IW0A 3TO9A 4C36A 3R9NA 4GK4A 4O81A 1M52A 3R83A 3WTUC 4IF4A 5M56A 5K0XA 4AWIA 2OFVA 1QNTA 5J5SA 5AP6A 1FMKA 4ENMA 3BKBA 1W7PD 5IH6A 5DFPA 5D9HA 1GNGA 3CTHA 3TACA 2W57A 4HGTA 3DKOA 3A7HA 5LRSA 3IKTA 4EHEA 3RAWA 1QPCA 3NPCA 2O6GE 5DPVA 3WF9A 4D2RA 4O84A 3EUHA 5KMOA 5L2IA 4UY9A 3DP7A 3FI8A 5I9UA 2NO3A 3M9AA 4WUAA 5E91A 2PVMA 1XQZA 2FSLX 3FM5A 5AX9A 2Z60A 1RW8A 4TYHA 5CYVA 5J6XA 3AC2A 4B8MA 3HAMA 2WTJA 2ZBKA 3F3UA 4WXCA 3E87A 3QRTA 3K3JA 4GGGA 2VTTA 5HDNA 5EHYA 5J9YA 4XG6A 5E8YA 4YNOA 4QPSA 5CVHA 4RIXA 2ITXA 3JAMK 4M74A 5DYJA 2JDSA 1URCA 2OXYA 4IB1A 3AC3A 4IVNA 4RB3C 4LYNA 4RX7A 1K3AA 4IH8A 4CYJA 2R7FA 4EVIA 3S95A 4P55A 2FQ3A 2IT0A 4I22A 4O22A 3BEGA 3G6GA 4BHCA 1R7JA 2CGVA 4D2WA 3BGQA 1YW2A 2ZV9A 4EK4A 3IL2A 3DQVC 3UE4A 3BQRA 3CE3A 4U0WA 4JDIA 4MNEB 4GT3A 3BIZA 1CKPA 2J50A 2PMOX 3QA8A 4GSBA 1B6CB 3KXZA 2MBFA 3MBLA 3HMPA 2JDRA 2RFDA 1R58A 3F61A 3DQWA 3NVMB 4Z3VA 2ZB0A 5HO6A 4D2SA 4LMYA 2VWYA 4M71A 2W1DA 3DFAA 3GCQA 2BZHB 4F6SA 2QONA 2OXDA 1KU9A 3GWZA 4RB0A 1VJYA 3PXKA 2GCDA 4YTCA 3ZQ7A 4XG4A 3VS7A 1YXXA 3ABUA 3LFKA 3ZRKA 2TDXA 3F6XA 2YM6A 4HYEA 3BHTA 5FBNC 4AWXB 3O8PA 2OU2A 3U87A 1OGUA 2WMQA 4XG9A 2R0IA 3EQRA 2HR3A 3P1AA 4U43A 5JN2A 4RQKA 2XJ1A 3KRWA 5DBXA 1JNKA 2FSMX 3IPHA 4BDGA 4M84A 3RGFA 2B9JA 1GIJA 2GHLA 2IA2A 5HE3A 5LMKC 1J7UA 4R7HA 3BI6A 4NH1A 4BYIA 1V1KA 2VRXA 3R60A 5FM3A 4EQUA 4CZUA 4LUDA 3BLRA 2UVXA 3KP2A 2VV9A 5HI2A 2J51A 4IAFA 2AXLA 4PCQA 3DJ6A 1YQAA 3OROA 4H36A 2Y9QA 2LAVA 4QP7A 1G3SA 1FQ1B 3LCKA 1W7PB 4XP0A 4F6UA 2XAHA 3RPYA 5M53A 5JGDA 5CS6A 4QMUA 1S9IA 2QG5A 4BTKA 5M09A 3RPQA 5AWMA 1OM1A 1Q62A 5HS8A 4PY1A 1P2FA 3L9LA 5CI7A 3DJ7A 3VVHA 3OC1A 4IX5A 2GFSA 2XK8A 4KUMA 4HQEA 2Z7LA 4CKJA 3C4WA 3GENA 1TTYA 2OJGA 5C8NA 2GAUA 3GC0A 1EH8A 1I1SA 3JSOA 3WTSC 4QRCA 4PMSA 4KA4A 4PMPA 4BIBA 3FMJA 4F9BA 3IQ7A 5ANIA 5K4JA 2BVAA 2VZ6A 4F4PA 4IHSA 1WCCA 4ENKA 4KYWA 2JIIA 4RB1A 5TF9A 2OD5A 4EOMA 3VB2A 3F8NA 4FTAA 4JBVA 3SXFA 2XMYA 5EKNA 1XCVA 3UZTA 2MLKA 4O7RA 4FKQA 2OG8A 5LHHA 3V5PA 2ZV7A 2B9HA 5BQ0A 3ZUTA 3RKXA 3BWGA 3TNHA 2CGXA 3QQJA 2IA0A 2GNHA 5T6KA 2QOCA 3R6XA 1OL1A 2HENA 5HCYA 4UYAA 5H6QA 2YM4A 1KOAA 3HDMA 3TTIA 5IZFA 3F7ZA 3D5XA 3DGKA 4IAYA 2CGPA 2EFPA 3PZHA 5DR9A 5IA2A 2DAOA 5AIPA 1OB3A 1BC7C 3ZFYA 5FBOA 3BCEA 4HF2A 4MWIA 3OWPA 4U0IA 4J8NA 3KXXA 4IRHA 3AC1A 4D2PA 1ZG5A 4I0RA 1O57A 1PXPA 1UHMA 3WI6A 3VBVA 4U40A 4YJSA 3QGYA 2C0TA 3QCSA 3JYAA 1QQIA 3TDUC 3QD4A 5LJJA 3RYRA 2OW3A 3WGGA 3PPJA 4KICA 3FQSA 2VOPA 4RFZA 2OJ9A 2YCFA 5ANOA 2DK8A 3IONA 3F6VA 4G9CA 4KIQA 4DTBA 5D6EA 4BI1A 3H3ZA 4DC2A 3CGFA 3LQ5A 5JFSA 4MTDA 3GU5A 3LE6A 3P7AA 4M13A 3V7SA 3GP0A 4IZ7A 4ONAA 4O0WA 4GYIA 4MXYA 2ETKA 4FV7A 3D83A 1PXMA 2JEDA 3NUNA 4UMPA 3P7CA 4PPAA 1MGTA 3ACKA 3A61A 2Z33A 3RAIA 3KLNA 3C4CA 5DD8A 5DRBA 5H3QA 5DH3A 2EK5A 2FA5A 3WZUA 1Q8UA 4J99A 4H05A 5A6OA 1JE8A 4QOXA 5CQUA 3T8TA 3KRRA 4EL9A 3REOA 5E4HA 3ZMTA 4BFMA 4AGUA 2GSFA 2WQNA 1KWPA 5DT3A 5CNOA 1XDSA 4M9ZA 4MK0A 2JLDA 3HSEA 4YBKA 4MF0A 2IJMA 4HZFA 4XV2A 3O7LB 2UW8A 3U4UA 4XUFA 2X8DA 3TOBA 4PP7A 3RYPA 4GUBA 2PI0A 3OBJA 1G5SA 3V8TA 2IP2A 5L4QA 4NTTA 2BAJA 1U5TB 2PE1A 2OIBA 5B0XA 2ERZE 1W82A 4G9RA 1OKRA 2QBYB 3Q9SA 2BDJA 5ANGA 1I44A 3R61A 3RTPA 3K1MA 3FHRA 3E88A 2HTJA 1Y57A 2B4SB 3LFQA 5L2WA 3PIXA 3D15A 3EETA 4XLVA 4WRSA 4YJPA 2W06A 5IQCA 5HVQC 1G3WA 3E3PA 4A0ZA 3UIXA 2PK9A 4EZ3A 2JAMA 2DQ7X 1J7LA 4BTMA 2Y48A 4IVAA 3DPKA 4IWPA 3QPTA 4ZTSA 5E7RA 3ZBXA 4I5PA 4O21A 2YEXA 1YXSA 4AN2A 4BC6A 4K18A 5IA1A 1FWZA 4DTKA 3U9GA 4D1SA 5M4UA 4JG8A 4AW2A 2A6HF 3S3IA 1F1ZA 1NVQA 1VTNC 4Q9ZA 2UZWE 1ZMVA 1R3CA 1M14A 5HLWA 5A2QK 3L09A 4O7SA 1YS7A 5IEXA 3FMRA 3FLWA 1T98A 4LOOA 3OP5A 3R7VA 3PSDA 4L9NA 4HCVA 2GS7A 4GIIA 3TJDA 5A4QA 2VU3A 2VTSA 3NCZA 5L3CA 3QPHA 3EKNA 4HA8A 2CDZA 4BDEA 4JBQA 4R3CA 3BBWA 3BPVA 4GFMA 5CSPA 3VS6A 4J52A 4ZZMA 1DAYA 4EUUA 3NUUA 4MH7A 1SM2A 3GZ5A 3R7OA 1ZRZA 5E8XA 2WQMA 3MWUA 1BI3A 3GFJA 4R7BA 4PTGA 2B53A 3LCTA 3UP2A 3P7NA 2P6TA 2BROA 2BRMA 4X2KA 4U8ZA 2A4LA 2OJIA 3DK6A 2O61A 4FL3A 4MVFA 4AFEA 3ZSHA 3WTTC 2FU4A 4EZ5A 5TE0A 4G6OA 4ZJIA 2R3HA 5HLIA 3SQQA 4NIFA 1WBTA 3ORKA 5BMZA 3BEAA 3G2FA 3RPRA 4LI5A 5FDXA 4DNCA 3E8CA 2LF8A 2M8EA 4M69A 3NYNA 4RSSA 4KIKB 4ITIA 3KVXA 3NMUF 1OMWA 3ALNA 4HJOA 1F4KA 1L8TA 4U42A 5IQGA 2J5OA 3PXYA 4NCTA 4NSTA 2C6OA 3UPZA 4E93A 4RLKA 4IBMA 4OTWA 4FKTA 4RAZA 5EK7A 1IN7A 5DNRA 5KMJA 4EH6A 4DG2E 1JAMA 1TBXA 2XM9A 1MUOA 4ID7A 4EHGA 3D2KA 2RFEA 2ZKZA 3OCTA 3KB7A 1J9IA 3Q2JA 3AMBA 1O3RA 4ESBA 5FTGA 1OIUA 2HWPA 5CU4A 1BKXA 1CKJA 3ZMMA 3GFEA 5L8KA 4M6YA 4FBXA 4N70A 4FTUA 1KUTA 3O23A 3LPBA 5D8KB 4OIPF 4N0SA 2O5KA 3U55A 4P5OA 3W6KB 4Q2AA 2DUVA 4ANSA 4U80A 4IADA 3ZBFA 1B39A 2MH2A 4I0TA 4K9YA 3RI1A 3MVLA 1ZYLA 5T68A 2O8XA 2WGJA 3AAFA 5HKMA 1B9MA 3VF8A 5CAVA 4HZRA 5CVFA 4D2TA 4AQCA 5IH4A 1IA8A 4DCEA 5A54A 5CVIA 2R4BA 1K78B 4A06A 4O7ZA 3SRVA 1BN5A 4DFUA 1XH6A 4R1YA 2WQBA 4W9WA 5JRSA 2J2IB 4EH4A 5BYLA 1W4MA 5D4SA 1JWHA 4RGXA 4FHTA 4FTJA 4AFJA 2XVCA 2HZTA 1O3SA 3KF4A 4GRBA 5GJDA 3WOWA 4EH5A 4BQAA 3EFWA 1XBBA 3J80Z 2EB7A 5LOHA 1D3YA 1IZ1A 4EGYA 5CU3A 2HTSA 3LM0A 3L8XA 3ET7A 3QYZA 4QQJA 5IQHA 5HDKA 4BDFA 3CXWA 3K3IA 1KOBA 3RK7A 4RGRA 1ZYSA 3DXQA 4L18B 1ZLJA 1IAJA 5JSMA 3ABTA 5JGBA 5HVJA 4RC3A 2UVZA 4FL2A 3VUHA 4KDPA 4BHPA 1B1BA 5DCMA 2W1EA 4AZEA 3VUGA 1HCLA 2IA1A 3UIUA 4BZNA 5FD5A 2ADUA 4ACMA 3UYTA 2VC1A 1WFCA 3SZPA 4LM5A 5AM7A 1W7PA 3ETAA 5ICCA 5F4NA 2YISA 5CALA 3W2PA 2ESNA 3WYXA 4Z2YA 4KKEA 5L6OA 4ORKA 2HK5A 4OIRF 1FGKA 1YXVA 2J6MA 3BJ6A 3SFZA 5A14A 1JGSA 3QWJA 3TL8A 3VC4A 1YI4A 2B9IA 4M3QA 3V6SA 4O3MA 2KIFA 4JQ8A 3WE2A 3MVJA 5KMKA 3RAKA 2O63A 3DJ5A 3FKLA 1V3FA 5IEYA 4IAAA 4CTCA 3V7RA 2E9NA 2QQBA 3GC8A 5C4LA 2G7HA 3B8QA 3ZPLA 5BYZA 2OZUA 4HOBA 5I3OA 4EC9A 1FY7A 1E2XA 4QLCU 2UZTA 3LXPA 5J9ZA 1IAHA 4BAYA 4EK3A 2YAKA 4LV8A 1SD4A 1P4OA 3Q2MA 4EJWA 3ORZA 1KE5A 3QUEA 2XKEA 2NYXA 2I1MA 5J9LA 4WRGA 4DYMA 2IPQX 4LOQA 4CVAA 3FV8A 5FRIA 3S2WA 4BCKA 4J96A 2JDTA 3UPXA 3FHIA 3WF8A 3V04A 4G9YA 2X7OA 3ULQB 3K5UA 4YHJA 2F7ZE 5AV3A 5D5UB 3S2PA 2I7QA 3KETA 1W7HA 4YSMA 3FUPA 4EYMA 3GVUA 4FV5A 1WAKA 2XEZA 4EHZA 4O0RA 4D55A 4WBBB 3EFJA 4S05A 4I93A 4GT4A 4K11A 4FT3A 1CSNA 1J0RA 5IT3A 2WIHA 5ICEA 2UZLA 5A4LA 5AAEA 1FP2A 4UHTA 5D1JA 3I4BA 4DT9A 4G6NA 1VEBA 3H3CA 3T5XA 3ZO4A 4YURA 2C1BA 3ZYAA 4TWOA 4TYJA 4OTGA 3TEIA 2UXXA 3GFLA 4ON0A 1FVVA 4NWMA 5AUYA 2WQOA 4F0FA 1OPJA 4I6BA 5CEKA 1WBNA 2CN8A 2H6CA 4CCUA 4RIXB 4RB2C 4QP3A 4FZAB 4BDIA 3EHAA 4YFXF 4QD6A 2YZAA 4D1XA 1YO5C 1BI7A 3LCSA 1Y0UA 3L8VA 1BC8C 4UALA 1R1TA 4TXCA 2UW5A 1YQJA 4HGSA 3R0TA 4ZZNA 3VBYA 5CVRA 3QTIA 4XBRA 4ETSA 2QM3A 2YZLA 4Y8DA 1PDNC 4B4LA 2NRYA 5KBQA 4GVAA 4U44A 3DNEA 3QGWA 3DB8A 2EVAA 2HKOA 2XB7A 3V5WA 4YPSA 3BZ3A 4KAOA 5IU2A 2REIA 4NEUA 3R8ZA 4V05A 3F3ZA 2P3GX 4KMFA 1P4WA 4JT3A 3NS9A 4LUEA 3TI1A 3CUQC 2ITYA 2OFUA 4FTCA 2WNTA 2DFIA 1VYWA 1JXSA 5IQIA 3F8MA 4H58A 3I0QA 4C4JA 3JVSA 3CPCA 3ALOA 4CXAA 3P7BA 5LCKA 2DS1A 3CC6A 4YUQA 4U97A 3W2QA 5AUZA 2BDFA 3OEFX 3K0LA 3V4GA 2O65A 4BB4A 4F9AA 3ZMSA 2I0YA 1PF8A 3KXNA 2GXGA 3PVUA 5JFRA 4WSQA 1ZYDA 3FXZA 4G6DA 4KKHA 2YFXA 3KF7A 3Q4ZA 1OUYA 3GFWA 1J59A 3VS5A 4PDPA 5F94A 5HIDA 4G7OF 4PRJA 4L3PA 3QFVA 1OBDA 4G1WA 4J7BA 2VWIA 2ZAZA 4FEVA 3VBTA 4RJ4A 4B9DA 2YCSA 3RNIA 3QD0A 1UU3A 4K2EA 3CLYA 3GEZA 3T8OA 4TWPA 2XIKA 5CWZA 3TZ7A 2F5FA 4FE2A 4IRGA 1OIYA 3VBWA 4UMRA 4F99A 4XLIA 2I40A 4MQVA 3MH2A 4L6QA 5BPYA 3H4JA 2BIKB 1LEZA 2EXCX 3RJCA 5HU9A 1FYLA 2C5YA 1LDKB 5AAFA 4AZTA 2J0IA 3E7OA 3FDNA 2WTIA 2XIYA 4BRXA 3D14A 3HYIA 2QG7A 3AT4A 3TUCA 1Y6BA 2EXEA 5IA4A 4PV0A 2UUEA 4YFNF 1OYYA 3KY2A 2OLCA 4EOIA 3A7FA 5AFVA 2IG7A 1H0MA 5BYYA 2GQRA 4ZIMA 4Y95A 2DPUA 2FNPA 4M9XA 3ROYA 4HDVA 3GFIA 4X2GA 4IJPA 3LFNA 5JFVA 2C5VA 3UG2A 1XBAA 4NM7A 4O6JA 2E7WA 4G3EA 3EN9A 4MEYF 3NNXA 4MQ9F 3BQCA 3IECA 2C0IA 3CEKA 4FIGA 4LL5A 5HS9A 4WO5A 2YHVA 3FZSA 3FWEA 1NXKA 2PZ5A 3OCBA 5CTPA 5E20A 4YLLA 4F0IA 2ZV2A 3IO7A 2RG5A 4W8EA 4DFYA 5FO5A 2NPQA 3F66A 3HECA 2BV6A 3U9CA 3Q4UA 1PXKA 4F1MA 5I9VA 2QUFA 3HRTA 1JSTA 2BAKA 5CASA 3FXWA 3LVPA 4DH8A 4QO9A 3SQNA 4FKRA 5M08A 3WGHA 5FQDC 1CF7B 1JKKA 2RGVA 4KWPA 4W4XA 1XSVA 1PXLA 3F3XA 2DBBA 3MESA 4UWCA 3LJ0A 2IW9A 1I6XA 3QWKA 5DT4A 3I0OA 4QQCA 3IKVA 4S32A 1UKHA 3GCUA 4IDTA 1ZMUA 2X39A 3FLZA 2WFYA 4ASXA 3PVBA 3CBLA 3QU0A 5EEHA 2R5TA 2PLYA 1SD7A 4RFMA 4DG0E 2UZDA 3B2TA 1LNWA 1XSXA 4KNBA 3LAUA 5DWRA 3SZTA 4HPTE 2VN9A 4YR8A 2X4ZA 1HKTA 1XH7A 2GIVA 3SKCA 4LB5A 4PGGA 3KRXA 4KN4X 3NW5A 2DO7A 5CF5A 2GA2A 4BWPA 1TW2A 1TQMA 2PUPA 3DY7A 3HRCA 3MVMA 4WK8F 3F2NA 1SMHA 4PDKA 1FGIA 1USSA 4YP8A 2EFNA 2Y4IB 5ILSA 1M7QA 3UMWA 1HKSA 3Q9VA 4XH6A 1UNGA 1GXQA 4IMYA 4MWHA 4GYGA 4IZAA 1YI6A 3TJCA 5HG5A 5ANKA 3G51A 4E73A 4DBXA 3HV7A 1B59A 3EL8A 4GU9A 4JDKA 5LVNA 2QYOA 4GUEA 3WTZA 3PYYA 4FT5A 3DBEA 2UW3A 3QKLA 4KKGA 5ANJA 4AIJA 3R9HA 5HD7A 2GS6A 3AD4A 5CZHA 1B38A 2V62A 4FF8A 2P6SA 1QZZA 4YTIA 4F09A 2Q2EA 5J79A 3PG3A 4WXHA 3ULZA 2QOLA 4C34A 5DRDA 4EJ7A 4YJOA 4O0UA 2WMAA 3KXMA 2XYNA 3VF9A 1IF1A 5BQTA 4QT1A 2W24A 4E4MA 5K5RA 4MXZA 4AG8A 5CEOA 4ZYGA 2C4GA 1NVSA 4S34A 4LLLA 4BNCA 2EV0A 3LMHA 3DAEA 1UCRA 4LV5A 5EI6A 4WX9A 3RP9A 3R7YA 2D2WA 2HKXA 2MC3A 1LDJA 1H8FA 3NEUA 3ZM9A 4FZFB 3IOPA 2RN7A 5HTCA 4KS7A 4Y15A 1PXIA 1HBXG 3SX9A 1U5TA 1UWJA 3VS2A 3BYOA 3F5XA 2J0LA 4RJ7A 1PXNA 5J87A 5JQ8A 1VYZA 2GTMA 5J1WA 1T46A 1QPJA 4X3JA 3TN8A 3OWLA 3O2MA 3OBGA 2H6DA 2VOOA 4UV0A 3P79A 2EWAA 5L3BA 3PTGA 1R22A 1Y8YA 3KP6A 3ZLXA 2EU9A 5CX9A 1SNXA 3D7TB 2PWLA 3DTWA 5EI8A 1HSJA 1WBSA 2A27A 2KTYA 3W2SA 1YDRE 4DTAA 2J4ZA 5AR3A 4HGLA 2GFCA 4ASZA 3UVQA 1O6LA 3DV8A 4ALVA 3KQ7A 4A6EA 1QZYA 2WPAA 4F7JA 1Q97A 4WD5A 3IWZA 1R0EA 4B6LA 4XBUA 3HUCA 1Z91A 1FLIA 5I4NA 4AVPA 2V7AA 3I1AA 4M6XA 3PG1A 3FYJX 2RVCA 5HLGA 1J91A 3KP5A 5HLHA 3FI3A 2QC6A 5E8UA 3V8KA 4YZ9A 1TLHB 4P90A 2UW6A 3FMQA 4O0XA 3R8VA 1J1BA 3BRBA 2YR2A 4RWKA 4FODA 4MXCA 2VTMA 4HCTA 5D5VB 3MN3A 5B2KA 3ZLSA 5BPDA 2F5CA 1O6YA 4M68A 1EV7A 1PHKA 5CYIA 4LG4A 3UJGA 5KHXA 4DGLC 4U3YA 3V6RA 3HRUA 4JX7A 1HW1A 2C6EA 3CSVA 3L1SA 3KREA 4BGQA 4LMNA 2NRUA 1GZ8A 4A4OA 3SW7A 2WXVA 4Y46A 4EI4A 2Q0BA 3LSTA 3G5DA 3FY0A 3KP4A 3UNZA 4D0PA 2VTQA 3G0EA 2XGXA 2R3NA 5C4KA 3QQKA 3TV4A 2UZEA 4QTAA 4ZYEA 1FX7A 3M7GA 2XYUA 5CZIA 2ZMEA 3J7AO 3O50A 4CMOA 1ODDA 4I94A 5IA0A 1XGOA 1UA2A 3LIJA 1ON2A 1UU8A 1H1QA 4TPTA 1CTPE 3CP9A 4FUYA 5AUTA 4F63A 1ZLTA 3BWJA 2IW6A 2V79A 1QL6A 2HZNA 3FWQA 2ONLC 4BI2A 1LEBA 5I9YA 5DGZA 2YJSA 5F1ZA 4DEHA 4UZDA 4EH8A 2YX7A 4FG9A 2YLEA 5IDNA 3EZVA 1I09A 1NY3A 1IASA 1STZA 3ZZWA 3THBA 4BKZA 3A4PA 3E6BA 5EM8A 2BPMA 3IW4A 3TM0A 5CY3A 4HVSA 4BDJA 4EBWA 5AP3A 4XOYA 4ZK5A 5E1SA 3ZM4A 4MEXF 1Y91A 5E8ZA 4ZMEA 2C1AA 2P55A 4XEYA 1YOJA 1DP7P 4D5HA 2ITTA 2R3SA 4D28A 5LBQA 5JVTA 3LQQA 3RPOA 2BRHA 4U88A 4ALUA 2WKMA 3GU4A 5A4TA 2CPKE 4DQ2A 1W5SA 2J0JA 3MFTA 3IDPA 3UZRA 4XRFA 2F2UA 1MKMA 2ZMEB 2BRNA 5LRRA 4ESFA 3DBCA 4L67A 4EQQA 3D0SA 3F23A 1IW7F 4U45A 1REPC 2QO2A 3LWFA 5F95A 4FA2A 1XGNA 4FT8A 4YC6A 4XYFA 2WELA 3QTXA 4S31A 2NNNA 3VODA 3RALA 4RIYB 1LEWA 1V0OA 2Z02A 3ZMZA 3GQIA 1Y8GA 5H9BA 1DS5A 3BDDA 4R3PA 3DEUA 3EL7A 3OOPA 3F6OA 1KE8A 3TKUA 4D1ZA 3NWWA 4BCNA 2FEZA 6PAXA 2GNLA 3DNDA 2PFBA 3PY1A 4BYJA 2OA4A 5D12A 3A7JA 4EJVA 4HF0A 4BY9E 4KMUX 3UOJA 3MFRA 3DTCA 5TR6A 5AA9A 4MNEA 2OJFE 4ITHA 3V01A 4KSQA 2PYWA 5JRQA 3VNTA 4IDVA 4BBMA 4HPUE 4IACA 3F3WA 3FL4A 4BN1A 3P9CA 3G90X 3QRUA 4MX9A 2OWBA 4IVCA 4ZZLA 3GU6A 3OY1A 5JEBA 1MDMB 5E8SA 2FMYA 4BCJA 3CQWA 3ORPA 3IW6A 4O38A 4Y17A 3UO5A 4ZS4A 5E8VA 4FIIA 2B0QA 3HL7A 2VO0A 1KE9A 3QZIA 4HVIA 2AS5F 2L54A 1OL5A 2F9GA 4OLIA 3EQLF 5CLPA 4Y83A 1BIBA 4J1RA 5K5XA 2F5EA 4BGGA 2P33A 3PY0A 3EB0A 5FP5A 5EW8A 4P9UA 3DLZA 2X4FA 3BWFA 4IPAA 2ZM3A 2BMCA 2UZUE 4R1HA 1BLXA 3AD6A 3DKCA 1PXOA 3PLAE 4EBVA 5JR3A 2R2PA 1JKSA 1YG2A 2L4AA 4Q47A 1B6AA 1SFEA 4GU6A 5B2MA 4PTCA 4O1PA 3R9DA 1Q1HA 3GXOA 1ULYA 2RKUA 2VAGA 3RTRA 4OU0A 3COKA 5DIAA 4ASDA 4KABA 3O7LD 3HNGA 3UIMA 1XH8A 5E1XA 4CXFA 2HEOA 2WTKB 2C6MA 2P2IA 4EWHA 4PL3A 4M69B 1UHWA 1S9JA 1PUEE 4FSNA 4GG7A 4J95A 1H07A 2J90A 2WWYA 4GG5A 4OUCA 4IHPA 2QENA 3Q32A 3K9TA 4XJ0A 2UW9A 4XCUA 3PJ8A 4C59A 1JQHA 4G3FA 2GWRA 4MEDA 3OF0A 3R7EA 4CSVA 3ZO3A 4XV3A 3DZQA 5BUJA 4C38A 5M4CA 1JLUE 5EYCA 2GTNA 4AGWA 4E20A 3G0FA 4TYIA 2XKDA 1JPAA 3KRLA 2MLGA 3FC1X 5DA3A 3JXWA 3I5ZA 1YW8A 4IAZA 2G2IA 3GO5A 4JQFA 1IN5A 4FTNA 4HGEA 2F7XE 4YJVA 1BUHA 3QXOA 2VTHA 5DMZA 2IN6A 2STWA 1ZY4A 5L8LA 3QHWA 2W4KA 3E97A 3HSFA 5J1VA 3G9NA 4FZDB 4C7TA 5AP4A 4U0VA 2BHEA 2XIXA 5EDQA 2QURA 3TZ9A 4OBQA 4UNOA 2A69F 2VE8A 2PHKA 4W9XA 4F7LA 5KE0A 2X7FA 3AGMA 3L9NA 3R2BA 3MDYA 3TV6A 3OMVA 2F57A 1OKWA 1CF7A 4CGAA 3OT3A 1Q8WA 2UW7A 1KQ0A 3GXLA 4G3CA 3TKHA 1MQBA 1YYVA 3GGFA 4GK3A 5DT0A 1APME 4FKVA 4A07A 4QTEA 2BFXA 3KMWA 3PSBA 4CV9A 2P5LC 4Y13A 1IEPA 2PY3A 3WZKA 2OZAB 4P7EA 4YIIA 3PZEA 3OZ6A 4U7BA 3FMSA 2ZCWA 3MIAA 4R6VA 1XWSA 3JUHA 5BVNA 3UP7A 1FBUA 4U81A 2X2KA 4CKIA 2Z7SA 5IKWA 2CYYA 4OTRA 2UW4A 3RINA 3QAME 3E3BX 3QF9A 2BE5F 1XH5A 2CHLA 5J8IA 4C2VA 2NS0A 3TNIA 3LJ1A 2UWMA 1T0FA 3KU2A 4U9AA 3UVPA 4V04A 1RI7A 3QZFA 4QP8A 3AG9A 4PMMA 3C0HA 4NKSA 3SW4A 2HZIA 3OOMA 5AJQA 3H30A 3ZN0A 1M7NA 5TOZA 1P6RA 4HLYA 4HX8A 3EKKA 5D7VA 4FTMA 1F0QA 4AD9A 2LNBA 4R79A 3ZRMA 5F20A 2CCHA 3LFAA 4FMQA 5LQFA 4G5PA 3E64A 2VN2A 5GJFA 5LWMA 5KO1A 1LDDA 3WF7A 3R7UA 2W1CA 4GFOA 5IH5A 5FWKK 2JKOA 2G2FA 3TCPA 3PA5A 2H6BA 5DI1A 5C1QB 3V8JA 5DD4A 3H0ZA 1UNHA 4MXOA 5M06A 2JKQA 4MNUA 4UX9A 4EONA 4ZLZA 3ZEWA 4QMXA 2XK6A 2JZYA 4CZTA 1MQ4A 1FMOE 4WF2A 3N4MA 4AIKA 4QYHA 5CXZA 3LMIA 2Y8OA 5EW3A 4YZCA 4AA4A 5GIPE 1M2QA 2V0DA 3ELJA 3HHHA 3O6BB 2XBJA 1YW9A 3C3WA 4RJ5A 2JPBA 3VUDA 3RAHA 4EJNA 1WKMA 4FNYA 5IISA 1I27A 2W96B 4FSUA 2JTVA 3BYMA 1DPRA 4J71A 4CLIA 2X6DA 1H1WA 4RPVA 4G8XA 4DFXE 2VODA 4K8AA 3RI4A 1O7LA 2PBIA 4ZTRA 1IN8A 3TIZA 5AR8A 1XR1A 2PUIA 3FPMA 4NFNA 5EI2A 4AW1A 5KX8A 3U6IA 3DXPA 4A5NA 3P9KA 3IW5A 3CS9A 1H1SA 3U6HA 5AR4A 1KU3A 2F7EE 2F49A 3G15A 2R3GA 5F6FA 1FP1D 2XNGA 3MZYA 1OKYA 5KK1A 2OH4A 3EH9A 2CKEA 3FEGA 4LK1F 3BHUA 1DAWA 3K1PA 2FBKA 4EM1A 5E1WA 4QMVA 4FV8A 1LR4A 3OW3A 3ZCLA 4YLJA 4GW8A 3MS9A 2JFMA 2XAQA 2HQRA 4QWQA 2E1CA 3EQBA 2MD5A 4CTBA 2BTSA 3FI4A 2FBHA 4MYGA 3BE2A 3PFQA 1IUYA 3I6WA 3Q4CA 1OKVA 4FVRA 4R7IA 5K5NA 2VXZA 1FPUA 4RWIA 5F9EA 3C18A 4O0SA 2G01A 2A0CX 3R73A 1Z57A 5DVRA 3E8EA 3HUGA 2OKRA 2IRFG 2L01A 1Y6AA 1J75A 2Q0NA 3LXNA 3E8DA 3GCPA 5KMLA 4NU1A 1XO2B 1OPKA 3RZBA 3H92A 4ENNA 3FXQA 4CFMA 1W83A 3M42A 5BPIA 2XIZA 4PF4A 3EQDA 2QVSE 4BWXA 3PSCA 5JFWA 4OTIA 2WIPA 5K0KA 4OAUC 2QR7A 4JDJA 3P23A 5L3EA 4TL0A 5CAPA 3ZRLA 2R3IA 5AM6A 3U9NA 1ZRCA 2YDIA 4O7NA 1HSTA 4D4YA 5L2SA 3DFGA 2PVFA 3HRMA 4XG8A 4I0AA 4L00A 4F9WA 3VWAA 2UZNA 1FSHA 3FZPA 2C47A 2YIXA 3LFEA 5G6VA 4D2VA 3BELA 2C5XA 3VS1A 2ZDUA 5EH0A 4HQMA 1R0PA 4RJ3A 4DFNA 2G2HA 3BJOA 3V5TA 4RX9A 2WMRA 4DHFA 4AAAA 3KLOA 4G6QA 1PKGA 1XKKA 1MJAA 2C3KA 5TT7A 5L3FA 3UOHA 5EM6A 2O2UA 2FSTX 5HG9A 2B52A 4G3GA 4B09A 2H96A 5CENA 4XSXF 4C61A 5JI6A 4PX6A 4C0TA 3QKKA 4ZTLA 4AOTA 3DBDA 3ERKA 4QMSA 4Z16A 3DAJA 3QQFA 4I09A 4JBOA 4XX9A 2I0VA 3E5XA 3ZHPC 1JKTA 5HS7A 4XRJA 2X4HA 2P7CB 2YN8A 4ZTHA 3ZC6A 5FEDA 5GZAA 2P7VB 3MYGA 4AIHA 1FYMA 4YZMA 2W1FA 1ZZLA 2BZJA 2E9OA 2W1IA 5AP0A 3VHKA 1YHSA 4IE9A 4YBJA 5AIQA 5HZNA 4XP2A 1ZG1A 2OZOA 4GJ2A 1NHAA 5JHUA 3QQGA 5HCXA 2XKOA 4W8DA 1OITA 3KC3A 1BMKA 2P2HA 3U6JA 2XKPA 2GDOA 3J81Z 3VHEA 4ESJA 3GLXA 4ENXA 4TTHB 2WMUA 3WE8A 3NNVA 4APCA 2VX1A 3HEGA 3WZJA 5E17F 1YOLA 2Y0MA 1Z1DA 3TUBA 5CI6A 2XH5A 3LAJA 4YJUA 2XAJA 2ZM1A 1AOYA 4RC4A 4I98B 2W05A 4XS2A 4BCHA 3O8TA 4KRCA 1UKIA 2QOKA 5AIKA 1IRGA 2CJMA 4JRVA 4IZ5A 2CN5A 5IEVA 4JI9A 5AR7A 3CD3A 4HVHA 2H09A 1OL7A 1XMKA 3O3KA 4M67A 4O7WA 1FC3A 2C3LA 4H1MA 4JBPA 3F2RA 2EFOA 5EQEA 2WTWA 1OI9A 4IXAA 3F82A 4HX7A 1YS6A 4ZSLA 3PWYA 4RGUA 5EQYA 4FIEA 4KT5C 4E5BA 3PP0A 4NCTC 3UQCA 3QCYA 2RNJA 2EB3A 3TV7A 3FXRA 3IHUA 2IVMA 3EQCA 4FX0A 5CEMA 5HVYA 3JY0A 4IX4A 3EYGA 3OT8A 1BOAA 4HVDA 2YDJA 2A6EF 1DM2A 2OU7A 2M1BA 1LPUA 3BV2A 1Q8YA 2BFYA 3FM3A 1RUNA 2IZTA 1FT9A 3I7BA 1AWCA 3DFCB 3GC9A 4FZ6A 2VNYA 3S0OA 2W1HA 4B99A 4D58A 1W8CA 3DV3A 3QU6A 4D4SA 2IO6A 4O27B 4A7CA 3A7IA 3FZVA 1XGSA 2WMWA 2YACA 5DOSA 1BM9A 2FMLA 2E9VA 2YWVA 4ZLOA 5A46A 2W84A 1ONVA 4OOIA 2RDPA 3W16A 3W32A 4L7FA 5FP6A 5IQBA 2CLQA 1JHHA 4FSQA 1BYGA 2COMA 3ORTA 4PDYA 4M15A 2A61A 3R8MA 1YKRA 3R7GA 4E6QA 2BRGA 1U78A 4KSPA 2PVRA 5E18F 2ITUA 1U59A 2JFLA 4FV1A 2JDVA 3O51A 1CDKA 1OKZA 2ESMA 4ZSEA 3RWQA 4FKSA 5KZ0A 5J8FA 2X0GA 2W17A 4O6LA 3R00A 4A9YA 4I41A 4ZXTA 4FI1A 3Q3BA 1NA7A 4RVMA 1JBPE 1IG1A 4KD1A 4AZVA 4BR3A 5CVJA 5LEKA 3FLSA 3HDNA 1H24A 4IAKA 1KYWA 4Z7GA 2WOUA 2XK7A 3SRVB 5LMBA 3UGCA 4CG9A 3COHA 1S8NA 4FKWA 4IB5A 4AN9A 5GZ9A 5IF1A 4WG3A 3MFKA 4G3DA 1V4RA 5L8JA 4X6RA 2R0UA 3E63A 1F5TA 2VT2A 4C58A 4ZTMA 4OR5A 5EEGA 4HYUA 3ZMUA 4JBAA 3JAMZ 4IJ9A 1W0XC 4ACCA 2A1AB 3ZLWA 3MY0A 3FKNA 1QPMA 3ORIA 4Q5SF 3AC5A 4WBOA 3S00A 4JNWA 4FTLA 4AE9A 4CZYB 2RFNA 3WTYC 1G6NA 3DK3A 3EOCA 5L6WL 2QHMA 4IAIA 4X3FA 4LK0F 5EHLA 3LA3A 3FI2A 4O91A 4QTBA 3TQNA 4YTFA 2C5OA 3OEZA 2B0LA 5AONA 3SA0A 2F4JA 3R0AA 5A2QZ 4OTDA 3C51A 4ZY5A 2PMNX 2QVOA 3VOEA 3NX8A 5HORA 4F7ZA 2YIQA 4FZ7A 2YM8A 2NRAC 4RRVA 5AUUA 2C6YA 4OT6A 4EH2A 2EV5A 4DH3A 3FXXA 4LGDA 2BKZA 3TXOA 3ORLA 2FE3A 3OD6X 2HCKA 3QTUA 3WU1B 4E4LA 5K5OA 2HS5A 2WAJA 3OTVA 2CKQA 3RJPA 3EDPA 1UNLA 2O0YA 4BTFA 5E90A 3O71A 5IUGA 5KHWA 4J8MA 3VN9A 4N4SA 2PVNA 3ANRA 4QPAA 1W98A 4PPBA 5JZJA 4Z9LA 2WMSA 1E17A 2L3DA 2P0CA 3ID6C 2X2MA 3K69A 3TKIA 2C6KA 3WARA 2WMTA 2HYFA 1MDMA 4GL9A 4EWQA 1BL7A 4A9RA 4UBAA 2ACJA 4GJ3A 3AXWA 3CO6C 2Y75A 1PYXA 3R30A 4X3FB 4IFCA 4MKCA 5KCVA 3ISPA 5HG8A 4A6DA 3EN5A 2C6IA 5I0BA 3J80K 2PEXA 5CJ9A 5AP1A 3BHVA 4AA5A 4AZFA 2G9WA 2BGCA 1XD7A 2QOBA 2ISYA 4Q5HA 1U54B 2PE0A 1R1WA 1FPQA 1E1VA 3I54A 3FX3A 5BUIA 5FLXZ 4MHAA 3AGLA 4LLNA 3R1YA 2JIVA 3Q52A 3V5QA 4LB6B 3W6JB 3CKWA 1KYZA 1RZ4A 3MWMA 1BI1A 5HOAA 1R00A 2R3LA 4ASEA 5CSWA 3HLLA 4AT5A 4L53A 1PMUA 4P96A 1Q8ZA 1U2WA 3AT2A 3DLSA 5BVFA 5E8TA 1HW2A 1T38A 1PY5A 3VBXA 5KZIA 5C27A 4U7DA 4I5HA 2ESHA 4QMPA 2Z5UA 3TOAA 3NGAA 5DYMA 4QMZA 4XLPF 4XHKB 1RIOH 3M8EA 4ZEGA 1VR2A 5K5QA 4C4HA 1XJDA 4LRMA 2VTIA 3CLOA 4NQWA 3HYHA 3F8FA 5HIBA 4UV8A 1M2RA 4LRKA 4J53A 4YTHA 2J0KA 1LEAA 3LZBA 2SRCA 3W1FA 4F6WA 3PY3A 5KMMA 3HIFA 3BP8A 4C3FA 3LFFA 5AR2A 1XDUA 3CKXA 3C4XA 5TRDA 3VRYA 3C5UA 2XA4A 3MAJA 2IW8A 4Q5EA 3IKAA 1MJ9A 4UWBA 2A07F 1Z9CA 3UYSA 5D10A 4PDOA 3KULB 5AUXA 2MA3A 4WT6A 1UWHA 3IGGA 4K77A 4K1BA 4BCPA 5CNNA 3EWHA 3JVRA 5IUHA 3WTWC 1ATPE 2NAZA 2XCHA 4B0GA 3FPQA 3DKWA 3PIYA 5K3YA 5JZNA 3LFCA 3QTWA 2BUJA 1WVYA 2VX3A 3TT0A 4XSZF 4B7TA 5AA8A 5CSXA 4M72A 2IZUA 1WVXA 5EHOA 3COMA 3P5KA 4E4XA 4JL9A 5CF8A 5EM7A 4NUSA 3VFZA 4H39A 2VTRA 2W25A 4IM0A 4KS8A 3OWJA 3NW6A 4EV0A 1YVJA 3UDBA 5L3DA 3UQFA 2X8EA 4AZSA 4O96A 2RSVA 4CDGA 3FQEA 3QL8A 3TUDA 3EQFA 3ZSGA 1MP8A 3HMMA 1L0OC 1HQCA 2Z7RA 2GNIA 3NNWA 1ZRDA 5HCZA 4AGCA 3GOPA 4FK6A 5J8CA 4ZYHA 2LSOA 4TV7A 5CEPA 1XHAA 1H27A 3QRIA 3HTUA 2RQPA 3I59B 2JD5A 1GY3A 4NJDA 2DK5A 1TVOA 2VBYA 3NDMA 5CT7A 3HV5A 3ENHA 5I9XA 1R5GA 2QOQA 4CZZA 1PP7U 4PL5A 4E1ZA 3QCXA 4G5JA 2B55A 1KV1A 2K86A 4J98A 4YNEA 2EUFB 3VS0A 1XCBA 4MTAA 1OBGA 2W9FB 4JRNA 4YJNA 4ZLYA 2P8TA 4L3LA 2ZOQA 1H9GA 2WV0A 4I5CA 3KGAA 4FEWA 2VTPA 5CAUA 5EOLA 4GVJA 2EA2A 4FKIA 3D5LA 3EFKA 3IWFA 5FLFA 1ZN2A 2KJCA 5LGUA 4L8MA 3RCJA 1D8JA 1YLFA 4D9UA 5LCJA 4OBPA 3EN4A 4HLXA 4EOQA 3LHJA 1H0VA 1EH4A 2VWUA 4RJ8A 4FKLA 3SG8A 2QQAA 5D41A 1STCE 4WG4A 4N6YA 4N9IA 4C4IA 2QKRA 5LARA 4IVBA 4FYOA 2K02A 3OXIA 3R2YA 2MH9A 4OMZA 3GB2A 5AAGA 2XNMA 3M8FA 1V0PA 5KKRB 4L3JA 4H1JA 4RWJA 5EYDA 4WOVA 4N9HA 2X7GA 3R1QA 1J7IA 3Q9WA 4ENYA 1F5QA 1USTA 3M2WA 3VUTA 3BLQA 2PZIA 4YJRA 4W4WA 3GW2A 4CFFA 2ZJ2A 3R8UA 1UVRA 3A8XA 4JR3A 1KV2A 3QX2A 3QD2B 3WF6A 1UB9A 4MBJA 3CDHA 1QMZA 2XROA 4H3PA 4C4EA 1XN7A 3QC9A 4AXAA 2X81A 3C7JA 5BMMA 2VO3A 5LGNA 4GH2A 3ZU7A
chains in the Genus database with same CATH superfamily
1ZOGA 1L3RE 1U4DA 1FVRA 4ZZDA 5KNLA 4B4CA 3QOEA 2VJJA 1ST4A 3CCEI 4IZZA 2QI8A 3U51A 3FBNB 1P4AA 1MH4A 3O8UA 3LQ3A 5HU3A 3FQHA 3SXRA 5D11A 3QKMA 1PMVA 3E62A 1Y8RB 3F21A 3FL5A 1SFOJ 5ACBC 3GTJJ 4HCUA 2NS8A 3ZO2A 1YWVA 4EJOA 4HBLA 4A9TA 4I23A 3Q5IA 3DCVA 4CFWA 2IS6A 5FRMA 4IX6A 1E9HA 2JJ7A 2CG4A 1OUKA 3RZFA 5M57A 5FROA 3A60A 3Q04A 4FV9A 2KRFA 4E6AA 3HGKA 1HW5A 2GQSA 1F36A 3GUDA 5JLWA 3VWBA 2UW0A 3FMNA 3MH1A 5EJCA 1ZG3A 3FMDA 2PMLX 4DGGA 4FTTA 2JGZA 3IV5A 3HKOA 3F5UA 5IA3A 3ZP5A 3CESA 4LLGF 4PJNA 2DI3A 5J5TA 1RUOA 4WNOA 3RQ4A 4A3JJ 5CU0A 1A48A 4ZH4F 3N4VA 3ZDUA 3CCSI 2UVYA 4I6HA 1G8SA 4NDLA 4XN0A 1T2KA 5LVPA 5CEQA 3WZDA 4M3FA 4R77A 4CLJA 5L3AA 2GIZA 3VULA 3TEDA 3KCCA 3HRBA 1U5QA 3QZHA 3GBGA 3OCSA 4I4EA 3RKQA 4IX3A 4FKPA 2P81A 5AV0A 4AT4A 2VWXA 5CU6A 4OWRB 1VF9A 5IT9Z 4L0YB 2GHGA 3K54A 4BQQA 1BI8A 1HDDC 3QTZA 3RM7A 3CJFA 4RZVA 4BIDA 1ETYA 3PJCA 2IZSA 3ECOA 3TNQB 3NFFB 1WI9A 3EUKL 2TRTA 5G1XA 1JKQC 3SAYA 2QU6A 4ARKA 4QQTA 3VYSB 5KNJA 4MGRA 5BOXA 1UG0A 5FEEA 2ZC2A 1OIQA 3BQZA 1PP8F 2GHMA 2CQNA 4QNAA 3IW7A 4KFCA 3BBTB 2AO9A 2R7BA 1YOMA 4QMQA 4DAWA 2C6TA 2CNQA 1ZKGA 3O96A 2HW7A 4FV2A 4HAMA 3KEQA 1GXPA 4M9SA 1R6RA 3DS6A 4IZYA 2K9LA 4A4LA 4TNDA 4I0BA 5H6RA 4V0GA 4AW5A 2F2CB 5J40A 1GHCA 1WMKA 3S16J 2W5BA 4JOAA 1FBQA 3FXMA 3OR1C 3WBLA 5HTIA 1U5TC 4O5VA 4ZTNA 2QHNA 1X8BA 2DQRA 1KONA 2WMBA 5ERIA 4KN7X 3F5GA 3HMOA 4A0XA 4X21A 4FSWA 5FB2A 1QPEA 3ACJA 4L42A 2OICA 1VZOA 3QC4A 3QAHA 4FSZA 1ZWSA 2IEWA 4EOKA 2PN6A 4WSYA 1WVRA 3HOSA 3ROUA 2V1XA 4O2PA 3SC1A 3RMFA 2V22A 3HV4A 5K1YA 4JIKA 4QMWA 2FO0A 4JR7A 4IB3A 4QIWN 1X1BA 1J09A 2HDCA 2W1OA 3G6EI 4HYIA 2FH9A 5AP5A 2C3JA 2YX4A 3DTEA 4O4FA 4FNWA 4LITA 1TW3A 2V6CA 3GU7A 2JKMA 2PMIA 1UFMA 3LMMA 2E60A 4UXQA 3R9RA 5E1EA 4FT0A 3RM6A 1MNEA 2K9SA 3DF8A 3ZUUA 2F5VA 5DUKA 2LRDA 2Z99A 3JTHA 4DEEA 2FF4A 3ECHA 3UG1A 3NAUA 4GKHA 3HDDA 1FINA 2XHKA 1W1WE 3BHHA 4F64A 2QQ7A 1XPXA 1YIOA 4L68A 4QMOA 4RFYA 5DR2A 5IQEA 3A0HC 3F3TA 4ZJJA 5ETIA 1A6IA 2VTOA 1JTXA 5H8BA 2HW6A 2Z2SB 3MTLA 1KSWA 3NUXA 1IA9A 4KB8A 4NM5A 4QMNA 3DQXA 3NNUA 1ZREA 3GTKJ 3Q9XA 2J5EA 3AT3A 3R22A 1OIRA 3CUOA 4GCVA 5GNKA 1MMAA 3FXJA 2YM7A 3BROA 1VQ5I 3OYGA 4KNYA 5EFQA 1L3LA 3V8SA 4ZSGA 4RM2A 4MNFA 3E3VA 4N6ZA 3UZPA 5HNHA 4AXDA 4Y3OA 1XSDA 4IM3A 4O4BB 2X0PA 1G2HA 4ACDA 4C8BA 4YG2F 3LCDA 3WG9A 1TP4A 2EJRA 2FSWA 3P86A 4NIFB 1YWNA 1PXJA 4H3QA 4ITJA 2ERKA 1PKDA 3KCKA 3S4QA 1H9TA 4ANBA 4S30A 4CYDA 2BCJA 2ZJRF 4OBOA 3EQHA 1WJCA 4X0MA 4C3HJ 5AP7A 2OSCA 4DEGA 3LCOA 5EM5A 4H3BA 4MXAA 1VQ6I 3WODF 3KXGA 3M11A 5HNFA 3W2OA 3LKMA 3N4UA 4FSMA 2M4KA 4C33A 3JSPA 3OYMA 3UC4A 1Q3DA 3QX4A 1X3UA 1CGPA 2DA7A 2VQLA 5DTDA 4YFKF 2K7LA 5M4IA 1FOTA 2I5UA 1PRYA 3PNVA 3MZ8A 5H8GA 4HNIA 2DODA 3EYIA 4YC8A 4ALWA 3P08A 2Y7JA 4Q48A 3HUBA 2FRHA 2HYYA 5GTHC 3B6AA 4QP2A 5LMAA 4DHIB 1K4TA 4EC8A 4EM0B 4DH5A 3KA0A 4MQ2A 4S0HB 4WUNA 4OGRA 2B63J 1WSUA 5LVLA 5HGIA 4ANMA 4M73A 4EM2A 4YJQA 4QMMA 4FT7A 4JAIA 4E4NA 4RIOA 4ZMFA 4Q4ZF 3FJQE 4YIRX 3C0IA 3TNPC 1T6SA 3K2ZA 2PL0A 4RX8A 3HA6A 1MNMC 1S7EA 5ANDA 2OUMA 2D1VA 3ORMA 5ILVA 4E3CA 4P9FA 2V7OA 1R78A 3W8LA 5GJGA 3DOGA 3IK3A 2HFHA 2LBFA 2KMUA 1I5ZA 3KXHA 2PZYA 4PFOA 1D0YA 3MB6A 4DITA 1H28A 4I2OA 3HTSB 4X7QA 4DLJA 1TNSA 3R6SA 1QVUA 4OTQA 2CKOA 1SMYF 3DBRB 4E6CA 1DU0A 1OPLA 5HNBA 1ND4A 3AKKA 1JOWB 4FUXA 3CIKA 2KKOA 2GXAA 5BVWA 4OTPA 3O2PE 1MBEA 1YHWA 2CFXA 5DEYA 5CVGA 2PZPA 2K4JA 3SG9A 4LOPA 2X0LA 3HEFA 5EYMA 5BVDA 2WQEA 4Y72A 3NVKI 1GIIA 4USEA 5HE0A 2TCTA 3F0CA 3NZ0A 4YO6A 4ZDOA 1P14A 1QPDA 4F0GA 2RV8A 4LD5A 2R7QA 4LG3A 2IBDA 2NXNB 2Z8CA 4NM3A 1K6OA 3L9FA 2XIGA 3O5AA 2OK1A 4RC2A 1WH7A 5IA5A 4AF3A 1ZGJA 4I4FA 4QQ5A 3COIA 4HOKA 2JBPA 3LFUA 4DG3E 3FZTA 4C4GA 5E1ZB 4XONA 2XGEA 3FC2A 3RKYA 1SFXA 5J95A 3O8HA 4X2FA 3SDJA 2HOEA 3E1SA 5F0HA 4QYFA 2R3KA 2Q83A 4RWLA 2P0WA 3W0NA 2ZJWA 2XGDA 2AQFA 2KULA 1O9UA 4JAJA 2FOKA 2Z2WA 1JTYA 4PSXA 1Q99A 3NLBA 2LP0A 2QKLB 5LHIA 3H9FA 3HZTA 4NM0A 1NG7A 4FTKA 5A3XA 2Q8KA 3LSIA 1IRFA 2GNFA 5HO7A 3CC7I 3PRFA 1GVJA 5DG5A 4QP1A 4BZOA 1H00A 2EIMH 4YZDA 3DAKA 3MW1A 2GA1A 2VX0A 2HZ4A 4JJRA 4GKIA 4KITB 1ENHA 5DE2A 4C57A 2E1NA 2Y4IC 3OVVA 2CSOA 5LMKA 4HNTA 4M97A 3EN7A 4UMQA 1D1AA 3K6GA 3SHEA 2DXIA 3ZQQA 4FIJA 2QO9A 2DA1A 2DYLA 4EOJA 5D5WB 1WZYA 3SHFA 2HZ0A 4AE6A 2EIJH 1LKXA 2HWOA 3Q9YA 3AD5A 3CUQA 2G15A 4I01A 3L8SA 3U4WA 1YRNA 3KVWA 2CV2A 4RX5A 3MA6A 4HYSA 1Q24A 4CZCA 3DDPA 1Q4LA 3T3VA 4V2FA 4BDCA 3HSRA 1Z0XA 4C2UA 1REJA 1NG6A 5GP9A 2WZJA 3ELKA 4MBLA 2H94A 2XJ0A 5ED4A 1G8AA 3DBFA 1IV8A 2R64A 5J7BA 4O86A 2XM8A 2D1HA 4PNKA 5HX6A 2HVSA 4EOLA 5FG8A 4A3CJ 5ILUA 2BZIB 3S3OA 4RG0A 2WU6A 3A01A 2V5QA 2O03A 1KZHA 4ZTQA 2H1LA 3B6CA 3PIOF 1LFPA 5FXQA 2RQQA 2CJJA 3OYFA 1FOWA 2ZMCA 3WE3A 1MRYA 2HYGD 2XF0A 4ZDLA 4LIVA 1WBWA 4D0WA 4I21A 3CJGA 4D9TA 1ZH5A 4LG0B 3G33A 5AV1A 4UB8C 3MGYA 1SAXA 2RIOA 4EEFG 4CV8A 2VTNA