1ZARA

Crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
267
Chain Sequence
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rio2 kinase
publication title Autophosphorylation of Archaeoglobus fulgidus Rio2 and crystal structures of its nucleotide-metal ion complexes.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 92
structure length 267
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zarA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zarA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zarA02
3HV5A 5ICPA 2IJMA 4J52A 2YX7A 1K6OA 2F49A 5I5ZA 2IJLA 2JT1A 4W8EA 3ZFMA 4C37A 2QOLA 4YZCA 3WODF 1R0EA 3ENMA 5CS6A 3ZQ7A 4CO8A 3QXPA 3KKVA 3M42A 4MEDA 1W7PD 3CQWA 3FE3A 3FSKA 1ZOEA 3SZPA 2RGPA 4L68A 3PDTA 4ARKA 2V6CA 2RNJA 4UYNA 3RKWA 3ZRMA 2V1XA 2HGCA 3I0QA 4O7LA 4KBKA 1PHKA 2PVJA 5ANEA 2WKMA 1ZREA 4U45A 3MY1A 3OC1A 1H26A 4Y8DA 3KN5A 4O7VA 3DF8A 5EFQA 4B0GA 3QZIA 4E1ZA 3ZMTA 2IPQX 3MEXA 2G15A 1UFMA 1KU7A 2GWRA 4O0YA 1X8BA 5HE2A 3TKUA 2XUBA 2VRXA 3DB8A 1FMOE 5GJGA 1TVOA 2XKCA 3DXJF 4YPSA 1OUYA 3VIDA 2ZM1A 2ZV8A 4QMZA 4WG5A 2VWUA 5IG1A 1G3TA 3HMIA 1XBCA 2H94A 2XNGA 2ADUA 2IZTA 4MXYA 1E17A 5HLPA 1DI8A 3WZEA 1AWCA 5AADA 4E5AX 3R0TA 4N9IA 1H00A 4HNIA 1XKKA 1B1BA 1W82A 4BI0A 2F2CB 4ITIA 3WZKA 2FSWA 4JR3A 2KJBA 4LLLA 3JS2A 2XKEA 3N9XA 4DGMA 3KP4A 1F1ZA 3UO6A 3THBA 4P90A 4E5WA 5AR2A 4W9XA 2EFWA 2K7LA 4PL4A 3WTUC 4LV8A 4G7OF 3LA7A 4I92A 4ZTRA 2W1HA 1Q24A 1A9UA 4I6FA 1KQ0A 3BPVA 2WMWA 3A99A 4N0BA 4YHTA 3UZRA 3ULIA 3Q32A 2GFSA 2PMOX 4BCNA 4M6XA 1XQZA 3BGZA 5HORA 5C4KA 2BAQA 2KULA 3Q9XA 4XBUA 4DC2A 4IAAA 5DGZA 4ZYHA 1WBOA 3C5UA 3O8UA 2OZOA 2HDCA 3H3ZA 3VN9A 1H1WA 1W7HA 4ASZA 3F5XA 5A4EA 2C6DA 2QODA 5CAPA 1Z05A 5B0XA 2FSLX 2WTVA 4YURA 3LCKA 5I9ZA 2P6SA 4CG9A 3DLZA 3HAMA 2GNLA 4XLVA 2IW6A 2XIZA 2XNOA 2ZFWA 4Y15A 2E9VA 4FV5A 2QVOA 6PAXA 3CSVA 2QUFA 3WZUA 2GXGA 3VFZA 5JGBA 5J8CA 5EW3A 2QQ7A 3KVXA 5AM6A 3JUHA 2BZJA 2EFQA 4KB8A 2D45A 3DV3A 3OXIA 3FKLA 1Q4LA 2VU3A 1PKGA 5FFXA 4L9JA 3ZPLA 1RW8A 2VO6A 1KQ8A 2GQRA 5E7RA 3FZPA 2ZDTA 4RWLA 5T68A 3GCSA 4ZJIA 4NYEA 3V8SA 4LRJA 2C6OA 5K5QA 3L8XA 4IZ5A 2P5LC 2HKXA 2OU2A 5BQTA 3KRWA 4RBLA 4Q47A 2OG8A 4C59A 1ZHFA 2H8HA 5E8TA 3I59B 5EOLA 2ZDUA 3PZEA 2QWWA 4KIQA 1YOJA 2JDSA 4DYMA 2I40A 1RZ4A 2KIMA 3ZUVA 2GNGA 4UXNA 4WG4A 5AV3A 2PZ5A 2J51A 2EFOA 2C4GA 4HDVA 4X3JA 3F8MA 4RG0A 4U6RA 3H9OA 4BRXA 2IVVA 3IW7A 2Z8CA 4KKGA 4PTCA 3GU6A 1GZKA 5EOBA 3DXNA 5C03A 2ERKA 4X2NA 1IN5A 2VC0A 2OZAA 3V01A 2PZIA 1IW7F 4EKKA 2JBPA 4JDIA 4L44A 5ANGA 4RFYA 3DXPA 2BR1A 1ZWSA 2JFLA 5EK7A 2DS1A 2HY81 1XH6A 3A7HA 4IMYA 3EN5A 4NSTA 3QPHA 4FVRA 4OGRA 4QPAA 1GXPA 5J7BA 3ZONA 1T0FA 3LAPA 3C9WA 3DAEA 4RB3C 4A0ZA 3N97A 1OZ1A 3SZTA 3C0GA 3ZEPA 3R0JA 3D94A 3TT0A 4CZTA 4AW0A 3QTRA 1TBXA 2IVSA 2EUFB 3W18A 2G7HA 2VO3A 4XX9A 2YISA 5KMLA 5D7VA 3F6OA 1YS6A 5HLGA 3ZH8A 2FE3A 2ZM3A 4KINA 5AUYA 3RK5A 3BWGA 5AR7A 4BGHA 4ZH4F 1BI2A 4C4FA 3KETA 4FKUA 3G90X 3POZA 1JKSA 4CCBA 5J7HA 5G6VA 5LHIA 4AOIA 5CVGA 5KBRA 2PZPA 5KHXA 3TTJA 1SD7A 3ALNA 3N4VA 5DIAA 4KNBA 3RPVA 4HVHA 3K2LA 3W2SA 3EFJA 3R8UA 4EJNA 3FX3A 1OYWA 4YJSA 2LNBA 2QKRA 5I4NA 5FEQA 3HX4A 1WBTA 5KX8A 3IDPA 5EG3A 2MH2A 5F94A 2NRAC 3GENA 3M8EA 1FP2A 5IZFA 3COHA 4PPCA 5A6OA 1WKMA 2PVRA 3TNWA 3FLNC 1FX7A 4FEVA 1BC8C 3KB7A 4IDTA 4YR8A 1VZOA 2EA4A 3JAMK 4IWDA 3ODZX 4J99A 2XK8A 2X81A 2VONA 3GCPA 2VWBA 4AXAA 4L9TA 5E92A 4M67A 1WZYA 4FKPA 2YIXA 2GZWA 5HG7A 1XDUA 3FQHA 3PIXA 4EOIA 2UW4A 3EFWA 2EU9A 1F9NA 5KNJA 3LE6A 2QU6A 3SXRA 4DHFA 2QOQA 5HE0A 2BZHB 4UB7A 3DPLC 3ELKA 1XMKA 4CFVA 4LD5A 4IXPA 4IC8A 3D5VA 1HKQA 5DUKA 3EL8A 2UXXA 2ELHA 4FIFA 4F4PA 3FMDA 2B0LA 3H9RA 2WOTA 4QMVA 3IQ7A 3KP2A 3UOLA 3NUSA 3I53A 2QI8A 2PVKA 4E26A 4A9UA 2J0IA 4MHGA 4IWPA 1USSA 1HKTA 4M12A 4DNCA 4X6QC 2X9EA 3MPMA 1S6LA 3VC4A 4HQMA 2VTLA 4UHTA 2R2PA 3CXWA 3MY5A 4WG3A 3SG8A 4GIIA 5AAEA 3AXWA 3L2CA 5CXZA 1XSXA 1JVPP 3GX4X 1YQJA 4KA3A 4D1ZA 5H6QA 3UVRA 2CLXA 4AT3A 2IVUA 4K9YA 5D5WB 4D4RA 2GFCA 3TUDA 4RC2A 4MXZA 4J71A 3I7BA 2P3GX 1VJYA 3FLZA 3FL4A 5KMJA 3VO3A 5DFPA 5LEJA 3R7IA 3VQUA 5I3OA 2W85A 2OW3A 4JBQA 4QPMA 2L4AA 3Q9SA 4L53A 1J5YA 4L3PA 5HTIA 3ACJA 5H8BA 4F7NA 4APPA 3GCVA 1H0MA 3J80K 1NT2A 4CQGA 4IVNA 1B4AA 3N4UA 4OINF 3M11A 4XG6A 1HXDA 5EYCA 3A7GA 2W1EA 2RFNA 4EOKA 2HZTA 3IK3A 5EHLA 4GT3A 3TNHA 5BUJA 1YG2A 3LOKA 3M1SA 2CLQA 2ZKZA 4HBLA 1RJBA 2OQGA 4UMQA 1FNNA 5AP0A 3Q6UA 1FQ1B 5HDNA 5ED4A 4IZ7A 4JLCA 3BP8A 4LRMA 2JPCA 1WFCA 3ZMMA 1DUXC 4ZZOA 3BROA 3TKHA 2WZJA 2C5VA 2E7XA 5AV2A 3F66A 5A4LA 4NQWA 2Y0MA 1O3QA 4IRIA 2WMQA 3VBQA 5IF1A 3HUBA 4K2EA 4EV0A 3MS9A 4GSBA 3PA4A 4YIIA 4MBLA 4ZIMA 4FTUA 4O84A 3F3VA 5EKOA 3P78A 2W4KA 4HCTA 2XF0A 3E8CA 3D14A 4FV7A 2A1AB 2OF2A 3QA8A 3A7IA 4JQ7A 5HICA 5E9EA 2OZAB 3ZM4A 3B8QA 3D2KA 3E87A 4ZZLA 4DEGA 2UZWE 3P1AA 4L3LA 4D1XA 2BTRA 1BMKA 3QCYA 3SX9A 2Y0AA 1IXSB 4XRJA 2W99B 4BDGA 5G1XA 4A9SA 3P9CA 1IRKA 2H34A 5DEQA 2HENA 4R77A 1ZN2A 1H9GA 2KRFA 3ORKA 5E18F 4HZFA 4GV1A 4EOSA 2C6IA 1HCLA 5HG5A 4AGUA 2DK8A 4F64A 5HI2A 3FM3A 4AN2A 3MGYA 5HNBA 2JSCA 5CAQA 4EOQA 4WKQA 2XNBA 3KP5A 3BJAA 3ZFYA 3RHXA 1TW3A 3VULA 4F7JA 2WTEA 3B8RA 4RVKA 1A48A 3IG7A 1Y6BA 3R7EA 3EHAA 2YPRA 3I79A 3EL7A 3HV3A 4KMUX 4HA8A 3EYYA 3FXWA 2VX3A 3FJQE 1XH5A 3NUPA 4HYUA 3UP2A 5CJ9A 1UKHA 2XKPA 4QP6A 1XH9A 1YVJA 5BVEA 4TWCA 1MJ9A 2LGCA 4KABA 5M06A 2C3JA 1J9IA 1WBSA 3CQUA 4NK9A 3W32A 5ANOA 1YWNA 3AC3A 5DOSA 3NYVA 1SD4A 3RCDA 2BDJA 3EFLA 1IXCA 2ZNZA 4X2GA 5ILSA 4NWMA 2C68A 1FOTA 1PUEE 5EHYA 4FVQA 5AONA 3Q9WA 3KEQA 2WMVA 4HDUA 1S9JA 1HSTA 2J0LA 3PXZA 5IU2A 1M17A 3R22A 4L8MA 5FUTA 1H24A 3V8KA 4XP3A 3LJ0A 4F9WA 4TW9A 2P4WA 4FTOA 3CLOA 2GDOA 4NH1A 3PWDA 2BALA 4BVUA 2RG5A 4UV9A 1OVEA 3ZO4A 2UVXA 4IHSA 1QPMA 3F2NA 2ITYA 2FQ3A 3PP1A 2QVSE 3NRVA 3L8SA 2WMRA 4GH2A 2LAVA 3EJ1A 3A7FA 4O5VA 3BHHA 2OLCA 2ZMEA 5IQGA 3IW4A 3BQRA 4LGWA 2YFXA 3I4PA 4FTAA 3Q4ZA 4MKCA 4CYIA 2XCHA 2YLFA 1I1GA 2Z9OA 2YDIA 3RCJA 5BVFA 2ONLC 1VEBA 2C30A 2R9SA 1B9NA 4G6LA 3SQQA 2YHVA 5EM6A 5K9IA 2OJGA 4GIHA 3AC2A 4DTBA 3R9DA 1ZARA 3F3XA 2A0CX 3RZFA 1M2RA 2PU8A 4GFMA 2W57A 4TYEA 4IAIA 3VS7A 3NCGA 4BKYA 5J9ZA 2X2LA 5BVDA 1YHVA 5H20A 4JJRA 4XUFA 3RVGA 2NP8A 3UTOA 5GZ8A 3O23A 4QYYA 1S7OA 4YO4A 4IHPA 3CUQC 3ZRLA 1YOMA 2OK1A 5ANDA 1W84A 5TRDA 3HTSB 1PMEA 1YFHA 3QD2B 3MH3A 4MXXA 3Q6WA 2BPMA 3ZXTA 3JAMZ 1IA8A 4K2RA 4KFCA 3KRLA 3ORIA 4QNAA 4XHKB 3NNXA 4MEYF 3BGPA 5CTPA 3QYWA 2GAUA 3C1DA 3O96A 1E1VA 4I7HA 5DT3A 2IPXA 3OF0A 2ITOA 4OTIA 5EI8A 1R5GA 2VD5A 3A8XA 2C3KA 4FTTA 4ZJVA 1BN5A 3P9IA 4CZYB 4BIEA 3KFWX 1YKRA 3HA6A 1P4OA 4ALUA 3PSBA 4RWJA 4EKLA 5EDRA 2X4ZA 2B9IA 3C0IA 1O3SA 1IA9A 3SLSA 1CGPA 1XMAA 5HVKA 2HTJA 2H6CA 4AZTA 3RHKA 2HIWA 5E8WA 2P7VB 2B7AA 3VUGA 2YZAA 3ZSHA 1W5SA 3NVKI 4ZXTA 1IN8A 4J7BA 5J9LA 5BVOA 5LEKA 4RB0A 3R83A 4EUTA 2R3PA 4LGHA 2YITA 2NS0A 3LXKA 3ZN1A 1NHAA 2EV5A 2XK9A 4JIAA 4D2VA 5CAVA 3AGMA 1XH8A 3OCTA 1CKJA 5AUWA 1K9AA 4A0XA 4FNWA 4BICA 4D5KA 3L7WA 4KIFA 4LLNA 3EQGA 5FXQA 3KK8A 1JAMA 3DKWA 2LDUA 1SYKA 2CKEA 4BHBA 3MSSA 2Y75A 2VTSA 4G5JA 3R9HA 1T45A 4FVPA 3I0OA 3FWQA 4APCA 3I6UA 4OU0A 4EH7A 4E4MA 2R3KA 1JNKA 2CG4A 1Z57A 5AMNA 5I9WA 4XJ0A 2A2AA 3RBWA 4R79A 3EKKA 3J80Z 1M7NA 1A06A 4K8AA 3PA3A 4YC6A 2VTJA 4C34A 2HZ4A 4G17A 2CN5A 4QMMA 3AT3A 3G9LX 3VS6A 5EEHA 3FYKX 3OUNB 2UW0A 4U41A 4BZNA 3AAFA 4YFXF 2WGJA 3TQNA 5LXMA 3G5DA 3ZBFA 3FLSA 4UMRA 5HNGA 4G3EA 4L5JA 4USEA 3VEPA 1ON2A 5DR2A 5DI1A 3WYYA 2XKOA 1MQ4A 3DFGA 2DLLA 4RX8A 3HMPA 4QP8A 2G7UA 3G0FA 5KZ0A 5B2MA 1R1WA 3VNTA 1EH4A 4GGGA 5EDPA 4E93A 4I6HA 3U1DA 3QHWA 4WNMA 2XNMA 4C3FA 3ORNA 3DK3A 3BYVA 3NUXA 4L7FA 2OJFE 1G4DA 1I6XA 5E8XA 4UVCA 3ATTA 5ILVA 4ZP5A 4R3PA 4GVAA 4DH7A 3DS6A 4FKJA 2G01A 2CKOA 2RSVA 5FGKA 4BAYA 4BYYA 4PMMA 3LFKA 2OAZA 1LEWA 1Y6AA 4BBMA 3FC2A 3TO9A 2XNPA 4CKRA 3U9NA 4OTRA 2D1HA 4WUNA 5CEKA 3QHRA 2NNNA 2UZLA 5HESA 1PW2A 2VWYA 2PTKA 1JWHA 4D0PA 1J7LA 1BC7C 5DMZA 4UMTA 2G2FA 2XASA 4EUUA 1FBSA 2BFXA 4Z9LA 4I01A 2GIVA 1UNGA 4P5QA 2Q83A 1OYIA 3KXGA 5L2WA 2HTSA 4LL5A 4RIXA 2C6EA 5A2QK 3SKCA 2C6TA 3P5KA 1ZMVA 3QCXA 3EH9A 2ITWA 1JHFA 5K0XA 5HG9A 1LPUA 5ACKA 2O5KA 2PZRA 1F3MC 2YDJA 3C0HA 4MNUA 5IUHA 2BMCA 4ALWA 4C4GA 1Z7UA 3I60A 5KVRA 1ERKA 3MB6A 2OKRA 2G2HA 4NM3A 3AMBA 2ZMEB 5BS6A 4CKIA 2JDOA 3DXQA 3GZ6A 3SG9A 3K1PA 4QMUA 3HA8A 3HOTA 5D5XB 2VN9A 5AA9A 1E2XA 4O7RA 2PE1A 3ZO1A 1W83A 5CEIA 3TV4A 4IWQA 4AS0A 1J7IA 4D4SA 1H08A 4B4LA 2QCSA 1DP7P 2W1ZA 1OL5A 1S8NA 2VBXA 3NEUA 4RWKA 1LVAA 2IT0A 5IQBA 2O2UA 2VZ6A 2CNQA 2FBIA 3LXNA 4FSWA 2W4JA 3Q52A 4FX0A 4QLCU 1NVRA 3HMMA 1HW5A 4KIGA 3KRRA 4LK0F 5J1VA 5AP7A 2IA0A 3CJFA 3OY1A 4AGWA 5M44A 4G7HF 4PTGA 3QQKA 5CSPA 1ON1A 2DQLA 4M71A 4UV0A 3CY2A 2ISZA 4CGAA 4M6YA 3IO7A 4I98B 4J8MA 4ENMA 3FHRA 3PRFA 3EQPA 4TV7A 3ZP5A 4P55A 4DEIA 5IUGA 4QTAA 4EONA 3U2RA 1VR2A 2MA3A 1QPEA 4M9SA 3FMNA 5TF9A 3G33A 4BTMA 1BI1A 4WRSA 5AM7A 3OY3A 3FC1X 4D9TA 4Y5QA 4BHNA 3D5WA 1K7AA 2HYYA 3RTPA 1OM1A 4F0GA 3IPHA 5EM5A 3TUCA 3Q4UA 1XB4A 3PE1A 4TYJA 1FVRA 4CKJA 4YJNA 4CXAA 1YXUA 4NW6A 3H0YA 5L3FA 1JKKA 2X4FA 4BBEA 3F21A 3W55A 4DFYA 3CUQA 3HSRA 1APME 4PQNA 1OUKA 3S2WA 4AP7A 3SXFA 3I58A 3IKAA 5K4IA 2WMBA 3CEKA 5CNOA 4WXHA 3I6WA 5CQUA 4C4EA 3C4CA 4JI9A 3VVHA 3MH1A 4JK1X 4XNEA 4BDKA 4BTKA 2W9FB 1I44A 4EJVA 2BHEA 4YU2A 2ZV7A 4DH1A 1H25A 3FQEA 1REKA 4LLGF 1PXKA 4YSJA 2V9VA 3LQ3A 4IZAA 3KCKA 3VF8A 3RMFA 4M97A 3W2OA 4G3GA 3CO6C 1M7QA 4CMUA 3L9LA 4LI5A 2NNYA 4DG2E 2HZNA 3ZO2A 5F95A 5FTQA 4BTJA 5KMMA 3D0SA 3OWLA 5LGUA 5A3XA 2CNVA 2PUPA 3GC0A 2FMLA 2WPAA 2BILB 3VODA 4EH8A 2RGVA 3KE2A 3JY0A 4GFOA 2M30A 1OPJA 3NEWA 2GU8A 4TWPA 4HGTA 2QHNA 5GHVA 3ZTXA 2ZNYA 1SZMA 3ZSGA 4BCIA 4CTCA 3LQQA 4AGCA 3CTAA 4DGOA 2CJMA 3E8DA 3RK9A 3E6DA 2DYLA 2JAMA 3UPXA 2YABA 3NNVA 3PVUA 3E97A 5BUEA 3OXTA 2AXLA 4K18A 2CGXA 5FTGA 3K54A 2KTYA 4C0TA 4C4JA 4MF1A 1YDTE 4GYGA 3GVAA 4R1VA 2PWLA 3CS9A 3VAPA 4I0AA 3M7GA 4DTKA 4UWBA 5AUUA 3UO5A 2FBHA 4Z3VA 4OOIA 5FTOA 2BDWA 4FKVA 4S34A 2XJ2A 3AC5A 3B2TA 4ZLYA 4O6JA 5HCZA 3GFLA 2RIOA 3HHHA 1U2WA 3Q9VA 4V0GA 5FBOA 5BMSA 4AZFA 4FTMA 4RA5A 4KIBA 5FDXA 5BPIA 2JDTA 1SNUA 3E6BA 3WF8A 3SA0A 5C4LA 4FTIA 2J5EA 4ZTHA 4P5ZA 4FSNA 3V5JA 4ASNA 1QZYA 4LOPA 4ACCA 3R6SA 4FV6A 4D4VA 2L01A 2C3LA 3JW4A 4BTFA 4HF2A 4EQMA 4YFKF 2SRCA 4NW5A 5AV0A 1FGKA 4NM5A 4WD5A 4XH6A 3TO7A 1WVYA 3WU0A 3T9TA 4X2FA 2PULA 3C4EA 3IGOA 1YI3A 5AP1A 4PWNA 3RJPA 4HV5A 1UHWA 4FE2A 5LVNA 4RZVA 3IRRA 1B59A 5IQFA 1RIOH 4U88A 5HLHA 5HO8A 4RIXB 4O22A 5KKRB 3Q96A 4G9RA 4C62A 4FKIA 2QOIA 5F20A 5F1RA 3QC9A 5D1JA 2VTHA 4Y13A 4Y83A 4XLIA 3SGCA 3QQLA 3R73A 2ACJA 1G8AA 4L00A 4MAOA 1YRPA 3PFIA 4EBVA 3K9TA 3F8NA 2R5TA 1TQIA 4FZ6A 3EN9A 4AWXB 1K79A 3E3VA 4LG0A 4GCVA 3DB6A 3O8TA 3QGYA 1BL6A 4GRBA 5F6FA 3RYPA 5EM7A 1Z6RA 4AE9A 3NYOA 3RPQA 2E9OA 2W24A 4IHTA 4IVCA 4OTDA 3GW2A 2RKHA 4E20A 2ZV9A 4M0YA 2VX0A 5DBXA 1Q3WA 4HGLA 4MK0A 4UN0C 3Q5ZA 4AW1A 4KBCA 2C5OA 1YXSA 1MZBA 1ZYSA 2Z5UA 4MQ9F 2AC5A 3QRFF 3I4BA 4U43A 1GXQA 4J98A 4FSTA 1IRFA 3TM0A 4XS2A 3UJGA 4FIEA 5KUPA 1E9HA 4Q2AA 5A2QZ 2PL0A 3IW6A 3VBTA 5BYYA 3LCDA 3FMRA 3F5PA 4C36A 3ZC6A 3NDMA 3MV5A 3BOQA 1IUYA 2R3MA 5M4IA 3QWKA 1EH6A 4ZLZA 1URCA 5LWMA 5HHWA 5IA1A 4FEXA 2NYXA 4CFXA 3KQ7A 4KRCA 3A60A 2HWOA 2EFNA 5E8YA 2MH9A 3TGNA 4EM1A 3Q4CA 1PXIA 3WZJA 2B0QA 3QRIA 2WFYA 3UQGA 3HDNA 1BIAA 1SFEA 4CCUA 1UU9A 5BX0A 3BV3A 3QAHA 4ZYGA 2A27A 2IW5A 3S2PA 4IFGA 1ZRFA 3KULA 5HEZA 2CW0F 4AVPA 3CIKA 5CF6A 3QU0A 2AC3A 4CRSA 3CUQB 5EYKA 5M53A 3D5UA 3IHUA 4HX8A 1BBYA 4EH3A 3WIGA 2Z33A 1H07A 2ISYA 3QD0A 1U3EM 4HPTE 2WMAA 4TYGA 3B2WA 1PXMA 4PL5A 2R3RA 1ZOGA 4EZ5A 5LVPA 2BEOA 2GTMA 2YIRA 1LDJA 1O3RA 4OMZA 3RALA 3D7ZA 5KK1A 4G3FA 3MH0A 3UOHA 1LJ9A 4GT5A 4H3BA 4ZY5A 4EH6A 2XA4A 2B1PA 2I0YA 4GYIA 4U0WA 5FQDC 4FV4A 3R1NA 2W7XA 3Q60A 3DKFA 2YA9A 3IDCA 2A19B 4O0TA 4RFMA 3V6RA 3SV0A 4L3JA 1WQ2A 3W8LA 3TI1A 4ZOGA 4Y95A 3GU8A 5L3EA 4E4NA 4ANBA 5LHGA 5A4QA 5M4CA 2W96B 2ERZE 3RPRA 4YC3A 4QMOA 4KIKA 4GW8A 4JVGA 2ITNA 2X8DA 3RPYA 2Y4IB 3PPJA 3J7AO 3H3UA 5HG8A 2JDRA 4FTJA 1V3FA 4M3QA 4QMWA 2HW7A 4IF4A 4I0RA 4KSPA 2BRHA 3QKMA 5K4JA 4RGSA 2A4LA 5LCJA 2DW4A 3DKGA 1YHWA 2WNTA 3NW5A 4I94A 4H36A 2C5YA 1YI4A 3KFAA 5ETCA 2PFBA 5JGDA 2JC6A 4KSQA 2DT5A 4TPTA 1ZOHA 1JHHA 3DU8A 4FUXA 1OKYA 4D0WA 3E8NA 3SRVA 4BDBA 4FKTA 4G3DA 2WMXA 3KXXA 3KMWA 2CGUA 4BBFA 4JRVA 1J75A 4GMYA 3ZSIA 4YMJA 5A9UA 3LMIA 5JT2A 3D5XA 3GT8A 3CP9A 3R7GA 4V0GB 5JEBA 1GZNA 3AQVA 5L2IA 3KCFA 2NNWB 1BOAA 4FNZA 2X7GA 5JFRA 5CVFA 3R8LA 3FY2A 4AA4A 3O6BB 3V5WA 4C02A 5T6KA 4UMPA 4MX9A 4FTQA 4EWHA 4HYSA 2QG5A 3CKXA 4DITA 5AP5A 2P2HA 3AG9A 3QX4A 4X2JA 3RPOA 4E6CA 4Z7GA 4GFGA 3RJCA 4AT4A 5K5XA 2XJ1A 1PXNA 2VTOA 1XWSA 3BYSA 2XNEA 5J1WA 5AUVA 3OWJA 3O3KA 2VNYA 4HQEA 1T39A 4YJUA 3NWWA 1T98A 5FGMA 4PMSA 1ZZLA 4UYAA 1MRYA 3ABUA 4UV8A 4DG3E 4MWHA 5EH0A 2JTVA 4BZDA 5E20A 1H1RA 2XS0A 2YCRA 1FPUA 1W8CA 4L7SA 4BHCA 4E4LA 3EKNA 3REPA 3JSOA 3O71A 4YIFA 5AV4A 3C1XA 3RDIA 5I9YA 4MXCA 4ZMFA 4I23A 2YM7A 5CVIA 2UZUE 2FXAA 3U51A 1LDDA 3ZLSA 3Q9ZA 2G2IA 4BDEA 4GUEA 3ZLYA 4EBWA 3ORXA 4LG0B 4DH3A 1J59A 3EDPA 2OBPA 4RGXA 5M51A 3MCZA 2RF9A 5ILUA 3RI1A 4RAYA 3NW6A 3F8BA 2YM4A 4F1OA 4CVAA 1KE5A 3I5ZA 2XAFA 3ORZA 5LMBA 1PYEA 3LW0A 1AOYA 1R3CA 3E8EA 4HGEA 3IECA 5J95A 1Q8YA 2VNWA 1MKMA 1Z91A 1OBGA 2QD9A 1HW1A 3D5LA 4FEWA 4UALA 4JG8A 5DDGA 3CQEA 1YXVA 3TIYA 3A62A 1KQ9A 3PRIA 1WWXA 4OIQF 2WMTA 4FICA 4KIOA 4JIKA 4F08A 1PYXA 3P7AA 4RB1A 3TIZA 1KV1A 3RWQA 2DK5A 2J6MA 4IACA 4FYOA 4N9HA 1XO2B 1G3YA 4RVLA 1Q99A 3ZM9A 4TNDA 2DFIA 3BBTB 3FSFA 3OW3A 3QC4A 3DPTA 2VTAA 4BI1A 4BYIA 3MQ0A 1Z9XA 3E6MA 2H96A 4IX4A 3V5TA 3VUHA 2YM6A 2F5CA 2WXVA 2UV2A 2LF8A 4UMUA 4EYMA 2G1TA 5GZAA 3R60A 1XGMA 4O6EA 3E5XA 3GVUA 4FC0A 5HS8A 3OEZA 3KULB 3VS5A 3ZDIA 5BQ0A 3F3WA 1JSTA 3SW4A 3UQFA 2YWVA 4LFIA 3NYXA 2ZMCA 4NTTA 3MA6A 4U0YA 1R58A 2R7DA 4PNIA 3DKCA 2ETMA 4O83A 3ORPA 3QQJA 1O6YA 2ITVA 4RVMA 1TW2A 3U4UA 2RL5A 2UVYA 4KYWA 4PZJA 1OPCA 3ROYA 4WXDA 2XAGA 1XCVA 2HEOA 3W2CA 3V5LA 3EN7A 2HOEA 3ZRKA 4O21A 1V0PA 3OT3A 5D7AA 3QPTA 5H8EA 4BQAA 2QOCA 3C50A 3F82A 3F69A 3UMWA 2B54A 3DQXA 5GIOE 5F1ZA 4PDYA 4IX3A 2H6BA 4S05A 5BOXA 2FBKA 3S00A 2ETHA 2OJIA 2CGWA 4EC8A 4AE6A 4QP9A 2A6HF 4AW5A 4WA9A 5ANKA 1KE6A 4KWPA 2B9FA 1STCE 2I7QA 2KIUA 3LFCA 3ANQA 3SC1A 4CNHA 4EYJA 1PXJA 1MJAA 3FQSA 4IJ9A 4RQVA 1FYMA 3O7LB 2IP2A 1WMKA 3ENHA 3AGLA 4KIKB 5ETAA 3DLSA 3C13A 4HOBA 1EH7A 4DLIA 3ACKA 2H27A 3GC9A 5FFZA 4PDPA 4I22A 4HYIA 1KU2A 1I27A 3UZTA 2O03A 1M52A 3JTGA 4LMNA 4AFJA 2K4BA 4B8XA 4KS7A 4IPAA 4HOKA 3VBWA 3FKNA 3BU6A 4YSMA 3F6VA 4ASXA 4KICA 5A6NA 4QO9A 3ZYAA 3MTFA 1D8JA 1IAWA 3GZ5A 4Q5EA 2HAKA 1LP4A 1TNSA 4EJ7A 4XV1A 2XK6A 3Q5FA 4TZRA 1Y0UA 5DWRA 3M1EA 3PVWA 4WOVA 3PVGA 2IW8A 1SVEA 4EOJA 4ASDA 4RB2C 4D2RA 2OSCA 2V0DA 3OS3A 4HJOA 4U8ZA 2OA4A 3SRVB 2Z02A 2IZSA 4ZSAA 5LJJA 4O81A 5CANA 2EA2A 3VS3A 2FMYA 2VT2A 4AZVA 3FXQA 1B9MA 4D58A 5M56A 4QMLA 4FOBA 5IT3A 2PUNA 2DO7A 4M7IA 4WRGA 4AA0A 4I5PA 4RSSA 4RJ5A 2J0JA 3OVVA 2ZB0A 5L6PA 2Z60A 4BR3A 3UVPA 4GU6A 1YO5C 3SHFA 2ZYBA 2IA1A 1U5TA 3LFNA 3VW8A 4I0SA 5CVUA 2D2WA 3K3JA 2PMNX 2VTPA 3IGGA 4M15A 4Y85A 4FG9A 2IW9A 1O7LA 4L45A 3DK6A 4ANNA 5FD6A 3JVSA 3R04A 1GVJA 5CVVA 3HUCA 3GOPA 4P9FA 4EH5A 3TN8A 4GJ2A 3WTYC 1KU3A 4AF3A 5IA4A 5E4HA 3O51A 3IOKA 5DPVA 1OL1A 1QQIA 4RPVA 3BCEA 1CKIA 1YYVA 3R2BA 2LF7A 3OP5A 3JPVA 3DJ6A 3FPQA 1KWPA 3DK7A 4FBXA 4H1MA 3HV6A 3FLWA 1XN7A 1PDNC 1KOAA 5DR6A 2FA5A 3BLRA 4YLJA 3ELJA 3RYRA 1BIBA 1U8RA 3M2WA 4LB6B 3GEQA 3RM7A 3LA3A 4QQ5A 3TNIA 5J8FA 2VO7A 1NXKA 3ITZA 4L67A 4PGHA 3VBXA 5M08A 3AOXA 4MVFA 4DEHA 4R7BA 5IISA 4FTLA 3GU7A 3QRJA 5CLPA 3WE8A 4TL0A 5LRSA 3EOCA 5IQCA 3PPKA 3W8QA 1PMNA 4OAUC 2PQ8A 3GUDA 4FA2A 1MDMA 3MW1A 5IH4A 5FEEA 4EQCA 2BHHA 4RJ6A 3ZFXA 2VOOA 3VUDA 2Y9QA 3TTIA 4CLJA 1MQBA 3BU5A 4F6UA 3U55A 4DFLA 2B55A 3WGIA 3IW8A 4GXOA 4ENJA 3W1FA 2R3LA 4ZY4A 2A6EF 4QMQA 3U54A 3E3PA 1Q62A 4BNCA 4FSQA 4Z55A 2VE8A 1H8FA 2B9HA 2V62A 4KA4A 2VBWA 3RKYA 3E64A 4R7HA 4WHZA 3K1NA 2QKWB 2VWIA 4EOLA 3HNGA 5AR5A 2CN8A 2UZKA 4PMPA 2CSNA 4JBAA 3S4QA 1J1BA 3AD6A 3G6GA 3I5NA 5HS7A 4EQUA 4DEBA 3UPZA 1IASA 1Q3DA 1FYKA 2QO2A 1OR7A 2W1DA 3PJCA 4HV6A 4XRLA 2XEZA 3WTXC 3HMOA 4P4CA 4TN6A 3VOEA 3IC7A 4GT4A 2ITQA 5CF4A 5HS9A 1FMKA 3LQRA 4HNFA 5AR4A 2CHLA 4QMNA 2P5VA 4BC6A 2ZV2A 3AT2A 5BYLA 2YLEA 2Z7RA 5HE3A 4RC3A 2BIKB 3QBNA 4K11A 2LKPA 2XJ0A 5HIEA 5JFXA 1I5ZA 1H9TA 1T46A 2E1CA 4LUEA 3SVVA 4X2KA 3NYNA 4LG4A 4Y73A 1GIIA 2Y6MA 1Q8ZA 2DI3A 3KREA 2FO0A 2E7WA 3AD4A 3QCQA 4WXCA 3ZEWA 4BDAA 3D9VA 4JR7A 3DFAA 2YCSA 4PPAA 2HQRA 4BIDA 4C57A 4WBOA 1AD5A 1M2PA 5C8KA 1S29A 4V05A 5DD4A 4F9CA 5CAUA 4CFNA 2ITZA 1R1UA 3KMMA 4C7TA 4PY1A 1W0XC 3QA0A 4TY1A 4UZHA 4BB4A 3FWEA 3LFDA 4HVIA 2UW6A 3GFJA 1GZ8A 2HCKA 2GCDA 2VOPA 5H2UA 4YLLA 4DGNA 5CU6A 4AUAA 4ZSEA 3T8RA 4FKOA 4QWQA 3A4OX 3HL7A 2TDXA 3LXPA 1WRJA 4B9DA 2DU9A 3FMMA 4GJ3A 4LM5A 5DLSA 4C3RA 3WIKA 1PF8A 1Y8GA 2HWVA 3L9PA 4D1SA 4WSQA 4YZBA 3DBQA 1BL7A 3DT1A 1Q1HA 3CD8A 3H0ZA 4USDA 3E62A 1DDNA 4OUCA 3PZHA 4WWCA 5DH3A 3BI6A 2J7TA 3CGOA 3H30A 3F9NA 2AS5F 1GAGA 3F72A 5JGAA 3MZYA 2P33A 3W6JB 2WEVA 1U54A 1DAYA 3PSDA 3BEGA 1UWJA 4RX9A 4MD9E 3FMSA 3V7SA 3HRMA 1L8TA 4J95A 4PPBA 4IVAA 5HTCA 4UNOA 3ZMUA 2VBYA 1FWZA 4QTDA 4F9YA 3HRCA 4UVAA 1AGWA 1YOLA 2V7AA 4QP1A 1SMYF 1F5TA 1FBNA 1P4XA 5H9BA 4E4XA 4R6VA 4F09A 1YQAA 4OBOA 4EJUA 2F7EE 2VTMA 2X8IA 1IR3A 1IF1A 1ZG5A 1QMZA 4A2UA 3W2PA 2J50A 4DTAA 1FSEA 2CMWA 2CGVA 4ZY6A 5DVRA 4ETSA 3L09A 1OKWA 2QQAA 4MTEA 1D3YA 5FLXK 2KKOA 4YBKA 4G6DA 3TNQB 3CJNA 1BI0A 3O7LD 3U6IA 4XCUA 4UX9A 2QQBA 2ZM4A 4I21A 5AJQA 5HLIA 3R7UA 1XCBA 1U5TB 3GLXA 4R3CA 2J0MB 2HW6A 4ACGA 3V6SA 1U46A 3NQOA 2EB7A 2FF4A 2VN2A 4AZSA 4RIWA 4JQEA 5E90A 1TKIA 4DT9A 3AC1A 1PKDA 2QOHA 3TV7A 2VAGA 5FD2A 5HCXA 3WE2A 2BYVE 4ACMA 4BGQA 3COKA 3L1SA 3OFMA 3F61A 5AX3A 4F7ZA 5AP3A 2WQEA 5BMMA 4BKJA 4MH7A 3ZO3A 5E1XA 2JKQA 1RQQA 4KS8A 3BWJA 1H1SA 2VX1A 3ZMSA 3CR0A 2IVTA 2WMUA 2JBOA 4NJDA 4D9UA 4FV0A 1MJBA 1ZMWA 5EEGA 1LUFA 1HKSA 4E7WA 3UGCA 2QR7A 2BFYA 2X1NA 5HZNA 5JQ5A 4MXAA 1NY3A 2O8XA 3E93A 1P2FA 5HVJA 4IB0A 3G2FA 4WF2A 2C69A 4CLIA 5E91A 2W4OA 4ZLOA 3REOA 3EQRA 5I9XA 1PMVA 5HCYA 4QTBA 3FZVA 2JPBA 3R1QA 2A61A 4W9WA 3CBLA 3MFUA 3GGFA 2O6GE 4K0YA 2W05A 1MDMB 1L3LA 3I64A 2RKUA 2EXEA 5IQDA 5EQPA 4PUZA 3TUBA 5DV5A 5AP6A 3ID6C 1SMTA 4L0YB 5CU4A 5KHWA 3AC8A 3QYZA 1ZXEA 3HLLA 4M13A 5GNKA 4RGRA 3PQJA 4ANQA 3UBDA 4ZTMA 4JDHA 4U0VA 2R7IA 3T3UA 2QC6A 3HKOA 2E9UA 5LARA 2KJCA 4F1MA 2O61A 3LIJA 3TEIA 5ITAA 2IO6A 4F63A 4YJQA 4U40A 5EM8A 1SNXA 4A4XA 5EHOA 2OD5A 1SVGA 4DQ2A 5HD4A 3P4KA 2PZYA 1OKVA 2RV8A 4R1HA 3TZ8A 4DFNA 5DA3A 3UE4A 4IVDA 1OI9A 2JFMA 2Z7SA 3HRBA 3A2CA 1R1VA 1BI8A 4PNKA 2VV9A 4IE9A 2QQ9A 3O2MA 3LCTA 4O7SA 5J79A 4BXUA 4F9AA 3A4PA 3J81K 2FUMA 5JVTA 4G6NA 1VYWA 2QLZA 1ZRZA 2WIHA 5IDNA 3TJDA 3RNIA 4WCGA 1YXXA 5C26A 4O7ZA 3BQCA 4YTIA 3NW7A 3GYHX 4JG7A 3G3ZA 3V5QA 4UVBA 4HPUE 4JX7A 1YI6A 1QPJA 3R8VA 2IA2A 4HZSA 2C6KA 3D15A 2BZKB 2ZAZA 4PGGA 4XV9A 3QP5A 3N4MA 3TKYA 4FYNA 1QCFA 4M0ZA 1ZYLA 2GTNA 3ORMA 4WNOA 4ZAUA 3BYMA 3NSZA 4O1PA 3EQHA 1S7AA 3MJ1A 3DZOA 3L00A 3ODYX 4YNOA 1DPRA 2R0UA 3PY0A 2Q8KA 4WO5A 3BWFA 4G5PA 3ECOA 4P9UA 2V1UA 4LYNA 2F57A 3U6HA 1UKIA 4YTFA 3FAAA 3NZ0A 3WI6A 5ERIA 3R00A 2BRNA 4IAZA 3QKKA 3VUTA 3H3CA 2W1IA 5J5SA 1BJAA 2Z2WA 2XHKA 1XJDA 4TYHA 4KD1A 2O3PA 2UW8A 3BHVA 1Q8TA 3LFFA 4BHZA 3R2YA 3B73A 1WBWA 3T5XA 1ZYCA 5M4UA 2HYFA 2M5WA 4X0MA 2BIYA 3VS0A 1OIQA 1GY3A 3SDJA 3PXQA 1RE8A 5L3CA 4D2WA 2GNHA 1U54B 4O0VA 4M8TA 3RNYA 4XP2A 4I4EA 3ZS5A 4C61A 4B8LA 1XBBA 3ROCA 1IG1A 4GG7A 3T9IA 2VO0A 3KY2A 3LM5A 4ZEGA 4II5A 3PXYA 4HCVA 4FIIA 4ZSGA 1IXRC 5HVYA 3VHEA 2YAAA 3QQHA 5TJJA 3ZUTA 4EJOA 4I20A 4X3FA 2PE2A 3LJ2A 3IW5A 2GXBA 5E8VA 3G9NA 4AZWA 1CTPE 4CGZA 5E8IA 1WSUA 4MBIA 2J5OA 4IM2A 1H4LA 2OF4A 5HO6A 4O3MA 3VS4A 4CFUA 4OLIA 4FF8A 5CF5A 3FXUA 4KNYA 3FMEA 5HOOA 3VBVA 4YHFA 5K5NA 4AACA 2WWYA 2AUHA 1A04A 1FZPB 2E1NA 3TDVA 4HF0A 3SAYA 4YUQA 2W1FA 3GU4A 2O64A 1Y57A 5FM3A 2PUUA 3S3IA 3ZZEA 1SFUA 3QUEA 4DEEA 1USTA 4OIRF 2UZVA 4A5NA 1R1TA 1JPAA 1SM2A 4FK3A 4ESFA 3OZ6A 1H27A 1SFXA 5IH6A 3DFCB 3C7JA 1GIJA 4EQQA 2P8TA 1U5RA 2OXYA 3PLSA 3HTUA 1QBJA 5DE2A 3ETAA 4GL9A 4RIWB 4TRLA 4X6RA 2JDVA 2QG7A 4JT3A 3OCBA 4TTHB 3KXNA 3LCSA 2YIWA 4FV1A 3BV2A 3II5A 3KP7A 2YSRA 5JFSA 4U79A 5HOAA 4CMOA 3PY1A 2YWPA 2NPQA 5KKRC 2CQKA 5CZIA 4UY9A 2OH4A 2HYGD 5DRDA 3IWFA 1ONVA 4EH4A 4J8NA 4R8QA 4IJAA 4BGGA 3NAXA 3QRTA 4O86A 3SW7A 4BN1A 1UB9A 2YM5A 3H4JA 3FLQA 4YP8A 1TNTA 3HECA 2PYWA 3JY9A 4XG4A 3QTXA 4QMTA 2PN6A 4AAAA 3TKIA 1SD6A 2Y8OA 3R9RA 1ODDA 3HHGA 1U4DA 2C6LA 3GF2A 4KAOA 2COMA 1JKTA 3FV8A 4U3ZA 3CGFA 3SQNA 2QOFA 3LA2A 5ICFA 5L8LA 5FLXZ 4DAWA 2H6DA 2FA2A 3FHZA 1OIYA 5FP5A 3QUDA 3WYXA 3R28A 2GPHA 3F22A 3KU2A 4F7LA 3WF7A 4BCPA 2KIFA 4TYIA 4EI4A 3SHEA 2QYOA 1BI3A 5AR8A 2VC1A 4V01A 2R3GA 2L02A 5FLFA 2HQNA 4EVIA 5B2LA 4WBBB 4FT8A 2WU7A 4K77A 2Y48A 3MVHA 3NGAA 3AMAA 4AT5A 2YIQA 4Q5HA 3T0YA 4NL0A 3O2PE 4M9ZA 3UIBA 3NPCA 4DGGA 4E8AA 1KOBA 3ZLWA 1P4WA 4AIKA 4DCEA 1EH8A 4AN9A 4RS8A 4IZYA 2XAHA 2JIUA 1UA2A 3FBVA 4PCQA 4RGJA 4XRFA 1KUTA 1FLIA 3ROUA 3MY0A 5LQFA 4EGYA 3BPXA 3BZ3A 2PJPA 4FNXA 1YW9A 1ZY4A 1R22A 2MC3A 2ZOQA 5BMZA 2YN8A 4BIBA 2WTIA 1J7UA 2X8EA 2CNUA 2VGPA 4ENNA 1J7KA 5AUTA 2VTTA 4U0IA 2L4MA 2VWWA 4IADA 2CKPA 1STZA 4NEUA 4NFNA 2DQ7X 5C8MA 4AG8A 3QX2A 2BCJA 5HGIA 2J5PA 3VS1A 4P96A 1MRUA 4YC8A 4MQ1A 3LM0A 3OXZA 4EOMA 2A68F 5L4QA 4FKLA 3GXOA 2G9WA 1HBXG 2V1DA 5D6EA 4RWIA 4OTGA 3TJCA 5CU2A 3O17A 4S04A 3L9FA 3COAC 3PXRA 2QENA 3QF9A 2UUEA 3CY3A 5LBQA 4QTCA 3OHTA 1GNGA 4EK6A 1ZY5A 4B6LA 4PDOA 1UU7A 1IZ1A 3MDYA 3UODA 1UNLA 2OXDA 4IQ6A 4CD0A 2OFUA 4FKSA 5D5UB 4XLPF 5FDPA 2XH5A 4L9IA 2DPDA 5FO5A 3R1YA 3WG9A 3BHUA 3IS5A 3FEGA 3D4QA 2HZ0A 3UYTA 2UVZA 2UW9A 3HSEA 3LFSA 2X39A 4ID7A 2FEZA 3EB0A 2FYSA 3MVMA 2XAJA 2VE9A 4I3ZA 2QONA 4FOCA 4L43A 2UZDA 4TYHB 3GCUA 2FRHA 4WSYA 3W33A 4L5IA 1IN4A 1I09A 4FT7A 3AMYA 5FP6A 1BM9A 1OKRA 3FZRA 2VT3A 4A9YA 4OT6A 4XOYA 3HVCA 4O82A 3GC8A 2Y4IC 3ZCLA 4I6QA 1YWRA 5EI2A 3RI4A 4ACHA 4YTCA 4LMUA 3VUKA 3T1BA 3OG7A 4TNBA 3J81Z 3MVLA 3HAVA 5CEMA 1AQ1A 1Q8WA 4GK3A 4U7ZA 4IM0A 1JSVA 2C6YA 4DGLC 2ZB1A 5CVHA 4UXLA 5AFVA 4QP3A 4G34A 2OIBA 5I9VA 2FH9A 4F9BA 3LFBA 3C4FA 4R5YA 4RZWA 4FV2A 2XBAA 3KZZA 3H10A 4JXFA 5IH5A 4X3FB 1OL6A 2WIPA 1NA7A 3QKLA 3P86A 4NU1A 3V8TA 3OOMA 3HV7A 4E3CA 4F99A 4F65A 4IB5A 2NAZA 4CFWA 4Z16A 2Q0OA 5CEQA 3N51A 1OECA 5HIDA 5J6XA 2RFSA 3KA0A 4FG7A 4O7YA 2Z3YA 3A7JA 4QP4A 4JS8A 4Q9ZA 4ZK5A 1F0QA 4Z2YA 2CGPA 2EV0A 1PP8F 5JK3A 5CALA 2BKKA 2QU5A 4BCFA 1Q61A 4GEOA 4FT0A 2GHMA 4XLNF 2PSQA 1T38A 3F3TA 2A3SA 3NAYA 4YJOA 2BDFA 4YZDA 2RN7A 2WTKB 5DCMA 4BY9E 3ORTA 1PXOA 3DPKA 4PDSA 3P9JA 1PJKA 4DA5A 4FSYA 4NM7A 1IN7A 3IL2A 2BUJA 4C35A 1BX6A 1QO0D 3T8TA 5JH6A 3F5UA 3R0AA 5TE0A 1SMHA 2HOGA 4RJ8A 3NR9A 4BCJA 3N4TA 3MA3A 1J3HA 4FKQA 4GCJA 2RQPA 4RLKA 4L42A 1E1XA 2H09A 2XM8A 2CWEA 1M2QA 3DV8A 4JBOA 5AAFA 4XG7A 4Q5SF 5IT9K 4D2TA 2GNIA 3I5UA 2F7XE 4YO6A 1UNHA 2Z7QA 3D2IA 3E3BX 2R3JA 5HE1A 3GFWA 5ICEA 1CMKE 4IFCA 4O2ZA 3UMXA 5JZJA 3ZLXA 1UVRA 3V4GA 4LK1F 5IQHA 5GINE 4W4XA 4ZTQA 1PXLA 2O65A 4ZTLA 3WARA 2CCIA 3LPBA 4HGSA 3MFSA 3ZUUA 4FSMA 3W16A 4G6QA 3UG1A 4B99A 3UVQA 2UWMA 3E92A 3BX5A 3OWKA 2ACXA 1S9IA 5HVQC 5DN3A 4MGRA 4NT4A 3SD0A 4FEQA 3MWUA 5LOHA 4TKSA 3A8WA 5EYMA 5FEDA 1QNTA 3HOSA 3ALOA 1REPC 1OPLA 1CF7A 3CC6A 5I0BA 2C3IB 5J8IA 4MD7E 4FT3A 5CZHA 4A5MA 2XUUA 3FKOA 3HRSA 4TXCA 2CPKE 4ITJA 2QHMA 2OFVA 3VS2A 4QPSA 3GP0A 3G15A 4HZRA 3E88A 5CQWA 2IN6A 2YR2A 3QRUA 1J91A 4H58A 3ATSA 3ZN0A 1KSWA 3JYAA 4EK4A 4U5JA 3WTVC 4R7IA 3NX8A 2XMYA 2X7OA 3FI4A 4BDFA 2Q2EA 4YHJA 3Q2MA 4M84A 3P7BA 4W8DA 2FGIA 4FSUA 4DT8A 4FIHA 4CMTA 3BJ6A 2PVMA 3ET7A 1FBUA 5L2QA 1DPUA 5TKDA 4ORKA 3KEOA 4EHEA 2O0UA 3WGGA 2PG4A 4FKGA 5B2KA 4ZZMA 3S95A 3GO5A 2W5HA 1FBQA 4FHTA 4IRGA 4L9NA 4A07A 4H3PA 3DQWA 4FSZA 2STTA 4WK8F 4ERWA 4RX5A 4ZJJA 1Z6TA 4XV2A 4YBJA 2I1MA 4RA4A 1T2KA 5CU0A 4BCKA 1YDSE 3LAJA 3MIYA 4FI1A 4JQFA 4NCTC 5CVRA 4JL9A 5HLNA 1ZYJA 3QFVA 4C8BA 5K0KA 5IA0A 5D8KB 3K5VA 4GKIA 4HCUA 3IKVA 5D5VB 2FOKA 1FVVA 5CNNA 4D55A 4QMPA 1JOWB 3LFQA 2HELA 1OGUA 5HKMA 3OTVA 5BVKA 2JD5A 3QLGA 4QQTA 1PXPA 2I6LA 5AIQA 2YACA 3CKWA 5AIRA 2YJRA 3Q5IA 1L0OC 1MGTA 1J1CA 2WU6A 2C0TA 3IONA 4FNYA 1GIHA 3LQ5A 3F5GA 5CEOA 1ZRCA 5BVNA 4QMSA 2WEIA 2BRGA 3DNDA 2X6EA 4XP0A 5DNRA 3E6CC 3JSPA 2HWPA 4Q4ZF 3GC7A 3TL8A 2UW7A 3V8JA 5D4SA 2NRUA 3FMLA 4GK4A 3QQUA 4HW7A 1H28A 5L6OA 1KE8A 4G1WA 4JDJA 4W4WA 4BYJA 5AR3A 1HOWA 4AWIA 1K78A 4BDIA 5IPJA 5E8SA 2UZEA 3QP6A 2J4ZA 1QGPA 4O7TA 2HKOA 3TWJA 3G0EA 4FZAB 1O6KA 5AIKA 2GSFA 3R1SA 3PJ2A 2J90A 3FL5A 4XMOA 1FT9A 4G6OA 4EM0B 3HYHA 1G8SA 1YLFA 2PVNA 4A4LA 4D0XA 3RKXA 4IRHA 2OGVA 1R23A 2IZRA 4XG3A 3F2RA 5CWZA 4EEVA 2CCHA 4IH8A 3L8PA 3R4KA 4HYHA 3FDNA 2OBJA 5E8UA 5KZIA 2VTIA 2R64A 4BCOA 1XH7A 1VYZA 2GQQA 2K86A 2R3SA 2W17A 3CTJA 2XZSA 4BDCA 3V8WA 3SFZA 2ZJWA 4OMYA 2OU7A 5D41A 3LJ1A 4K33A 3MPAA 3GUBA 5A14A 5L3BA 4AIHA 1R0PA 2PEXA 5D9HA 5I9UA 3K1MA 2CFXA 3UYSA 3BGQA 5LCKA 3WU1B 5DCMB 2QLQA 3FZOA 3WF6A 1XGOA 5JQ8A 4UWCA 3MFKA 4I5MA 2J5FA 3LFAA 4CHUA 1JXSA 4M69A 2XV4S 3KMUA 4MEXF 5EW8A 3PJ1A 3LZBA 2W25A 2HR3A 2VWXA 5JHUA 3NLBA 2X7FA 3MH2A 3R21A 2CO5A 4C4HA 2XIKA 3BPRA 1Z5MA 2X9FA 2J9MA 4BHPA 4Z7HA 4BCGA 3UC4A 4S31A 4F7SA 5IQIA 5HX8A 4YG2F 2EFPA 3F6XA 5ANIA 4G9YA 4BZOA 2GQSA 2EXCX 4IW0A 5AUXA 3FMKA 3JTHA 3GEZA 4U44A 3OTUA 4U42A 1Y8YA 5HDKA 4KKEA 3BBWA 5A54A 3F7ZA 4IB1A 3R8PA 3S1HA 3F7WA 4HX7A 2G9XA 1YXTA 1TQMA 4ITHA 3V7CA 3HDMA 2VTRA 2GS2A 5L8KA 2OQRA 2V7OA 3LMGA 3C4ZA 3DJ5A 1P2AA 4UEUA 3GBZA 3M8FA 4FG8A 3EQCA 4O0WA 4RQKA 2HZIA 4CICA 3R7YA 3HZTA 2PMIA 3BE9A 4D2PA 4XSZF 3UP7A 4F6SA 3DNEA 3I0TA 3EYHA 4E6QA 3KEXA 4LV5A 3QD3A 4PL3A 1K2PA 1CF7B 2XGXA 4U81A 3UIUA 1QL6A 2PVYA 4EH2A 1UHMA 4FZ7A 2YX4A 3EQDA 4OAVB 1WI9A 1QPDA 4ZTSA 2ZMDA 3BHYA 2RFDA 3EIDA 1DAWA 5GJDA 3VF9A 1Y91A 3WGHA 1V1KA 5IA2A 3TZ7A 4EMSA 3KRJA 2DQRA 4CEGA 4IVBA 1G5SA 4UWYA 4LUDA 3BLHA 5IT9Z 2FVDA 4N6ZA 4Y46A 1LR4A 1KE9A 4AA5A 4N0SA 4O91A 2PY3A 2QO7A 3QTUA 1XDSA 2GNJA 1HSJA 1KGSA 3GFMA 4G16A 5IA5A 2P2IA 4C38A 4QQJA 2K27A 3F23A 4Y5HA 4QQCA 1ZGJA 3ANRA 2X2KA 3VJOA 3NIEA 1FVTA 4LFUA 3OCSA 5E8ZA 3RPSA 4FL2A 4V04A 4EWQA 3RTRA 3DAKA 4FK6A 4ANOA 1ZLJA 4KN4X 2NO3A 2WMSA 4MNFA 5CU3A 1H1PA 4G9CA 2UZNA 3HP5A 3OUKA 3KRXA 5IA3A 2PK9A 2YAKA 1ATPE 2HFHA 5KMOA 2VTNA 3EYIA 4ENXA 4DFBA 3RKBA 3M9AA 3NNUA 2B4SB 4OBPA 1KE7A 4FTNA 1Q8UA 3DZQA 4I09A 4LB5A 1QPCA 5DEYA 5DD8A 5TR6A 4PRJA 4I0BA 3O50A 4IAFA 4PP9A 3KF4A 2GNFA 4O0RA 4L0ZB 2CSOA 1YDRE 3CD3A 1OITA 3WE4A 4S33A 4KUJA 3WTZA 3OWPA 3DEUA 3OT8A 4O7NA 4U80A 1OYYA 2A07F 1ZLKA 3KXZA 4NCTA 3LWFA 4EJWA 3BY6A 1FY7A 3UC3A 3BU3A 4G3CA 1LEAA 4MF0A 4XBFA 4ZZDA 3AC4A 3PE2A 2OICA 1K78B 4CSVA 2BV6A 4FT9A 4O1OA 5LVMA 3K69A 3DGKA 2UW3A 5CI7A 1HQCA 1H01A 4LQMA 2C5XA 3E7VA 3VUMA 3K0LA 3S0OA 2R0IA 4FKRA 5L3AA 3G73A 5L3GA 5F4NA 2B52A 2Y6OA 1TTYA 5J87A 2PE0A 2BVAA 2P7CB 4I6BA 3OD6X 2P0CA 4H1JA 2YCQA 5ICCA 4PP7A 3LKMA 3JXWA 4R3RA 5CSXA 4HYEA 3V04A 3PUPA 4KBAA 4IANA 2WTJA 3OROA 2F7ZE 1Z9CA 1WVXA 4IAKA 1KA8A 2P6TA 4NIFA 5FB2A 3NS9A 1P5EA 2W5BA 2WQMA 2R3NA 3QXOA 3MPTA 5HU9A 4KRDA 4OTWA 1XHAA 4D28A 4G94A 4K1BA 1JKLA 3WBLA 1OB3A 1U5TC 5IMEA 3D7TA 3MN3A 2GS6A 3FZTA 3TXOA 2F2EA 1W4MA 5B7VA 3KVWA 5AIPA 1VTNC 4NJ3A 3B02A 3Q2JA 1OKZA 2GQGA 3D0EA 4E6AA 4RIOA 4FX3A 4LGGA 4QYHA 3GNIB 4KMFA 4M69B 1OPKA 3VJNA 5LMKC 2WTCA 3AT4A 3Q4TA 2ITXA 4AZEA 5H6RA 2JKOA 3ZZWA 2W5AA 1RNLA 2JKMA 1ZG3A 3V7RA 4L9VA 5DHJA 4NUSA 1XSVA 2GHGA 3PSCA 3DDQA 1H0VA 3HGKA 3QOPA 4N70A 1YW8A 4EOPA 3RIRA 5F64A 3DJ7A 2YJSA 3DBCA 2QLUA 4ANLA 2C1AA 4DN5A 5C27A 1CKPA 2P5KA 3HIFA 3OEFX 4YNEA 2YM3A 4GUBA 2F5FA 5DEWA 4XG8A 3KCCA 4EZ7A 4RLLA 2OIQA 1OMWA 4NM0A 3EETA 3PP0A 4DG0E 4BL1A 2OJ9A 4IX6A 3PXFA 3G51A 2LSOA 4F0IA 2FNPA 4L52A 3LHJA 5HLWA 2L54A 4HF1A 5L2TA 2BAJA 3LCOA 2PMUA 4ANMA 3DKOA 2XKDA 2YIYA 3CCNA 5H3QA 3K3IA 2XIGA 2XRWA 2HS5A 3ML6A 3NUUA 3EZRA 4QMXA 3U8WA 3TZMA 3UG2A 3QRKA 3TV6A 3KXMA 5ANJA 4M73A 5IEYA 2Q0BA 3NNWA 4ZSLA 1LEBA 3QTQA 1ZYDA 4UZDA 4QYEA 4MBJA 4MTAA 2X2MA 3K5UA 3VW6A 3MBLA 5CASA 3MAJA 5CT7A 4X7QA 4DEAA 5FD5A 4O96A 5HO7A 3FY0A 3FYJX 4I2OA 3GB2A 1MUOA 1KYZA 2WOUA 1MP8A 4BWXA 3UOJA 3HV4A 5JZNA 3PIZA 4ASEA 5HNIX 4ESBA 3BE2A 4ACDA 4FSRA 2GMXA 2B53A 5FM2A 3ZOSA 5DYMA 2OH0E 5D8LB 5AAGA 3QALE 5C01A 2JLDA 2EV6A 3KZYA 1DM2A 3HRTA 4WT6A 4A0YA 5LGTA 3UQCA 4B7TA 2VTQA 4YZ9A 2ESMA 4CRLA 3OMVA 3OBGA 1OIUA 1Z1DA 5LMAA 4DE4A 5AP2A 3RAIA 2R3HA 4AU8A 4HW0A 4OR5A 4RIYA 3U9CA 5HBJA 3T8OA 3ULZA 4H0EA 2VWVA 5CY3A 3UZPA 4WX9A 1U5QA 4MXOA 3UNKA 3RAHA 4LJZF 1W98A 5JKGA 2RC4A 2I0EA 3RAWA 3FM5A 4H39A 4U9AA 2OIDA 3LLTA 3NMUF 4GKHA 2EK5A 3ISPA 4DCAA 4RAZA 3O0GA 3FI8A 3NUYA 4LOQA 4DLJA 3E5AA 1WBNA 4EL9A 5T3QA 1I1SA 3IDBA 5DR9A 4JQ8A 1FP1D 4C58A 2PBIA 5HBEA 5KE0A 1XR1A 3TACA 3RZBA 5KO1A 3QTIA 4LOOA 3GQIA 4H05A 2FSMX 3RWPA 3WF5A 4YJVA 4M14A 2XKFA 2FB8A 5LWNA 4HLYA 4DF3A 3HRUA 4ZS4A 3PG3A 1JLUE 3BELA 1UWHA 1JQHA 2DWBA 2QURA 2V5QA 1NVSA 3W2RA 3EN4A 3BIZA 4DFUA 5E1SA 4JG6A 3QL8A 2GHLA 4CQEA 2X4HA 5CAOA 4J1RA 4PTEA 4CFFA 2ITTA 4RVTA 3FLYA 1CDKA 3UIXA 3ORLA 3VBYA 2GA2A 4JOAA 5CENA 4J97A 3DTCA 4FGBA 1RDQE 1SAXA 4QOXA 3QD4A 4XOZA 4FV3A 3LQ8A 4AGDA 3ERKA 4ONAA 3MFRA 3L9MA 5BYZA 4FR4A 4IBMA 3I81A 3FXRA 4KKHA 4I1ZA 3H9FA 4FGRA 2PMHA 1YIOA 5ETFA 1ZG1A 2A5YB 3KK9A 3WF9A 3QQFA 2FSOX 3F8FA 3WTTC 4AN3A 4R5SA 4NIFB 2L3DA 5IQAA 1XH4A 4WNKA 4L01A 3EWHA 1G6NA 5EQYA 3VUIA 3GU5A 2EB2A 3Q53A 4OTQA 3Q9YA 5IEVA 5K1YA 2O63A 5LVOA 2R7BA 4GVJA 5L2SA 3D7TB 5E1WA 4D2SA 3RAKA 3IWZA 5A46A 4E73A 3QU3A 2XIXA 2XROA 4O0UA 2JRTA 1GHCA 5IKWA 4JBVA 5IEXA 2Q0NA 2V22A 2BTSA 4F70A 1ZLTA 2UW5A 1BI7A 3AD5A 4O38A 5AX9A 5FRIA 1R5HA 4XV3A 2OXXA 4ON0A 2O0YA 3P7CA 3R9NA 3C18A 4HVSA 2BBYA 5E1EA 2GS7A 4JDKA 4DFXE 4XG9A 1KYWA 2QM3A 2ONLA 4FZDB 2RDPA 1JSUA 2EVAA 1ZZ2A 4EK3A 5CX9A 5E1ZB 1BKXA 3NRMA 3DBDA 4IDVA 4RJ4A 5K3YA 4JX3A 4XYFA 3GOKA 1MRVA 3R30A 3GXLA 1HW2A 3TCPA 2WV0A 2CYYA 3R71A 2A69F 3EUHA 3VQHA 4O27B 2XVCA 4JRNA 4USFA 5M4FA 2P4IA 3R7VA 3EQLF 4FIJA 3MVJA 4YZNA 3SOAA 3DAJA 4BH9A 1O7FA 4DBXA 2JZYA 4F1TA 5DT4A 5CVJA 5EDQA 4AQCA 4O0XA 5BUIA 2OO8X 4J53A 3V8LA 5L6WL 4Q48A 5HDGA 4A7CA 4PX6A 3KGAA 4IB3A 2ZVAA 2UZTA 3DOGA 2VBZA 2QOOA 2OJJA 2DPUA 2X0LA 3OOPA 3RK7A 4NTSA 5ETIA 3I71A 1XD7A 1JBPE 4P5OA 3NCZA 1V4RA 3HYIA 4OIOF 5LMKA 2F5DA 4ENYA 1K3AA 4FEUA 4N57A 5GZ9A 1BLXA 1PY5A 2UZBA 4FTKA 2R3OA 3FMJA 2XEYA 5BNJA 3QAME 5JR3A 3CPBA 1URWA 4OTHA 4B09A 5CYVA 2WELA 2XIYA 3KLNA 1DI9A 3QZHA 4A06A 5FBNC 2GA1A 3R61A 4QT1A 5EW9A 3FI2A 2C0IA 3EFKA 5EQEA 4FL1A 3F8CA 3OCGA 2RVCA 3MTLA 3U6JA 1O9UA 4DFZE 1RI7A 3OBJA 3HEGA 3PWYA 4S2ZA 1QZZA 4A6DA 3QZFA 4ZS0A 2W1GA 4RMZA 4M68A 4AX8A 3R8ZA 4FKWA 2XK3A 4EGZA 5FXSA 4A9RA 1ZAOA 3QTWA 1W7PA 5C1QB 3EMGA 3EZVA 3R6XA 2E9PA 4G31A 2BE5F 3MZHA 2QR8A 1PP7U 1UU8A 3PJ8A 4JAJA 3P0MA 2XK7A 4Y17A 1MD0A 4FZFB 3W2QA 4JNWA 3P7NA 3ERED 1GZOA 1U6GA 4BF2A 2BGCA 4E70A 4DINA 4UUVA 4RIYB 3RP9A 2QBYA 4YJRA 3EQIA 1UCRA 5LLQA 3F3ZA 2DAOA 4C4IA 1G3SA 5AWMA 4OBQA 5DT0A 1FGIA 4I41A 1ZRDA 2PPQA 1O57A 5K5RA 2PI0A 2RG6A 4EHGA 3BKBA 4A9TA 4KDPA 3ZDUA 4CXFA 3PPZA 1LB2A 1G3WA 3CLYA 3EYGA 4QMYA 2X0GA 5AEPA 2AYPA 4RFZA 4FL3A 5C9CA 4H3QA 3EN6A 3WTWC 1XGSA 3V5PA 1P4FA 3FUPA 4P7EA 4IEBA 1TQPA 4E6DA 2JAVA 5HU3A 1R78A 2EWNA 3NIZA 3JVRA 3RINA 2I0HA 4O0SA 1SVHA 4QYFA 4HVDA 2W06A 4QP2A 3MESA 4AD9A 2OZ6A 2CDZA 4QD6A 4G7ZF 2E2BA 2PMLX 3FHIA 2FU4A 4BDHA 1P14A 2FNAA 4CDGA 4LGDA 1YWVA 4I02A 2EWAA 2XM9A 5JN2A 3JR1A 1ZGAA 1TLHB 4CFMA 1YW2A 4BI2A 2YDKA 4ENKA 3CO7C 1O6LA 3PG1A 4CYJA 5H8GA 3VWAA 4N6YA 2HXLA 3WOWA 1FC3A 4OT5A 4M66A 4QYGA 4X3FC 5C8NA 4EM2A 2WC2A 3TDUC 4K6ZA 1UU3A 3CTQA 4A4OA 3BRBA 2XB7A 4CT1A 4IM3A 3RPUA 4KT5C 3FMHA 4MD8E 3FXXA 4L46A 4R8HA 4AOJA 3QTZA 2DBBA 4G8XA 1B38A 2IWIA 1J0RA 3PVBA 4EC9A 3P79A 5K5OA 5CT0A 3IKTA 4A6EA 4FIGA 3PY3A 5EI6A 5FWKK 1IRGA 2ESNA 4ESJA 4MCVA 4M9XA 1UV5A 2Y4PA 5JFWA 3UO4A 1H1QA 4MYGA 5IDPA 5D11A 2STWA 3KLOA 4ZZNA 2R3QA 2PVLA 1P92A 3FZSA 5JI6A 1FYLA 1ZH5A 4S30A 4AIJA 4U3YA 4GU9A 4IAYA 3V51A 3C4XA 1ZMUA 2WTKC 3I54A 2QOKA 1S3JA 4ANSA 2WD1A 5TT7A 4BCMA 2Z7LA 1FPQA 2Z99A 3DCVA 1LEZA 3PJ3A 3F88A 1LQ1A 3GI3A 4BWKA 5M09A 3E63A 3PFQA 2JIIA 4XBRA 3ZBXA 1P6RA 3C7QA 4OIPF 3MI9A 3P9KA 4TT7A 3PQKA 4I4FA 2R3IA 3SXYA 3E5QA 1RUNA 5J5TA 4U7DA 4Y72A 5BVWA 3FF5A 3KP6A 4D4YA 5M57A 2WTDA 3WZDA 2R3FA 2RFEA 2YM8A 4ZYDA 1G3NA 2R7FA 5E8GA 2IG7A 2W0JA 3NUNA 4J96A 5AUZA 4L6QA 5HX6A 2XBJA 4U7BA 3KXHA 4B8MA 1OL2A 4XEYA 2H9VA 3BLQA 4BKZA 3BEAA 3SXSA 3OOGA 1KV2A 2I0VA 4CV8A 3QTSA 3EQBA 5HTBA 4XG2A 1YHSA 3R63A 3VRZA 4KIPA 1R00A 2O3FA 1IAJA 4N4SA 4WUAA 4Q9SA 4O6LA 3HMNA 3C3WA 3QU6A 4YGAA 4JBPA 1GOLA 2MBFA 2MD5A 1F4KA 1U78A 1SD5A 4MQ2A 4X21A 2EJRA 2WQNA 1IN6A 2XRNA 2BZIB 2VWZA 2BKZA 3L8VA 4YLKA 4M74A 4C2VA 2ITPA 3FI3A 4QP7A 4C3PA 3EQFA 2V79A 3LXLA 1Q41A 5CLSA 3ABTA 1ZYRF 2F4JA 4IX5A 3CPCA 4I5HA 4YZMA 3NVMB 2DUVA 2M87A 3I7CA 1YTYA 3LVPA 3GQLA 2ZO4A 3BYUA 3V3VA 3ZMDA 4OTFA 3QUPA 3CDHA 4NKAA 4JAIA 3FXZA 3TDWA 5M55A 3LLAA 5KMNA 3U4WA 2OZUA 2EB3A 2XAQA 1PRYA 2MLKA 2E9NA 4YJTA 4AOTA 4A12A 1FOKA 2BRMA 3BDDA 4TWNA 1FSHA 1NW1A 1W7PB 4R1YA 2M8EA 5GJFA 2HXQA 3L9NA 2C1BA 4NKSA 1B6CB 4LL0A 3TG1A 3SOCA 2OWBA 2EXMA 4MNEA 1R36A 3HP2A 3ECHA 2C5NA 3R02A 2Y7JA 3UNJA 4DBNA 2XVDA 4AW2A 3CE3A 1NVQA 4LRKA 2XNNA 4WIHA 4RJ7A 4FODA 4FV8A 5CSVA 3QQGA 3COMA 3ZMZA 4BCHA 2XYNA 3P08A 5I3RA 5FXRA 3IRQA 3MB7A 1YW7A 2QBYB 2ETRA 2M1BA 4LMYA 3DBEA 5DUIA 2JEDA 5DRBA 2ETKA 2J2IB 2B9JA 3ZXZA 3HUGA 4IJPA 2PHKA 4EORA 3F3UA 3Q04A 4IXAA 1LNWA 1LDKB 3QCSA 1ULYA 1H0WA 4D5HA 4AFEA 4NZWB 2BAKA 2WO6A 4QTEA 3WILA 2PVFA 1BYGA 1XBAA 3U9GA 2ITUA 3PIYA 2OI4X 4ERKA 5KCVA 3OV8A 3A61A 4RC4A 4EHZA 3UDBA 3DDPA 1YS7A 5GIPE 1JE8A 5DYJA 4EOOA 5TOZA 4RT7A 2VUWA 2YERA 3O8PA 4O7WA 4NFMA 4EK5A 2IZUA 4S32A 3ZU7A 4DH5A 2WTWA 3GFEA 3FPMA 3ZMVA 3W10A 2JGZA 2YCFA 5CI6A 3MFTA 1J2XA 1Q97A 2JKKA 1CSNA 5HIBA 4I93A 3R9OA 1IEPA 4PMTA 4KN7X 4FV9A 3GFIA 2C47A 3KF7A 3T3VA 4DH8A 3TDZC 4CZUA 2QZ8A 3BYOA 5CSHA 3PYYA 2WHBA 4EH9A 2K02A 2F5EA 3HSFA 3PTGA 3UIMA 3TOBA 5LRRA 1X3UA 3VB2A 4M72A 5IQEA 1F5QA 2XK4A 3G6HA 1ND4A 1C0WA 3COIA 3KP3A 3WE3A 1M14A 4PF4A 4XSXF 4GS6A 5KMKA 2O8YA 3VHKA 2C6MA 4F6WA 3C51A 4OTPA 4W4YA 4BCQA 3DA6A 5D10A 5D4RA 3CUOA 2PLYA 3ZHPC 4CTBA 5BPYA 2WB8A 3LAUA 1D8KA 4HAMA 5DG5A 4FTRA 4CG8A 2F2UA 3FZ1A 5CSWA 2XIRA 1XGNA 4NB5A 4ZSJA 4I5CA 5HD7A 5JMSA 1IAHA 5JSMA 3FMQA 4YTHA 4ZYEA 3TZ9A 2HY0A 2IVMA 5D12A 4I24A 2VODA 3R7OA 5A4TA 1REJA 3GWZA 3VRYA 5AV1A 4RX7A 3HRFA 5DCFA 4FT5A 1DS5A 1KU9A 2P55A 4NHJA 4CV9A 3BJOA 3WTSC 4WNPA 2UXNA 3MYGA 5AA8A 4ZTNA 3W6KB 4DEDA 4HX4A 2QNJA 3LMHA 1O3TA 3NUAA 2DTRA 5LHHA 5EYDA 4P2KA 4MQVA 1OBDA 2JITA 2YU3A 2J0KA 5HBHA 4TWOA 4BWPA 4RRVA 1BUHA 4RJ3A 2C0OA 3UNZA 3DP7A 4CZZA 4YJPA 5TO8A 3DQVC 3LFEA 5ACBC 3RGFA 3K2ZA 3OW4A 4GK2A 1WVWA 3R01A 1L3RE 2BROA 4UXQA 4OW8A 4KUMA 3C4WA 1B39A 4L18B 4FMQA 3R8MA 4U97A 2ZBKA 4W4VA 3TOAA 4BDDA 2HK5A 2WQOA 4IWOA 4C33A 4UBAA 3POOA 2YZLA 2FSTX 1P4AA 2R4BA 1R7JA 4CYDA 3MIAA 5M07A 1W5TA 4QRCA 2W84A 2YEXA 1PMUA 5ICGA 1OIRA 4MTDA 1WBVA 3H92A 5CF8A 1WCCA 2PUIA 3DTWA 5EKNA 5J9YA 4EZ3A 4MHAA 1OMIA 2CKQA 2M45A 1R39A 4G2FA 5HQ0A 2XP2A 3Q3BA 2IRFG 3KC3A 3E7OA 4PDKA 4BDJA 2W1CA 1EV7A 4I0TA 4C2WA 2W9ZB 2D1VA 3CTHA 4EK8A 2X6DA 1Q5KA 3PLAE 1WBPA 5KMIA 4ALVA 2XCKA 4CT2A 5A4CA 4IIRA 4QNYA 5FG8A 4FTCA 1FINA 2WAJA 5AP4A 3U87A 4R78A 3DBFA 1HCKA 3ZC5A 1CM8A 4EJTA 3RM6A 1D5VA 5CEPA 3TNPC 2QOBA 3P23A 3QLFA 1GJOA 2JIVA 2K4JA 1RUOA 2QO9A 3QWJA 4PV0A 4YPDA 3PXKA 1B6AA 3I59A 3MWMA 3QGWA 5JFVA 5IMXA 5L3DA 5L8JA 4BFMA 4E5BA 5LGNA 3CJGA 3KN6A 2PVHA 2REIA 3D83A 3TO6A 3ULQB 3F2AA 4FX4A 2MLGA 2UZOA 3IOPA 3UOKA 3KL8A 1OL7A 5D6FA 3E5UA 2NRYA 4MNEB 1JGSA 5CXHA 3DY7A 4GG5A 1WAKA 5F9EA 3BHTA 4HVGA 1V0OA 2V55A 1XSDA 4RGUA 1U59A 4FUYA 5E17F 4GO1A 4ZMEA 2XRUA 5KBQA 2VGOA 3PA5A 2ZXJA 3LSTA 3MJ2A 4O2PA 4YFNF 3BZ6A 2ESHA 3I1AA 3C5IA 4F0FA 5LVLA 1V0BA 5JRQA 4IC7A 2F9GA 5BPDA 2VXZA 5CYIA 1T6SA 2XYUA 2WQBA 4HLXA 5JRSA 2BRBA 4EHVA 4MWIA 3GCQA 2ZCWA 2ZJ2A 3QZGA 5IUIA
chains in the Genus database with same CATH superfamily
3HV5A 5ICPA 2IJMA 4X6AJ 4J52A 2YX7A 5FJ8J 1K6OA 2F49A 1IV8A 2IJLA 2JT1A 4W8EA 5I5ZA 4BQOA 3ZFMA 4C37A 2QOLA 4BBSJ 4YZCA 2E60A 3WODF 1R0EA 3ENMA 5CS6A 3ZQ7A 4CO8A 3QXPA 3PSIA 3KKVA 3M42A 4MEDA 1W7PD 3CQWA 3FE3A 3FSKA 1ZOEA 3SZPA 2RGPA 3ABLH 4L68A 2XSDC 4ARKA 3PDTA 1VF9A 3HDDA 2V6CA 2RNJA 4UYNA 3RKWA 3ZRMA 1SAUA 5E3NA 2V1XA 2HGCA 3I0QA 4O7LA 4KBKA 1PHKA 2PVJA 5ANEA 2WKMA 1ZREA 4U45A 2VLAA 2CMPA 3MY1A 3OC1A 5GADJ 1H26A 3LFUA 4Y8DA 3KN5A 4O7VA 3DF8A 5EFQA 4B0GA 3QZIA 4E1ZA 3ZMTA 3FK6A 2IPQX 3MEXA 2G15A 1UFMA 1KU7A 2GWRA 4O0YA 1X8BA 5HE2A 3TKUA 2XUBA 2VRXA 3DB8A 1FMOE 5F08A 2A05A 4JOMA 5GJGA 2PJRB 1TVOA 2XKCA 3DXJF 4YPSA 1OUYA 3VIDA 2ZM1A 2VQCA 2ZV8A 2MGQA 4QMZA 9ANTA 2VWUA 4WG5A 2DCEA 5IG1A 1G3TA 3HMIA 1XBCA 2H94A 2XNGA 2ADUA 2IZTA 4MXYA 3CCYA 4E7LA 1E17A 1K6YA 3MKLA 5HLPA 1DI8A 3WZEA 1GVDA 4XLCA 1AWCA 2EH3A 5AADA 4E5AX 3R0TA 4N9IA 1GDTA 1H00A 4HNIA 1XKKA 1B1BA 1W82A 4CCNA 4BI0A 2BY2A 2F2CB 4ITIA 3WZKA 3SDBA 1MH4A 2FSWA 4JR3A 2Y0SN 2KJBA 1UG2A 4LLLA 3JS2A 2DOEA 2TRTA 2XKEA 3N9XA 4DGMA 3KP4A 1F1ZA 3UO6A 3THBA 4P90A 4E5WA 5AR2A 4W9XA 2EFWA 2K7LA 4PL4A 3WTUC 2CS3A 4LV8A 4G7OF 3ZGKA 3LA7A 4I92A 4ZTRA 2W1HA 1X1BA 1Q24A 1OISA 1A9UA 4I6FA 4A3DJ 3Q0UA 1KQ0A 3BPVA 2WMWA 1TFFA 3A99A 4N0BA 4YHTA 3UZRA 1F36A 3GCMA 3ULIA 3Q32A 2GFSA 4N4OB 2PMOX 5B66C 4BCNA 4M6XA 1XQZA 3BGZA 5HORA 5C4KA 2BAQA 1VQ6I 2KULA 2BZTA 3Q9XA 1BA5A 4MFDA 2XANA 4XBUA 1RETA 4DC2A 4IAAA 5DGZA 1RESA 4Z6YA 4ZYHA 1WBOA 3C5UA 3O8UA 2OZOA 2HDCA 3H3ZA 2HPMA 3VN9A 1H1WA 1W7HA 2Y30A 4M3GA 3RPUD 4ASZA 2ID6A 3BZKA 3S16J 2M0MA 3F5XA 5A4EA 3PJRA 2C6DA 2CUFA 2QODA 5CAPA 2NXNB 2R7SA 1Z05A 5B0XA 2FSLX 2WTVA 4YURA 3LCKA 5I9ZA 2P6SA 4CG9A 3DLZA 3HAMA 2GNLA 4XLVA 2IW6A 2XIZA 2XNOA 2ZFWA 4Y15A 4UUSB 2E9VA 4ZC3A 3HEFA 4FV5A 2QVOA 2XB0X 6PAXA 3CSVA 2QUFA 3BLAA 3WZUA 2GXGA 3VFZA 5JGBA 5J8CA 5EW3A 2QQ7A 3KVXA 5AM6A 3JUHA 2BZJA 5FKLA 3RQ4A 2EFQA 1MNMC 4KB8A 2HVRA 3CJTB 2D45A 3DV3A 3OXIA 3FKLA 1Q4LA 2VU3A 3JR9A 1ETVA 1PKGA 5FFXA 5J40A 4L9JA 3ZPLA 1RW8A 2VO6A 1KQ8A 2GQRA 5E7RA 3FZPA 3W2WA 2ZDTA 2L9NA 3OY9A 4RWLA 5T68A 3B6CA 3GCSA 4ZJIA 4NYEA 3V8SA 3K4LA 4LRJA 2C6OA 5K5QA 3L8XA 4IZ5A 2P5LC 2HKXA 2VJ4A 2OU2A 2GXAA 5BQTA 4QTRA 3KRWA 2ELKA 4RBLA 4Q47A 2OG8A 1ZGWA 4C59A 1ZHFA 2H8HA 5E8TA 3I59B 4ZTFA 2DJNA 5EOLA 2ZDUA 3PZEA 1ZTRA 3HOYJ 1JKPC 2QWWA 4NC6A 4KIQA 3UNGC 1YOJA 2JDSA 4DYMA 3DEEA 2I40A 1RZ4A 2KIMA 3ZUVA 2GNGA 4UXNA 4WG4A 5AV3A 2PZ5A 2J51A 2EFOA 2C4GA 1MNEA 4HDVA 4X3JA 3F8MA 4RG0A 4U6RA 3H9OA 4BRXA 2IVVA 3IW7A 2ZFYA 2Z8CA 4KKGA 1YOVB 4PTCA 3GU6A 1OCRH 1GZKA 5EOBA 3DXNA 2NOJB 4W97A 2ERKA 5C03A 1VQKI 4X2NA 1IN5A 3QYFA 2VC0A 2OZAA 3V01A 2PZIA 1IW7F 5GPAA 4EKKA 2JBPA 4BQNA 4JDIA 4L44A 5ANGA 4RFYA 3DXPA 2BR1A 3KZIC 1ZWSA 2JFLA 5EK7A 2Z1DA 3PO2J 2DS1A 4LIVA 1RKWA 2HY81 3BR3A 1XH6A 3A7HA 4IMYA 4CCKA 3EN5A 4NSTA 3Q0VA 2XAMA 3QQAA 3QPHA 4FVRA 3G1MA 4OGRA 4QPAA 1GXPA 2DMPA 5C4JJ 1OQYA 5J7BA 3EUKL 1X3ZB 3ZONA 4HNVA 1T0FA 3LAPA 3G4SI 3C9WA 3DAEA 4RB3C 3PNTA 4A0ZA 3N97A 1OZ1A 3SZTA 3C0GA 3ZEPA 3NWTA 3R0JA 3AKKA 3K4JA 5E3MA 3D94A 3TT0A 4CZTA 4AW0A 3QTRA 1TBXA 2IVSA 2XGCA 2EUFB 3W18A 2G7HA 2VO3A 4XX9A 2YISA 3QYEA 5KMLA 5D7VA 2XPWA 3F6OA 1YS6A 5HLGA 3ZH8A 1IDZA 2FE3A 2ZM3A 4KINA 5AUYA 3RK5A 3BWGA 5AR7A 5HNFA 4BGHA 4ZH4F 3OYMA 3DCFA 4BL0B 1BI2A 4C4FA 3KETA 1IJWC 4FKUA 3G90X 3POZA 1JKSA 4CCBA 5J7HA 5G6VA 3W0NA 5LHIA 4AOIA 5CVGA 5KBRA 1BR4A 2D5VA 2PZPA 5KHXA 3DU6A 3TTJA 1SD7A 3ALNA 1YI2I 3N4VA 5DIAA 4KNBA 3RPVA 4HVHA 3K2LA 3W2SA 3EFJA 5JVGF 3R8UA 4EJNA 3FX3A 1OYWA 2ZMEC 4YJSA 3CJRB 2LNBA 1LKXA 3L2UA 2QKRA 5I4NA 3ESWB 5FEQA 3HX4A 1WBTA 5KX8A 3ZXSA 3IDPA 5EG3A 2MH2A 5F94A 2NRAC 3GENA 3M8EA 1FP2A 4ZDLA 1X58A 5IZFA 3UKGA 3COHA 4PPCA 4C9YA 3S15J 5A6OA 1WKMA 2PVRA 3TNWA 3FLNC 2UUZA 1FX7A 4FEVA 1BC8C 3KB7A 4AXCA 3VONA 4BDYA 4IDTA 4A3BJ 4YR8A 1VZOA 2EA4A 3JAMK 4IWDA 3ODZX 4J99A 2XK8A 2X81A 2VONA 2CRGA 3GCPA 2VWBA 1ENHA 2VJJA 4AXAA 4L9TA 5E92A 4M67A 1WZYA 4FKPA 5IY5H 2LD5A 2YIXA 1A5JA 2GZWA 5HG7A 1XDUA 3FQHA 3PIXA 4EOIA 2UW4A 3EFWA 2EU9A 1F9NA 5KNJA 3LE6A 2QU6A 3TYKA 4YRVA 3SXRA 4BY7J 4DHFA 1P7JA 4ANJA 4NDLA 3W0MA 2QOQA 5HE0A 2BZHB 4UB7A 4L5EA 3DPLC 3ELKA 1XMKA 4CFVA 4LD5A 4IXPA 2R93J 4IC8A 2JSPA 4XRMA 3D5VA 1HKQA 5DUKA 3EL8A 3CD6I 2DT6A 2UXXA 2ELHA 4FIFA 4F4PA 3FMDA 2B0LA 3H9RA 5IUIA 2WOTA 4QMVA 3IQ7A 3KP2A 3UOLA 4BE0A 3NUSA 3I53A 2QI8A 2PVKA 4E26A 4A9UA 2J0IA 2L7ZA 4MHGA 4IWPA 1USSA 1HKTA 4E4HA 4M12A 4DNCA 4X6QC 2X9EA 2O7OA 3MPMA 3I9V2 1S6LA 3VC4A 4HQMA 2VTLA 4UHTA 2R2PA 3CXWA 5DM6F 3MY5A 4WG3A 4FTHA 3SG8A 4GIIA 1W1WE 5AAEA 3ZCOA 3AXWA 3PFYA 3L2CA 5CXZA 1XSXA 1JVPP 3GX4X 1YQJA 4KA3A 4D1ZA 5M3MJ 5H6QA 3UVRA 2CLXA 4AT3A 2IVUA 4K9YA 5D5WB 4D1QA 4D4RA 2GFCA 3CP8A 4DZJA 3TUDA 1R5ID 4RC2A 4MXZA 4J71A 3I7BA 3L2VA 2P3GX 1VJYA 3FLZA 3FL4A 1JJ6C 5KMJA 4RM3A 3VO3A 1IC8A 5DFPA 2COBA 5LEJA 3R7IA</