3FL4A

P38 kinase crystal structure in complex with ro5634
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 108
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fl4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fl4A01
3L8PA 3F3ZA 2XIZA 3NNUA 2J0MB 5CF6A 3OWKA 3GEQA 5B2MA 3SRVA 3RAIA 4TXCA 4CXAA 4NM0A 4QPAA 2HY0A 4RQVA 3QRTA 4X3FB 4DLJA 2PVNA 5J95A 5B7VA 3IW7A 2E9UA 4O91A 3ETAA 2CN8A 3KN5A 3NDMA 2REIA 1YXSA 2ITWA 3NW5A 4FKOA 4R3RA 5AR3A 4EWHA 2W4OA 4CFUA 3RMFA 5K5XA 3QCQA 5KBRA 1YDSE 3LFFA 5A14A 4CQGA 4P2KA 3DXQA 3AQVA 4IM3A 4X21A 4IWQA 4CKRA 4FEQA 3PVBA 4FC0A 4ANBA 5IEVA 1H28A 5E4HA 3R21A 4V0GB 2IG7A 4J98A 5EHYA 4YTFA 4W9WA 2C6MA 2F7ZE 3QA0A 3TV7A 3U8WA 3E62A 3A7FA 5HTCA 2PYWA 2B9HA 3LFDA 4U41A 5HGIA 4AW2A 4JXFA 3FMKA 4BCPA 4AZEA 3VS6A 1OITA 2RG5A 4OBPA 3BHTA 3DV3A 4R8QA 2VWWA 3HEGA 3DPKA 3TT0A 1M2RA 2Z7RA 3FMEA 3D5VA 4PMTA 4UY9A 3TNWA 3BWJA 3VS7A 5CVHA 5TR6A 4F9CA 2R3FA 3GCPA 4Y5HA 4D1ZA 5B2KA 4IE9A 2OK1A 3ANRA 3GC7A 2R2PA 1H01A 4KIOA 5DGZA 2XM8A 2EWAA 3AC2A 3DY7A 5LARA 2R7IA 4HYUA 3P86A 4QQ5A 3LFEA 2WMSA 2RF9A 4H05A 4EOLA 4CKJA 2XK8A 3L8VA 4CLIA 4HVIA 5HCYA 4XEYA 5EFQA 1KOBA 3PZEA 2B9FA 4QMNA 3HNGA 2AC5A 3EYHA 2CKQA 5C8KA 2ONLA 3AXWA 3MA6A 5DRDA 3V5PA 5HLWA 4FTUA 4QMTA 1CM8A 5J9LA 2C0IA 3DGKA 2VO0A 4JJRA 3SLSA 4TWPA 3PXZA 2HWOA 3W2QA 3TM0A 4LOPA 4Y85A 3UO4A 4BDGA 4RC4A 2IZRA 2JAMA 3OWPA 3SC1A 1YRPA 3P1AA 5DG5A 5E8YA 5K0XA 4R3CA 3BWFA 3WE4A 4V04A 5IQDA 4C02A 1X8BA 5M07A 4YU2A 4J8MA 5KMLA 3FYKX 2IVSA 1WVYA 4XG6A 4JIAA 4EK8A 5FBNC 1LPUA 2G1TA 3AC1A 3ALNA 4HCUA 4G17A 2WEVA 4DYMA 3FMMA 2UZDA 3ZXZA 2UZUE 3P78A 4QYFA 3ATTA 2WMBA 2X7GA 5AAFA 4NCTC 1OIYA 5JSMA 2PPQA 5EK7A 3R7GA 4HNFA 2GFSA 2WTDA 2CGVA 4QP8A 3Q9XA 1XH7A 5E8TA 1O9UA 1OL2A 3DFCB 3F3UA 1J1CA 2BKZA 4LRJA 3F82A 4YO6A 5E92A 4HVHA 4HNIA 5L8LA 1JKTA 1MQ4A 2R5TA 1O6LA 2B52A 4FNZA 3WYYA 4CMUA 5I0BA 3HRFA 3UOKA 1YI3A 4PL4A 4BWKA 5LMKA 2EB3A 3VUMA 2C1BA 2V62A 3OCGA 3BU3A 3EMGA 2WQEA 4FIHA 4IWPA 3KY2A 4QNYA 3ZU7A 3FQSA 4UMUA 4NYEA 2UVYA 2WMUA 4TRLA 5M08A 4WUNA 2FB8A 4KBAA 3F5PA 3WZUA 4C4EA 4BYIA 3CY2A 5FXQA 1XKKA 5LWMA 4IH8A 1VR2A 2ITUA 4EJ7A 4U0IA 3LQ5A 2UZWE 2CLQA 2PMNX 4UMQA 3JY0A 5H8BA 5I5ZA 5HIDA 4JVGA 2YLEA 2RG6A 2W4JA 4IAFA 2W06A 3S00A 3MPMA 3NYNA 3IW8A 4FSZA 4Z9LA 5I4NA 5AM7A 4IB5A 2QOCA 2WMTA 3NS9A 3NYXA 2R3GA 1Q8UA 4MD9E 4HVGA 2X9EA 3OUNB 2JITA 1YXTA 4DT8A 4BDKA 5BUIA 3A62A 4RIYB 2F7XE 3WZEA 1A06A 2J0IA 3GQIA 4FSTA 4KRDA 3PE2A 4AQCA 3R9RA 4C38A 4CLJA 2PMIA 3UIUA 2VD5A 1KSWA 3H3CA 1B38A 2IO6A 4N6YA 2OW3A 2OZAA 2ZM4A 2PUUA 4LGHA 5M55A 4DC2A 4IADA 3D4QA 2HZIA 5HTBA 2G9XA 3LMGA 3W33A 1H1SA 5DI1A 3M2WA 4JAIA 2BAJA 3PVUA 1SZMA 2KULA 1TQMA 4FVPA 4IXPA 3PY0A 1O6YA 3W2SA 5LJJA 3N4UA 3A7IA 3FI3A 3O8UA 4ITJA 3Q9ZA 2Q0NA 5J87A 3DNDA 4XV2A 5A4TA 2V55A 3SRVB 3LLAA 2W17A 3BV2A 4FV7A 4LRMA 4X6RA 2PZPA 4EBVA 4R7IA 3H30A 2WMXA 3HZTA 1R0EA 5DBXA 2NO3A 2C6DA 3QCXA 1YVJA 4PTGA 1KUTA 3KULA 4HGSA 2HZNA 5K3YA 3OY1A 3VBVA 3ERKA 4CRSA 1BX6A 2C30A 4D0WA 4EH9A 3ORZA 4EHZA 5JRQA 1O6KA 3QHWA 3BEAA 3ET7A 3SA0A 4O0SA 5CSWA 4FT0A 3AT2A 5EI8A 1ZYCA 2W4KA 4GH2A 2FA2A 3FWQA 5FEDA 3UYTA 4B99A 3H9FA 4I4FA 4BTKA 3UG1A 3R8ZA 2I0YA 5HQ0A 4ZMFA 3H10A 3OCTA 1XH4A 3KK9A 4W4WA 3KK8A 1M17A 5EG3A 3E7VA 4JNWA 3DXPA 3ZC5A 2PMLX 3BLQA 4YBJA 1OPJA 2Y4PA 3FV8A 4PRJA 3RKBA 3HV5A 3IGGA 3ID6C 2W5HA 4QP6A 2WGJA 3F9NA 4F6SA 4QMVA 5KO1A 3VUHA 3IECA 4GU6A 3OD6X 2QOKA 3GFEA 4WBBB 5GINE 3QX4A 3LFSA 5KMKA 4PTEA 1OL6A 2YLFA 3BZ3A 3MPTA 1YWRA 5DPVA 2ERZE 5AP4A 5KCVA 3MESA 4RZWA 1PHKA 3QRJA 1KOAA 4AW5A 1B39A 3NNWA 2X7FA 1WVWA 4YZNA 4ZTSA 2ZVAA 3LHJA 5GIPE 4EKLA 3OFMA 4FICA 4BZOA 2OIBA 5FUTA 4FNYA 2VWZA 3BEGA 2W1CA 3HRBA 4FTLA 1Q3WA 1Q8YA 3R1YA 4EHVA 4RWIA 3BYSA 2ZYBA 4WKQA 1NVQA 4JBVA 4DH8A 4FTJA 4JQ8A 1PY5A 3M42A 4XG7A 3K2LA 1MRVA 2LGCA 3N51A 4R1VA 4TYIA 5AIRA 4IZ5A 4U3ZA 3RPYA 4QMOA 2YWVA 3GU8A 3L9NA 4ARKA 5AUYA 4BTFA 3ZLYA 3EFJA 4IAIA 2QOHA 3RK5A 4FTQA 1Q8WA 3MH2A 1ATPE 3DBDA 4Y8DA 5DT4A 3WARA 3T3UA 2YWPA 3AMBA 4DEGA 4R78A 2C6LA 5GIOE 1S9IA 4XG3A 3FC2A 1H1RA 2JKQA 3LM0A 3OXIA 1J91A 4WG4A 4M14A 4GVJA 4M3QA 4C35A 3MFTA 4IAKA 3RNYA 3LKMA 3WBLA 4UXQA 4EL9A 2ITXA 3LFBA 2HYYA 4XLIA 4YZMA 1HOWA 2PVLA 2WOTA 3MB6A 2GMXA 4KAOA 2UVZA 4H1MA 4B4LA 3PJ1A 2R3QA 4WNOA 3DKGA 2ETKA 2VWXA 4O7NA 2ESMA 3GB2A 3GBZA 3Q60A 4MXZA 5DIAA 3FQHA 2GNIA 2P2HA 2YFXA 3I6UA 3MW1A 3DDPA 2X39A 1IASA 3TCPA 1DI8A 4AAAA 4B8LA 2C68A 5JT2A 4ACHA 4XP0A 3DA6A 4D2RA 3NX8A 2XF0A 2BROA 3QTQA 5D10A 3QUPA 5AUTA 3R2BA 3JVRA 2CMWA 2OLCA 2CHLA 5CANA 3ZYAA 2I0EA 3D94A 2C6KA 4L8MA 5BYZA 1WMKA 3U55A 1OUKA 3TDWA 4FG7A 2XK9A 4I0RA 1W98A 5CVFA 4DN5A 4M0ZA 4FIIA 2G2IA 2UW0A 3R7VA 2VTQA 3BHHA 1Y91A 3ZUVA 4DAWA 3PIXA 4ZSEA 3D2KA 4CNHA 3DBCA 3FXXA 1OIRA 4BF2A 1OL7A 5IQCA 2OF4A 3R7UA 3P4KA 3A8XA 1UKIA 1Y8GA 4C4HA 1BUHA 2ZMCA 5I9WA 1JKSA 5BUJA 3IK3A 4ALUA 1PMUA 5HHWA 5E1SA 4W9XA 2OZAB 3NRMA 5CNOA 3OTUA 5BMMA 3SAYA 4OTWA 5M44A 4FV8A 4IVDA 5M4CA 2ZM1A 3FMHA 1SVEA 3LCKA 4AA4A 2XCHA 3PSCA 4H1JA 3ZONA 2JEDA 1CSNA 1FOTA 4FV3A 2YIXA 2XIYA 2JDSA 1ZRZA 2BMCA 4KABA 4YR8A 2PL0A 5FXRA 4L9IA 5IQAA 4NM7A 1V0PA 4AT3A 1J7IA 4I5MA 3RINA 3VRZA 5LMBA 2GNGA 3LFCA 3PUPA 4O2PA 2ITOA 3H9OA 1QMZA 2BHHA 4NTSA 2YM8A 3KULB 3VS4A 5ICPA 5L2WA 3IO7A 3QFVA 3QTUA 5CSPA 3QLGA 4AOIA 2I0HA 5AUXA 4YZCA 3A60A 4O7SA 4F9AA 3Q9YA 3GUBA 4QNAA 5HICA 3O0GA 2WPAA 4RZVA 2WAJA 4FKWA 5L6WL 4LRKA 4CV8A 4RX9A 2XBJA 3JPVA 3VBQA 2OH4A 4EONA 1WBTA 4GL9A 4QYHA 2JDOA 3RAHA 3ORPA 5G1XA 4G3FA 5G6VA 4D4RA 4EORA 3MY1A 5HG7A 4FTTA 3KVWA 3PPZA 3DKCA 2IZUA 3TN8A 2I7QA 3UP7A 3IDPA 3EN5A 4S33A 4RA4A 2CNQA 3ZHPC 1OB3A 2C6EA 4WO5A 4KRCA 4YNEA 3PIZA 5A4LA 4W8DA 5I9XA 2C3IB 4NJ3A 3C5IA 5CEMA 1FVRA 1U5QA 4LV8A 3QTZA 2W96B 4JOAA 4CMOA 2R3OA 3C50A 4LGDA 4D1SA 1BLXA 5DYJA 2VTNA 2I0VA 4I6FA 4S34A 4R77A 3B8QA 3F6XA 1OPLA 4LL5A 2UW7A 4FTCA 4EOSA 2JBPA 3CQEA 4OBOA 1REJA 1STCE 4HYHA 3ZTXA 4AFJA 2UW8A 4QTBA 5AP2A 4I6HA 3RPSA 3QRKA 2XIRA 2QOBA 4ALVA 3LJ0A 3ZUTA 3SOAA 4LGGA 2WZJA 4G6OA 5I9YA 3NNXA 3MA3A 2RFNA 3SGCA 2YISA 3UIMA 2O64A 5HE1A 1I09A 4JS8A 4YTCA 1ZMUA 4TNBA 4DEDA 2E9PA 3R1NA 2PMOX 4O81A 4UZHA 4I3ZA 5CT0A 4IEBA 3G5DA 3VW8A 3W8LA 2HK5A 3C4CA 5ACBC 1TQPA 4JBPA 5LXMA 2W1ZA 3CQWA 1G5SA 4FKQA 4QMMA 4G16A 4QMSA 4CQEA 2JIUA 3BCEA 4DH3A 4GS6A 3C0GA 4N0SA 5F1ZA 3O23A 2E2BA 4QMWA 3Q53A 4YJVA 4MQ2A 4BHZA 3RNIA 4V05A 2ETMA 1FQ1B 4Y72A 1GNGA 3AMAA 2OICA 4AZFA 1P4OA 2GPHA 2UZBA 3GGFA 3R9NA 2WU6A 4ERKA 3SG8A 2ZJWA 1WCCA 4EI4A 2QOFA 4GYIA 4RFMA 3VF8A 3QYWA 1JAMA 5DMZA 4F9BA 2YDJA 1SNUA 4NCTA 4FT3A 3KVXA 5KHWA 3ZSGA 4G2FA 2IPXA 2OJ9A 2Q83A 3RM6A 3P0MA 5CWZA 3UZRA 3EZVA 3O2MA 4HPTE 5HU3A 3I4BA 5ETCA 5FP5A 4TY1A 4ZLYA 3C13A 3RTPA 3MJ2A 3A99A 4DITA 2P3GX 2XK3A 4Q5HA 5BVFA 3RHXA 4XV1A 3LXLA 2QOIA 4NT4A 4UV0A 3LCDA 5AA8A 4AFEA 4KS8A 4RJ5A 2YDIA 3CD8A 4ZLOA 3DCVA 3GC9A 5EHLA 3V5TA 1L3RE 4BGHA 1IR3A 2PULA 2R64A 4YNOA 3M11A 3QUDA 1NT2A 2C5XA 3Q32A 5F9EA 3VIDA 2GTNA 4FEVA 4L3PA 2JGZA 3TUCA 3EFKA 4CFFA 5K4IA 5KX8A 5EI2A 5ANKA 4B7TA 3II5A 3GCSA 3Q52A 2QC6A 4YC6A 5HESA 2AUHA 3PWDA 4QMPA 4CYJA 2YM7A 3QQFA 3LCTA 5AUWA 1J7UA 3UJGA 3WILA 3P7AA 3HP2A 1F3MC 3EN9A 5FM2A 3ZS5A 4GW8A 2UW3A 4ONAA 1ZY5A 5C8NA 4Y73A 5FTOA 1H08A 4G9CA 3BV3A 2O5KA 2OF2A 4YBKA 3IG7A 4YGAA 3CE3A 1PYEA 4FNXA 3WF7A 4II5A 2CKOA 2X6EA 3NIEA 4U97A 3FHRA 5EOBA 3GCUA 3L8SA 3E3BX 5F20A 1YXXA 2R3MA 3BYUA 3GOKA 3LFQA 4KB8A 4QMZA 5BQ0A 5FBOA 3TWJA 2X7OA 3PXRA 2YCQA 4JQEA 3ODYX 4OW8A 4OTGA 4CMTA 3BI6A 1DS5A 4M0YA 2OU7A 1Q99A 2Z7QA 5L8KA 3HYHA 1SMHA 4S2ZA 3FMNA 3VBTA 1OECA 2PUIA 1FMOE 3LJ2A 3R2YA 4QRCA 5KKRB 1WBNA 3PDTA 3OW4A 2XB7A 3MFUA 3D5XA 4W8EA 5FLFA 5EM5A 4G3EA 3BU5A 4JIKA 4ANMA 3ORIA 2EUFB 4BVUA 2XCKA 3TACA 2R7BA 1M7NA 4UWCA 1OUYA 1V1KA 3COHA 4I6BA 3B2WA 3RAWA 5E9EA 3FZPA 4FX3A 1GZOA 3QC9A 4ZZOA 2CDZA 3FLSA 5L8JA 3T3VA 2VO6A 4BCNA 2WEIA 1UU9A 4IDTA 3CS9A 2VTAA 4IW0A 3TV6A 4FZ7A 3VF9A 5IUIA 3QZGA 3MBLA 1XBBA 5DOSA 3WF6A 4F9YA 3F66A 1GIJA 3D15A 4PL5A 3IOKA 3EN6A 3C4EA 2R4BA 5BPYA 5HO6A 5JQ5A 3SOCA 5EW8A 4UXLA 3QD4A 2O0UA 4IQ6A 2Y6MA 4CD0A 5CLPA 3JXWA 4YHFA 1KE6A 4V01A 2J4ZA 3FPMA 3E5AA 4U43A 3SXRA 3V01A 2H9VA 3PLSA 3QQJA 5AV1A 3UC4A 4BYJA 5A4EA 4DFXE 2RKUA 2WTVA 4BWXA 4DE4A 3AD4A 5CAPA 4LFIA 4DT9A 4QTAA 4BIBA 4O7WA 4IIRA 3SKCA 3MPAA 5BUEA 2OIQA 4I20A 4F1TA 4IZYA 5CZHA 4OT6A 4U45A 3WZJA 5H8GA 3GNIB 1ZYSA 3BLRA 5TE0A 2HZ0A 4JR3A 4DGNA 3BLHA 5AUZA 4U44A 4AOTA 3GC8A 3KXXA 3FI4A 5I3OA 5A54A 4QMYA 3HMIA 3RWPA 3KMUA 3VUTA 2F7EE 5M4IA 2OJFE 2A0CX 3HMOA 3UODA 2PVMA 2EXMA 3K5UA 4FVRA 4DTBA 1P2AA 2QU6A 4QO9A 2JKOA 3RBWA 2CKPA 4A9YA 3CJGA 5LVLA 2JKMA 1YOJA 5HTIA 3KU2A 4A7CA 4DF3A 3ENMA 2WQOA 2VN9A 3GT8A 4MCVA 4C37A 4TWCA 5CF4A 3A2CA 2Y4IC 3U9CA 4AZSA 4XJ0A 2XJ0A 4QTEA 1IEPA 2J6MA 3E92A 1NA7A 1MRYA 4FG8A 4JBOA 5CNNA 4L01A 3PA3A 3U6HA 3C5UA 4F0FA 2VTPA 1OBDA 4AZVA 4BKZA 4JDJA 5HBJA 4FV1A 2P4IA 4BCQA 3FI2A 3PSBA 4CFNA 2XEZA 2G2FA 4AZWA 5AP5A 3FLQA 4AW0A 2HOGA 4F1MA 3O50A 3I7BA 4USFA 2JBOA 5CX9A 2IN6A 3QKMA 4HW7A 2Y6OA 4C7TA 4A4XA 4IX5A 5CS6A 4DGOA 2PZ5A 2OGVA 2PZYA 4MXYA 2FSMX 1MRUA 5CU4A 5T3QA 5GJDA 4RX5A 5KKRC 3EQPA 4E7WA 4NM5A 4PMSA 4EH6A 4JG8A 3KF7A 3KXGA 4UWBA 3TZMA 2V5QA 5TO8A 3TKIA 2QOQA 3S95A 4WG5A 4YJRA 1S9JA 2W5BA 2WQMA 5EM6A 3FUPA 4BCIA 2QD9A 3E93A 3QRUA 1WBVA 5EYKA 1JPAA 3DK3A 2FUMA 3BGZA 4KIPA 3G15A 4PY1A 5HX6A 4PDYA 2R3PA 3EN4A 4JRVA 2C6IA 3L9LA 2C5OA 4MKCA 4I0TA 5IA3A 4YJTA 3KB7A 2BRGA 3ITZA 3CTJA 3NUPA 5F95A 3R7IA 4D4VA 3TIZA 3ZFYA 3CXWA 3Q4UA 3VBXA 4GYGA 4YPSA 5FP6A 4YZDA 4JRNA 2F49A 4Z3VA 2ZV7A 3C0IA 4DEBA 3VS5A 3HAMA 1JOWB 4OUCA 2WB8A 3HMMA 5FM3A 2VX0A 5CAUA 4QT1A 3C4ZA 5GZ8A 5KNJA 4F9WA 2ZOQA 3W55A 4CSVA 1WFCA 1UU3A 3BHVA 1GZ8A 2JIVA 4FV4A 5JGAA 4G6NA 5CEKA 2NNWB 1UU8A 3F69A 5LVMA 3CP9A 4WA9A 2WTKC 3DK6A 3KEXA 3R04A 4BDJA 4BZDA 4PP7A 5IA0A 2PU8A 4YUQA 2ETRA 5GZ9A 3CCNA 4AT5A 5J7HA 5BNJA 5L2TA 3NPCA 3REPA 3C9WA 4MVFA 2B7AA 2R3KA 3PPKA 4U5JA 4ZAUA 4BGQA 4DG3E 3GVUA 1ZARA 4FKIA 4JLCA 4XX9A 4C3PA 4JT3A 5IMEA 4GFGA 2QKWB 4K1BA 5JFVA 4AF3A 2GS7A 3GOPA 4Z7HA 5IDNA 4D2PA 2DS1A 1YHVA 1R1WA 4FMQA 4HYIA 4YLKA 5AR2A 5HVYA 4C59A 2VWUA 1NY3A 1PKDA 2WU7A 1W0XC 5JFXA 4I4EA 2HW6A 4HJOA 4QP1A 1J7LA 4RX7A 5T6KA 2Z7SA 3HV7A 3ZUUA 2J0JA 2KTYA 5C1QB 1UNLA 1GJOA 5HVJA 1JVPP 1CKIA 2YABA 4OLIA 5JFWA 1OVEA 4CCBA 5CU2A 2FSTX 3MVLA 4QP7A 2OO8X 3AC5A 1V0OA 4M67A 1NVSA 4NEUA 5CQWA 5AX3A 4PNKA 3PVWA 2GCDA 1REKA 3UQCA 3PPJA 4O86A 3GCQA 3PIYA 3LE6A 4O0RA 5IUGA 4FTMA 4B8MA 4EQUA 3FEGA 3ROYA 4IX3A 4BZNA 5JMSA 2ERKA 5HO8A 2FYSA 3SD0A 2GHLA 4O7VA 4GFMA 3S4QA 3SX9A 3W2CA 1ZYLA 4Y83A 3ZO1A 3G6HA 3C51A 3HV6A 5L4QA 2C5YA 4E6DA 3EKKA 4QQTA 4I1ZA 2PE2A 3OP5A 3Q4ZA 3BX5A 3I5ZA 2GFCA 4TYHA 3TKHA 3VS2A 4XBUA 1V0BA 2GHMA 2W1GA 4FT9A 3R7OA 1PXOA 4ANQA 3ORKA 4EUTA 3GU5A 3EQDA 4L7FA 4RC3A 3OT3A 1H1WA 4D9UA 4GIIA 3KN6A 2XRWA 4G34A 5BX0A 2ZV2A 2W1DA 5CI7A 4GEOA 3UVPA 3VRYA 4IZAA 2ZB1A 1URCA 3Q5ZA 2RGPA 3FLWA 1LEZA 4RPVA 4D28A 3ULZA 3RM7A 5EDRA 5AAGA 2BZHB 4NM3A 2BILB 1KE7A 2BRMA 4ZTLA 5HBHA 3BPRA 4FEUA 4IC8A 3TTJA 4B6LA 4ENXA 5HORA 5JH6A 3R30A 3DJ5A 5KMMA 3TV4A 4KS7A 5M4FA 4P4CA 4C2VA 1JNKA 2ITNA 4KWPA 4RVLA 3K54A 2BRHA 1J3HA 4YPDA 3R02A 4O0TA 3UDBA 4RQKA 5IG1A 5BVDA 3VUKA 4BTMA 2XNOA 2QNJA 4CG8A 3FLZA 3SDJA 2QG5A 1L8TA 2UW4A 3VC4A 3R7YA 3VQHA 5I9VA 4R5SA 2YCSA 5KMOA 5IF1A 5IH5A 5CSHA 2F9GA 4ENYA 3QXOA 5HCXA 5AWMA 2O8YA 3BBTB 4L3JA 2PZRA 2F4JA 1OKVA 3EH9A 2IW6A 2XNEA 2OZOA 3FKLA 2WHBA 3ROCA 2JDRA 3NW6A 3FZRA 1B6CB 1H27A 2VWYA 3ENHA 5FGKA 5HBEA 2XNNA 3DBQA 5DE2A 2WTCA 5IEYA 4E26A 2RSVA 4UYAA 3QU0A 4W4XA 4XCUA 5BVOA 4GU9A 3ALOA 5AP1A 3NUSA 5JN2A 1KE8A 3QTSA 4YTIA 4IWOA 2OKRA 4Z55A 4Y95A 4XOZA 3TNQB 2HIWA 3NLBA 3NVKI 3EL8A 1XH9A 3G6GA 4PWNA 3VHKA 4RSSA 5JZJA 2UV2A 3U9NA 4ACMA 1KV2A 3UC3A 4ZLZA 3D2IA 2YM4A 2EU9A 3UG2A 4O82A 4CFWA 5BVNA 3RI1A 1H0WA 1Y8YA 5BYLA 2BTSA 3W18A 3W2RA 3AT3A 4FE2A 3MTFA 4EOIA 5D11A 4F0GA 5K9IA 4X0MA 3RCDA 3OROA 3QQHA 2B54A 3CR0A 4O2ZA 3RJCA 3I0OA 3H0ZA 1W8CA 3CKWA 3D7TA 2O2UA 3FZSA 2NP8A 3MY0A 1U54A 3CSVA 1F0QA 3ODZX 2VRXA 1PRYA 5IU2A 4TYJA 2O3PA 4U40A 3R22A 2WQNA 3QTXA 2CLXA 4MD8E 5FEEA 5TT7A 3IGOA 2QHNA 2OFVA 4YJPA 4NW5A 4BC6A 4E5BA 4F0IA 5B2LA 1OKYA 3ZFXA 5AR4A 3SXSA 4ZEGA 1JKLA 3EIDA 4FNWA 1P5EA 4MQ1A 2R0IA 4ANOA 4FODA 5AMNA 5J8IA 4FIEA 4FTNA 3KGAA 3KCFA 3OY3A 3FY0A 4ALWA 3DLSA 4RGJA 3JYAA 2R3NA 2BKKA 2X2MA 1JBPE 2VUWA 2JLDA 2FSLX 3ACKA 4QYGA 4XOYA 1XBCA 4BKYA 3MFSA 4UMPA 4QMQA 4KUJA 2WQBA 3LLTA 4BDDA 2G01A 4KA3A 4ZJJA 4C36A 3OCBA 2WFYA 3QQUA 2VNYA 3QYZA 3R28A 4H3PA 4LQMA 4N4SA 4HCTA 5J9ZA 5IH6A 1OM1A 3PP1A 4HCVA 4YLJA 4PDPA 2BIYA 2NRYA 3IS5A 1JLUE 2XNGA 5DR2A 1E1VA 4O7YA 2CCHA 5CEPA 1K9AA 3RK9A 1RW8A 2PVHA 4C57A 3QZHA 1VYWA 2QR7A 2WIPA 3HDMA 3PE1A 3EQHA 3PG3A 4EK4A 5JQ8A 4YZ9A 3TDVA 5JZNA 4AXAA 2BUJA 1BMKA 3LVPA 4BCOA 4F65A 2Y7JA 2XP2A 4FT5A 2J5FA 4XG9A 4F1OA 4K9YA 4O0UA 2C69A 4IB0A 1SVHA 2YACA 1YWNA 3P79A 5DA3A 3UZPA 2F2CB 1FMKA 2JFMA 4I41A 4ZSAA 2GU8A 3Q6WA 3DKFA 3Q04A 1GZNA 4UMTA 4ZSGA 5FTQA 2UZVA 2YDKA 4ANLA 2A1AB 4XP2A 4TYGA 3D83A 4X2JA 1UU7A 3CGOA 4TYHB 4HOKA 4E3CA 1FGIA 2ZB0A 3SV0A 2X81A 2IVUA 1ZZLA 2OFUA 4OTDA 3DB8A 3TZ7A 3W2OA 3ULIA 4NW6A 2FGIA 1ZLTA 4R7BA 2VTRA 1PXKA 3O7LB 4Q9SA 3T8OA 3S2PA 1M2QA 4IM2A 3GC0A 4PMMA 2HY81 3QQLA 2VWIA 2I1MA 2W99B 2ACXA 2A2AA 4GRBA 2CNUA 4DGGA 2OSCA 5E8VA 1JQHA 5HE3A 3DDQA 4G1WA 4F7NA 5ANIA 4UMRA 4DGMA 3ZXTA 4G9RA 4Z16A 5I9ZA 4EH8A 4JDIA 5KBQA 3BELA 4U7ZA 3FY2A 4DH5A 4TL0A 4L52A 5EDPA 1PXLA 3WOWA 3L8XA 1AGWA 5CU3A 2BHEA 5HG9A 4BDCA 5HX8A 2VTJA 4I24A 5H2UA 4YURA 2WMQA 3MH0A 3BGPA 4XS2A 2W7XA 1F5QA 3EQIA 3W2PA 5IDPA 4KIQA 4PTCA 1UA2A 4M68A 3QKLA 2YIRA 4GV1A 4DTAA 4YC8A 3UE4A 2FH9A 4KSPA 1PKGA 3WZDA 4EYJA 4O6LA 2JDVA 3RGFA 4E4NA 5L2IA 5H9BA 1YI4A 3IKAA 4GUEA 4AGCA 3OUKA 2WTIA 2BR1A 4FZFB 4DLIA 4I21A 4PPBA 2E9VA 3E3PA 4I5PA 1YOMA 2C3JA 3OWLA 2OJJA 5HEZA 4LM5A 3TNHA 4R7HA 1DAWA 5AV0A 4XG2A 2QOLA 2EXEA 4X7QA 3V8TA 3QL8A 5DHJA 3FI8A 4O1OA 2G15A 1FVTA 3RPRA 2CNVA 3EQRA 3GI3A 5CT7A 3KXHA 4AOJA 2CN5A 4K6ZA 5AV4A 4WIHA 1H8FA 1GY3A 3FYJX 4TKSA 5CZIA 3R9DA 2XKDA 5CU0A 1FGKA 2W1EA 4ZTQA 3V8WA 3I1AA 3R83A 1M52A 3EWHA 3IW4A 3QGWA 4DCEA 3OMVA 4F6WA 4XMOA 2JFLA 2LAVA 3HA6A 1DI9A 4UEUA 4I5HA 2X6DA 3ZEPA 2QURA 5KE0A 1YI6A 5CF5A 5HLNA 2GTMA 4O27B 3UVQA 1LEWA 4U81A 4AACA 1PXJA 1NVRA 5HNIX 2C3KA 3Q3BA 5A6OA 4C3FA 3PXFA 4FI1A 4JX7A 5FQDC 3E63A 3KXZA 3W10A 3D7TB 4XNEA 2XH5A 3UVRA 1YWVA 4DEHA 1U54B 2XKFA 2HZ4A 2WXVA 4IFGA 3UQFA 4LOOA 5JKGA 3QRIA 3MIAA 2CCIA 2PK9A 3CC6A 4TW9A 3SXFA 3AG9A 1RJBA 3SHEA 3EYGA 3ZC6A 5JFSA 4EJNA 4KSQA 3AOXA 1ZOGA 2VTSA 4A06A 2QONA 3MVHA 4MXAA 4H39A 4UYNA 2QLUA 1RE8A 4JDHA 3AD6A 3O8PA 2CSNA 5C01A 3GU6A 2X8IA 1KV1A 4IDVA 4OTIA 4BKJA 2J7TA 2YIQA 4JL9A 4ASDA 3UOJA 4RVMA 4EHEA 3UBDA 3IW5A 4ZY5A 5J5TA 4YP8A 2PY3A 4MF0A 2UZTA 4FKVA 2BALA 4LYNA 5ETAA 4F64A 3FQEA 4MBJA 4GCJA 4P90A 3IQ7A 5BVWA 3D14A 3ZM9A 3GCVA 5AX9A 4C61A 1ZZ2A 2VTHA 2OH0E 4O0WA 4GVAA 1PW2A 1E9HA 4C62A 4GG7A 3Q6UA 4CZTA 4X2GA 3VUIA 4D2WA 4DG2E 4RJ6A 5FWKK 4BCKA 4J71A 5CEQA 5HLPA 1QCFA 1WBSA 1JSUA 4BWPA 4D5KA 5LVPA 4ORKA 3VN9A 4DFBA 4O1PA 2W1FA 1H0VA 3KF4A 2VWVA 2VX1A 1PYXA 4BTJA 3ANQA 3OBGA 3UO5A 3LMHA 2C1AA 2ZM3A 4RIOA 4OBQA 4D2VA 4FVQA 2R3RA 3Q96A 2OI4X 2XKEA 1K2PA 3Q4CA 3QBNA 5ANGA 5CENA 3V5WA 3G2FA 4PPAA 4NJDA 5DR6A 2AYPA 2XS0A 4L46A 3ZO3A 3ZSHA 4C4JA 1WBPA 3F3WA 4FKRA 2VGOA 3UNZA 1CTPE 4BICA 4FKGA 4O96A 1P4FA 4MAOA 1OMWA 3LQ3A 3CEKA 2E9OA 3QD2B 5AR8A 4FSUA 2H34A 4N57A 3BBWA 3QAME 3RHKA 4C2WA 4JBQA 3V8SA 3AC8A 2ZV9A 4GKHA 2BIKB 2HW7A 1RDQE 1ZMVA 4OTQA 4CKIA 4BCFA 2VO7A 4FV6A 3ZFMA 1SM2A 5H3QA 1MUOA 2P0CA 3FMJA 3UO6A 1W7HA 5EM8A 2Q0BA 3K3IA 4ZS4A 4DCAA 2YJSA 4K33A 4O38A 3MV5A 4M15A 1ND4A 4J95A 4C0TA 4BDBA 1UNHA 1VYZA 1XHAA 2C0OA 2Z2WA 1IA9A 1ZWSA 2VTIA 4M8TA 5DLSA 3UNJA 4AWIA 5FDXA 5IA4A 2C0TA 5EQEA 4YHTA 3R8VA 2QOOA 2JD5A 4J7BA 4O83A 2XYNA 5AV2A 1YHSA 2BRBA 3UMWA 1BKXA 2WMAA 4KIKA 4L45A 2R9SA 2Y4IB 2YERA 4NK9A 4WNMA 4GJ3A 4QYYA 3UPZA 5K4JA 4AGDA 3MSSA 3R01A 3ZZEA 3F7ZA 3N9XA 4WBOA 4AGWA 4Z7GA 1AQ1A 2UUEA 3FZTA 4CVAA 2WIHA 3JVSA 4FBXA 4FIFA 3KMWA 1YKRA 5CY3A 4AU8A 4YMJA 3C4WA 4NH1A 4IM0A 3BKBA 2ITPA 2P33A 4XBRA 4FOBA 5CTPA 3ORMA 4IX6A 3G51A 3TXOA 3PRIA 3NAXA 4AZTA 1NW1A 2QVSE 3ZO4A 4BI1A 4I0SA 4OR5A 4F6UA 4OAUC 3DJ6A 3NWWA 3OOMA 4NU1A 1ZOHA 5E7RA 3ZRLA 4DFZE 4ASXA 2IZTA 4TYEA 5KUPA 5IQFA 1JSTA 4ZTMA 3K5VA 1P14A 4QP9A 4RA5A 3OT8A 3FL4A 5FD2A 1LP4A 3NIZA 4UWYA 3DB6A 3GU4A 3IDBA 3ORNA 3DT1A 2Z8CA 3KA0A 4U42A 2FO0A 3V04A 5M56A 4FSMA 5M4UA 3UZTA 4CG9A 3KL8A 1DM2A 4ZZMA 4BI0A 1GZKA 5TKDA 4FEXA 5A6NA 1Z9XA 3P08A 1H4LA 3AD5A 2W9FB 3OG7A 4QD6A 3NR9A 4YLLA 5TOZA 4F7SA 4KBCA 4MWHA 1SYKA 3ELJA 3QQGA 5IQGA 3KXNA 2J0KA 4O0VA 2GDOA 3B8RA 2YM6A 2DUVA 2J90A 1W84A 4EZ5A 2XUUA 3R00A 4OTPA 1OGUA 2WKMA 3O8TA 4XYFA 1G8AA 2OWBA 3VBYA 5KMJA 1OL5A 1W83A 1ZYJA 4AE9A 3BU6A 4YJOA 1ZOEA 4FTOA 1U4DA 4PPCA 4RLKA 3HP5A 2BPMA 3KRLA 1Q8ZA 4RT7A 4KINA 3R8UA 4A9UA 4FIGA 1IAHA 3LFAA 5BVEA 1ZAOA 2QI8A 2F57A 4R3PA 3R7EA 5CF8A 4FIJA 3H4JA 4IVAA 3PJ8A 2WTKB 3PG1A 4QOXA 4DBXA 4E73A 3ZO2A 2UZNA 4ZIMA 3QLFA 4B9DA 3QGYA 3CTQA 4IX4A 4M13A 2BZKB 4FG9A 5E8UA 5AP7A 4BR3A 3MH1A 2J50A 4KKEA 3UGCA 1LUFA 4EOQA 4RVKA 2BAKA 5LMAA 5CSXA 2PVRA 4ZTRA 3FBVA 5IMXA 2QU5A 4ZS0A 2VTOA 4JR7A 5HIBA 4RIXA 3KXMA 5CEIA 1CMKE 4E5AX 3GU7A 2GNFA 2IJMA 4GKIA 4KBKA 3DAEA 2UW9A 2Y0AA 4FV0A 2Z02A 2XMYA 1LR4A 3I79A 4L00A 2GS6A 3NYVA 5ANEA 4ZJVA 4IVBA 4RJ3A 1UV5A 4BDEA 3KCKA 4F08A 4M69A 4CEGA 1PMVA 3MVMA 3QD0A 4EHGA 4PX6A 3VULA 5A46A 5AR5A 3NUAA 3OS3A 4DEEA 4FSRA 5K0KA 3WF8A 1SVGA 4FTAA 3RK7A 4Y46A 4CTCA 4S32A 3EOCA 2ITZA 3QUEA 4RJ8A 5KZIA 5IPJA 1CKJA 4FKJA 4CGAA 5IQHA 2ZDTA 3O17A 3IOPA 2I6LA 4BDHA 4YJSA 3NUNA 3NSZA 4U8ZA 1EH4A 4D4YA 3HV4A 5AA9A 3ORLA 4PDSA 4L42A 4PNIA 1Q4LA 2ZDUA 3FJQE 4OTRA 2NPQA 4PUZA 4CTBA 2PVJA 3QX2A 4FTRA 1YHWA 4CT1A 3FZOA 2VZ6A 3EHAA 3LMIA 3OWJA 1UWHA 1MQBA 1Q97A 2V7AA 3OC1A 1BL7A 4MTAA 2HXQA 4QP2A 3RP9A 5M51A 3KQ7A 2PZIA 3UIBA 2VX3A 3HA8A 3HUCA 3Q2JA 4JAJA 3AGLA 4MBLA 2GNLA 3NVMB 4X2KA 5DN3A 4WOVA 4ZK5A 4L68A 1GIHA 3AC4A 4AW1A 5J1WA 2I40A 2PTKA 2ITVA 4WG3A 3G0FA 4R5YA 1XBAA 3FLNC 3PJ2A 5T68A 3DQXA 4MBIA 4Y5QA 4FL1A 3VS1A 4KIKB 1A9UA 2WD1A 3RALA 3SQQA 4BDIA 4JX3A 3NAYA 2DQ7X 3KRWA 2XVDA 4FTIA 4GJ2A 4J53A 4LUEA 5LCKA 4NL0A 4XH6A 2XK4A 3Q2MA 4CV9A 2QCSA 1I44A 5BYYA 5CALA 3TG1A 3V3VA 3FLYA 2W1HA 4IBMA 4FYNA 3S0OA 3E87A 3L9PA 3MVJA 2GSFA 4BBMA 4UX9A 1IAJA 3BQCA 1M14A 4L43A 4FEWA 4FR4A 4NFNA 3DS6A 3NUYA 5AEPA 5F4NA 1OBGA 1YXUA 2WMVA 5ITAA 4W4VA 3TZ9A 2XZSA 3IPHA 4AT4A 3RZBA 2BAQA 3GP0A 1XR1A 5D1JA 2RFSA 3VWAA 4EC8A 5C26A 5LOHA 1Q3DA 3OOGA 2YAKA 3V5JA 4W4YA 5LCJA 4O7TA 2RL5A 1VJYA 4WNPA 3ZM4A 4BRXA 3MYGA 2EVAA 5LVNA 4E5WA 3TNPC 5IQIA 4LUDA 1R39A 2PWLA 3F2AA 3FAAA 2C47A 2XJ1A 4G3CA 4BGGA 3JUHA 5M53A 4IC7A 4C4IA 1JSVA 1R3CA 2BDFA 3AGMA 3RWQA 4YC3A 4AA0A 3I60A 1XH6A 3NYOA 2BTRA 1Q5KA 4TZRA 3NEWA 5CQUA 4YJNA 4OAVB 4IHPA 2WELA 4EYMA 3G9NA 5DT0A 5EM7A 5J7BA 3W16A 1H24A 2R3LA 3CLYA 4MX9A 2WMRA 4QMLA 2C3LA 3PXQA 3E88A 3OEZA 4ZMEA 2XIXA 3PTGA 3TZ8A 3TKUA 4NIFA 4AX8A 5H8EA 4U3YA 4AN9A 3M1SA 2B53A 2VTMA 3PFQA 1OKZA 3R9OA 5GJGA 3O51A 4MWIA 1OIUA 1Y6BA 3IONA 1SNXA 5KHXA 4HYSA 3EFLA 5EH0A 4I6QA 3EKNA 2YAAA 5AIKA 4EUUA 5E8WA 3LM5A 3VJNA 4APCA 3HKOA 2A27A 5AV3A 4G5JA 4YTHA 4FTKA 1Y57A 4F70A 3COIA 2CJMA 2QHMA 4BIDA 4GK3A 3EQCA 3MIYA 3NGAA 4IB1A 3HV3A 2GQGA 2B4SB 3NUUA 4BHNA 4EK3A 5AAEA 3RPOA 4BY9E 3RCJA 4EH4A 4C4GA 4FUXA 3EFWA 4FGRA 3DK7A 4ACDA 4EK6A 3FZ1A 5ANDA 3DFAA 2CGUA 4PF4A 5A9UA 4BL1A 4RIXB 4X6QC 3UIXA 3DAKA 3QXPA 4CZYB 3RVGA 5E1EA 2J2IB 4X3FC 5B0XA 4LI5A 1Z57A 3MJ1A 4MD7E 4DTKA 1M2PA 3WF5A 3DU8A 4BN1A 1IG1A 5DVRA 3IW6A 4E93A 1CKPA 4PQNA 4E6AA 1W82A 1WAKA 5M06A 2YHVA 4RVTA 3FDNA 1Z5MA 4OTHA 5CXZA 4M69B 4WNKA 1YW2A 4FZ6A 1TQIA 5AM6A 1BL6A 3EQGA 4O7RA 4BIEA 5IA2A 4F7JA 3BYVA 3BQRA 5DH3A 1H07A 2ITTA 3D5WA 4UZDA 5E90A 3FKOA 4CT2A 4IVCA 3E64A 3MS9A 4C34A 4R1YA 3MN3A 1YXVA 1R78A 3O96A 5IISA 3VQUA 5IQBA 4I23A 1WVXA 3TJCA 4DFYA 4M12A 3HRCA 3WI6A 3CPCA 5C4LA 3FE3A 3S1HA 4QP3A 3ZCLA 4OGRA 3JS2A 4U6RA 4H36A 4XG4A 5A3XA 4ACGA 4FZAB 4ZXTA 2X1NA 5IEXA 3V6RA 3CBLA 1ERKA 4M97A 1R0PA 1UWJA 4EOKA 4RG0A 2QQ7A 4HZRA 3F88A 5FXSA 3HMNA 4BCMA 4D5HA 4RC2A 3BIZA 1Q62A 5J5SA 5E8XA 3UOLA 4FSNA 4BDAA 2V0DA 3D0EA 3I6WA 5EYMA 5HNGA 3TUBA 3PLAE 3QTRA 4N6ZA 5EI6A 2QLQA 3LZBA 3A4PA 5C8MA 4EWQA 3A61A 3F3TA 3CY3A 2XM9A 2DYLA 3GFWA 4RJ4A 3C0HA 1UKHA 2NRUA 4GT3A 3SW4A 5I3RA 2X9FA 5EKNA 2UW6A 4EH2A 3U6JA 4C8BA 5ACKA 1XQZA 2UW5A 2GNJA 4HGTA 3E8NA 3R8MA 5LQFA 2GQSA 2H6DA 4I92A 3CJFA 5JEBA 4ZSJA 3JR1A 5FTGA 2A19B 3HVCA 4JDKA 3P9JA 4ZY4A 1TKIA 5HNBA 5LWNA 2XBAA 4G5PA 4FA2A 5AFVA 5A4CA 2P2IA 3Q4TA 3TJDA 3H0YA 5CAQA 3RZFA 1QPCA 1PXMA 3D5UA 3QA8A 4WUAA 3ZSIA 3ZEWA 1QPEA 4K2RA 3LFNA 4DEAA 3WIKA 4IJ9A 5HD4A 3ORTA 4GK2A 2IW8A 1HCLA 2PUPA 4IANA 4A9SA 4DA5A 4AN2A 2PVFA 3VAPA 4HGEA 5FRIA 3V5QA 2BFYA 3WYXA 3QHRA 4D2SA 1PMNA 3JY9A 1T46A 1FPUA 3ZLXA 2BZIB 1K3AA 3BE9A 4AA5A 1QPJA 3A7HA 2R3JA 4JI9A 3ACJA 3OVVA 5HKMA 3MY5A 2HCKA 4OTFA 5KMNA 4ZOGA 3DAJA 4P5ZA 4WD5A 3TEIA 2PHKA 3BHUA 4O84A 2C5NA 4MXOA 3U54A 2IZSA 3MGYA 3LCSA 3QCYA 3G90X 1Y6AA 2WNTA 2CPKE 3UYSA 3HLLA 4QQCA 4FSQA 1TVOA 2PE1A 1H25A 4MNEA 4MYGA 1XJDA 1KE9A 2C4GA 4LMNA 3A7JA 3T9IA 4KD1A 4QYEA 4E1ZA 4MH7A 1VZOA 3B2TA 4EQCA 3MI9A 2XJ2A 2IW9A 5EDQA 3FKNA 1J1BA 2R3HA 4FGBA 4FYOA 4GSBA 4LOQA 3G0EA 5HE0A 3KKVA 1CDKA 5HD7A 3FPQA 1WBWA 1URWA 3EJ1A 4FKSA 3R8PA 4Q5EA 1T45A 1M7QA 1U46A 2B55A 4TWOA 3R9HA 2UVXA 2Y8OA 3WF9A 4E6QA 5DFPA 4HGLA 3PWYA 3C7QA 4DH7A 3F5GA 4FSWA 4BI2A 4DHFA 3TUDA 2CKEA 5AP6A 2YZAA 4NIFB 3QD3A 4CRLA 3KRRA 1MP8A 3SW7A 3G33A 4DBNA 5DWRA 2XNMA 4FV9A 4TT7A 4FV5A 4E20A 4TWNA 4EEVA 3FHIA 4L44A 1GOLA 3HECA 4C33A 5TF9A 2VU3A 1Q41A 5AP0A 2CGWA 2EB2A 3H9RA 3QCSA 2F2UA 4WT6A 4HVSA 2JC6A 2R3IA 1H1QA 3MDYA 5BMSA 3BRBA 4GK4A 5IQEA 2FSOX 2OJGA 2X0GA 2IWIA 3ZZWA 5F94A 4USDA 3LJ1A 2X2KA 3TIYA 3ZDUA 2J0LA 3DXNA 3FMDA 4LL0A 3COMA 4O7LA 4EBWA 2XEYA 4PMPA 4IZ7A 4ZSLA 1Q8TA 2XNBA 1IA8A 3AMYA 4HZSA 4IAAA 4ZP5A 4PV0A 5I9UA 4DFNA 2WMWA 2VV9A 3TTIA 1FVVA 4C4FA 4EK5A 1XH5A 4JQ7A 4G6LA 3HX4A 2XK7A 5IH4A 3R6XA 5LVOA 1BYGA 4Q2AA 5HCZA 5E8ZA 3L1SA 3R1SA 3KREA 3BE2A 2GNHA 2QO7A 3QALE 3BGQA 3CTHA 4XRJA 3C1XA 3CPBA 3DJ7A 3PSDA 4ID7A 5IUHA 3PXYA 4GT4A 2ITQA 3AC3A 3HGKA 4FUYA 2GQRA 4L3LA 4I94A 4EZ3A 2ZMDA 5EW9A 2QR8A 4EH3A 1QL6A 2RFEA 3F61A 3DBEA 2W05A 3LCOA 3POZA 5AUVA 3QWJA 2PUNA 4MK0A 3VHEA 3KC3A 2UZLA 5CYIA 4UB7A 1PF8A 4F4PA 2YEXA 3C4XA 3VW6A 3HAVA 4ANSA 2HENA 5HE2A 1JWHA 4FKTA 4A9RA 3DBFA 3UP2A 3WE8A 4S31A 4XRLA 4KNBA 5D9HA 4I22A 4XUFA 3CQUA 3NMUF 2XYUA 4RWLA 4YZBA 4QMXA 2XKCA 4PDOA 2WOUA 2YITA 3PRFA 2X2LA 3KFAA 3UPXA 4C58A 4O0XA 4ZTNA 4KKHA 1G8SA 3ZRKA 3Q5IA 4FT7A 3VJOA 5AADA 3OF0A 4GMYA 4LG4A 4RX8A 4U9AA 4WRSA 3WIGA 3OTVA 4TN6A 4L7SA 5KZ0A 2VTTA 4D9TA 2WTWA 4QPSA 1WBOA 4FF8A 4UBAA 3MWUA 4MF1A 4XV9A 4DGLC 5AUUA 1FBNA 5D7AA 1G3NA 3VS0A 4BB4A 3EL7A 1ZY4A 4AE6A 3LIJA 4AGUA 2A4LA 3R71A 3KRJA 3L9MA 3QQKA 4KKGA 1A48A 2ONLC 4WRGA 2OXYA 3HUBA 3D9VA 3HL7A 4DINA 2VNWA 5JGDA 4RBLA 3FSKA 3F5UA 3LXKA 3POOA 4NKSA 2XK6A 3R73A 2C6OA 1BI8A 3V6SA 2BDWA 5L6OA 4E4MA 3EQFA 3FXWA 2DWBA 3NW7A 4IMYA 4UALA 3VS3A 1YOLA 5DRBA 4QTCA 1ZYDA 4RWJA 4Q9ZA 5AR7A 4FKPA 4EOMA 5J79A 5IA5A 3UTOA 4DH1A 3NZ0A 4E4LA 4EH5A 1OKWA 3ZMMA 5EHOA 3A7GA 2W5AA 1Q61A 3F2NA 3ZLSA 2UZOA 4A07A 2OXXA 3DTWA 3P5KA 5D41A 5CAVA 4F09A 3VBWA 4O0YA 2E9NA 3N4TA 1AD5A 3NUXA 3HMPA 3WZKA 1UVRA 4EZ7A 4BCGA 2OXDA 4DFLA 4GFOA 5D12A 5IA1A 4AS0A 3DOGA 3F5XA 2G2HA 4K0YA 4MNEB 4TTHB 1YQJA 3LXNA 3A8WA 4IAYA 4WSYA 4BDFA 3PVGA 3ZDIA 4RRVA 5LMKC 3RAKA 4IB3A 4D0XA 1PJKA 2GHGA 4G31A 4ZZNA 3KRXA 2HELA 4H3QA 3ZOSA 4HPUE 5ANOA 2SRCA 3VUDA 3P23A 3NCZA 4FOCA 1ZMWA 2JIIA 4QMUA 2ZV8A 3LW0A 2BCJA 4GUBA 5EQPA 3OCSA 3K3JA 4YHJA 1E1XA 2XRUA 3A4OX 3DTCA 2OG8A 3OHTA 4D55A 2YJRA 4FSYA 5HOAA 3TI1A 5FEQA 4BCHA 3CD3A 3KMMA 3RPVA 4C3RA 1OI9A 4J1RA 3UNKA 4OT5A 3ZLWA 3QZIA 4H3BA 4XLVA 3F2RA 4EC9A 5HZNA 3FXZA 5EQYA 2W9ZB 1NXKA 2YN8A 4IJPA 4ASEA 3P7BA 3I81A 3OXZA 1FINA 5AJQA 3W1FA 3GXLA 3E8CA 3PP0A 3QTIA 3LQ8A 3I5NA 4MXCA 3U6IA 5DT3A 2Y9QA 3MFRA 5EYCA 3U4WA 4L53A 1PXIA 4BCJA 1H26A 5L3AA 3FMLA 2BDJA 4EKKA 2V7OA 3FC1X 4RIWA 4CFMA 5DNRA 4P7EA 3NCGA 5DR9A 1BI7A 1JKKA 5ETIA 2ITYA 4ERWA 3OBJA 4RLLA 2O63A 4MHAA 2VAGA 2X8EA 5EOLA 3FSFA 5CU6A 2HXLA 4K8AA 4PL3A 4RMZA 2IVVA 4U79A 4E6CA 1QPDA 2FVDA 3PZHA 3BYMA 2CGXA 1Q24A 1U5RA 2RIOA 4QP4A 4X3FA 3DQWA 4A9TA 4YJUA 3TL8A 2XNPA 1OIQA 4XHKB 5L6PA 2X4ZA 1UNGA 2WO6A 4ITHA 5D7VA 3ZBFA 4NWMA 4J97A 4QTDA 1XWSA 4QQJA 3AT4A 4G3DA 3ZBXA 4FK3A 3LAUA 4USEA 5JK3A 3V51A 2OJIA 5HIEA 3V5LA 3EN7A 4ZTHA 2QKRA 4RJ7A 3R8LA 3ATSA 4YSJA 5AP3A 1GIIA 1YDRE 5C27A 2ZAZA 5J9YA 5EW3A 3HDNA 5L2SA 5GNKA 3VNTA 3CKXA 4O7ZA 2YA9A 3CIKA 5GZAA 4IFCA 4J96A 5CEOA 2X8DA 4V0GA 3E7OA 5HG8A 3N4VA 2H96A 4NFMA 4YO4A 2HAKA 2R0UA 3NNVA 4X3JA 2BVAA 3EQBA 5DEYA 3ZRMA 4A4OA 4PP9A 1XH8A 4GG5A 2YZLA 4BBEA 3UMXA 2C5VA 3R1QA 5JGBA 4IACA 3QTWA 2YCRA 3E8DA 3MH3A 3QWKA 3QF9A 2B9JA 2P55A 5E8SA 2BRNA 4JG7A 5ANJA 4CFVA 3PY1A 1PXPA 2W1IA 4FV2A 3P7CA 3R0TA 1GAGA 4EOPA 4K18A 5IZFA 4CZUA 4U80A 5JRSA 5K5NA 1XO2B 5CSVA 4B0GA 3OXTA 4NUSA 3DNEA 3Q9WA 4J99A 4M84A 5HVKA 4YJQA 3DZQA 3DZOA 4RFYA 3U87A 1OL1A 2Z60A 5CXHA 3VUGA 1DAYA 4CCUA 4MNFA 5HU9A 2YCFA 2C6TA 2YIWA 4K11A 4X2NA 4M7IA 2QO9A 3I7CA 2YIYA 3CGFA 4IAZA 2EXCX 4O6EA 5CAOA 2GS2A 4GIHA 1WZYA 4DG0E 4WHZA 3IDCA 5GJFA 5IKWA 4J8NA 3O7LD 5CVGA 4QPMA 4FKUA 4E8AA 2B1PA 3PA5A 5EYDA 2YM3A 3UOHA 5GHVA 4A4LA 4ASZA 4DFUA 3PA4A 4JG6A 4EH7A 2Z7LA 3LOKA 2X4FA 2IVTA 2J9MA 3VO3A 1H1PA 5ETFA 5EKOA 2VWBA 3PJCA 4FL3A 3U4UA 2YM5A 3F3VA 3DKOA 2PVYA 5BVKA 4D2TA 2VO3A 4AP7A 3F7WA 4AUAA 2QO2A 5FG8A 5E91A 4AN3A 4EOJA 3C4FA 2QG7A 2XIKA 2QODA 3QC4A 4E4XA 4UN0C 4O22A 3PJ3A 3PXKA 4XP3A 4CFXA 4LMUA 3OZ6A 4ANNA 4CYIA 2B0QA 4EQMA 4P5QA 2UZEA 1OZ1A 2VTLA 2JAVA 4NKAA 4RFZA 1PMEA 3O71A 4IWDA 4XV3A 5HG5A 5C03A 4FL2A 1KE5A 2H8HA 4HVDA 2JKKA 5HI2A 1APME 3ZH8A 4D4SA 4NZWB 5FDPA 2BZJA 3LXPA 1PXNA 3TNIA 5KMIA 5CASA 2VGPA 3ORXA 4RWKA 4TNDA 1H00A 4F7LA 4BBFA 4LV5A 5M09A 1U59A 1VEBA 4XG8A 4G3GA 3THBA 2JDTA 4FKLA 4D58A 5C4KA 2AC3A 3LPBA 1RQQA 4L67A 4N70A 4NSTA 4S30A 3PY3A 1OPKA 3COKA 4WSQA 4NTTA 4YSMA 2RFDA 3SVVA 3OW3A 4I93A 2J5EA 2WTJA 3VVHA 4F63A 3W32A 4APPA 3MTLA 2PE0A 3E8EA 4K77A 3T9TA 3SG9A 1YDTE 4H58A 3QKKA 4GT5A 4AG8A 2B9IA 3BYOA 3OEFX 4M66A 1KWPA 5C9CA 4F99A 5A4QA 2OIDA 3G9LX 3W8QA 4ITIA 2OBJA 3EZRA 4L6QA 5CI6A 4EOOA 5J1VA 5HO7A 3D7ZA 3PYYA 4FZDB 2BFXA 3FL5A 4D1XA 3BHYA 3GENA 4MXXA 2XA4A 3DLZA 1HCKA 4R6VA 3EB0A 4RIYA 1IRKA 1ZXEA 4ZY6A 4RIWB 3QZFA 4X2FA 3S3IA 2PSQA 4I5CA 2W0JA 2PVKA 3MB7A 3GQLA 5M57A 3R63A 3U51A 4BFMA 4TPTA 4DEIA 2V22A 4ACCA 2O65A 4FK6A 4J52A 4MEDA 2HWPA 2J51A 4O21A 5L2QA 3UQGA 3I0QA 4ZJIA 5DEWA
chains in the Genus database with same CATH superfamily
3L8PA 3F3ZA 2XIZA 3NNUA 2J0MB 5CF6A 3OWKA 3GEQA 5B2MA 3SRVA 3RAIA 4TXCA 4CXAA 4NM0A 4QPAA 2HY0A 4RQVA 3QRTA 4X3FB 4DLJA 2PVNA 5J95A 5B7VA 3IW7A 2E9UA 4O91A 3ETAA 2CN8A 3KN5A 3NDMA 2REIA 1YXSA 2ITWA 3NW5A 4FKOA 4R3RA 5AR3A 4EWHA 2W4OA 4CFUA 3RMFA 5K5XA 3QCQA 5KBRA 1YDSE 3LFFA 5A14A 4CQGA 4P2KA 3DXQA 3AQVA 4IM3A 4X21A 4IWQA 4CKRA 4FEQA 3PVBA 4FC0A 4ANBA 5IEVA 1H28A 5E4HA 3R21A 4V0GB 2IG7A 4J98A 5EHYA 4YTFA 4W9WA 2C6MA 2F7ZE 3QA0A 3TV7A 3U8WA 3E62A 3A7FA 5HTCA 2PYWA 2B9HA 3LFDA 4U41A 5HGIA 4AW2A 4JXFA 3FMKA 4BCPA 4AZEA 3VS6A 1OITA 2RG5A 4OBPA 3BHTA 3DV3A 4R8QA 2VWWA 3HEGA 3DPKA 3TT0A 1M2RA 2Z7RA 3FMEA 3D5VA 4PMTA 4UY9A 3TNWA 3BWJA 3VS7A 5CVHA 5TR6A 4F9CA 2R3FA 3GCPA 4Y5HA 4D1ZA 5B2KA 4IE9A 2OK1A 3ANRA 3GC7A 2R2PA 1H01A 4KIOA 5DGZA 2XM8A 2EWAA 3AC2A 3DY7A 5LARA 2R7IA 4HYUA 3P86A 4QQ5A 3LFEA 2WMSA 2RF9A 4H05A 4EOLA 4CKJA 2XK8A 3L8VA 4CLIA 4HVIA 1XMMA 5HCYA 4XEYA 5EFQA 1KOBA 3PZEA 4AQKA 2B9FA 4QMNA 3HNGA 2AC5A 3EYHA 2CKQA 5C8KA 2ONLA 3AXWA 3MA6A 5DRDA 3V5PA 5HLWA 4FTUA 4QMTA 1CM8A 5J9LA 4I6LA 2C0IA 3DGKA 2VO0A 4JJRA 3SLSA 4TWPA 3PXZA 2HWOA 3W2QA 3TM0A 4LOPA 4Y85A 3UO4A 4BDGA 4RC4A 2IZRA 2JAMA 3OWPA 3SC1A 1YRPA 3P1AA 5DG5A 5E8YA 5K0XA 4R3CA 3BWFA 3WE4A 4V04A 5IQDA 4C02A 1X8BA 5M07A 4YU2A 4J8MA 5KMLA 3FYKX 2IVSA 1WVYA 4XG6A 4JIAA 4EK8A 5FBNC 1LPUA 2G1TA 3AC1A 3ALNA 4HCUA 4G17A 2WEVA 4DYMA 3FMMA 2UZDA 3ZXZA 2UZUE 3P78A 4QYFA 3ATTA 2WMBA 2X7GA 5AAFA 4NCTC 1OIYA 5JSMA 2PPQA 5EK7A 3R7GA 4HNFA 2GFSA 2WTDA 2CGVA 4QP8A 3Q9XA 1XH7A 5E8TA 1O9UA 1OL2A 3DFCB 3F3UA 1J1CA 2BKZA 4LRJA 3F82A 4YO6A 5E92A 4HVHA 4HNIA 5L8LA 1JKTA 1MQ4A 2R5TA 1O6LA 2B52A 4FNZA 3WYYA 4CMUA 5I0BA 3HRFA 3UOKA 1YI3A 4PL4A 4BWKA 5LMKA 2EB3A 3VUMA 2C1BA 2V62A 3OCGA 3BU3A 3EMGA 2WQEA 4FIHA 4IWPA 3KY2A 4QNYA 3ZU7A 3FQSA 4UMUA 4NYEA 2UVYA 2WMUA 4TRLA 5M08A 4WUNA 2FB8A 4KBAA 3F5PA 3WZUA 4C4EA 4BYIA 3CY2A 5FXQA 1XKKA 5LWMA 4IH8A 1VR2A 2ITUA 4EJ7A 4U0IA 3LQ5A 2UZWE 2CLQA 2PMNX 4UMQA 3JY0A 5H8BA 5I5ZA 5HIDA 4JVGA 2YLEA 2RG6A 2W4JA 4IAFA 2W06A 3S00A 3MPMA 3NYNA 3IW8A 4FSZA 4Z9LA 5I4NA 5AM7A 4IB5A 2QOCA 2WMTA 3NS9A 3NYXA 2R3GA 1Q8UA 4MD9E 4HVGA 2X9EA 3OUNB 2JITA 1YXTA 4DT8A 4BDKA 5BUIA 3A62A 4RIYB 2F7XE 3WZEA 1A06A 2J0IA 3GQIA 4FSTA 4KRDA 3PE2A 4AQCA 3R9RA 4C38A 4CLJA 2PMIA 3W0NA 3UIUA 2VD5A 1KSWA 3H3CA 1B38A 2IO6A 4N6YA 2OW3A 2OZAA 2ZM4A 2PUUA 4LGHA 5M55A 4DC2A 4IADA 3D4QA 2HZIA 5HTBA 2G9XA 3LMGA 3W33A 1H1SA 5DI1A 3M2WA 4JAIA 2BAJA 3PVUA 1SZMA 2KULA 1TQMA 4FVPA 4IXPA 3PY0A 1O6YA 3W2SA 5LJJA 3N4UA 3A7IA 3FI3A 3O8UA 4ITJA 3Q9ZA 2Q0NA 5J87A 3DNDA 4XV2A 5A4TA 2V55A 3SRVB 3LLAA 2W17A 3BV2A 4FV7A 4LRMA 4X6RA 2PZPA 4EBVA 4R7IA 3H30A 2WMXA 3HZTA 1R0EA 5DBXA 2NO3A 2C6DA 3QCXA 1YVJA 4PTGA 1KUTA 3KULA 4HGSA 2HZNA 5K3YA 3OY1A 3VBVA 3ERKA 4CRSA 1BX6A 2C30A 4D0WA 4EH9A 3ORZA 4EHZA 5JRQA 1O6KA 3QHWA 3BEAA 3ET7A 3SA0A 4O0SA 5CSWA 4FT0A 3AT2A 5EI8A 1ZYCA 2W4KA 4GH2A 2FA2A 3AKJA 3UDZA 3FWQA 5FEDA 3UYTA 4B99A 3H9FA 4I4FA 4BTKA 3UG1A 3R8ZA 2I0YA 5HQ0A 4ZMFA 3H10A 3OCTA 1XH4A 3KK9A 4W4WA 3KK8A 1M17A 5EG3A 3E7VA 4JNWA 3DXPA 3ZC5A 2PMLX 3BLQA 4YBJA 1OPJA 2Y4PA 3BL9A 3FV8A 4PRJA 3RKBA 3HV5A 3IGGA 2IEWA 2W5HA 3ID6C 4QP6A 2WGJA 3F9NA 4F6SA 4QMVA 4FJVA 5KO1A 3VUHA 3IECA 4GU6A 3OD6X 2QOKA 3GFEA 4WBBB 5GINE 3QX4A 3LFSA 5KMKA 4PTEA 1OL6A 2YLFA 3BZ3A 3MPTA 1YWRA 5DPVA 2ERZE 5AP4A 5KCVA 3MESA 4RZWA 1PHKA 3QRJA 1KOAA 4AW5A 1B39A 3NNWA 2X7FA 1WVWA 4YZNA 4ZTSA 2ZVAA 3LHJA 5GIPE 4EKLA 3OFMA 4FICA 4BZOA 2OIBA 5FUTA 4FNYA 2VWZA 3BEGA 2W1CA 3HRBA 4FTLA 1Q3WA 1Q8YA 3R1YA 4EHVA 4RWIA 3BYSA 2ZYBA 4WKQA 1NVQA 4JBVA 4DH8A 4FTJA 4JQ8A 1PY5A 3M42A 4XG7A 3K2LA 1MRVA 2LGCA 3N51A 4R1VA 4TYIA 5AIRA 4IZ5A 4U3ZA 3RPYA 4QMOA 2YWVA 1VLRA 3GU8A 3L9NA 4ARKA 5AUYA 4BTFA 3ZLYA 4DDIA 3EFJA 4IAIA 2QOHA 3RK5A 4FTQA 1Q8WA 3MH2A 1ATPE 3DBDA 4Y8DA 5DT4A 3WARA 3T3UA 2YWPA 3AMBA 4DEGA 4R78A 2C6LA 5GIOE 1S9IA 4XG3A 3FC2A 1H1RA 2JKQA 3LM0A 3OXIA 1J91A 4WG4A 4M14A 4GVJA 4M3QA 4C35A 3MFTA 4IAKA 3RNYA 3LKMA 3WBLA 4UXQA 4EL9A 2ITXA 3LFBA 2HYYA 4XLIA 4YZMA 1HOWA 2PVLA 2WOTA 3MB6A 2GMXA 4KAOA 2UVZA 4H1MA 4B4LA 3PJ1A 2R3QA 4WNOA 3DKGA 2ETKA 2VWXA 4O7NA 2ESMA 3GB2A 3GBZA 3Q60A 4MXZA 5DIAA 3FQHA 2GNIA 2P2HA 2YFXA 3I6UA 3MW1A 3DDPA 2X39A 1IASA 3TCPA 1DI8A 4AAAA 4B8LA 2C68A 5JT2A 4ACHA 4XP0A 3DA6A 4D2RA 3NX8A 2XF0A 2BROA 3QTQA 5D10A 3QUPA 5AUTA 3R2BA 3JVRA 2CMWA 2OLCA 2CHLA 5CANA 3ZYAA 2I0EA 3D94A 2C6KA 4L8MA 5BYZA 1WMKA 3U55A 1OUKA 3TDWA 4FG7A 2XK9A 4I0RA 1W98A 5CVFA 4DN5A 4M0ZA 4FIIA 3AKKA 2G2IA 2UW0A 3R7VA 2VTQA 3BHHA 1Y91A 3ZUVA 4DAWA 3PIXA 4ZSEA 3D2KA 4CNHA 3DBCA 3FXXA 1OIRA 4BF2A 1OL7A 5IQCA 2OF4A 3R7UA 3P4KA 3A8XA 1UKIA 1Y8GA 4C4HA 1BUHA 2ZMCA 5I9WA 1JKSA 5BUJA 3IK3A 4ALUA 1PMUA 5HHWA 5E1SA 4W9XA 2OZAB 3NRMA 5CNOA 3OTUA 5BMMA 3SAYA 4OTWA 5M44A 4FV8A 4IVDA 5M4CA 2ZM1A 3FMHA 1SVEA 3LCKA 4AA4A 2XCHA 3PSCA 4H1JA 3ZONA 2JEDA 1CSNA 1FOTA 4FV3A 2YIXA 2XIYA 2JDSA 1ZRZA 2BMCA 4KABA 4YR8A 2PL0A 5FXRA 4L9IA 5IQAA 4NM7A 1V0PA 4AT3A 1J7IA 4I5MA 3RINA 3VRZA 2XAOA 5LMBA 2GNGA 3LFCA 3PUPA 4O2PA 2ITOA 3H9OA 1QMZA 2BHHA 4NTSA 2YM8A 3KULB 3VS4A 5ICPA 5L2WA 3IO7A 3QFVA 3QTUA 5CSPA 3QLGA 4AOIA 2I0HA 5AUXA 4YZCA 3A60A 4O7SA 4F9AA 3W0RA 3Q9YA 3GUBA 4QNAA 5HICA 3O0GA 2WPAA 4RZVA 2WAJA 4FKWA 5L6WL 4LRKA 4CV8A 4RX9A 2XBJA 3JPVA 3VBQA 2OH4A 4EONA 1WBTA 4GL9A 4O4FA 4QYHA 2JDOA 3RAHA 3ORPA 5G1XA 4G3FA 4O4DA 5G6VA 4D4RA 4EORA 3MY1A 5HG7A 4FTTA 3KVWA 3PPZA 3DKCA 2IZUA 3TN8A 2I7QA 3UP7A 3IDPA 3EN5A 4S33A 4RA4A 2CNQA 3ZHPC 1OB3A 2C6EA 4WO5A 4KRCA 4YNEA 3PIZA 5A4LA 4W8DA 5I9XA 2C3IB 4NJ3A 3C5IA 5CEMA 1FVRA 1U5QA 4LV8A 3QTZA 2W96B 4JOAA 4CMOA 2R3OA 3C50A 4LGDA 4D1SA 1BLXA 5DYJA 2VTNA 2I0VA 4I6FA 4S34A 4R77A 4AXFA 3B8QA 3F6XA 1OPLA 4LL5A 4QDEA 2UW7A 4FTCA 3UDSA 4EOSA 2JBPA 3CQEA 4OBOA 1REJA 1STCE 4HYHA 3ZTXA 4AFJA 2UW8A 4QTBA 5AP2A 4I6HA 3RPSA 3QRKA 2XIRA 2QOBA 4ALVA 3LJ0A 3ZUTA 3SOAA 4LGGA 2WZJA 4G6OA 5I9YA 3NNXA 3W0MA 3MA3A 2RFNA 3SGCA 2YISA 3UIMA 2O64A 5HE1A 1I09A 4JS8A 4YTCA 1ZMUA 4TNBA 4DEDA 2E9PA 3R1NA 2PMOX 4O81A 4UZHA 4I3ZA 5CT0A 4IEBA 3G5DA 3VW8A 3W8LA 2HK5A 3C4CA 5ACBC 4QDVA 1TQPA 4JBPA 5LXMA 2W1ZA 3CQWA 1G5SA 4FKQA 4QMMA 4G16A 4QMSA 4CQEA 2JIUA 3BCEA 4DH3A 4GS6A 3C0GA 4N0SA 5F1ZA 3O23A 2E2BA 4QMWA 3Q53A 4YJVA 4MQ2A 4BHZA 3RNIA 4V05A 2ETMA 4MUQA 1FQ1B 4Y72A 1GNGA 3AMAA 2OICA 4AZFA 1P4OA 2GPHA 2UZBA 3GGFA 3R9NA 2WU6A 4ERKA 3SG8A 2ZJWA 1WCCA 4EI4A 2QOFA 4GYIA 4RFMA 3VF8A 3QYWA 1JAMA 5DMZA 4F9BA 2YDJA 1SNUA 4NCTA 4FT3A 3KVXA 5KHWA 3ZSGA 4G2FA 2IPXA 2OJ9A 2Q83A 3RM6A 3P0MA 5CWZA 3UZRA 3EZVA 3O2MA 4HPTE 5HU3A 3I4BA 5ETCA 5FP5A 4TY1A 4ZLYA 3C13A 3RTPA 3MJ2A 3A99A 4DITA 2P3GX 2XK3A 4Q5HA 5BVFA 3RHXA 4XV1A 3LXLA 2QOIA 4NT4A 4UV0A 3LCDA 5AA8A 4AFEA 4KS8A 4RJ5A 2YDIA 2X0QA 3CD8A 4O4CA 4ZLOA 3DCVA 3GC9A 5EHLA 3V5TA 1L3RE 4BGHA 1IR3A 2PULA 2R64A 4YNOA 3M11A 3QUDA 1NT2A 2C5XA 3Q32A 5F9EA 3VIDA 2GTNA 4FEVA 4L3PA 2JGZA 3TUCA 3EFKA 4CFFA 5K4IA 5KX8A 5EI2A 5ANKA 4B7TA 3II5A 3GCSA 3Q52A 2QC6A 4YC6A 5HESA 2AUHA 3PWDA 4QMPA 4CYJA 2YM7A 3QQFA 3LCTA 5AUWA 1J7UA 3UJGA 3WILA 3P7AA 3HP2A 1F3MC 2XANA 3EN9A 5FM2A 3ZS5A 4GW8A 2UW3A 4ONAA 1ZY5A 5C8NA 4Y73A 5FTOA 1H08A 4G9CA 3BV3A 2O5KA 2OF2A 4YBKA 3IG7A 4YGAA 3CE3A 1PYEA 4FNXA 3WF7A 4II5A 2CKOA 2X6EA 3NIEA 4U97A 3FHRA 5EOBA 3GCUA 3L8SA 3E3BX 5F20A 1YXXA 2R3MA 3BYUA 3GOKA 3LFQA 4KB8A 4QMZA 5BQ0A 5FBOA 3TWJA 2X7OA 3PXRA 2YCQA 4JQEA 3ODYX 4OW8A 4OTGA 4CMTA 3BI6A 1DS5A 4M0YA 2OU7A 1Q99A 2Z7QA 5L8KA 3HYHA 1SMHA 4S2ZA 3FMNA 3VBTA 1OECA 2PUIA 1FMOE 3LJ2A 3R2YA 4QRCA 5KKRB 1WBNA 3PDTA 3OW4A 2XB7A 3MFUA 3D5XA 4W8EA 5FLFA 5EM5A 4G3EA 3BU5A 4JIKA 4ANMA 3ORIA 2EUFB 4BVUA 2XCKA 3TACA 2R7BA 3O5AA 1M7NA 4UWCA 1OUYA 1V1KA 3COHA 4I6BA 3B2WA 3RAWA 5E9EA 3FZPA 4FX3A 1GZOA 3QC9A 4ZZOA 3W0QA 2CDZA 3FLSA 5L8JA 3T3VA 2VO6A 4BCNA 2WEIA 1UU9A 4IDTA 3CS9A 2VTAA 4IW0A 3TV6A 4FZ7A 3VF9A 5IUIA 3QZGA 3MBLA 1XBBA 5DOSA 3WF6A 4F9YA 3F66A 1GIJA 3D15A 4PL5A 3IOKA 3EN6A 3C4EA 2R4BA 5BPYA 5HO6A 5JQ5A 3SOCA 5EW8A 4UXLA 3QD4A 2O0UA 4IQ6A 2Y6MA 4CD0A 5CLPA 3JXWA 4BJJA 4YHFA 1KE6A 4V01A 2J4ZA 3FPMA 3E5AA 4U43A 3SXRA 3V01A 2H9VA 3PLSA 3QQJA 5AV1A 3UC4A 4BYJA 5A4EA 4DFXE 2RKUA 2WTVA 4BWXA 4DE4A 3AD4A 5CAPA 4LFIA 4DT9A 4QTAA 4BIBA 1XMLA 4O7WA 4IIRA 3SKCA 3MPAA 5BUEA 2OIQA 4I20A 4F1TA 4IZYA 5CZHA 4OT6A 4U45A 3WZJA 5H8GA 3GNIB 1ZYSA 3BLRA 5TE0A 2HZ0A 4JR3A 4DGNA 3BLHA 5AUZA 4U44A 4AOTA 3GC8A 3KXXA 3FI4A 5I3OA 5A54A 4QMYA 3HMIA 3RWPA 3KMUA 3VUTA 2F7EE 5M4IA 4AXCA 2OJFE 2A0CX 3HMOA 3UODA 2PVMA 2EXMA 3K5UA 4FVRA 4DTBA 1P2AA 2QU6A 4QO9A 2JKOA 3RBWA 2CKPA 3TYKA 4A9YA 3CJGA 5LVLA 2JKMA 1YOJA 5HTIA 3KU2A 4A7CA 4DF3A 3ENMA 2WQOA 2VN9A 3GT8A 4MCVA 4C37A 4TWCA 5CF4A 3A2CA 2Y4IC 3U9CA 4AZSA 4XJ0A 2XJ0A 4QTEA 1IEPA 2J6MA 3E92A 1NA7A 1MRYA 4FG8A 4JBOA 5CNNA 4L01A 3PA3A 3U6HA 3C5UA 4F0FA 2VTPA 1OBDA 4AZVA 4BKZA 4JDJA 5HBJA 4FV1A 2P4IA 4BCQA 3FI2A 3PSBA 4CFNA 2XEZA 2G2FA 4AZWA 5AP5A 3FLQA 4AW0A 2HOGA 4F1MA 3O50A 3I7BA 4USFA 2JBOA 5CX9A 2IN6A 3QKMA 4HW7A 2Y6OA 4C7TA 4A4XA 4IX5A 5CS6A 4DGOA 2PZ5A 2OGVA 2PZYA 4MXYA 2FSMX 1MRUA 5CU4A 5T3QA 5GJDA 4RX5A 5KKRC 3EQPA 4E7WA 4NM5A 4PMSA 4EH6A 4JG8A 3KF7A 3KXGA 4DDGA 4UWBA 3TZMA 2V5QA 5TO8A 3TKIA 2QOQA 3S95A 4WG5A 4YJRA 1S9JA 2W5BA 2WQMA 5EM6A 3FUPA 4BCIA 2QD9A 3E93A 3QRUA 1WBVA 5EYKA 1JPAA 3DK3A 2FUMA 3BGZA 4KIPA 3G15A 4PY1A 5HX6A 4PDYA 2R3PA 3EN4A 4JRVA 2C6IA 3L9LA 2C5OA 4MKCA 4I0TA 5IA3A 4YJTA 3KB7A 2BRGA 3ITZA 3CTJA 3NUPA 5F95A 3R7IA 4D4VA 3TIZA 3ZFYA 3CXWA 2XAMA 3Q4UA 3VBXA 4GYGA 4YPSA 5FP6A 4YZDA 4JRNA 2F49A 4Z3VA 2ZV7A 3C0IA 4DEBA 3VS5A 3HAMA 1JOWB 4OUCA 2WB8A 3HMMA 5FM3A 2VX0A 5CAUA 4QT1A 3C4ZA 5GZ8A 5KNJA 4F9WA 2ZOQA 3W55A 4CSVA 1WFCA 1UU3A 3BHVA 4DHIB 1GZ8A 2JIVA 4FV4A 5JGAA 4G6NA 5CEKA 2NNWB 1UU8A 3F69A 5LVMA 1TZDA 3CP9A 4WA9A 2WTKC 3DK6A 3KEXA 3R04A 4BDJA 4BZDA 4PP7A 5IA0A 2PU8A 4YUQA 2ETRA 5GZ9A 3CCNA 4AT5A 5J7HA 5BNJA 5L2TA 3NPCA 3REPA 3C9WA 4MVFA 2B7AA 2R3KA 3PPKA 4U5JA 4ZAUA 4BGQA 4DG3E 3GVUA 1ZARA 4FKIA 4JLCA 4XX9A 4C3PA 4JT3A 5IMEA 4GFGA 2QKWB 4K1BA 5JFVA 4AF3A 2GS7A 3GOPA 4Z7HA 5IDNA 4D2PA 2DS1A 1YHVA 1R1WA 4FMQA 4HYIA 4YLKA 5AR2A 5HVYA 3VONA 4C59A 2VWUA 1NY3A 1PKDA 2WU7A 1W0XC 5JFXA 4I4EA 2HW6A 4HJOA 4QP1A 1J7LA 4RX7A 5T6KA 2Z7SA 3HV7A 3ZUUA 2J0JA 2KTYA 5C1QB 1UNLA 1GJOA 5HVJA 1JVPP 1CKIA 2YABA 4OLIA 5JFWA 1OVEA 4CCBA 5CU2A 2FSTX 3MVLA 4QP7A 2OO8X 3AC5A 1V0OA 4M67A 1NVSA 4NEUA 5CQWA 5AX3A 4PNKA 3PVWA 2GCDA 1REKA 3UQCA 3PPJA 4O86A 3GCQA 3PIYA 3LE6A 4O0RA 5IUGA 4FTMA 4B8MA 4EQUA 3FEGA 3ROYA 4BJJB 4IX3A 4BZNA 5JMSA 2ERKA 5HO8A 2FYSA 3SD0A 2GHLA 4O7VA 4GFMA 3S4QA 3SX9A 3W2CA 1ZYLA 4Y83A 3ZO1A 3G6HA 3C51A 3HV6A 5L4QA 2C5YA 4E6DA 3EKKA 4QQTA 4I1ZA 2PE2A 3OP5A 3Q4ZA 3BX5A 3I5ZA 2GFCA 4TYHA 3TKHA 3VS2A 4XBUA 1V0BA 2GHMA 2W1GA 4FT9A 3R7OA 1PXOA 4ANQA 3ORKA 4EUTA 3GU5A 3EQDA 4L7FA 4RC3A 3OT3A 1H1WA 4D9UA 4GIIA 3KN6A 2XRWA 4G34A 5BX0A 2ZV2A 2W1DA 5CI7A 4GEOA 3UVPA 3VRYA 4IZAA 2ZB1A 1URCA 3Q5ZA 2RGPA 3FLWA 1LEZA 4RPVA 4D28A 3ULZA 3RM7A 5EDRA 5AAGA 2BZHB 4NM3A 2BILB 1KE7A 2BRMA 4ZTLA 5HBHA 3BPRA 4FEUA 4IC8A 3TTJA 4B6LA 4ENXA 5HORA 5JH6A 3R30A 3DJ5A 5KMMA 3TV4A 4KS7A 5M4FA 4P4CA 4C2VA 1JNKA 2ITNA 4KWPA 4RVLA 3PFYA 3K54A 2BRHA 1J3HA 4YPDA 3R02A 4O0TA 3UDBA 4RQKA 5IG1A 5BVDA 3VUKA 4BTMA 2XNOA 2QNJA 4CG8A 3FLZA 3SDJA 2QG5A 1L8TA 2UW4A 3VC4A 3R7YA 3VQHA 5I9VA 4R5SA 2YCSA 5KMOA 3ML1A 5IF1A 5IH5A 5CSHA 2F9GA 4ENYA 3QXOA 5HCXA 5AWMA 2O8YA 3BBTB 4L3JA 2PZRA 2F4JA 1OKVA 3EH9A 2IW6A 2XNEA 2OZOA 3FKLA 2WHBA 3ROCA 2JDRA 3NW6A 3FZRA 1B6CB 1H27A 2VWYA 3ENHA 5FGKA 5HBEA 2XNNA 3DBQA 5DE2A 2WTCA 5IEYA 4E26A 2RSVA 4UYAA 3QU0A 4W4XA 4XCUA 5BVOA 4GU9A 3ALOA 5AP1A 3NUSA 5JN2A 1KE8A 3QTSA 4YTIA 4IWOA 2OKRA 4Z55A 4Y95A 4XOZA 3TNQB 2HIWA 3NLBA 3NVKI 3EL8A 1XH9A 3G6GA 4PWNA 3VHKA 4RSSA 5JZJA 2UV2A 3U9NA 4ACMA 1KV2A 3UC3A 4ZLZA 3D2IA 2YM4A 2EU9A 3UG2A 4O82A 4CFWA 5BVNA 3RI1A 1H0WA 1Y8YA 5BYLA 2BTSA 4FRFA 3W18A 3W2RA 3AT3A 4FE2A 3MTFA 4EOIA 5D11A 4F0GA 5K9IA 4X0MA 3RCDA 3OROA 3QQHA 2X0OA 2B54A 3CR0A 4O2ZA 3RJCA 3I0OA 3H0ZA 1W8CA 3CKWA 3D7TA 4LDTA 2O2UA 3FZSA 2NP8A 3MY0A 1U54A 3CSVA 1F0QA 3ODZX 2VRXA 1PRYA 5IU2A 4TYJA 2O3PA 4U40A 3R22A 2WQNA 3QTXA 2CLXA 4MD8E 5FEEA 5TT7A 3IGOA 2QHNA 2OFVA 4YJPA 4NW5A 4BC6A 4E5BA 4F0IA 2A98A 1OKYA 5B2LA 3ZFXA 5AR4A 3SXSA 4ZEGA 4AXDA 1JKLA 3EIDA 4FNWA 1P5EA 4MQ1A 2R0IA 4ANOA 4FODA 5AMNA 5J8IA 4FIEA 4FTNA 3KGAA 3KCFA 3OY3A 3FY0A 4ALWA 3DLSA 4RGJA 3JYAA 2R3NA 2BKKA 2X2MA 1JBPE 2VUWA 2JLDA 2FSLX 3ACKA 4QYGA 4XOYA 1XBCA 4BKYA 3MFSA 4UMPA 4QMQA 4KUJA 2WQBA 3LLTA 4BDDA 2G01A 4KA3A 4ZJJA 4C36A 3OCBA 2WFYA 3QQUA 2VNYA 3QYZA 3R28A 4H3PA 4LQMA 4N4SA 4HCTA 5J9ZA 5IH6A 1OM1A 3PP1A 4HCVA 4YLJA 4PDPA 2BIYA 2NRYA 3IS5A 1JLUE 2XNGA 5DR2A 1E1VA 4O7YA 2CCHA 5CEPA 1K9AA 3RK9A 1RW8A 2PVHA 4C57A 3QZHA 1VYWA 2QR7A 2WIPA 3HDMA 3PE1A 3EQHA 3PG3A 4EK4A 5JQ8A 4YZ9A 3TDVA 5JZNA 4AXAA 2BUJA 1BMKA 3LVPA 4BCOA 4F65A 2Y7JA 2XP2A 4FT5A 2J5FA 4XG9A 4F1OA 4K9YA 4O0UA 2C69A 4IB0A 1SVHA 2YACA 1YWNA 3P79A 5DA3A 3UZPA 2F2CB 1FMKA 2JFMA 4I41A 4ZSAA 2GU8A 3Q6WA 3DKFA 3Q04A 1GZNA 4UMTA 4ZSGA 5FTQA 2UZVA 2YDKA 4ANLA 2A1AB 4XP2A 4TYGA 3D83A 4X2JA 1UU7A 3CGOA 4TYHB 4HOKA 4E3CA 1FGIA 2ZB0A 3SV0A 2X81A 2IVUA 1ZZLA 2OFUA 4OTDA 3DB8A 3TZ7A 3W2OA 3ULIA 4NW6A 2FGIA 1ZLTA 4R7BA 2VTRA 1PXKA 3O7LB 4Q9SA 3T8OA 3S2PA 1M2QA 4IM2A 3GC0A 4PMMA 2HY81 3QQLA 2VWIA 2I1MA 2W99B 2ACXA 2A2AA 4GRBA 2CNUA 4DGGA 2OSCA 5E8VA 1JQHA 5HE3A 3DDQA 4G1WA 4F7NA 5ANIA 4UMRA 4DGMA 3ZXTA 4G9RA 4Z16A 5I9ZA 4EH8A 4JDIA 5KBQA 3BELA 2AEGA 4U7ZA 3FY2A 4DH5A 4TL0A 4L52A 5EDPA 1PXLA 3WOWA 3L8XA 1AGWA 5CU3A 2BHEA 5HG9A 4BDCA 5HX8A 2VTJA 4I24A 5H2UA 4YURA 2WMQA 3MH0A 3BGPA 4XS2A 2W7XA 1F5QA 3EQIA 3W2PA 5IDPA 4KIQA 4PTCA 1UA2A 4M68A 3QKLA 2YIRA 4GV1A 4DTAA 4YC8A 3UE4A 2FH9A 4KSPA 1PKGA 3WZDA 4EYJA 4O6LA 2JDVA 3RGFA 4E4NA 5L2IA 5H9BA 1YI4A 3IKAA 4GUEA