3D4QA

Pyrazole-based inhibitors of b-raf kinase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Potent and selective pyrazole-based inhibitors of B-Raf kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d4qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d4qA01
2A2AA 2WTKB 2KTYA 3TM0A 3RWQA 4CSVA 3FPMA 5I4NA 2WKMA 5B7VA 3VHKA 4W4YA 4FL3A 2OSCA 4C61A 3LM0A 3CJGA 4QRCA 1JBPE 4U5JA 4WOVA 4DINA 1LEWA 4I5MA 4B99A 4BFMA 3O2MA 3R28A 4IX6A 4OBOA 4RMZA 4CFWA 1OBGA 4PUZA 4F6UA 3C13A 4FKOA 4O81A 4NIFB 2IG7A 5JQ8A 3RPSA 2XF0A 1IEPA 3M1SA 4U40A 4CVAA 2VZ6A 3Q6UA 3OP5A 3UYTA 4CT2A 4YNEA 4DH7A 4XMOA 4ANOA 1SZMA 4KRDA 2UW6A 3FI4A 1H1QA 2JDVA 4DGGA 5HE0A 3A61A 5EM6A 3ORXA 4HYHA 2W06A 3TWJA 1ZXEA 4QP2A 4O0VA 2WZJA 1KOAA 2JAVA 4IJ9A 4FZ7A 4L67A 3TUDA 3LXPA 2F49A 1MRVA 3WZEA 4PL5A 3KEXA 4FV9A 3VIDA 2XNEA 4RLLA 2CKPA 2QHMA 3BLRA 3L9LA 4X6RA 5IH4A 1U54B 5FD2A 4W4VA 3EN6A 5ETIA 3GCVA 3KVXA 3BYUA 2P55A 3PYYA 2YIYA 5KZ0A 1P14A 3DAJA 4E73A 5CF8A 4IZAA 3RKBA 4A9TA 5HVKA 5L2SA 5J9LA 4WNKA 1W98A 1H1RA 1SVEA 4RJ4A 3ZRKA 5FP6A 2GNFA 3T9TA 4F6WA 3SOCA 2XNGA 3D5XA 4YP8A 2GFCA 2ITOA 2GS6A 4UY9A 5AR5A 3EKNA 5HEZA 4Y8DA 4YSMA 5ANKA 2CSNA 1IA8A 3NNWA 5LMKC 4U44A 2UZLA 3OTUA 2IW8A 5DLSA 3OY1A 2ERZE 4L00A 2PUNA 2X7GA 5KX8A 3QTWA 5DR2A 4M14A 2ZB0A 1NW1A 3NYNA 4A07A 5AIRA 3NRMA 2QD9A 4YZNA 4HVHA 3IO7A 4U6RA 4QTBA 3NDMA 3DKOA 2WTKC 2G9XA 2Y6OA 3QTRA 5J95A 4TXCA 2YERA 3BU5A 4QYYA 3ROCA 5LOHA 4DLIA 2BTSA 1TQIA 2CGXA 4CFVA 1YXTA 5D1JA 5B2MA 4QMVA 4O38A 5CNOA 4HCUA 3A99A 2R3JA 1J3HA 2B53A 4XOZA 1REJA 4BWPA 4WIHA 3QX2A 4FTCA 4OT5A 3HV3A 1H4LA 1QCFA 1YQJA 5CEOA 3EQPA 5CQUA 5A14A 3KK8A 3MVLA 4FV1A 1LUFA 4RX9A 4DLJA 5L8KA 2I0EA 4LGGA 4EH4A 5F95A 3G0FA 4FICA 4G9CA 4BHZA 4BZDA 5J5SA 1V0PA 5M53A 1H00A 4IH8A 3ODZX 2QVSE 4MNEA 1PXLA 2W1HA 4XV3A 3NWWA 4I92A 4IACA 3KN5A 4YHFA 5EI8A 3Q3BA 3QC4A 3LQ8A 2XM8A 2VWZA 2GDOA 5M44A 2Y0AA 5CEMA 2QKWB 1FQ1B 4FKJA 5EW9A 4AGCA 3HDNA 3P9JA 5FTQA 5ICPA 3OCGA 2BAJA 3ENMA 3U51A 4UV0A 5CSXA 3QF9A 4FOBA 4U97A 4F09A 2C6KA 2WMXA 3C4FA 5C8NA 3QWJA 1Q24A 2R3PA 3S3IA 3DOGA 2OWBA 4I24A 1URWA 3LOKA 4HZRA 4YBKA 5IQGA 3GU5A 3FDNA 3TI1A 1XH8A 5EI6A 1ZYDA 5AAEA 1JSVA 4O0YA 3SOAA 4EI4A 2JKKA 4GH2A 3DXQA 1CMKE 2YACA 3H0YA 3PRIA 3WIKA 4V0GA 1KE9A 3D7TB 4F65A 4RA5A 1OL1A 5CEKA 3F5PA 5JEBA 2WEIA 4BCNA 3AMAA 3DZQA 1WBNA 2ZMCA 4FTQA 1OL7A 1XBCA 4I1ZA 4WO5A 3A7FA 3SQQA 2G1TA 4NZWB 3N4TA 4YGAA 4CQEA 2YZAA 2PVHA 3IDCA 1Z9XA 3O8UA 3EZVA 4YJPA 5ACKA 1Q8UA 2IZSA 2J50A 4B8MA 3QRJA 2WMVA 4BVUA 3OUNB 5EG3A 4QMOA 2PE0A 5DWRA 1S9IA 3DTWA 4IWOA 3DU8A 4YTIA 2PVNA 4EHZA 4PQNA 4PTGA 3SV0A 4CTBA 3ALNA 1OUKA 4X3FB 3BYOA 3BZ3A 3IDPA 4NM0A 4WRGA 2VWUA 2XM9A 1UA2A 4UYAA 5KMJA 3PJ8A 2Q0BA 5FP5A 3IECA 4F1OA 3F2AA 4QMWA 3PRFA 5HE1A 1J7LA 2NPQA 5AR2A 2PMLX 4TYIA 1YDRE 3ENHA 4F1TA 3MH3A 4FTMA 4BKJA 4DFBA 3ORIA 1F3MC 3HYHA 4FSQA 4KS7A 4FEWA 4IIRA 2QOKA 4AW1A 3BX5A 2Z7RA 3KMUA 5M51A 3ZLSA 4G16A 2FGIA 2Q83A 2XNBA 5AUXA 4XOYA 5AP1A 5HICA 2QOIA 4EK4A 3QHRA 4ACHA 2BZJA 4DHFA 1O6KA 3GUBA 3LCOA 3LXNA 2NRYA 4JG8A 3HRBA 3BPRA 3QRUA 4C4JA 4O2ZA 3WF8A 3CQEA 2C5XA 2BILB 5GIOE 4MWIA 2BRHA 4L43A 5E1SA 3D14A 4FKWA 3S2PA 5EQPA 3KN6A 3F5GA 2XJ0A 3ZMMA 4FTRA 4EUTA 1J1BA 4LL0A 5J9YA 3CY2A 4QTCA 3FLYA 3ZSIA 4AN9A 1Y6BA 5EYKA 2PE1A 3F3WA 4IX3A 2YA9A 3UBDA 4FMQA 4FTNA 3U54A 5FM2A 5CENA 4IHPA 1R0PA 4BTKA 2W1CA 5CQWA 3I5NA 2C0IA 3NMUF 4FI1A 2R2PA 1OL2A 2XRUA 4IAYA 3FYKX 3LFFA 2UZVA 4GMYA 4I22A 4NFMA 5ANGA 2VNWA 2F2CB 3SVVA 3I60A 4ZLYA 3DXPA 4B0GA 5JFVA 2YAAA 3PXRA 5KMKA 4G5JA 2V62A 4JAJA 5EFQA 2HCKA 5J7HA 3CTHA 3NZ0A 4QP3A 5K4JA 4BI0A 4BZOA 2QO7A 3Q2JA 1G8AA 2PMOX 5EKNA 2OIQA 3WZDA 1P5EA 1XH6A 1GNGA 4J98A 1FVTA 3MWUA 3QWKA 1ZYCA 5EW3A 3KRXA 5HG5A 3W2QA 4AG8A 3I4BA 2OZAB 2AC3A 3PXQA 4P2KA 4O7NA 2VD5A 1PY5A 4CFNA 5LVPA 2IN6A 4CLIA 2CDZA 3VS4A 4EBVA 3GCPA 3QRIA 4X2KA 4IX5A 3COIA 4EUUA 5LMAA 4RVLA 3NYXA 4YLLA 3PE1A 4FIFA 1U54A 1KE6A 3PP1A 4ZZOA 3F7ZA 2VTQA 2CLXA 3MFRA 4GFGA 3KY2A 2R3MA 3QD4A 3W18A 3MDYA 4QYFA 4JBOA 5A54A 5BMMA 3VUDA 3UO6A 5JN2A 2ACXA 2E2BA 2PK9A 4BBFA 2FO0A 1KE7A 4PF4A 2UZDA 3MA3A 5TE0A 1OPLA 3QQUA 2YITA 3B8RA 4PMPA 3C4CA 4M69B 3EKKA 4HGTA 3B2TA 1WAKA 1WVYA 5IG1A 1M2RA 3U55A 4CKIA 4L01A 2F2UA 4BB4A 4AZTA 2GQRA 4PV0A 4UMRA 3FXWA 4DFYA 3CD3A 3FC2A 4PP9A 3EHAA 3UIXA 2ZV2A 3GBZA 4ZTQA 4D2VA 2X7FA 4E26A 2Z7LA 1BI7A 4M8TA 3QD2B 4PL3A 2B4SB 3SKCA 5IUIA 3ALOA 4D0WA 5AADA 5HORA 5C26A 4K9YA 4I21A 5DFPA 5HX8A 2HW7A 5DA3A 4NM7A 1YVJA 2V7AA 5HTCA 4XG4A 4GK3A 3D83A 4XJ0A 3T3UA 2BPMA 2OIBA 5IA5A 2VTLA 3G5DA 5KHWA 2H9VA 2IO6A 4IAFA 3EIDA 4RJ6A 4Z16A 5IA1A 3LFQA 3BELA 3FMNA 3R2YA 4GUBA 3FMEA 2ZM1A 4XYFA 3C5UA 3KA0A 4JLCA 3V8WA 1JSUA 2CJMA 2RSVA 3PPZA 3REPA 1UNLA 1Y8GA 1K2PA 3BGPA 2XEYA 3RPRA 3SXFA 4A9YA 4ZY4A 4X2GA 5AP3A 2H6DA 3FI8A 4O7WA 3Q5IA 2J0MB 3QCSA 5HNIX 5BVNA 5M57A 5HI2A 2VTRA 5C8MA 1CKJA 2EUFB 3GCSA 3FE3A 5DBXA 5KMMA 2BHEA 3CBLA 2WU6A 2R3QA 4IWPA 5GJFA 3PJCA 3W16A 2ZJWA 1I09A 3DKFA 3PWYA 3WARA 3ZS5A 4TL0A 1Q97A 5BNJA 4O7SA 4PPBA 4DBXA 4ZMFA 3LJ1A 2R5TA 5AUWA 3HA6A 2XS0A 1KE8A 3QTQA 4TZRA 4C8BA 5F4NA 3UIBA 1PXMA 2YIQA 2R0IA 4FX3A 3UG1A 4UMPA 5CU4A 3ACJA 3PZHA 4JL9A 4ALUA 4I0TA 4ZS0A 5AMNA 3ZUUA 3Q9ZA 4DC2A 3KCFA 4O91A 3Q60A 4GL9A 3QCQA 1QPJA 3AT3A 3Q53A 3FZ1A 4RC3A 4ZTSA 3PVUA 2EB3A 2BZHB 3D7TA 4J53A 3VUMA 3ZUVA 4BCJA 4CG9A 4HJOA 1XQZA 2W5AA 3QCYA 4E6QA 2R3HA 4CCBA 1NXKA 3SGCA 1K3AA 1R1WA 5ANIA 3GENA 4G9RA 5ANEA 3GGFA 3A8XA 3RAIA 2VX3A 4MNFA 4AZFA 5FQDC 2A4LA 1Q8WA 4C38A 2J0LA 2J4ZA 2PVMA 3NSZA 3QXOA 4IZYA 4UX9A 2OIDA 1CDKA 3CJFA 4FIJA 3WZKA 2JIVA 2XKEA 5DRDA 4AX8A 3LIJA 2UW9A 2HZNA 4ENXA 1Z5MA 2WMAA 4EKKA 3MVJA 4EOLA 3NCGA 5LCKA 3RHKA 2CNUA 4CTCA 4KBCA 3R7EA 4HVIA 2IJMA 2QR8A 2PVLA 2G01A 3QGYA 3RMFA 4FTKA 5E8VA 4BBMA 2X9EA 4I5PA 3JXWA 4BCHA 2IW9A 1UV5A 3O7LD 4JS8A 3D15A 3PVGA 5J8IA 4A7CA 4CFUA 3R22A 2VV9A 3G33A 4FSWA 4F70A 5KMOA 3QD0A 2YJSA 2RFDA 2B55A 4NCTA 3BWJA 4GKHA 3LFCA 3MIYA 5GJGA 3E63A 2Z7QA 3MI9A 3NIEA 3KRWA 4MX9A 3U9CA 5KO1A 4N57A 3R8ZA 1MRUA 5LWMA 3AC4A 5JKGA 3V5PA 5DEWA 2WTCA 2ZOQA 3I0QA 4GRBA 4NK9A 3PJ2A 3NCZA 5BMSA 3R2BA 5IF1A 3LFAA 1GJOA 2VTPA 2UW4A 4L8MA 5A3XA 4AP7A 2PZIA 2SRCA 4KIQA 3TV6A 3KFAA 2YIRA 1XWSA 4FSNA 2ONLC 5HG8A 5H9BA 4B4LA 4A9SA 4USFA 2WMQA 2IVSA 4DF3A 3TDWA 1WFCA 3Q9WA 1PKGA 4YZCA 4FIIA 4ZXTA 2ZM4A 4EYMA 3OTVA 4M84A 2YCFA 4FSRA 3Q9XA 3KXXA 4IMYA 3F61A 4CYJA 3EFJA 4CNHA 4EWHA 3ZEPA 1UWJA 4R77A 1DM2A 1PHKA 2XYUA 3HLLA 1XH7A 4WA9A 1R3CA 4D2TA 4HVDA 3DLSA 4MWHA 4HNFA 3OCSA 2O64A 3OEZA 4IANA 5CU3A 5H3QA 4AOJA 4PP7A 3ULIA 3ORTA 3HNGA 4L44A 2X8DA 2QURA 3I6UA 3TKHA 2YCQA 4YTFA 1E1XA 3VULA 4F6SA 4QYHA 3QQFA 5GZ8A 3MBLA 2X39A 5CAQA 3SAYA 4FNZA 3TZ9A 5H2UA 2CKOA 3BE9A 3MIAA 4HYSA 4NT4A 4QQTA 2I40A 2QG5A 2BDFA 4W9WA 1NVRA 2VNYA 3EN9A 4WHZA 2PHKA 4QMQA 4G3GA 3BGQA 2PTKA 2XNPA 4I6HA 4MD8E 2C6DA 5EOBA 5TF9A 4E8AA 3CEKA 4QPAA 3OW4A 4IWDA 2AC5A 2OH4A 3FHRA 5AX3A 4FL1A 4ANLA 3NNVA 2PULA 4RJ5A 1IRKA 4H3PA 3QKMA 4RJ3A 1RJBA 2ETRA 1OZ1A 2Y4IC 3CIKA 3ODYX 4QYGA 4BHNA 4FG8A 2XK8A 4Y73A 2XKDA 3LAUA 3ELJA 4G6NA 4O2PA 2XJ2A 1OL5A 4F63A 3JY9A 5M08A 3BYSA 4NH1A 4WUNA 2QOLA 1PMEA 2EB2A 1QPCA 2UZEA 4XUFA 4K8AA 3IW7A 4BDHA 1NT2A 4DFUA 1BX6A 4AN3A 5CALA 2UW3A 2J7TA 3ZH8A 3F5XA 3VBXA 4DBNA 3RAWA 5ETFA 2XCHA 4FSZA 2GU8A 2X2LA 4LOQA 3UNZA 1Q41A 4PY1A 4IC7A 5BX0A 2PUPA 5DI1A 3QC9A 4ENYA 4IB5A 5HNGA 5FTGA 1R78A 2NP8A 3P0MA 2H8HA 1ND4A 3Q96A 2VX1A 4I20A 3UGCA 3DKGA 4V05A 4DT8A 5CAPA 3L8VA 4S30A 2FB8A 2JKMA 2PZYA 3AC2A 3E8EA 2R4BA 3HMOA 5CYIA 1SNXA 5IA0A 4HPTE 4ZSJA 4FIEA 3V51A 3E8CA 4WT6A 5BVEA 1OIRA 1PYEA 3PLAE 2RFEA 4NWMA 5BVWA 4EH9A 4IW0A 3PSCA 5CVHA 3LE6A 4FZFB 3VS2A 4QMXA 4E4XA 3ORPA 3S0OA 5CF6A 3VS7A 4D2PA 4UZHA 2PE2A 1G8SA 1L3RE 1UU3A 5BVOA 3A4PA 3NW7A 3FHIA 4JOAA 4ASZA 2R7BA 4UZDA 5E8ZA 3R8UA 4JVGA 5EDRA 2OFVA 3R9NA 3TKUA 3ZO3A 2WELA 3QQGA 3QRKA 4G6OA 3U87A 3R8MA 4RQVA 1S9JA 1YXXA 2PUUA 2EVAA 4GFMA 3FXZA 2BHHA 2GCDA 4LGDA 3EYHA 3KXZA 4YLJA 3R21A 4H1MA 3OXZA 3GC7A 3NUUA 3IKAA 1LEZA 1Q8YA 1ERKA 4U45A 1YWVA 4U41A 3TNPC 1OMWA 3AGLA 4R6VA 2O65A 3FL5A 5JFWA 4PPCA 2VRXA 4JDIA 3ZCLA 4M7IA 4DFXE 4PDPA 4CMTA 4Z7GA 2B0QA 2YM5A 3W8QA 5IDPA 3HRFA 2W17A 2W9ZB 2WTDA 3A62A 4GIIA 4O0RA 3TCPA 4HVSA 5HD4A 2XK9A 3DT1A 3SRVB 3RGFA 1R0EA 5I9UA 4C37A 1H0VA 2X2MA 3JY0A 1Z57A 3HMMA 2VWWA 2VTMA 4YJVA 3H9OA 4GU9A 3FZRA 4MF1A 3QTUA 2XKCA 5T6KA 3AD5A 3HUCA 2UZOA 4K11A 3ZEWA 5IMEA 4JQ7A 4ZTNA 4H36A 2PVRA 2C1AA 1TVOA 3QALE 5EM5A 4TYHA 3U9NA 5BUJA 4WNPA 4DH1A 3DY7A 4E6AA 1MQBA 3KXNA 3OD6X 4IZ7A 4M67A 4XV1A 3EMGA 4F1MA 5JH6A 2WMUA 4CKJA 1URCA 3PA3A 4MQ1A 3QZGA 3I6WA 3LCSA 3WZJA 5CNNA 3H0ZA 3HMNA 5EHYA 3TTJA 2PVFA 3BHTA 4JDKA 3ANQA 4EOKA 4RWKA 1H26A 5D10A 3OVVA 4O21A 3W55A 5M09A 3R9HA 4FIGA 4I0RA 4RBLA 1YI3A 2ZAZA 3NS9A 4GVAA 3OT8A 3ORLA 3FWQA 1XH9A 1YWRA 3MY0A 4FL2A 4AACA 4L3PA 5JT2A 1V0BA 2E9NA 5H8GA 4PMTA 2R3NA 5HLNA 2XUUA 2B7AA 3QL8A 3UJGA 4WSYA 3SD0A 5CEPA 1REKA 3BE2A 4OAVB 5LQFA 3R7VA 1PRYA 4FR4A 4YZBA 4YZMA 4C36A 5HTIA 1GY3A 5A9UA 4YHTA 1UKHA 3NEWA 5DT3A 4G34A 4L7SA 2OF4A 5EK7A 1JLUE 5HD7A 2PYWA 4ORKA 2GMXA 1UVRA 2FUMA 2YWVA 4J7BA 1QMZA 3ZDUA 3BEAA 1YDTE 3L8PA 4JX3A 5E8UA 2RFSA 2FSMX 3TDVA 3FMDA 2HY81 4KSPA 4RVKA 3LXLA 3Q32A 1GIHA 5E7RA 4IX4A 1I44A 3U6HA 3ZBXA 5FRIA 3R01A 4MXAA 5HU9A 5BVDA 2W96B 2ZDTA 4A9RA 4FGRA 3GU7A 4MKCA 3MY5A 4LUEA 2YISA 3QA0A 5DR9A 2B9JA 4U3ZA 4MXXA 1VYZA 2XJ1A 5IH6A 3HUBA 2VO6A 4RIYA 3ZO1A 3NUSA 5AA9A 5FDXA 2V0DA 2GTMA 4RJ7A 5EI2A 4DAWA 3VF8A 5FTOA 4UWCA 2OXXA 4ZOGA 3ZUTA 2C0OA 2G2IA 5BPYA 4AZSA 3UPZA 2RGPA 4GEOA 3FZPA 1OIUA 2EWAA 1PXNA 1W84A 3AQVA 4BCFA 3FKNA 3DA6A 5I9XA 4M97A 3LXKA 4XV2A 3ZXZA 5HLPA 5LJJA 2WTVA 4ERKA 5M56A 1GIIA 2QOQA 4PMSA 3PWDA 4MXOA 1NVQA 1Y57A 3ORKA 5CEIA 4EK6A 2C6TA 3ZBFA 1SNUA 2DWBA 2X0GA 4AZVA 4S34A 4FEUA 3PJ1A 4D28A 4E3CA 3R7UA 4RWJA 4YMJA 4ZAUA 1GZOA 4CG8A 1JQHA 4E5BA 5L2TA 3P5KA 4GYGA 3JR1A 1XH5A 2J0KA 5M55A 4CQGA 2PY3A 2OW3A 4PTEA 1NVSA 2JFMA 5HBHA 4YHJA 5J7BA 5M4UA 5KCVA 2Z8CA 3MPTA 4TN6A 1ZOGA 1HCKA 3RP9A 5CU2A 2XEZA 3QD3A 5CSWA 4QP7A 2VTTA 5AFVA 5AR8A 3HAMA 4YU2A 4ANSA 3AC8A 4F0GA 1PXKA 3LCKA 1B38A 4YJNA 3WF6A 4LMUA 4K18A 3UDBA 4W4XA 4F0FA 2RFNA 5DE2A 3ZYAA 4FKVA 3UTOA 3LFSA 3GOKA 3HMIA 2XK6A 3MV5A 1H1WA 4F7SA 2GNJA 1PMVA 5EM8A 1IA9A 5HZNA 3E5AA 4RFZA 5M07A 5AM6A 4IXPA 4O1OA 3COHA 3QKKA 4IAZA 4HGLA 4IVAA 4M68A 5BYZA 3V5JA 4KUJA 3BCEA 3L8SA 2VTIA 1WBSA 4P5QA 4C4IA 4H05A 2J90A 3IW5A 2ZV9A 4IVDA 4RX8A 3R8VA 3R83A 4QPSA 2C68A 2JDRA 4JNWA 2EXCX 3BWFA 3FZTA 2CPKE 2UV2A 3E3PA 4BF2A 3LCTA 2O3PA 3R7YA 1GZKA 2R64A 4JQEA 5L8LA 1M2PA 3G2FA 5IQDA 2PPQA 2QOHA 3SG8A 5A46A 4IDTA 1M7NA 2H96A 1W8CA 4QD6A 4XP0A 4W8EA 4CCUA 4X21A 3MJ2A 2QQ7A 4ZZNA 3GQLA 3VRYA 4WG5A 2CHLA 3BHHA 3P23A 5J5TA 3RCJA 3R1YA 5A4TA 4P4CA 5M4IA 2XIXA 3U6JA 4ZSGA 5JSMA 3DDQA 3QFVA 3E88A 4KKHA 2I1MA 2VU3A 2CMWA 3MTFA 4Q5HA 3CP9A 4U3YA 4EH7A 2GQGA 2W1FA 1Q3DA 3EQFA 2HELA 4D0XA 4EK8A 4QP6A 4EH5A 3GP0A 2BAQA 1XKKA 3ZDIA 4C3RA 4C58A 2RF9A 2OG8A 4NJ3A 5K3YA 3WYXA 3C7QA 4KA3A 5B2LA 5DEYA 2ZYBA 2OKRA 3KF7A 4FKIA 4ZSEA 3RPYA 1IAHA 3M2WA 4EHEA 4GJ2A 4RA4A 4WKQA 3OXTA 3D2IA 1CKPA 4HCVA 3QHWA 4GSBA 4LM5A 4AOIA 4TWCA 3QYWA 5H8BA 5IEXA 3SRVA 2VTAA 3HP5A 5K4IA 3LJ2A 1QPEA 3NPCA 4OTQA 4WUAA 4D4VA 5IH5A 3VF9A 3DBFA 1OECA 4FT3A 4R8QA 3V6SA 4UN0C 2IVVA 1Q8ZA 1YOMA 2CNQA 3GFEA 2E9OA 4RWIA 3V8SA 3D5VA 4FNXA 5HCYA 5HCZA 3EZRA 4L3LA 4N6YA 1IR3A 4C3FA 2B9IA 3DAEA 4NFNA 2GS7A 3MB6A 3TT0A 1YKRA 3GC9A 5IZFA 4G5PA 4ZLZA 3GNIB 4BGQA 2RIOA 4BTJA 5JK3A 2WEVA 3V6RA 1R39A 3I81A 5JZJA 3TUCA 4I0SA 3LCDA 4PL4A 3IW4A 4FT7A 4I41A 3UOHA 4CT1A 2ITQA 4BDCA 2J0IA 2X6EA 2X8EA 3HZTA 2F57A 3E93A 3KMMA 5FEQA 4CV8A 1KSWA 5GZAA 4PTCA 4K2RA 3ZRMA 5CF4A 4WD5A 4B8LA 4E6CA 5LMBA 5F94A 2R3OA 2GTNA 1UWHA 4ZIMA 4X0MA 3UVQA 2O8YA 3GVUA 3O96A 4YC6A 4Z3VA 3KREA 3G0EA 3OCTA 3R63A 1XR1A 5EHLA 3RTPA 3UP7A 1OM1A 4RQKA 5FXRA 4YO6A 5CT0A 4GCJA 2FSOX 3N9XA 4MYGA 2YM3A 1OKVA 4MF0A 4YLKA 4ZZMA 3ZO2A 3BGZA 1U46A 2J5EA 5G1XA 4AT3A 4MBJA 3Q5ZA 4EHVA 2W4OA 2XVDA 4BN1A 5HQ0A 4QOXA 3D5WA 4XNEA 3IS5A 4R1VA 5HESA 4WNOA 4FK6A 2C3LA 4X2NA 3BIZA 3EFWA 2C3KA 2ZM3A 3S1HA 3R30A 5AP0A 4BDBA 4E7WA 1FMKA 5AR4A 3PUPA 3U6IA 1PJKA 5IUHA 3AT2A 3GCQA 5K5XA 1A9UA 3JUHA 3VW8A 4HCTA 3L9PA 4BCIA 2ITWA 2OJ9A 1A06A 4QMLA 2JLDA 3QYZA 5AP5A 4KIOA 1BL7A 3TJCA 4ZJJA 5DH3A 2IVTA 5CI7A 4XG8A 4AUAA 3DTCA 2J2IB 1TQPA 1XH4A 3MVMA 5AUTA 2CKQA 2XNNA 3BYMA 5E1EA 3DQXA 3MH1A 4TRLA 4X3FC 5HO8A 2WOUA 4WNMA 2VO7A 4YJTA 5J9ZA 2WQBA 4IC8A 4AFEA 2C47A 3FLZA 3ORNA 4D4SA 2YCRA 4L45A 5KHXA 3S95A 1XO2B 3EWHA 4J8NA 5D7VA 4OT6A 4L9IA 3WE8A 3K5VA 4BYJA 3NLBA 4ITJA 4EQCA 4HW7A 3FAAA 4O0WA 3KRJA 3AD4A 1K9AA 3ZTXA 4EH2A 2QLQA 2JIIA 4O96A 4EQUA 3LFBA 4H1JA 1DAWA 3VUTA 4NW5A 4AAAA 4DGOA 5FDPA 4YJRA 1BLXA 2G15A 4I5HA 4JRVA 4BCQA 4EHGA 3FZOA 4NJDA 2GS2A 3R1QA 3U8WA 3DFCB 3F3TA 4O6EA 4RRVA 4GG7A 4F0IA 4J52A 1JOWB 4ALVA 5AV2A 4XG6A 3ZC6A 2R3GA 2C30A 3C51A 5C9CA 4CMUA 2WMSA 3MFTA 3E3BX 4F9YA 5A4QA 5HBJA 3C1XA 3ZO4A 4Z9LA 4UB7A 5FEEA 4YZDA 2OLCA 3ET7A 3OOMA 4GV1A 4MXCA 1OGUA 2ZDUA 3K3IA 1M2QA 1FGIA 4JR7A 4O1PA 4D1SA 3A7GA 4L53A 5EYCA 1BI8A 3THBA 5CTPA 2B54A 3C4XA 2QLUA 3ZFXA 2I0VA 3C4WA 3GFWA 2ESMA 5CVGA 4FSMA 4BCOA 5CU0A 4UYNA 3U4UA 5AP6A 3BBWA 4XBUA 4XG2A 4RIXB 3BQCA 4NM5A 4O6LA 1B6CB 1RW8A 5GZ9A 1CM8A 3E62A 3HA8A 3E64A 4XP3A 3BU3A 3ANRA 4TYEA 3C4EA 4GK2A 2OJFE 2WTIA 1FOTA 1F5QA 3QX4A 1LPUA 5C1QB 1E9HA 3DNEA 4NEUA 3PSDA 4KKEA 4JBPA 3ZHPC 3RPVA 2QR7A 4C4GA 4RFYA 4KIKA 4FKSA 4N0SA 3UZPA 4QP8A 3EQIA 4FKQA 4PDOA 3BBTB 1UKIA 4K6ZA 4A4LA 4CRSA 3OUKA 3AGMA 4R3CA 3RALA 2IZUA 2WMWA 3QTXA 3ROYA 5AEPA 2GQSA 1KOBA 3RK5A 4TPTA 3QUEA 3DXNA 2BALA 4L6QA 4JQ8A 4YSJA 3VJOA 3T3VA 4O0TA 2JITA 4GVJA 3O50A 5IEVA 4ANMA 2C1BA 1KWPA 4KRCA 5C8KA 3R04A 4P7EA 2XYNA 2V55A 1ZOEA 2C69A 5IISA 2BMCA 1H07A 2C5OA 2ZMDA 4G3FA 4ZTHA 5HCXA 5ACBC 3AT4A 4BBEA 4PNIA 1ZAOA 2VWXA 3LHJA 2VX0A 3WI6A 4X2JA 3DFAA 2CGWA 3IG7A 3QRTA 5D12A 3KB7A 4MTAA 5FGKA 3D2KA 4IM0A 2R9SA 4R7HA 4E4NA 3IPHA 4MEDA 4R3PA 4GKIA 4ZK5A 4AWIA 3SA0A 4AW5A 4AE6A 4DH8A 1YI4A 4A9UA 5KBRA 4AA0A 5EM7A 3POZA 4Q9SA 4BY9E 4WSQA 3UVRA 4YPDA 4F99A 1W7HA 4TYHB 4M0YA 4L7FA 4BDDA 4OBPA 2QU5A 5BVKA 2J5FA 4LV5A 3PXKA 3DBEA 4FT9A 2JBOA 5CAVA 3GOPA 3V3VA 4EK3A 2P0CA 3FMKA 2QI8A 4PWNA 2BRGA 2Q0NA 4O0SA 4CZYB 3G9LX 3IGGA 3FMJA 2VO0A 5ITAA 3BHYA 4NSTA 1J7UA 3QA8A 4F7NA 2YHVA 3PXYA 3DDPA 4XEYA 4F7LA 3LW0A 1MQ4A 4LG4A 4PX6A 3LMHA 3I7BA 2C4GA 4W8DA 2VWYA 1Q99A 5CY3A 2GNGA 4FTJA 5J87A 3PPJA 5AUZA 1M7QA 3N51A 2I6LA 3KCKA 4BWXA 4G31A 3A2CA 3RCDA 4V04A 3Q2MA 1IG1A 4HGEA 4QQ5A 5AV0A 1ZY4A 4EJNA 1SM2A 2A19B 3TTIA 4FIHA 2AUHA 4J1RA 5ANDA 3P7BA 3SHEA 3HRCA 3ZONA 4D5KA 1JNKA 5BUIA 3OWKA 2QOBA 1PXPA 3QZHA 4R5YA 2OGVA 2XA4A 4QMNA 4E20A 3NVKI 4EYJA 3FKOA 5IQIA 3HKOA 4UXQA 2A27A 4IADA 4L3JA 3WBLA 3T8OA 2HZ0A 4AOTA 3PVBA 2C6OA 4FC0A 3CPBA 4ACGA 4AW0A 3VC4A 5M4CA 4NTSA 2OF2A 3BV3A 2C6EA 4GUEA 4KINA 4OAUC 2CCIA 3PFQA 2GSFA 4H39A 4U42A 2OXYA 4DE4A 2NO3A 4RIYB 5CF5A 2VUWA 3CS9A 3LFNA 3RM7A 2UUEA 3FJQE 2E9PA 2PZ5A 3ZLWA 4AT4A 1JKKA 3P1AA 1OBDA 3LMIA 4ERWA 2GHLA 4ZP5A 2PWLA 4QO9A 4RPVA 5DG5A 1P4FA 2PL0A 5HBEA 3RHXA 3U4WA 4C34A 3MY1A 4IM2A 4M66A 2YN8A 3FKLA 2OXDA 4D9TA 4J95A 3P08A 4XG7A 4OTRA 5LCJA 2PUIA 1GIJA 2YLEA 3QAME 3EL8A 4FG9A 4FTUA 2BR1A 3UODA 4BCMA 5KMLA 2BROA 4Q2AA 4I4EA 3KULB 4DTAA 2UVZA 4D58A 1Q4LA 4Y5HA 1O9UA 4UMTA 4ANBA 3CKWA 2FA2A 5I3RA 2EU9A 1B39A 1H24A 3K3JA 3C0GA 4QP1A 4DCAA 4G3CA 3GCUA 4XV9A 1OIQA 2CKEA 3ULZA 2O0UA 2YIXA 3W2SA 4EORA 3D4QA 3EQDA 5DN3A 2PSQA 2PZRA 4OGRA 2W5BA 5D11A 3OS3A 2ZV7A 3T9IA 5LVLA 2VWBA 4U8ZA 3W2PA 2XKFA 3NGAA 4FSTA 4CYIA 2QOCA 4EOIA 3VS5A 1Q3WA 3EJ1A 3EQRA 3COKA 3RK7A 3NUNA 4F7JA 2QONA 2XIZA 4BTFA 3UP2A 4W9XA 2WMTA 2YEXA 4ZJIA 1GZNA 3V01A 3VS1A 3ATSA 2BFXA 4C3PA 4I6BA 4F9BA 1MP8A 1PMNA 4EH6A 4B9DA 4C59A 3UE4A 4BICA 3NUPA 3QLFA 4RWLA 3VW6A 4U43A 3A8WA 3CPCA 4QTDA 2YM7A 3KRRA 3TV4A 4CXAA 3SG9A 1OPKA 2XBAA 4LRJA 2BZKB 3Q9YA 4D1XA 4RIXA 1EH4A 1PMUA 4FEQA 3UQGA 4EH8A 3HGKA 2PVYA 4KS8A 2OU7A 3CKXA 3R6XA 4I6FA 3R0TA 4FKGA 4CMOA 3ETAA 1ZYLA 3CXWA 4I23A 4MBLA 5IA4A 2YABA 4QNYA 5IU2A 3LLTA 5K9IA 3VUIA 4FT5A 2UW7A 4CD0A 3F2NA 1WZYA 4CKRA 4FVQA 2W9FB 3QUDA 3EN5A 3Q6WA 4U0IA 3LJ0A 4U80A 3RNYA 1JKLA 2HYYA 3DS6A 4IQ6A 3QBNA 4OTDA 4TTHB 4O82A 4TT7A 1HOWA 1G5SA 1XHAA 4JIAA 4G1WA 4R7IA 4ARKA 4YUQA 4YNOA 3R71A 5FBNC 4MVFA 1Q62A 2W1DA 4S2ZA 3E87A 3F3ZA 4OTPA 2P3GX 3KGAA 1AD5A 3G90X 4FV3A 3KQ7A 3VBWA 3RAHA 4AZWA 3UZTA 4JAIA 2FH9A 1RQQA 4DEAA 3FYJX 4DEBA 2UW8A 2R3IA 1OPJA 5F1ZA 3O51A 4ZEGA 2W1ZA 4YTHA 5AR7A 2BIKB 2XK3A 4LL5A 5C4LA 4JR3A 3F5UA 3OFMA 3P7CA 3SXSA 3R02A 2WAJA 4FZDB 2XB7A 2XIKA 3QTSA 4E6DA 3PPKA 5IPJA 1YW2A 3OY3A 5AUUA 4XS2A 4JIKA 3TZ8A 3ZU7A 3PIYA 5B0XA 2P4IA 3SC1A 4ACDA 4ANNA 3RNIA 2J0JA 4Y85A 3O8PA 4R7BA 3HV6A 3OF0A 4IVBA 4M12A 1ZMUA 3UMXA 3KMWA 4D55A 4DG2E 2HZIA 2OO8X 4RIWA 1DS5A 5CSVA 5FM3A 3N4VA 3O7LB 2ITZA 3OG7A 3QUPA 4XG3A 3HV7A 4RT7A 3CE3A 3F9NA 4HPUE 3UVPA 4BKYA 4QPMA 5HX6A 3S00A 4QMPA 5AAFA 3DJ7A 3RBWA 2OBJA 4MAOA 4IZ5A 4TW9A 5HGIA 3UC3A 4BGHA 4MCVA 5EH0A 4FT0A 3R8PA 2CN5A 2HIWA 1OITA 1ZZ2A 4ZTLA 3HVCA 3TN8A 1WMKA 2XK4A 2Y8OA 5DRBA 4TWPA 3TNQB 5LXMA 3C5IA 3C0HA 2NRUA 2QHNA 4XP2A 4DGMA 2XH5A 2XK7A 3FMMA 3R73A 1YOJA 1Y8YA 4O7RA 1H27A 4NYEA 1BUHA 4F9WA 4ZTMA 3VBVA 2UZUE 4FSUA 2W7XA 3RK9A 3VS0A 3ZOSA 4O84A 3BLQA 3NVMB 5JGBA 2F7ZE 3WF9A 3UO5A 4ZSAA 2UZNA 4DN5A 1JKTA 1H1PA 2BRMA 4UALA 4LI5A 3FZSA 3B8QA 2QCSA 1HCLA 4OLIA 4HNIA 3LFDA 2DS1A 1JPAA 2OICA 3AG9A 5HVYA 4H58A 4CZTA 3DK6A 4QP4A 5JQ5A 4XX9A 5CAUA 4UXLA 5B2KA 3FLSA 4NW6A 5BYYA 2ETKA 2YDKA 4FEXA 3ZC5A 1H1SA 2HENA 3BEGA 3DPKA 3MGYA 1YI6A 3ZZWA 3A7HA 5AP7A 5I0BA 4IDVA 4I93A 4IJPA 1E1VA 3RPOA 3SX9A 5M06A 4D2SA 3ZLYA 5JZNA 4IE9A 3A7IA 1BMKA 4J97A 4AGUA 2A1AB 1IAJA 4YR8A 4D2RA 2R3LA 3TZ7A 4DCEA 5CZIA 2I7QA 4J99A 4IAIA 5LARA 2P2HA 3AC3A 5IQCA 1ZYJA 3BV2A 2QOOA 4NKAA 3DAKA 4BKZA 4FA2A 4FTLA 4C7TA 3POOA 4YPSA 1VEBA 5CX9A 3P78A 3LM5A 1UNHA 4Y72A 4KABA 3VBQA 2WOTA 3CTQA 1PXJA 2HWPA 1V0OA 3EOCA 2NNWB 3IGOA 4GK4A 4GJ3A 4F64A 4E4LA 3UC4A 2WPAA 4RVTA 5AAGA 3HL7A 2PMIA 4WG4A 5A4EA 4BIBA 4PMMA 3V8TA 3EYGA 5A6OA 3IQ7A 4AA5A 5FUTA 2C3JA 5FEDA 3KU2A 1MUOA 2JBPA 4RX7A 3QQJA 3VS6A 4UMQA 1YHVA 3TNWA 2V22A 2J51A 4UBAA 4C33A 3EH9A 4FV4A 4QT1A 4ASXA 4EONA 3R1SA 4FNYA 2RG6A 5L6OA 4MXYA 4R78A 2X2KA 3DNDA 2UVYA 4AFJA 3HV5A 5CAOA 3MVHA 4G17A 1KE5A 5HVJA 3DBCA 3TG1A 4IB3A 4ZY5A 4WRSA 3WILA 5JMSA 3KULA 3D9VA 3QCXA 3SXRA 4OTIA 2OJIA 4BI2A 2J9MA 2FSTX 3CC6A 4FZAB 5ETCA 4IAKA 5I9YA 5LWNA 3S4QA 4EBWA 5I5ZA 4FKUA 3LPBA 3HX4A 4OTGA 2OFUA 2ITXA 2WFYA 3OXIA 2FYSA 4WBOA 4XLIA 3VBYA 3DV3A 1OL6A 4QMZA 2WXVA 3IOPA 4PDYA 2CNVA 4BGGA 3PA4A 1JSTA 3VAPA 3FQEA 4O7TA 4Z7HA 1P4OA 2C6IA 3IW8A 3NW5A 3QZFA 2OJGA 3O0GA 3V5QA 2QODA 1YXVA 2QOFA 1CTPE 3A7JA 3AXWA 3NX8A 3A60A 3F82A 2W0JA 5HKMA 4MD7E 5EQEA 3FLQA 4FKPA 5DT0A 1YHWA 2VTHA 4FUXA 4HGSA 3RJCA 4AZEA 3TKIA 3H9FA 4APPA 3NUXA 2ITVA 2JDTA 3FL4A 2XMYA 4KBAA 3ZRLA 4F9CA 2C5NA 5J1VA 1AQ1A 4TWOA 3R9RA 5KE0A 3JS2A 4GS6A 3FMHA 4N6ZA 2X81A 3H30A 3LMGA 2YDJA 4YBJA 2YJRA 1Y91A 3RWPA 4DTBA 1YRPA 4KAOA 3UZRA 1ZARA 5HNBA 3TZMA 1QPDA 2GNLA 2WB8A 4EOMA 5I9VA 3VUGA 3FQHA 4YURA 3FPQA 5BYLA 4UWBA 4EWQA 5KMNA 3PG1A 1PKDA 3GU4A 3OWPA 4GU6A 4XCUA 3W8LA 3FI2A 4LMNA 2F7XE 4FKRA 4OBQA 4BDAA 4C2WA 4CFMA 4ONAA 3UYSA 5GNKA 3RAKA 5E9EA 5CSHA 4KIKB 3RM6A 2VTSA 4QMMA 4FV5A 1FBNA 1GZ8A 2LGCA 5E4HA 2HY0A 3VRZA 3CCNA 5HO7A 4L46A 3EL7A 2W1IA 4TY1A 1M52A 3KKVA 4KWPA 1IASA 4RFMA 2BFYA 2F7EE 4S31A 4F08A 3K5UA 1FVVA 2H34A 3FQSA 4EH3A 2BDJA 5M4FA 3CTJA 3H9RA 4XLVA 4XRJA 5AV3A 2G2FA 4EZ7A 1CSNA 2RKUA 2P2IA 1Q8TA 3BKBA 1OKYA 3H4JA 3RZBA 2UW5A 3UQFA 4Z55A 1X8BA 3PG3A 4BIEA 5DVRA 4FUYA 2C6LA 3EQCA 4FGBA 4HYUA 5T68A 4PPAA 5CWZA 3HV4A 3NNXA 4YJQA 3MFSA 3MH0A 4YJOA 3LQ3A 1H8FA 4IEBA 4FYNA 4X7QA 5EDQA 1WBOA 2W4KA 3PTGA 4MQ2A 5CASA 4N4SA 1H28A 2BVAA 1WBVA 3PY3A 4G3DA 5F20A 5L6WL 3UMWA 3VN9A 4R1YA 2V5QA 4JBQA 2ITTA 4PNKA 5AJQA 1VR2A 4ZSLA 3HMPA 3QXPA 3VQUA 2DUVA 1KUTA 3KVWA 5L6PA 2IPXA 4ASDA 4QMYA 5J79A 3VJNA 3G15A 3UIMA 1W82A 5GHVA 1FMOE 1BKXA 3GQIA 2REIA 1APME 3AD6A 5E91A 3E7VA 3TIZA 4O7ZA 3JYAA 1KV2A 2XCKA 4EOPA 4CGAA 1YHSA 4GW8A 4FE2A 1W0XC 3L1SA 4KNBA 2I0HA 4FV6A 2BDWA 2E9VA 4NUSA 2BZIB 3W33A 4ANQA 2Z60A 2XIRA 3PXZA 5D9HA 4EEVA 4RSSA 5FWKK 2JAMA 5AM7A 5A4CA 5EDPA 5HIBA 3QTIA 1SYKA 5ETAA 3NAYA 5L3AA 4BC6A 3FY0A 4R3RA 1STCE 1WVXA 4FOCA 4LRMA 4YJSA 4NM3A 3TXOA 3UO4A 4C4EA 4O7YA 3RZFA 2A0CX 4HVGA 5K0KA 3MFUA 2O63A 3MW1A 3OCBA 3ZSGA 3I79A 3OROA 4BL1A 5AA8A 1U59A 3UQCA 2YM4A 3F3UA 3OBJA 3FXXA 5TKDA 3DB6A 2VN9A 3VUHA 4J8MA 4BI1A 4DEDA 3G9NA 4L52A 5CVFA 2B1PA 4IWQA 4JX7A 5A6NA 5KNJA 4FK3A 3K54A 3MESA 3CGFA 5CI6A 4MXZA 2UVXA 1ZRZA 2HWOA 1PW2A 4LOOA 1P2AA 3O17A 3ZFYA 2XIYA 4FSYA 2XNMA 1NA7A 1XBAA 2JKOA 4I4FA 1F0QA 2WIPA 3JVSA 2GNIA 3II5A 3NR9A 4LRKA 5DPVA 5C27A 4IB0A 2PMNX 2P33A 1WBTA 2B9HA 3OW3A 4YJUA 3VNTA 3G51A 4JT3A 3MTLA 5EHOA 4O0XA 4M0ZA 5HIDA 2R7IA 3O8TA 1OUYA 4U81A 5IQAA 5IA2A 5E8SA 4IFCA 2BKZA 4DH3A 4TNBA 5LMKA 2CCHA 3NW6A 3QTZA 4IBMA 3VQHA 4CFFA 1GOLA 1TKIA 5JRQA 5BQ0A 2HOGA 4XBRA 5L4QA 4EOJA 4I5CA 3C0IA 4LFIA 5TR6A 4AA4A 4P90A 4BR3A 2Z7SA 3KXGA 1H08A 4E4MA 5LVMA 3BU6A 3N4UA 3P7AA 1U4DA 4BCKA 3FUPA 4KKGA 4GYIA 3DZOA 2VGOA 3NYOA 5CS6A 2WTWA 5TOZA 3R9OA 5AV4A 3MYGA 4E1ZA 5I9WA 4HZSA 4BCPA 4EL9A 2WQNA 3H3CA 4LQMA 4LV8A 5L2WA 4UEUA 3FI3A 2QU6A 4FKLA 4G2FA 3TV7A 2XRWA 3C4ZA 3ACKA 4NIFA 3ATTA 4QYEA 1PYXA 4FTOA 4DEEA 2Z02A 3E92A 3P86A 1GAGA 3PY1A 3QQLA 4NCTC 2C5YA 4USDA 2W1EA 3W1FA 5CZHA 2HXLA 2CGUA 2JDOA 4BDFA 3AOXA 1NY3A 2R3RA 4M13A 2OH0E 2VAGA 5D41A 3BHUA 3IONA 3L9NA 4H3QA 4IB1A 2WNTA 3ERKA 5E92A 1FPUA 1ZWSA 5TO8A 4AE9A 5DHJA 3GU6A 4D1ZA 4NKSA 4EOOA 2JC6A 3HEGA 3QQHA 4FZ6A 5EYMA 3DGKA 3E7OA 4FV8A 4M15A 3MN3A 4DYMA 3OZ6A 4FNWA 4PRJA 5DT4A 4A4OA 4NL0A 5KBQA 2WU7A 4D2WA 2WIHA 1FVRA 1H01A 2QO2A 3CGOA 3CR0A 5GINE 2GHGA 4GFOA 3GT8A 1PF8A 1OB3A 5HE2A 4Y95A 3GI3A 4G3EA 2JKQA 3AC1A 4F4PA 4JRNA 4FTAA 5CXZA 2WO6A 2BIYA 4A4XA 4DITA 1LR4A 1QL6A 2IW6A 3R9DA 4BYIA 4E5WA 3BLHA 1U5QA 1VZOA 3FSKA 4U79A 5DYJA 4RZVA 2C3IB 4CRLA 5GIPE 5DIAA 4JG6A 3PY0A 4PDSA 3GB2A 5E8WA 2Y7JA 2HW6A 2R3KA 3F3VA 3ITZA 2W4JA 4M3QA 5JGDA 4CLJA 4DEGA 2X1NA 1DI9A 3TNIA 2IWIA 2WHBA 4LYNA 2DYLA 3BYVA 3PVWA 3DB8A 4RVMA 5CU6A 5AX9A 3PDTA 3VUKA 3UOKA 4BIDA 3DK7A 2WQOA 4HYIA 3A4OX 4W4WA 3D0EA 5CLPA 3VBTA 2XZSA 4ITHA 5CSPA 5IQFA 3TL8A 1Y6AA 2GFSA 4DEHA 4ZMEA 2XBJA 3P79A 1U5RA 2HZ4A 3KXMA 3PSBA 4E5AX 3BI6A 4YC3A 2W1GA 4BDKA 1ZMWA 3GC8A 3RI1A 3W32A 2YCSA 1H0WA 4NU1A 4IM3A 5KZIA 5TT7A 2W99B 3EN7A 3O71A 5FBOA 4AF3A 5FG8A 1G3NA 4FV7A 3UOJA 2YAKA 1JVPP 4S32A 4E93A 2GNHA 3DCVA 2UZWE 2ITUA 3WF5A 1J7IA 3LKMA 4DGNA 3DBQA 4C4HA 3PIZA 4UWYA 2OJJA 4AN2A 1UU9A 2ITYA 4B7TA 2JDSA 5K0XA 4RZWA 3WYYA 3FY2A 2RG5A 2EXMA 2FVDA 2C6MA 2VGPA 3DLZA 4K0YA 4DT9A 3OEFX 4L42A 3KL8A 3CY3A 2I0YA 4II5A 4KIPA 4MHAA 5FXSA 3RVGA 4DTKA 3PJ3A 4RIWB 3NYVA 3TUBA 2Y6MA 5L2IA 2Z2WA 5JFSA 3WOWA 4RJ8A 1MRYA 3BHVA 1FGKA 3WIGA 5LVNA 3RINA 3ZM4A 4DFLA 2OZOA 3MSSA 4JG7A 5E8XA 4EQMA 3SW7A 5IQBA 5I3OA 3WF7A 5HHWA 4YTCA 3FLWA 2EXEA 3EN4A 3F88A 1XBBA 3GXLA 3WE4A 4GT4A 2UW0A 1W83A 4ITIA 3F6XA 5E90A 1SMHA 5IKWA 2RL5A 5FLFA 2G2HA 3Q4TA 4RGJA 3TNHA 1TQMA 4Y46A 1J91A 3CD8A 4GIHA 5EQYA 3DK3A 4NTTA 3KK9A 3MJ1A 1WBPA 2BRBA 2IVUA 4AXAA 2QO9A 4YO4A 4D4RA 5C03A 4BDGA 5DMZA 1ZMVA 5DGZA 4AGDA 2WMRA 3M11A 4O7LA 3UOLA 3Q52A 3R7IA 1DAYA 3MPMA 4U9AA 4FTIA 4RC4A 4RX5A 5BUEA 1YOLA 1RE8A 4MD9E 4DH5A 3DJ5A 3F69A 1YXUA 4O0UA 5ANOA 4O86A 4G6LA 1VYWA 3KRLA 3CSVA 4V01A 3PP0A 4MK0A 4X2FA 2UZBA 1PXOA 4O27B 4RG0A 1BL6A 4FEVA 2VTNA 3DJ6A 3H10A 3E8DA 4X3FA 4O7VA 4EC8A 5LVOA 4X6QC 3R1NA 5I9ZA 1SVGA 2ERKA 4RLKA 3SLSA 3DBDA 1WBWA 4IVCA 4KB8A 4FVPA 4OUCA 3UNJA 3W2CA 4C62A 4I3ZA 4ZLOA 4DG3E 4JXFA 4S33A 2ZVAA 4O83A 3PA5A 3Q4UA 1OIYA 1BYGA 3CQUA 3ZFMA 4F9AA 4K33A 2Y4IB 4K77A 2ITPA 2UZTA 2R0UA 3EQGA 3VO3A 5KUPA 4EKLA 5DR6A 4ZJVA 3LLAA 3Q4CA 5AUYA 4KD1A 4X3JA 4XG9A 4QMTA 2XP2A 5HG9A 4DGLC 3ID6C 3FMLA 1ATPE 2CN8A 1ZYSA 1LP4A 4EK5A 2PVJA 2Y9QA 2OK1A 3G6HA 3AC5A 3C9WA 3QQKA 4QP9A 3K2LA 5AUVA 3I1AA 2XNOA 3V5TA 2IZTA 2WQMA 4EOQA 4CEGA 1FINA 4CV9A 2QNJA 4OTFA 2WTJA 2VWVA 3ZM9A 2YIWA 4BWKA 1PXIA 3JPVA 4N70A 3NNUA 5EKOA 3F7WA 3TEIA 5K5NA 3UG2A 4A06A 4BDEA 5J1WA 3EB0A 5EOLA 4ZS4A 5KKRB 2JD5A 3KXHA 4EOSA 2VTOA 2B9FA 2E9UA 5HO6A 5AIKA 2W5HA 2HXQA 2YWPA 4TWNA 2BKKA 4FV2A 2X9FA 2YLFA 3HP2A 3MB7A 5GJDA 5EYDA 4QQCA 4AGWA 3AMBA 4FF8A 4QMSA 1H25A 2DQ7X 2JFLA 4MBIA 2X4ZA 3CLYA 3R00A 4P5ZA 5AP4A 3UIUA 4ZY6A 3L8XA 4FTTA 4R5SA 5JFXA 1OKZA 3MA6A 2WMBA 4USEA 1JKSA 4AW2A 3PE2A 4UMUA 3PLSA 1XJDA 5IA3A 1ZZLA 3O23A 1Q61A 4I6QA 3NIZA 5IMXA 4DFZE 5JGAA 3I7CA 3FEGA 5HE3A 3HAVA 5DOSA 3DKCA 4BTMA 3B2WA 4J71A 4Q5EA 4Y5QA 4OTWA 5C01A 4LUDA 1DI8A 2OZAA 3ZLXA 4D4YA 2GPHA 4WBBB 3ZSHA 4FKTA 4RIOA 4J96A 4TNDA 5A4LA 3BQRA 4Y83A 5AP2A 3Q4ZA 2QKRA 1V1KA 3ORZA 4ID7A 4O22A 1YXSA 3ZZEA 2C0TA 3FLNC 3VHEA 3OWJA 4Q9ZA 4BDIA 1VJYA 2CLQA 3QU0A 4MH7A 2HK5A 5L2QA 2WGJA 2F9GA 4JDHA 5DNRA 4H3BA 3I5ZA 3LQ5A 3ORMA 3V5LA 5E8TA 1UU8A 2ZV8A 2R3FA 2YM6A 3IK3A 2C5VA 2X6DA 2IZRA 3PIXA 4OW8A 2WQEA 1OKWA 4GG5A 4QTAA 4QNAA 4AQCA 1YWNA 3AMYA 3QLGA 2BCJA 3JVRA 1O6YA 4M69A 4WG3A 4QTEA 4GT5A 5HU3A 3E8NA 3DQWA 3OMVA 1CKIA 3GC0A 4EC9A 2AYPA 3IOKA 4OTHA 2GHMA 4XHKB 4C57A 4C4FA 1UU7A 4K1BA 5FXQA 1JWHA 1OVEA 4TKSA 2ETMA 4TYGA 4FODA 4FYOA 5HG7A 3MS9A 3TACA 3VVHA 3KC3A 3MPAA 2WD1A 4RC2A 5KKRC 4LOPA 3NUAA 3QKLA 4FBXA 4AS0A 3OOGA 1SVHA 2BRNA 3G6GA 3FSFA 4GT3A 4OR5A 5H8EA 5L8JA 2YM8A 3M42A 5AR3A 4ALWA 5HTBA 2PU8A 4FV0A 3W2OA 3NAXA 2V7OA 5IQEA 3OBGA 4HOKA 3HECA 4JBVA 5AWMA 3F66A 1ZY5A 3EQHA 3QZIA 4MNEB 3UNKA 3MH2A 5IQHA 3SW4A 4JI9A 2KULA 3TIYA 1WCCA 4BDJA 3C50A 5BVFA 3ZXTA 3EFLA 4KBKA 5CXHA 4IAAA 5IEYA 1JAMA 4JDJA 2B52A 5ANJA 1OI9A 4DG0E 4ACCA 4EZ5A 3R7GA 1KV1A 2OI4X 2YDIA 1AGWA 2VO3A 3EFKA 3VS3A 4ACMA 4C02A 1A48A 2BAKA 5HIEA 3P4KA 4D9UA 2ONLA 3EQBA 4I94A 1UNGA 4V0GB 4U7ZA 4XRLA 4CZUA 5IDNA 2PVKA 4IFGA 2ITNA 2ZB1A 3V5WA 2PZPA 4XH6A 1O6LA 3FC1X 4CFXA 2X8IA 3PZEA 3WZUA 4C0TA 3IDBA 5F9EA 1YDSE 3LFEA 1ZLTA 2VTJA 4EJ7A 3VWAA 4BCGA 1M14A 5CANA 2BTRA 2FSLX 2QG7A 4KSQA 2X7OA 4EZ3A 2JGZA 5HLWA 3GEQA 3LVPA 2F4JA 2O2UA 2LAVA 4BZNA 5KMIA 3V04A 2J6MA 3COMA 4QMUA 2JIUA 3W10A 4LGHA 5CT7A 5D7AA 5EW8A 4QQJA 4APCA 1WVWA 3OT3A 5C4KA 3QGWA 3TJDA 3CQWA 5E8YA 3W2RA 3SDJA 4FG7A 3Q04A 3NUYA 2W05A 3FBVA 3OHTA 3UPXA 4B6LA 2Y4PA 2CGVA 4DFNA 3F2RA 1M17A 3HDMA 5IUGA 4JJRA 4ASEA 3IW6A 5JRSA 2BUJA 2X4FA 3D5UA 3FV8A 4YC8A 2HAKA 2VWIA 3OWLA 1J1CA 3R8LA 4YZ9A 3GU8A 4TYJA 5CEQA 4DA5A 5T3QA 4AT5A 1L8TA 1ZOHA 4L68A 5AV1A 2O5KA 1RDQE 4C35A 3LZBA 3R7OA 5HOAA 4C2VA 3OC1A 4DEIA 3PXFA 4ZTRA 2JEDA 3I0OA 5G6VA 2YZLA 1T46A 4AU8A 3KF4A 3D7ZA 4FVRA 3D94A 2QC6A 1Q5KA 2YFXA 4D5HA 3L9MA 3BRBA 4BRXA 1T45A
chains in the Genus database with same CATH superfamily
2A2AA 2WTKB 2KTYA 3TM0A 3RWQA 4CSVA 3FPMA 5I4NA 2WKMA 5B7VA 3VHKA 4W4YA 4FL3A 2OSCA 4C61A 3LM0A 3CJGA 4QRCA 1JBPE 4U5JA 4WOVA 4DINA 1LEWA 4I5MA 4B99A 4BFMA 3O2MA 3R28A 4IX6A 4OBOA 4RMZA 4CFWA 1OBGA 4PUZA 4F6UA 3C13A 4FKOA 4O81A 4NIFB 2IG7A 5JQ8A 3RPSA 2XF0A 1IEPA 3M1SA 4U40A 4CVAA 2VZ6A 3Q6UA 3OP5A 3UYTA 4CT2A 4YNEA 4DH7A 4XMOA 4ANOA 1SZMA 4KRDA 2UW6A 3FI4A 1H1QA 2JDVA 4DGGA 5HE0A 3A61A 5EM6A 3ORXA 4HYHA 2W06A 3TWJA 1ZXEA 4QP2A 4O0VA 2WZJA 1KOAA 2JAVA 4IJ9A 1OGYA 4FZ7A 4L67A 3TUDA 3LXPA 2F49A 1MRVA 3WZEA 4PL5A 3KEXA 4FV9A 3VIDA 2XNEA 4RLLA 2CKPA 2QHMA 3BLRA 3L9LA 4X6RA 5IH4A 1U54B 5FD2A 4W4VA 3EN6A 5ETIA 3GCVA 3KVXA 3BYUA 2P55A 3PYYA 2YIYA 5KZ0A 1P14A 3DAJA 4E73A 5CF8A 4IZAA 3RKBA 4A9TA 5HVKA 5L2SA 5J9LA 4WNKA 1W98A 1H1RA 1SVEA 4RJ4A 3ZRKA 5FP6A 2GNFA 3T9TA 4F6WA 3SOCA 2XNGA 3D5XA 3VONA 4YP8A 2GFCA 2ITOA 2GS6A 4UY9A 5AR5A 3EKNA 5HEZA 4Y8DA 4YSMA 5ANKA 2CSNA 1IA8A 3NNWA 5LMKC 4U44A 1VLRA 2UZLA 3OTUA 2IW8A 5DLSA 3OY1A 2ERZE 4L00A 2PUNA 2X7GA 5KX8A 3QTWA 5DR2A 4M14A 3O5AA 2ZB0A 1NW1A 3NYNA 4A07A 5AIRA 3NRMA 2QD9A 4YZNA 4HVHA 3IO7A 4U6RA 4QTBA 3NDMA 3DKOA 2WTKC 2G9XA 2Y6OA 3QTRA 5J95A 4TXCA 2YERA 3BU5A 4QYYA 3ROCA 5LOHA 4DLIA 2BTSA 1TQIA 2CGXA 4CFVA 1YXTA 5D1JA 5B2MA 4QMVA 4O38A 5CNOA 4HCUA 3A99A 2R3JA 1J3HA 2B53A 4XOZA 1REJA 4BWPA 4WIHA 3QX2A 4FTCA 4OT5A 3HV3A 1H4LA 1QCFA 1YQJA 5CEOA 3EQPA 5CQUA 5A14A 3KK8A 3MVLA 4FV1A 1LUFA 4RX9A 4DLJA 5L8KA 2I0EA 4LGGA 4EH4A 5F95A 3G0FA 4FICA 4G9CA 4BHZA 4BZDA 5J5SA 1V0PA 5M53A 1H00A 4IH8A 3ODZX 2QVSE 4MNEA 1PXLA 2W1HA 4XV3A 3NWWA 4I92A 4IACA 3KN5A 4YHFA 5EI8A 3Q3BA 3QC4A 3LQ8A 2XM8A 2VWZA 2GDOA 5M44A 2Y0AA 5CEMA 2QKWB 1FQ1B 4FKJA 5EW9A 4AGCA 3HDNA 3P9JA 5FTQA 5ICPA 3OCGA 2BAJA 3ENMA 3U51A 4UV0A 5CSXA 3QF9A 4FOBA 4U97A 4F09A 2C6KA 2WMXA 3C4FA 5C8NA 3QWJA 4AQKA 1Q24A 2R3PA 3S3IA 3DOGA 2OWBA 4I24A 1URWA 3LOKA 4HZRA 4YBKA 5IQGA 3GU5A 3FDNA 3TI1A 1XH8A 5EI6A 1ZYDA 5AAEA 1JSVA 4O0YA 3SOAA 4EI4A 2JKKA 4GH2A 3DXQA 1CMKE 2YACA 3H0YA 3PRIA 3WIKA 4V0GA 1KE9A 3D7TB 4F65A 4RA5A 1OL1A 5CEKA 3F5PA 5JEBA 2WEIA 4BCNA 3AMAA 3DZQA 3W0PA 1WBNA 2ZMCA 4FTQA 1OL7A 1XBCA 4I1ZA 4WO5A 3A7FA 3SQQA 2G1TA 4NZWB 3N4TA 4YGAA 4CQEA 2YZAA 2PVHA 3IDCA 1Z9XA 3O8UA 3EZVA 4YJPA 5ACKA 1Q8UA 3BLAA 2IZSA 2J50A 4B8MA 3QRJA 2WMVA 4BVUA 3OUNB 5EG3A 4QMOA 2PE0A 5DWRA 1S9IA 3DTWA 4IWOA 3DU8A 4YTIA 2PVNA 4EHZA 4PQNA 4PTGA 3SV0A 4CTBA 3ALNA 1OUKA 4X3FB 3BYOA 3BZ3A 3IDPA 4NM0A 4WRGA 2VWUA 2XM9A 1UA2A 4UYAA 5KMJA 3PJ8A 2Q0BA 5FP5A 3IECA 4F1OA 3F2AA 4QMWA 3PRFA 5HE1A 1J7LA 2NPQA 5AR2A 2PMLX 4TYIA 1YDRE 3ENHA 4F1TA 3MH3A 4FTMA 4BKJA 4DFBA 3ORIA 1F3MC 3HYHA 4FSQA 4KS7A 4FEWA 4IIRA 2QOKA 4AXFA 4AW1A 3BX5A 2Z7RA 3KMUA 5M51A 3ZLSA 4G16A 2FGIA 2Q83A 2XNBA 5AUXA 4XOYA 5AP1A 5HICA 2QOIA 4EK4A 3QHRA 4ACHA 2BZJA 4DHFA 1O6KA 3GUBA 3LCOA 3LXNA 2NRYA 4JG8A 3HRBA 4LV7A 1W2FA 3BPRA 3QRUA 4C4JA 4O2ZA 3WF8A 3CQEA 2C5XA 2BILB 5GIOE 4MWIA 2BRHA 4L43A 5E1SA 3D14A 4FKWA 3S2PA 5EQPA 3KN6A 3F5GA 5BV3A 2XJ0A 3ZMMA 4FTRA 4EUTA 1J1BA 4LL0A 5J9YA 3CY2A 4QTCA 3FLYA 3ZSIA 4AN9A 1Y6BA 5EYKA 2PE1A 3F3WA 4IX3A 2YA9A 3UBDA 4FMQA 4FTNA 3U54A 5FM2A 5CENA 4IHPA 1R0PA 4BTKA 2W1CA 5CQWA 3I5NA 2C0IA 3UDSA 4FI1A 2R2PA 1OL2A 3NMUF 2XRUA 4IAYA 4O7NA 3FYKX 3LFFA 2UZVA 4GMYA 4I22A 4NFMA 5ANGA 2VNWA 2F2CB 3SVVA 3I60A 4ZLYA 3DXPA 4B0GA 5JFVA 2YAAA 3PXRA 5KMKA 4G5JA 2V62A 4JAJA 5EFQA 2HCKA 5J7HA 3CTHA 3NZ0A 4QP3A 5K4JA 4BI0A 1XMMA 4BZOA 2QO7A 3Q2JA 1G8AA 2PMOX 5EKNA 2OIQA 3WZDA 1P5EA 1XH6A 1GNGA 4J98A 1FVTA 3MWUA 3QWKA 1ZYCA 4O4FA 3KRXA 5EW3A 5HG5A 3W2QA 3I4BA 2OZAB 2AC3A 3PXQA 4P2KA 4AG8A 2VD5A 1PY5A 4CFNA 5LVPA 2IN6A 4CLIA 2CDZA 3VS4A 4EBVA 3GCPA 3QRIA 4X2KA 4IX5A 3COIA 4EUUA 5LMAA 4RVLA 3NYXA 4YLLA 3PE1A 4FIFA 1U54A 1KE6A 3PP1A 4ZZOA 3F7ZA 2VTQA 2CLXA 3MFRA 4GFGA 3KY2A 2R3MA 3QD4A 3W18A 3MDYA 4QYFA 4JBOA 5A54A 5BMMA 3VUDA 3UO6A 5JN2A 2ACXA 2E2BA 2PK9A 4BBFA 2FO0A 1KE7A 4PF4A 2UZDA 3MA3A 5TE0A 1OPLA 3QQUA 2YITA 3B8RA 4PMPA 3C4CA 4M69B 3EKKA 4HGTA 3B2TA 1WAKA 1WVYA 5IG1A 1M2RA 3U55A 4CKIA 4L01A 2F2UA 4BB4A 4AZTA 2GQRA 4PV0A 4UMRA 3FXWA 4DFYA 3CD3A 3FC2A 4PP9A 2A98A 3EHAA 3UIXA 2ZV2A 3GBZA 4ZTQA 4D2VA 2X7FA 4E26A 2Z7LA 1BI7A 4M8TA 3QD2B 4PL3A 2B4SB 3SKCA 5IUIA 3ALOA 4D0WA 5AADA 5HORA 5C26A 4K9YA 4I21A 5DFPA 5HX8A 2HW7A 5DA3A 4NM7A 1YVJA 2V7AA 5HTCA 4XG4A 4GK3A 3D83A 4XJ0A 3T3UA 2BPMA 2OIBA 5IA5A 2VTLA 3G5DA 5KHWA 2H9VA 2IO6A 4IAFA 3EIDA 4RJ6A 4Z16A 5IA1A 3LFQA 1G8JA 3BELA 3FMNA 3R2YA 4GUBA 3FMEA 2ZM1A 4XYFA 3C5UA 3KA0A 4JLCA 3V8WA 1JSUA 2CJMA 2RSVA 3PPZA 3REPA 1UNLA 1Y8GA 1K2PA 3BGPA 2XEYA 3RPRA 3SXFA 4A9YA 4ZY4A 4X2GA 5AP3A 2H6DA 3FI8A 4O7WA 3Q5IA 2J0MB 3QCSA 5HNIX 5BVNA 5M57A 5HI2A 2VTRA 5C8MA 1CKJA 2EUFB 3GCSA 3FE3A 5DBXA 5KMMA 2BHEA 3CBLA 2WU6A 2R3QA 4IWPA 4QDVA 5GJFA 3PJCA 3W16A 2ZJWA 1I09A 3DKFA 3PWYA 3WARA 3ZS5A 4TL0A 1Q97A 5BNJA 4O7SA 4PPBA 4DBXA 4ZMFA 3LJ1A 3PFYA 2R5TA 5AUWA 3HA6A 2XS0A 1KE8A 3QTQA 4TZRA 4C8BA 5F4NA 3UIBA 1PXMA 2YIQA 2R0IA 4FX3A 3UG1A 4UMPA 5CU4A 3ACJA 3PZHA 4JL9A 4ALUA 4I0TA 4ZS0A 5AMNA 3ZUUA 4DHZA 3Q9ZA 4DC2A 3KCFA 4O91A 3Q60A 4GL9A 3QCQA 1QPJA 3AT3A 3Q53A 3FZ1A 4RC3A 4ZTSA 3PVUA 2EB3A 2BZHB 3D7TA 4J53A 3VUMA 3ZUVA 4BCJA 4CG9A 4HJOA 1XQZA 2W5AA 3QCYA 4E6QA 2R3HA 4CCBA 1NXKA 3SGCA 1K3AA 1R1WA 5ANIA 3GENA 4G9RA 5ANEA 3GGFA 3A8XA 3RAIA 2VX3A 4MNFA 4AZFA 5FQDC 2A4LA 1Q8WA 4C38A 2J0LA 2J4ZA 2PVMA 3NSZA 3QXOA 4IZYA 4UX9A 2OIDA 1CDKA 3CJFA 4FIJA 3WZKA 2JIVA 2XKEA 5DRDA 4AX8A 3LIJA 2UW9A 2HZNA 4ENXA 1Z5MA 2WMAA 4EKKA 3MVJA 4EOLA 3NCGA 5LCKA 3RHKA 2CNUA 4CTCA 4KBCA 3R7EA 4HVIA 2IJMA 2QR8A 2PVLA 2G01A 3QGYA 3RMFA 4FTKA 5E8VA 4BBMA 2X9EA 4I5PA 3JXWA 4BCHA 2IW9A 1UV5A 3O7LD 4JS8A 3D15A 3PVGA 5J8IA 4A7CA 4CFUA 3R22A 2VV9A 3G33A 4FSWA 4F70A 5KMOA 3QD0A 2YJSA 2RFDA 2B55A 4NCTA 3BWJA 4GKHA 3LFCA 3MIYA 5GJGA 3E63A 2Z7QA 3MI9A 3NIEA 3KRWA 4MX9A 3U9CA 5KO1A 4N57A 3R8ZA 1MRUA 5LWMA 3AC4A 5JKGA 3V5PA 5DEWA 2WTCA 2ZOQA 3I0QA 4GRBA 4NK9A 4DHJA 3PJ2A 3NCZA 5BMSA 3R2BA 5IF1A 3LFAA 1GJOA 2VTPA 2UW4A 4L8MA 5A3XA 4AP7A 2PZIA 2SRCA 4KIQA 3TV6A 3KFAA 3W0SA 2YIRA 1XWSA 4FSNA 2ONLC 5HG8A 5H9BA 4B4LA 4A9SA 4USFA 2WMQA 2IVSA 4DF3A 3TDWA 1WFCA 3NFFB 3Q9WA 1PKGA 4AAYA 4YZCA 4FIIA 4ZXTA 2ZM4A 4EYMA 3OTVA 4M84A 2YCFA 4FSRA 3Q9XA 3KXXA 4IMYA 3F61A 4CYJA 3EFJA 4CNHA 4EWHA 3ZEPA 1UWJA 4R77A 1DM2A 1PHKA 2XYUA 3HLLA 1XH7A 4WA9A 1R3CA 4D2TA 4HVDA 3DLSA 4MWHA 4HNFA 3OCSA 2O64A 3OEZA 4IANA 5CU3A 5H3QA 4AOJA 4PP7A 3ULIA 3ORTA 3HNGA 4L44A 2X8DA 2QURA 3I6UA 3TKHA 2YCQA 4YTFA 1E1XA 3VULA 4F6SA 4QYHA 3QQFA 5GZ8A 3MBLA 2X39A 5CAQA 3SAYA 4FNZA 3TZ9A 5H2UA 2CKOA 3BE9A 3MIAA 4HYSA 4NT4A 4QQTA 2I40A 2QG5A 2BDFA 4W9WA 1NVRA 2VNYA 3EN9A 4WHZA 2PHKA 4QMQA 4G3GA 3BGQA 2PTKA 2XNPA 4I6HA 4MD8E 2C6DA 5EOBA 3AKJA 5TF9A 4E8AA 3CEKA 4QPAA 3OW4A 4IWDA 2AC5A 2OH4A 3FHRA 5AX3A 4FL1A 4ANLA 3NNVA 2PULA 4RJ5A 1IRKA 4H3PA 3QKMA 4RJ3A 1RJBA 2ETRA 1OZ1A 2Y4IC 3CIKA 3ODYX 4QYGA 4BHNA 4FG8A 2XK8A 4Y73A 2XKDA 3LAUA 3ELJA 4G6NA 4O2PA 2XJ2A 1OL5A 4F63A 3JY9A 5M08A 3BYSA 4NH1A 4WUNA 2QOLA 1PMEA 2EB2A 1QPCA 2UZEA 4XUFA 4K8AA 3IW7A 4BDHA 1NT2A 4DFUA 1BX6A 4AN3A 5CALA 2UW3A 2J7TA 3ZH8A 3F5XA 3VBXA 4DBNA 3RAWA 5ETFA 2XCHA 4FSZA 2GU8A 2X2LA 4LOQA 3UNZA 1Q41A 4PY1A 4IC7A 5BX0A 2PUPA 5DI1A 3QC9A 4ENYA 4IB5A 5HNGA 5FTGA 1R78A 2NP8A 3P0MA 2H8HA 1ND4A 4DDGA 3Q96A 2VX1A 4I20A 3UGCA 3DKGA 4V05A 4DT8A 5CAPA 3L8VA 4S30A 2FB8A 2JKMA 2PZYA 3AC2A 3E8EA 2R4BA 3HMOA 5CYIA 1SNXA 5IA0A 4HPTE 4ZSJA 4FIEA 3V51A 3E8CA 4WT6A 5BVEA 1OIRA 1PYEA 3PLAE 2RFEA 4NWMA 5BVWA 4EH9A 4IW0A 3PSCA 5CVHA 3LE6A 4FZFB 3VS2A 2IEWA 4QMXA 4E4XA 3ORPA 3S0OA 5CF6A 3VS7A 4D2PA 4UZHA 2PE2A 1G8SA 1L3RE 1UU3A 5BVOA 3A4PA 3NW7A 3FHIA 4JOAA 4AXCA 4ASZA 3W0QA 2R7BA 4UZDA 5E8ZA 3R8UA 4JVGA 5EDRA 2OFVA 3R9NA 3TKUA 3ZO3A 2WELA 3QQGA 3QRKA 4G6OA 3U87A 3R8MA 4RQVA 1S9JA 1YXXA 2PUUA 2EVAA 4GFMA 3FXZA 2BHHA 2GCDA 4LGDA 3EYHA 3KXZA 4YLJA 3R21A 4H1MA 3OXZA 3GC7A 3NUUA 3IKAA 1LEZA 1Q8YA 1ERKA 4U45A 1YWVA 4U41A 3TNPC 1OMWA 3AGLA 4R6VA 2O65A 3FL5A 5JFWA 4PPCA 2VRXA 4JDIA 3ZCLA 4M7IA 4DFXE 4PDPA 4CMTA 4Z7GA 2B0QA 2YM5A 3W8QA 5IDPA 3HRFA 2W17A 2W9ZB 2WTDA 3A62A 4GIIA 4O0RA 3TCPA 4HVSA 5HD4A 2XK9A 3DT1A 3SRVB 3RGFA 1R0EA 5I9UA 4C37A 1H0VA 2X2MA 3JY0A 1Z57A 3HMMA 2VWWA 2VTMA 4YJVA 3H9OA 4GU9A 3FZRA 4MF1A 3QTUA 2XKCA 5T6KA 3AD5A 3HUCA 2UZOA 4K11A 3ZEWA 5IMEA 4JQ7A 4ZTNA 4H36A 2PVRA 2C1AA 1TVOA 3QALE 5EM5A 4TYHA 3U9NA 5BUJA 4WNPA 4DH1A 3DY7A 4E6AA 1MQBA 3KXNA 3OD6X 4IZ7A 4M67A 4XV1A 3EMGA 4F1MA 5JH6A 2WMUA 4CKJA 1URCA 3PA3A 4MQ1A 3QZGA 3I6WA 3LCSA 3WZJA 5CNNA 3H0ZA 3HMNA 5EHYA 3TTJA 2PVFA 3BHTA 4JDKA 1G8KA 3ANQA 4EOKA 4RWKA 1H26A 5D10A 3OVVA 4O21A 3W55A 5M09A 3R9HA 4FIGA 4I0RA 4RBLA 1YI3A 2ZAZA 3NS9A 4GVAA 3OT8A 3ORLA 3FWQA 1XH9A 1YWRA 3MY0A 4FL2A 4AACA 4L3PA 4FJVA 5JT2A 1V0BA 2E9NA 5H8GA 4PMTA 2R3NA 5HLNA 2XUUA 2B7AA 3QL8A 3UJGA 4WSYA 3SD0A 5CEPA 1REKA 3BE2A 4OAVB 5LQFA 3R7VA 1PRYA 4FR4A 4YZBA 4YZMA 4C36A 5HTIA 1GY3A 5A9UA 4YHTA 1UKHA 3NEWA 5DT3A 4G34A 4L7SA 2OF4A 5EK7A 1JLUE 5HD7A 2PYWA 4ORKA 2GMXA 1UVRA 2FUMA 2YWVA 4J7BA 1QMZA 3ZDUA 3BEAA 1YDTE 3L8PA 4JX3A 5E8UA 2RFSA 2FSMX 3TDVA 3FMDA 2HY81 4KSPA 4RVKA 3LXLA 3Q32A 1GIHA 5E7RA 4IX4A 1I44A 3U6HA 3ZBXA 5FRIA 3R01A 4MXAA 5HU9A 3KIOC 5BVDA 2W96B 2ZDTA 4A9RA 4FGRA 3GU7A 4MKCA 3MY5A 4LUEA 2YISA 3QA0A 5DR9A 2B9JA 4U3ZA 4MXXA 1VYZA 2XJ1A 5IH6A 3HUBA 2VO6A 4RIYA 3ZO1A 3NUSA 5AA9A 5FDXA 2V0DA 2GTMA 4RJ7A 4MUQA 5EI2A 4DAWA 3VF8A 5FTOA 4UWCA 2OXXA 4ZOGA 3ZUTA 2C0OA 2G2IA 5BPYA 4AZSA 3UPZA 2RGPA 4GEOA 3FZPA 1OIUA 2EWAA 1PXNA 1W84A 3AQVA 4BCFA 3FKNA 3DA6A 5I9XA 4M97A 3LXKA 4XV2A 3ZXZA 5HLPA 5LJJA 2WTVA 4ERKA 5M56A 1GIIA 2QOQA 4PMSA 3PWDA 4MXOA 1NVQA 1Y57A 3ORKA 5CEIA 4EK6A 2C6TA 3ZBFA 1SNUA 2DWBA 2X0GA 4AZVA 4S34A 4FEUA 3PJ1A 4D28A 4E3CA 3R7UA 4RWJA 4YMJA 4ZAUA 1GZOA 4CG8A 1JQHA 4E5BA 5L2TA 3P5KA 4GYGA 3JR1A 1XH5A 2J0KA 5M55A 4CQGA 2PY3A 2OW3A 4PTEA 1NVSA 2JFMA 5HBHA 4YHJA 5J7BA 5M4UA 5KCVA 2Z8CA 3MPTA 4TN6A 1ZOGA 1HCKA 3RP9A 5CU2A 2XEZA 3QD3A 5CSWA 4QP7A 2VTTA 5AFVA 5AR8A 3HAMA 4YU2A 4ANSA 3AC8A 4F0GA 1PXKA 3LCKA 1B38A 4YJNA 3WF6A 4LMUA 4K18A 3UDBA 4W4XA 4F0FA 2RFNA 5DE2A 3ZYAA 4FKVA 3UTOA 3LFSA 3GOKA 3HMIA 2XK6A 3MV5A 1H1WA 4F7SA 2GNJA 1PMVA 5EM8A 1IA9A 5HZNA 3E5AA 4RFZA 5M07A 5AM6A 4IXPA 4O1OA 3COHA 3QKKA 4IAZA 4HGLA 4IVAA 4M68A 4QEBA 5BYZA 3V5JA 4KUJA 3BCEA 3L8SA 2VTIA 1WBSA 4P5QA 4C4IA 4H05A 2J90A 3IW5A 2ZV9A 4IVDA 4RX8A 3R8VA 3R83A 4QPSA 2C68A 2JDRA 4JNWA 2EXCX 3BWFA 3FZTA 2CPKE 4JMQA 2UV2A 3E3PA 4BF2A 3LCTA 2O3PA 3R7YA 1GZKA 2R64A 4JQEA 5L8LA 1M2PA 3G2FA 5IQDA 2PPQA 2QOHA 3SG8A 5A46A 4IDTA 1M7NA 2H96A 1W8CA 4QD6A 2IF8A 4XP0A 4W8EA 4CCUA 4X21A 3MJ2A 2QQ7A 4ZZNA 3GQLA 3VRYA 4WG5A 2CHLA 3BHHA 3P23A 5J5TA 3RCJA 3R1YA 5A4TA 4P4CA 5M4IA 2XIXA 3U6JA 4ZSGA 5JSMA 3DDQA 3QFVA 3E88A 4KKHA 2I1MA 2VU3A 2CMWA 3MTFA 4Q5HA 3CP9A 4U3YA 4EH7A 2GQGA 2W1FA 1Q3DA 3EQFA 2HELA 4D0XA 4EK8A 4QP6A 4EH5A 3GP0A 2BAQA 1XKKA 3ZDIA 4C3RA 4C58A 2RF9A 2OG8A 4NJ3A 5K3YA 3WYXA 3C7QA 4KA3A 5B2LA 5DEYA 2ZYBA 2OKRA 3KF7A 4FKIA 4ZSEA 3RPYA 1IAHA 3M2WA 4EHEA 4GJ2A 4RA4A 4WKQA 3OXTA 3D2IA 1CKPA 4HCVA 3QHWA 4GSBA 4LM5A 4AOIA 4TWCA 3QYWA 3W0OA 5H8BA 5IEXA 3SRVA 2VTAA 3HP5A 5K4IA 3LJ2A 1QPEA 3NPCA 4OTQA 4WUAA 4D4VA 5IH5A 3VF9A 3DBFA 1OECA 4FT3A 4R8QA 3V6SA 4UN0C 2IVVA 1Q8ZA 1YOMA 2CNQA 3GFEA 2E9OA 4RWIA 3V8SA 3D5VA 4FNXA 5HCYA 5HCZA 3EZRA 4L3LA 4N6YA 3AKKA 1IR3A 4C3FA 2B9IA 3DAEA 4NFNA 2GS7A 3MB6A 3TT0A 1YKRA 3GC9A 5IZFA 4G5PA 4ZLZA 3GNIB 4BGQA 2RIOA 4BTJA 5JK3A 2WEVA 3V6RA 1R39A 3I81A 5JZJA 3TUCA 4I0SA 3LCDA 4PL4A 3IW4A 4FT7A 4I41A 3UOHA 4CT1A 2ITQA 4BDCA 2J0IA 2X6EA 2X8EA 3HZTA 2F57A 3E93A 3KMMA 5FEQA 4CV8A 1KSWA 5GZAA 4PTCA 4K2RA 3ZRMA 5CF4A 4WD5A 4B8LA 4E6CA 5LMBA 5F94A 2R3OA 2GTNA 1UWHA 4ZIMA 4X0MA 3UVQA 2O8YA 3GVUA 3O96A 4YC6A 4Z3VA 3KREA 3G0EA 3OCTA 3R63A 1XR1A 5EHLA 3RTPA 3UP7A 1OM1A 4RQKA 5FXRA 4YO6A 5CT0A 4GCJA 2FSOX 3P5JC 3N9XA 4MYGA 2YM3A 1OKVA 4MF0A 4YLKA 4ZZMA 3ZO2A 3BGZA 1U46A 2J5EA 5G1XA 4AT3A 4MBJA 3Q5ZA 4EHVA 2W4OA 2XVDA 4BN1A 5HQ0A 4QOXA 3D5WA 4XNEA 3IS5A 4R1VA 5HESA 4WNOA 4FK6A 2C3LA 4X2NA 3BIZA 3EFWA 2C3KA 2ZM3A 3S1HA 3R30A 5AP0A 4BDBA 4E7WA 1FMKA 5AR4A 3PUPA 3U6IA 1PJKA 5IUHA 3AT2A 3GCQA 5K5XA 1A9UA 3JUHA 3VW8A 4HCTA 3L9PA 4BCIA 2ITWA 2OJ9A 1A06A 4QMLA 2JLDA 3QYZA 5AP5A 2AQXA 4KIOA 1BL7A 3TJCA 4ZJJA 5DH3A 2IVTA 5CI7A 4XG8A 4AUAA 3DTCA 2J2IB 1TQPA 1XH4A 3MVMA 5AUTA 2CKQA 2XNNA 3BYMA 5E1EA 3DQXA 3MH1A 4TRLA 4X3FC 5HO8A 2WOUA 4WNMA 2VO7A 4YJTA 5J9ZA 2WQBA 4IC8A 4AFEA 2C47A 3FLZA 3ORNA 4D4SA 2YCRA 4L45A 5KHXA 3S95A 1XO2B 3EWHA 4J8NA 5D7VA 4OT6A 4L9IA 3WE8A 3K5VA 4BYJA 3NLBA 4ITJA 4EQCA 4HW7A 3FAAA 4O0WA 3KRJA 3AD4A 1K9AA 3ZTXA 4EH2A 2QLQA 2JIIA 4O96A 4EQUA 3LFBA 4H1JA 1DAWA 3VUTA 4NW5A 4AAAA 4DGOA 5FDPA 4YJRA 1BLXA 2G15A 4I5HA 4JRVA 4BCQA 4EHGA 3FZOA 4NJDA 2GS2A 3R1QA 3U8WA 3DFCB 3F3TA 4O6EA 4RRVA 4GG7A 4F0IA 4J52A 1JOWB 4ALVA 5AV2A 4XG6A 3ZC6A 2R3GA 2C30A 3C51A 5C9CA 4CMUA 2WMSA 3MFTA 3E3BX 4F9YA 5A4QA 5HBJA 3C1XA 3ZO4A 4Z9LA 4UB7A 5FEEA 4YZDA 3W0RA 2OLCA 3ET7A 3OOMA 4GV1A 4MXCA 1OGUA 2ZDUA 3K3IA 1M2QA 1FGIA 4JR7A 4O1PA 4D1SA 3A7GA 4L53A 5EYCA 1BI8A 3THBA 5CTPA 2B54A 3C4XA 2QLUA 3ZFXA 2I0VA 3C4WA 3GFWA 2ESMA 5CVGA 4FSMA 4BCOA 5CU0A 4UYNA 3U4UA 5AP6A 3BBWA 4XBUA 4XG2A 4RIXB 3BQCA 4NM5A 4O6LA 1B6CB 1RW8A 5GZ9A 1CM8A 3E62A 3HA8A 3E64A 4XP3A 3BU3A 3ANRA 4TYEA 3C4EA 2XARA 4GK2A 2OJFE 2WTIA 1FOTA 1F5QA 3QX4A 1LPUA 5C1QB 1E9HA 3DNEA 4NEUA 3PSDA 4KKEA 4JBPA 3ZHPC 3RPVA 2QR7A 4C4GA 4RFYA 4KIKA 4FKSA 4N0SA 3UZPA 4QP8A 3EQIA 4FKQA 4PDOA 3BBTB 1UKIA 4K6ZA 4A4LA 4CRSA 3OUKA 3AGMA 4R3CA 3RALA 2IZUA 2WMWA 3QTXA 3ROYA 5AEPA 2GQSA 1KOBA 3RK5A 4TPTA 3QUEA 3DXNA 2BALA 4L6QA 4JQ8A 4YSJA 3VJOA 3T3VA 4O0TA 2JITA 4GVJA 3O50A 5IEVA 4ANMA 2C1BA 1KWPA 4KRCA 5C8KA 3R04A 4P7EA 2XYNA 2V55A 1ZOEA 2C69A 5IISA 2BMCA 1H07A 2C5OA 2ZMDA 4G3FA 4ZTHA 5HCXA 5ACBC 3AT4A