1XBBA

Crystal structure of the syk tyrosine kinase domain with gleevec
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
277
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title A Novel Mode of Gleevec Binding Is Revealed by the Structure of Spleen Tyrosine Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xbbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xbbA01
4WRSA 3L8XA 3GCSA 3V04A 2YACA 4FSWA 3F5XA 3OT8A 1DAYA 4YJRA 3GB2A 4H1MA 4DTBA 1JOWB 4EUTA 3KKVA 2IW9A 4AA0A 3QQHA 5EHYA 4ANNA 3FMJA 3OWPA 4WSQA 5M57A 2ERZE 5AP4A 5A3XA 4EH3A 4ARKA 2HY81 3R1QA 3VRYA 4BCHA 4ZMEA 3HL7A 3NYNA 3UZPA 3FZSA 3ZZWA 4BGGA 3QU0A 3UQFA 4CG8A 3FZOA 1YW2A 4IZAA 5CU4A 5KBRA 2EB2A 3MI9A 3EZVA 3GFWA 5DIAA 3EQDA 4QTCA 4OGRA 4UMTA 1YI4A 4EOPA 3KK8A 3RPYA 4Y5HA 2WMRA 3VF9A 4E6QA 4IZ5A 5FDXA 3GOPA 2UZLA 4EHZA 1GAGA 3EMGA 5EYCA 1B6CB 3LFFA 4QQCA 5C9CA 1J1BA 3O71A 5EOLA 4AT3A 3EOCA 4G31A 4XV2A 3RMFA 2J6MA 4FKUA 5E8WA 3V01A 4FI1A 4WNPA 5JT2A 2BILB 2VWXA 5C27A 4USEA 3PE1A 4D2SA 4ZTMA 2VD5A 4BCMA 3S0OA 2YIXA 4OT6A 4R1VA 3JVRA 4BI2A 3GP0A 4MNFA 1KE6A 2H34A 3DNDA 5I9UA 2UZDA 2R3NA 5ANDA 1Y6AA 3ULIA 4CMOA 4O7LA 2UZEA 5BMMA 2PZYA 5BVEA 5C8MA 4ZIMA 1PMEA 4YJSA 1V0BA 3H10A 5CANA 5CXZA 4NM0A 4FF8A 3I1AA 4HGTA 3DQWA 3I7CA 5LVNA 1Y6BA 2WMQA 3GENA 3Q4UA 5AP3A 2F7EE 1V0PA 2UW6A 4W4XA 3L8PA 3KXHA 4TPTA 3RZFA 3T9IA 4A07A 4M67A 5HTCA 1OL7A 3QQKA 4YTIA 4JQ8A 5CQUA 3DXQA 4QP1A 1PJKA 4L3PA 4YUQA 3ET7A 2VTSA 5HBEA 5IZFA 1YXUA 4ANOA 3FL5A 1FOTA 4JQEA 5HICA 2XUUA 3KMUA 3R0TA 4JG6A 2HY0A 4DFNA 5FLFA 4FX3A 4ZY5A 4BCQA 2FSMX 3R73A 3IW5A 4XP3A 3E7OA 4DG0E 5J9LA 3E3PA 3EQCA 1LR4A 5E1SA 5HCXA 2IVTA 4GK2A 4KB8A 4FEVA 2OZAB 5C01A 3ACJA 3II5A 4FNZA 2GQSA 4RZWA 4IAYA 5CVFA 5E91A 5J7HA 3V5QA 3MTLA 5DT3A 5HO7A 2VTNA 4QTAA 5CNOA 2BZHB 5IEVA 4FGRA 1URWA 4ITJA 5EM7A 4LUEA 2ITXA 4LL0A 4ACMA 4L00A 1QL6A 4C34A 2WMSA 3EWHA 1FVRA 2OGVA 2X7GA 5IUGA 3AC3A 5AM6A 4MQ1A 5L2SA 5FM2A 2XRWA 3D5UA 3LPBA 4J71A 1YI3A 2OXDA 2W1HA 5EM6A 4OTDA 2W1DA 5HO8A 4EKKA 2QCSA 4ZSLA 4I24A 5I9VA 2YDIA 4KSPA 3GOKA 4PV0A 2H96A 3Q4ZA 3S1HA 5HLNA 4ZXTA 4DAWA 4UMUA 5M09A 4JOAA 3QLGA 2R3JA 3RNIA 2C6KA 4O7SA 3ZXZA 1JQHA 4BIBA 3E63A 4S31A 1WBOA 2YA9A 3BX5A 3O8PA 2OF4A 3PPZA 4D5HA 3ORKA 4EH8A 2XJ2A 2PVHA 4FKLA 1YHSA 4I6BA 4JAJA 2GHGA 1VYZA 2PK9A 1VR2A 2OK1A 1FGIA 1UU7A 4JS8A 4PNIA 5LMBA 3UMWA 2UW9A 2QLQA 4R7IA 4U9AA 2F7XE 2HELA 2I1MA 4EHEA 4RIYB 5HNIX 2Y7JA 4GFOA 4YO6A 5C4LA 2O5KA 4UX9A 4IFCA 2JFMA 2B53A 5KUPA 1JSVA 3CTHA 3GCQA 5AR7A 5B2LA 2OLCA 3GFEA 4X2JA 4RX8A 5GIPE 1T46A 2VO6A 4EZ5A 4CZYB 2XA4A 3N4TA 3QD4A 2ITVA 2O8YA 2UZWE 4YU2A 1YOMA 5DH3A 1ZARA 4O96A 5CZIA 4HOKA 5EYMA 3BHYA 3PFQA 3LXNA 2YM6A 3LMGA 4GG7A 4QMTA 2I0HA 4AF3A 1TQPA 2QOLA 3B8QA 4D2VA 4DLIA 3GXLA 3F3TA 4YTHA 3DU8A 2CLQA 2H6DA 4U41A 2YLFA 2JIIA 4WD5A 1JAMA 1OKYA 4FSQA 4BB4A 1YWNA 3PIYA 3R8MA 5AR3A 3VS0A 2FGIA 2DWBA 1U59A 2F4JA 2GNLA 3DY7A 4FV5A 5DPVA 4FTQA 4MBIA 3VWAA 4CYJA 4IVAA 2AC3A 5AR4A 3UTOA 1VYWA 4WO5A 1WBWA 2ZM1A 5C8NA 4W4WA 2HZNA 5FUTA 4EOLA 3BLHA 3P78A 4EL9A 4H3QA 2XNPA 5DOSA 4PTEA 5M4FA 4OTQA 5EI8A 4BIEA 3F82A 3TV7A 4JR7A 2PMLX 3G9NA 4F9WA 3FY0A 5IA4A 1GNGA 2PVLA 5AR5A 2C5NA 4G3GA 4QNYA 4HCVA 4QMZA 3PWDA 4C61A 4DT8A 4JIAA 4L3LA 3VULA 5AR2A 3LM0A 2YM5A 4HYSA 3AD4A 4PUZA 4KIQA 4EHGA 3RM7A 2ITPA 4WG4A 1L8TA 4I41A 3UOKA 2CMWA 4DFUA 1JVPP 3S00A 4NT4A 4QD6A 5GZ8A 2A0CX 2ACXA 4MTAA 3Q4TA 5JK3A 1H27A 4ANLA 3SKCA 1GIHA 2XS0A 3ANQA 4A7CA 3G6GA 5M56A 3GGFA 4CV9A 4UALA 5BVDA 3L8VA 4UXLA 3FKOA 3PYYA 3HMIA 1B39A 5E9EA 4TNBA 4EOIA 3PPKA 2UVYA 1QPJA 3HAMA 5CYIA 3LQ5A 3RK9A 3M11A 4MNEA 3SV0A 4EOMA 3R7UA 3PUPA 2O0UA 5CT7A 4F6SA 3QZIA 4IM2A 2OW3A 3IGOA 1UU3A 1KOAA 2NRUA 4FL1A 5J79A 1PF8A 2VU3A 3HYHA 5G1XA 1WVXA 2OICA 3QXOA 2GS2A 4PL3A 3DKFA 3WF5A 4EC8A 2QHNA 3UQCA 4IAKA 4X3FA 3E5AA 4OTIA 2X2KA 2VTTA 3RWQA 5A54A 2OG8A 4MXCA 2C1AA 2HW6A 1CKPA 3QUEA 3UNZA 3OVVA 2AYPA 3A8WA 5EKOA 4RWKA 4F6UA 1ZOHA 2JDTA 5LMKC 3WF8A 2J9MA 2A4LA 3KCKA 4JDJA 2V5QA 1UNGA 2OZOA 4W9WA 4MX9A 4HVHA 2IVUA 4TWPA 5F94A 2OIQA 4FSNA 4KUJA 4UZDA 2C0OA 4ALVA 2JBPA 2PZPA 4RWLA 2OO8X 5LVLA 3G9LX 4O7ZA 4TY1A 5GIOE 3P08A 3R1SA 3FY2A 4IAAA 3NNWA 4IX6A 4ZTSA 4BCNA 5A4LA 4AGCA 1PXIA 5EW9A 1NY3A 3OT3A 2H9VA 1ZYDA 4E6DA 4HYIA 2QOFA 3ZSIA 2B7AA 4C2WA 4DT9A 1T45A 3CD8A 4QQ5A 4NTTA 2C4GA 3PVBA 4KWPA 2PTKA 1UV5A 3WF9A 5E8XA 3L1SA 2UV2A 4LMNA 4C02A 5IQFA 1Q97A 2XM8A 4JDHA 3NYOA 2OIBA 5CAVA 1K9AA 1W7HA 2IWIA 2RGPA 4XRLA 4A4LA 5CSXA 3TNPC 3R63A 3QA0A 2YIQA 4IJ9A 1HOWA 3FQSA 2XJ0A 3ZM9A 3WBLA 2WOTA 5A4CA 3ORNA 4CQGA 1ZRZA 4XOYA 3AMAA 3QRIA 4O81A 4FVRA 4MWIA 1GZNA 5EW8A 3NSZA 5BVKA 2QO7A 3DAEA 1UU8A 4QTBA 2BRBA 3UPXA 4DITA 3T8OA 4ZK5A 3BRBA 4L68A 2ZV7A 4EQCA 4L52A 4JR3A 2UZUE 3C0IA 5J9ZA 3AC8A 2ITWA 3CY2A 4LRJA 2YIYA 3TNIA 4M12A 1EH4A 3DZQA 4KIPA 1WVYA 1XKKA 3A2CA 4HGLA 5EI6A 4AA4A 3ANRA 4U40A 3ULZA 3R02A 5EDQA 3TUBA 3V5WA 2HXQA 3L8SA 4M84A 3FPQA 1PRYA 5IEYA 5LJJA 5KMLA 5H2UA 3WE8A 2OIDA 1H4LA 1YOJA 3ZONA 3FHIA 4NCTC 1XH7A 4ZTHA 5ANJA 3R83A 4FIIA 5AUYA 3R8ZA 5BQ0A 5DG5A 3DBFA 5J95A 4KRCA 2EXCX 3OMVA 3JS2A 4C37A 5BMSA 3ZSGA 1CMKE 3GUBA 1ATPE 4M0YA 4U44A 5FXRA 1PYXA 2KULA 2ZMCA 1FINA 3RPRA 5C26A 3I5ZA 4NIFB 5DI1A 2X81A 3FLZA 4TWCA 3OUNB 4IHPA 1YWVA 4LYNA 3NW5A 5IH4A 2VTMA 4F63A 3VS3A 4GVJA 5AAGA 5E90A 3TCPA 1ZXEA 3R28A 2CNQA 4L3JA 4C35A 3SVVA 2NP8A 5HCZA 5HQ0A 2YWVA 3OG7A 2XKDA 4LG4A 4AG8A 4NL0A 4DTAA 3UOJA 3LLTA 2YZLA 4UWBA 4F7SA 5AV0A 4RGJA 4AN3A 1RQQA 2IPXA 4NH1A 3BLQA 4JX7A 2GQRA 3KRRA 3SA0A 2FUMA 4W8DA 2PY3A 5L6OA 3LFSA 5JZJA 2IVVA 2Y0AA 5HKMA 5CAOA 1XH5A 1E9HA 4AOTA 4BDEA 3M42A 2Y6MA 2WO6A 3H0ZA 3UYSA 3R8UA 3P7CA 4WBBB 3MFRA 3AD6A 1LUFA 5EW3A 3Q2MA 3V8WA 3D4QA 3QC4A 3GCUA 4IAZA 4ASDA 3GQLA 4OTWA 2CN5A 2IO6A 3MWUA 3U4WA 2BROA 4C4GA 4YTFA 4G5PA 5CF6A 3FXWA 4KS7A 2Z7LA 4X3JA 3GC8A 3PA4A 4I5CA 3UMXA 4B99A 4P7EA 1YOLA 3GU5A 5L2WA 4Y46A 2E9NA 2QOOA 3LFAA 2WMTA 4K6ZA 3TZMA 3WI6A 3QRTA 5CAQA 3OP5A 3PG3A 1UU9A 4ORKA 3ORXA 2JDRA 4LMUA 3SD0A 4C3PA 3MPMA 4NW6A 1JSTA 4FTAA 2Y9QA 4XMOA 5DE2A 4L45A 3SXFA 3TM0A 1H24A 3H9FA 3K2LA 1CM8A 4GRBA 5DRBA 2Z2WA 1BI8A 1UWJA 4TTHB 2PE2A 5ETCA 1OIUA 5A4QA 5LWNA 3ZDIA 1NT2A 3P4KA 4AAAA 2F57A 4BR3A 4DINA 2W9ZB 3G33A 4QMQA 4FKSA 4QYEA 4BL1A 2VO0A 2XK7A 2QR8A 2R3PA 4QP9A 3IONA 2XK6A 3MPAA 3C50A 1E1VA 2OFVA 3EYGA 3PA3A 4QNAA 3F2RA 1PMVA 3WYXA 1H1RA 2JDSA 4KD1A 4M13A 4BBMA 4GFMA 5ANGA 3PXYA 4J52A 1QMZA 1H1SA 1JSUA 1XJDA 4IDVA 1LP4A 3HMNA 4ZTNA 4XV1A 5M4UA 4E20A 4FTJA 4D0WA 3FUPA 3A99A 4I21A 2XP2A 2YCRA 3BU5A 1PYEA 1WBSA 2IZRA 3EFWA 4G6OA 4C57A 1PKGA 2CGVA 3R7OA 4EH7A 4J1RA 3KRJA 5HD4A 3PXFA 5I3RA 4G3CA 1XQZA 5D7AA 5L2TA 3SX9A 3UNKA 3FLYA 3ORTA 4GJ3A 2W1ZA 2PZRA 4BCKA 1R1WA 2W17A 4O0VA 4QPAA 4BDGA 4PMPA 3ORPA 5FTQA 3W2SA 1UVRA 4FTTA 1APME 3DFCB 4DH5A 5T6KA 4HGSA 4FSRA 2ITQA 4BIDA 4ONAA 5JFVA 2JGZA 3UQGA 2X39A 3C4XA 3FZPA 5EQEA 2QOCA 3WF7A 4IZYA 2NNWB 4EH2A 3ELJA 4XRJA 4QMXA 2WMXA 4I5MA 4AFEA 4FICA 3UYTA 1XWSA 3MJ2A 1H26A 2E9VA 2W05A 3CKXA 4LOQA 4DBXA 4C62A 5M53A 3JY9A 2QOIA 3CJGA 3SC1A 2VTRA 4E4NA 3RALA 3CXWA 1O9UA 2G15A 3TDVA 2NPQA 3RHKA 3PTGA 4QMPA 4XHKB 4YNEA 4Y72A 4ENYA 5A4TA 4O84A 4DFXE 1X8BA 3H9OA 4D4RA 5JQ8A 2VTAA 3C13A 1H0WA 3NUYA 4FODA 1W8CA 3ZXTA 5KCVA 2QR7A 2XK9A 3FKLA 4FKGA 2BFYA 4FZDB 4ASXA 3FLNC 3N51A 4DEGA 5CF5A 3EIDA 4B0GA 5L8LA 3UPZA 3PIZA 4C3FA 3TG1A 2YM8A 4CFNA 3F69A 2XYUA 3FYJX 2RFSA 5ANIA 2WTWA 2BAJA 2C6EA 5J9YA 3C5IA 3ZLXA 1Q3WA 2ZJWA 3MY5A 2RFNA 4AOJA 5E1EA 3EQIA 4F9YA 3N4VA 5IKWA 1PHKA 3ZCLA 4FV3A 3CD3A 1GIJA 2BTSA 5I9YA 3PLAE 4BBFA 1SVEA 4TYJA 3W32A 4BF2A 5J5SA 1M17A 2WPAA 3U6JA 3DXPA 5HE2A 2B9IA 4H05A 4QMMA 4BDIA 1JBPE 4WBOA 4JBQA 2R3KA 3BIZA 2XCKA 3GCVA 1IA9A 5B2KA 1A9UA 2J0LA 4IAIA 5JMSA 4HNIA 4JJRA 4RQVA 4Q5EA 2A2AA 2VZ6A 3WZDA 3QZGA 1Z5MA 1KOBA 1R78A 3DBEA 3QF9A 2BIYA 2ESMA 3DS6A 4IB0A 4ASEA 4BI1A 1ERKA 4DGMA 4KIKA 4FR4A 4X0MA 4C8BA 4RA4A 2E9OA 3CTQA 4QT1A 3GC0A 2JKQA 4E5BA 3D15A 3NX8A 3BYUA 4FKIA 4CXAA 4UWYA 4AT4A 3QWJA 3NAYA 5CF4A 2C6TA 4FKOA 2WTJA 2YAAA 2XH5A 5J87A 4Z55A 2IG7A 4FT0A 4IACA 5FRIA 3C9WA 3DB8A 3R9RA 2AC5A 4O22A 4N57A 5D41A 1BX6A 1H01A 1URCA 4FEXA 4BCGA 3MVJA 3HP5A 3KN6A 5ANOA 3HDMA 5BYYA 1FMKA 4FIGA 3EKKA 4AX8A 1SZMA 3R04A 2X7OA 5CXHA 4U8ZA 1IAHA 3HDNA 4C36A 4F64A 4HCUA 4IW0A 2C0TA 4E26A 4RT7A 5CX9A 2XEYA 3AG9A 3ALNA 5D1JA 4BTJA 5EYKA 3NYVA 2VGPA 4RC3A 2YHVA 3S4QA 2JAMA 3AT3A 3PY0A 3LOKA 3OCGA 5ETFA 2WTIA 1PMNA 3F3ZA 4EKLA 3I4BA 4ACGA 3ZEWA 4FK3A 3FMLA 3VS1A 1Q8WA 1ZWSA 3RI1A 5BVNA 2Y4IB 1BUHA 5HORA 3NUAA 2ZDTA 3ROYA 3QFVA 3PP1A 4PMMA 3AXWA 1H0VA 3NUSA 4JBVA 4P2KA 3TKHA 3EB0A 3ZLWA 3ZLSA 4FKVA 2B52A 3H9RA 4CQEA 2XK4A 4XX9A 5B0XA 4MWHA 2HXLA 4ASZA 3DXNA 1CKJA 2XB7A 3PIXA 2XKFA 5EKNA 3G2FA 3V51A 3UZTA 2QKRA 3P5KA 1OKVA 5HIDA 4YJOA 4CTBA 4ZLYA 4FTLA 1VEBA 3RAKA 3G15A 4DYMA 2VUWA 3TTJA 2XVDA 3IO7A 4NTSA 4TWNA 3E8CA 4F0GA 4F1MA 4A4XA 1BLXA 2O63A 3E64A 3FMDA 2YM3A 3UVQA 5D7VA 3VJOA 4L53A 4E1ZA 5TKDA 1OMWA 4UMRA 4OLIA 4ZJVA 4QP8A 4MD7E 2FB8A 4ANQA 3HP2A 2PU8A 1Q5KA 4FE2A 5JRSA 3MY1A 3ZOSA 4L01A 4DEDA 1R39A 4CFVA 4J99A 1NVSA 3MFSA 3P7AA 1GY3A 4ZSJA 2W5BA 1ZAOA 3AMYA 3F7ZA 4ENXA 4MYGA 3PXZA 2CKOA 5HGIA 3VS2A 1W84A 3JXWA 2IZTA 2XNOA 3PZEA 3NGAA 5HD7A 4FV8A 4HYUA 3VBQA 4AUAA 3WIKA 1E1XA 1PXMA 3OBJA 5IISA 2BRMA 3DAJA 3M2WA 4O1OA 5LCJA 2JIUA 4HGEA 2B0QA 5CU0A 1OKZA 3R8VA 3RGFA 2J0IA 4G34A 4XEYA 3BYSA 2UZVA 2RG5A 3P79A 2HWOA 4TZRA 4CFWA 3FMNA 4FZ6A 3MW1A 4X2GA 2IZUA 4JDIA 1K3AA 3ALOA 4FSUA 4TRLA 2XIKA 4RJ3A 4BDJA 4RX5A 4RIXA 4DH7A 3JVSA 4D1ZA 4EJ7A 1OITA 2Q0NA 4UB7A 3KXGA 5CSVA 3GNIB 2QOBA 4U0IA 3VQHA 3C4CA 4CCUA 3TTIA 4UY9A 4BDCA 4FSTA 1KSWA 1YXVA 3D0EA 1AQ1A 4IVDA 5IQBA 4CCBA 3ZFMA 2P2IA 5C1QB 2J0JA 3RWPA 4FTIA 2VGOA 3HLLA 4BDAA 5EG3A 4G9CA 3BEAA 3HVCA 5AJQA 5DBXA 4UZHA 3QRJA 2R0UA 4Z9LA 3NAXA 3O23A 4GIHA 4F09A 2OU7A 3E7VA 2B9HA 3DAKA 4H36A 4R6VA 4RPVA 3COKA 3PSCA 2CGXA 2YEXA 1Y57A 4FVQA 4OR5A 4NW5A 3QQGA 4K11A 4PL4A 3AC1A 4JX3A 3VS5A 1Z57A 3EKNA 3L9MA 3EL8A 5CU6A 3IDCA 1UKIA 3RNYA 3LJ1A 2P2HA 4YC3A 4CFUA 4AGWA 1UNHA 3HMPA 2JFLA 4FOCA 3NEWA 2W96B 4RFMA 4MAOA 3P7BA 2ERKA 5JKGA 1GJOA 2YWPA 3BZ3A 4RWJA 3ZBFA 3ZO4A 4AW5A 1UWHA 4J7BA 2OXXA 4NYEA 4XP0A 4YJNA 5JRQA 4I94A 1XHAA 3VS7A 4DFBA 4PMSA 3ACKA 4QMVA 4YPDA 3V8TA 1YDSE 5HBHA 4ZTQA 3D7TB 5IMXA 3TKUA 4E5AX 4FT9A 4AGDA 3AD5A 4R1YA 2FSTX 5K9IA 4GIIA 4F65A 3CQWA 4EI4A 1P14A 2PVRA 4TWOA 2XK8A 1J1CA 4L43A 3SOCA 4UWCA 4WRGA 2YIRA 5CASA 3KGAA 4U3ZA 3I0QA 5I3OA 4G1WA 4L6QA 3TZ7A 5IUIA 3BKBA 4RBLA 4FT7A 5CEIA 2GU8A 4AN9A 3P1AA 5D9HA 5KBQA 4BKYA 1P2AA 2X6DA 1SVHA 4MNEB 2QC6A 4NUSA 2CNVA 3SGCA 1LPUA 4B9DA 5M51A 2X1NA 1Y8GA 2VWVA 4O2PA 3G0FA 2JEDA 1IR3A 5CTPA 4FTCA 3KULA 3W55A 2CLXA 3KMMA 2QG5A 4FGBA 3A7GA 4G16A 2QU6A 2R0IA 4CLIA 3THBA 3O8UA 5CI6A 3EYHA 4QTDA 4X3FB 5F20A 1YHWA 4YZDA 5ANKA 4M66A 2XIXA 3UIUA 3PG1A 1OPKA 3UC4A 2RG6A 3C0HA 4ZZMA 3R9DA 2EXEA 4EOKA 4RIWA 2I40A 3R7VA 3RINA 4XOZA 2I0EA 3NWWA 4Y73A 5HG9A 2YM4A 2X4ZA 4Y83A 2I7QA 4KBAA 3WARA 3KXNA 3OOMA 4D55A 2VX0A 4PP7A 4Z7HA 4HJOA 5GINE 4N0SA 1ZZ2A 1OUKA 5D11A 4PDPA 5E92A 3N4UA 4FOBA 2G2IA 4WUNA 4LOOA 3C4FA 1XBAA 3ZSHA 4UXQA 3LJ2A 3VQUA 4CZTA 5AA8A 1WBNA 4AE6A 4GK3A 4P90A 4QYHA 3NNXA 4R8QA 3QKLA 5AM7A 4QPMA 4D4VA 2UZTA 2ZMDA 4DFLA 3QKKA 4M8TA 3BYMA 4YBJA 3OXTA 3POZA 3R8PA 1BL6A 4G6LA 4EEVA 2CKQA 4HVIA 3IKAA 3T3VA 1JKLA 5ETAA 4F4PA 5IU2A 2C5VA 3DT1A 3D5XA 4QMOA 4JL9A 4AGUA 1TQMA 3MGYA 4D2TA 3PY3A 3RPOA 5KKRB 4PDOA 2ITYA 4NKAA 5EFQA 2IJMA 4ZZNA 4IM0A 2PWLA 2QD9A 2QOHA 3TWJA 4BRXA 5I9WA 4O6LA 3RHXA 3HAVA 4O7WA 5IQGA 3Q32A 3CGFA 4GKHA 1A06A 3MVLA 4MH7A 2OFUA 1SNXA 4F9AA 4NM5A 4JRVA 5C8KA 4F6WA 2QURA 4MF0A 4PWNA 4A4OA 3LLAA 4UYAA 4WNKA 2BRHA 4MBLA 3QGYA 1XH4A 1YDRE 4O0SA 2JD5A 1VZOA 3HEGA 2VWYA 5AEPA 4IB1A 3FE3A 3VW8A 3KFAA 4GT5A 3WZUA 5HNGA 3H30A 3ENMA 2RFDA 4GUBA 4OT5A 4F0FA 2UW0A 4RSSA 3FC2A 3RJCA 4NK9A 4IX5A 3TXOA 3UNJA 5DR2A 4OTRA 4YJVA 2C5XA 4G17A 4PTGA 4UMPA 2VWIA 4ITIA 4KKHA 3ZLYA 4CYIA 1KV2A 2BIKB 3COMA 2ITUA 4QMYA 5EH0A 2YM7A 3PRFA 4YJPA 3A7HA 3UIXA 4XUFA 4ANBA 2YCSA 5FXQA 4O86A 1YXTA 3E93A 3LJ0A 4WIHA 3R9OA 2XK3A 3FI4A 2ZM4A 2BRNA 5AWMA 1R0EA 3I79A 1FPUA 3E62A 3FLQA 3Q60A 3SXSA 2QONA 1Q8ZA 2WU7A 3EN7A 3LMIA 3OCBA 4YLLA 3QGWA 4FL3A 5E7RA 3LHJA 1MRUA 4N6YA 4A9YA 2PYWA 3OZ6A 2B9FA 2ETKA 1JKKA 3SRVA 2BKZA 3ZUUA 1WBVA 2WU6A 4D1SA 5DVRA 4K77A 4EK8A 4TYGA 3PJ8A 4Q2AA 3O2MA 2PZ5A 2GSFA 4M0ZA 5JFWA 3TIYA 4RIYA 2JDVA 2WQBA 4ANSA 4KA3A 3RM6A 4FV9A 4LGGA 4D5KA 5EQPA 2GPHA 3E8NA 5ACBC 5KKRC 3EFLA 3ZRMA 4IC7A 3DDPA 3SXRA 4F7JA 5CALA 5J7BA 1YWRA 4XV9A 3OWKA 1BMKA 2UW7A 4Y8DA 3UZRA 5E8SA 3KQ7A 3CPBA 2W5HA 4FMQA 5HBJA 2XBAA 2WQEA 3FWQA 4RJ7A 4BHNA 5A6OA 5AV1A 3L9NA 4BYJA 4L7SA 4FKRA 3LFBA 4KBKA 4BN1A 3NR9A 2UVXA 2OWBA 1SMHA 2BR1A 2C3KA 1XH9A 2OJGA 3DTCA 4LRKA 2R9SA 3IK3A 3CKWA 4CFMA 3LIJA 4JDKA 3DGKA 2OJ9A 1BYGA 2ONLC 1Y8YA 1OIQA 3I5NA 3NUUA 4I6FA 2OF2A 3O8TA 1V1KA 2IZSA 4CKIA 2WMVA 4YZMA 2QG7A 5ANEA 3IW7A 5K0KA 3NVMB 3C0GA 3QZHA 4GU6A 3VO3A 2YJSA 5IA2A 3D2KA 3F61A 3FJQE 4UN0C 4GJ2A 2I6LA 5AP0A 4M69A 1U5QA 2WQMA 4KBCA 1GZKA 3UVPA 4IWPA 1WBTA 2X9EA 2P55A 3QZFA 4DH3A 1G3NA 3QQFA 3Q6WA 5EQYA 4ERKA 4P5ZA 2FSOX 3AC5A 3ZRLA 4EWHA 2C6IA 1GZ8A 2C30A 4O7RA 4E93A 3CQUA 1KE9A 4GH2A 2GS7A 3O17A 3MIAA 4KRDA 4S32A 1OPLA 4F9BA 4L9IA 2YLEA 4IVCA 3REPA 3C7QA 4DN5A 2CPKE 4J98A 4RA5A 1Q3DA 3QYZA 4XH6A 5KX8A 3H3CA 1IA8A 4O27B 3CCNA 4IEBA 4YHTA 4ZEGA 3QUPA 3IG7A 3R30A 4J8NA 3UOLA 1G5SA 3V5LA 5FM3A 5E8YA 4E3CA 1JKSA 2HZ4A 3KRWA 3UIMA 4C58A 3ITZA 2FH9A 3C4WA 4E4LA 5CEOA 3KC3A 3TZ9A 4LGDA 1P4FA 4CT1A 2WIHA 3FI2A 3QALE 5M4IA 1TQIA 2WIPA 3QXPA 2XRUA 4WG5A 1FVVA 4X21A 5J1VA 4FSYA 5AFVA 2R3LA 3BV3A 3O7LD 2X0GA 3PXKA 4LRMA 3KK9A 4Z3VA 4ZTLA 3HUCA 4H3PA 4V04A 3UG2A 4AZVA 5LXMA 3HA8A 3PP0A 3ZS5A 3GEQA 2O2UA 3KY2A 4IXPA 4RWIA 3ZC6A 1IAJA 5AADA 4RC4A 3Q9XA 4AA5A 4BDFA 4UEUA 2VTPA 4K2RA 5M07A 3DOGA 2J90A 1XH6A 3I7BA 2BRGA 3DK6A 3ERKA 3QTQA 4UYNA 5DR9A 4AACA 2X9FA 2IW8A 4DGGA 3LXKA 2QVSE 4RFZA 2YDKA 4XNEA 4X6QC 2UZNA 3B2WA 2ZV9A 2Q83A 4QMLA 3PJ1A 3KVWA 1FGKA 2GDOA 1STCE 4FV6A 4GEOA 5DHJA 3HV4A 4GCJA 2UW3A 4MD9E 5HLWA 3F2AA 3GCPA 3LVPA 5EDPA 2LGCA 3LW0A 3MH3A 3OTVA 4H58A 4YJQA 4BZNA 1S9JA 4Q9ZA 3DPKA 1OZ1A 1ZMUA 2GS6A 5LQFA 1XBBA 4E5WA 5H3QA 4U79A 3UO6A 4NM3A 2REIA 4QPSA 2OJJA 4EUUA 2P4IA 4Q5HA 3EFJA 4QYFA 3FKNA 3FLWA 3FMHA 5AUTA 3DJ7A 4OBQA 3QTZA 4BCIA 3EJ1A 5CS6A 1U54A 5D10A 1CSNA 2VRXA 3FZRA 4OUCA 3ZUTA 3QCQA 5IQIA 5IPJA 1ZY5A 2X2MA 3BI6A 2VTIA 2ZOQA 4H3BA 1IASA 4NCTA 4F70A 2F7ZE 4S30A 2EVAA 4RG0A 3UVRA 5H9BA 4HVSA 2C1BA 2XM9A 2WMAA 4R3RA 4PTCA 4DBNA 2XNBA 1KWPA 5KZ0A 2SRCA 5AV2A 3JY0A 2R3RA 3CSVA 5DFPA 3DA6A 1ND4A 3SG9A 4TXCA 3R22A 3BU6A 1WZYA 3QQLA 4ANMA 4USDA 2VN9A 2BAQA 3TV6A 4D9TA 3UC3A 5J1WA 3MVMA 3PVUA 2OJFE 2QOKA 2HCKA 3AT4A 3FPMA 4IDTA 4B7TA 4EOOA 4USFA 5FP6A 2ETMA 4HVGA 3R21A 3FXZA 5BPYA 3DKGA 3SHEA 3A60A 4M15A 2XCHA 3PVWA 5FXSA 4JT3A 2GFSA 3CBLA 3ZRKA 4HYHA 3TT0A 3QAME 3MY0A 2ZV8A 3VBXA 4NSTA 4EK6A 3HUBA 4GYGA 3PE2A 3KL8A 2J0MB 1CDKA 3O7LB 5H8EA 2X8EA 1QCFA 3QHWA 4QYGA 3W10A 3G5DA 4DHFA 5A6NA 4ZOGA 3RK5A 3CGOA 3ID6C 2C3LA 3QA8A 4K0YA 3PWYA 4QP3A 5TE0A 4GG5A 5DEWA 3VUKA 3WZKA 3RAHA 4O7NA 2GNIA 4ZSEA 2UW8A 1WCCA 4IE9A 1NA7A 3AGLA 3IW8A 3ZO3A 4AFJA 4NKSA 4BZOA 2ZM3A 5K0XA 4DGOA 5FTGA 2HW7A 4AZWA 4XP2A 5DR6A 2YFXA 4HPTE 5BNJA 2B9JA 4L8MA 2ZDUA 5AX9A 3SLSA 4EYMA 3Q04A 4FYNA 4O0XA 4YZNA 5KMNA 2B54A 5CVGA 4EK5A 2BZJA 3G6HA 2QODA 3BLRA 4JG7A 5M06A 5DA3A 1MQBA 2J51A 2Y4PA 5CEMA 1JLUE 2CSNA 4X2NA 1GZOA 2V7AA 1CTPE 2JAVA 4RX7A 2VTOA 1J7UA 3ODYX 4DH1A 5JQ5A 4K18A 3QYWA 4O0UA 5AP1A 4KIOA 2JC6A 5AAEA 2EUFB 4J97A 3IW6A 3Q6UA 1XO2B 4C2VA 4ZS4A 3VIDA 5L3AA 2PMOX 5CT0A 2UZBA 3NYXA 4IX4A 4PQNA 4APCA 4RFYA 2C68A 3U87A 2X7FA 2PVYA 4PX6A 4YSMA 1H1QA 5CSPA 3FV8A 4XLIA 4PPCA 3OBGA 4QOXA 3QQJA 4U5JA 1Q4LA 5AUXA 4J95A 2VTHA 3RPVA 4EORA 3OW4A 2G9XA 4TN6A 4ERWA 5AA9A 4I0RA 5IA5A 4CSVA 2JLDA 5FEQA 3HKOA 4R7HA 3S95A 5IEXA 1Q61A 2YABA 3I60A 5TF9A 2PVNA 2VWWA 3MVHA 4N6ZA 2GTMA 4TYEA 3IOKA 4FTRA 4LV8A 3KN5A 1NVQA 5KNJA 3P9JA 4EONA 4Y5QA 4HZSA 4FEWA 3Q3BA 4W4YA 4O7TA 5IA3A 5AP6A 5KMJA 1OPJA 4L67A 1OIRA 4TYHA 3ZMMA 1REKA 4IADA 4QMWA 4A9RA 5EOBA 2CCHA 4D2PA 4G9RA 3IS5A 2WKMA 3E8DA 3K5UA 4BTMA 3GC7A 2PE1A 2BVAA 3VUIA 5HNBA 4I6HA 4BHZA 4FNWA 3QWKA 2WELA 5EM8A 5L2QA 1SM2A 2O64A 1IRKA 1OB3A 3ZFYA 2UW4A 3FSFA 3OS3A 4MHAA 1YI6A 4HVDA 4Z7GA 5B2MA 4FG9A 3SW7A 1J7IA 5KE0A 2BKKA 4O21A 3ORLA 3BE2A 3GU8A 2GHLA 2R3GA 3OUKA 3CEKA 3MH2A 4F1OA 1Q8TA 5JH6A 2BUJA 2C6DA 4BCJA 1OVEA 4O0TA 2C69A 3QTIA 3KB7A 5FWKK 1HCLA 2RIOA 5JZNA 4FKTA 3C1XA 4MXOA 3OD6X 1JKTA 4KKGA 4TNDA 1NVRA 2VO7A 4W8EA 4EH5A 3SOAA 4HW7A 2JITA 3OY1A 5GHVA 5M08A 1O6KA 3C4EA 2WGJA 4H39A 4I5PA 4GV1A 4JNWA 4X2KA 4XV3A 5CY3A 3P23A 3R6XA 4MXAA 3TIZA 1WBPA 1H1PA 4CNHA 5LOHA 5IQHA 2XNNA 3FMEA 4FV4A 2WOUA 4MQ2A 3Q9YA 3VN9A 4A9TA 4S2ZA 4AP7A 4BICA 3FAAA 5AIKA 4FEUA 4W4VA 3U6IA 3ZFXA 5CAUA 3IDPA 3TUDA 4JRNA 3R00A 4G3DA 5EHOA 3UBDA 3LCOA 3NW6A 4MBJA 3FLSA 4RIXB 1OGUA 1ZY4A 2WNTA 4IH8A 3FHRA 3ZH8A 3O0GA 3ZDUA 1F0QA 3PRIA 4J8MA 3A4PA 4BDHA 5JGBA 1XR1A 2Z60A 3KEXA 2UVZA 5JFXA 1YXSA 2CHLA 3DNEA 3Q53A 3W16A 5JN2A 5BYLA 3R71A 2WD1A 4AN2A 2P33A 5A46A 2O65A 5IH6A 4CT2A 4JI9A 4FIFA 3VBTA 2QO9A 3S3IA 2PVJA 5JFSA 4QMUA 1PY5A 3IQ7A 4IM3A 3SDJA 3DFAA 4DEBA 2E9UA 3BBTB 5HG8A 5L4QA 4D0XA 1OKWA 3R7YA 4YGAA 2ZB0A 3QTWA 3F3UA 2GNFA 2RSVA 5HEZA 2UZOA 4D4SA 1VJYA 5D12A 2X8DA 2R7BA 1WMKA 5JGAA 4BCPA 3TACA 3BHTA 4AOIA 3AC4A 3BHUA 3VBYA 3CJFA 3EQHA 5HZNA 3ATSA 2DS1A 2W9FB 4I6QA 3KRXA 3DLZA 4S33A 5CWZA 3SAYA 3BCEA 3FDNA 5HI2A 3I6WA 4RZVA 2PUIA 4GW8A 4K1BA 4U80A 5HG7A 3R9NA 4II5A 4Y95A 2WMWA 4G3FA 2WQNA 2VTLA 5K3YA 3OCSA 4EOJA 4CKJA 3G51A 4FNYA 2ITZA 4FUYA 4DGLC 1P4OA 2CGUA 4RVMA 4G2FA 1MRVA 5HIBA 2YISA 3MS9A 4X6RA 4FA2A 1FMOE 3CTJA 4TKSA 2R3QA 4YHJA 2EXMA 3KA0A 3I81A 2PVMA 1JPAA 4ALWA 3DTWA 5HU3A 2YN8A 3BHHA 1PW2A 5HE0A 3V3VA 1F3MC 4R7BA 5JGDA 2BFXA 4YHFA 2WTCA 4PDSA 4AWIA 4YURA 1PXJA 4MCVA 4BY9E 1Y91A 5I5ZA 3C4ZA 3FXXA 2WQOA 3NIEA 5F95A 5T3QA 2QQ7A 2OXYA 4E8AA 3CC6A 3KULB 3TNWA 2WMUA 2VTJA 3TNHA 4CRLA 3R01A 4ZJIA 3A7JA 5AMNA 5HHWA 4R3CA 2PE0A 1Q24A 2ITNA 2R3FA 3HNGA 4FUXA 3D14A 4PPBA 2R5TA 3MSSA 1ZOGA 3R7GA 4LFIA 4C4HA 4EZ3A 5KMKA 4I4EA 5E8VA 2Y4IC 3NIZA 4GT3A 1M2PA 4YZBA 1UA2A 3F7WA 4FZAB 3DKCA 4YZCA 3LXPA 3U4UA 3FSKA 3I0OA 3MBLA 4RIWB 2IN6A 4RJ8A 4I22A 4K33A 3UDBA 2WB8A 1KE5A 2BAKA 5IDPA 1OIYA 4B8MA 2JDOA 4AT5A 3V5TA 2YDJA 4XJ0A 4YJUA 1RE8A 5G6VA 4K8AA 4I5HA 5LVPA 2HOGA 4WSYA 5CAPA 5AV4A 5FEDA 5EYDA 3IW4A 2BMCA 2Y8OA 2J0KA 1M52A 4WHZA 4EK3A 3FYKX 3VNTA 1QPCA 3DZOA 5DT0A 3KXMA 2J5EA 4OBOA 3UIBA 3R7IA 1S9IA 3FMMA 3RTPA 4BWKA 3DKOA 4RJ6A 4FKWA 4IMYA 4QMSA 2C47A 5FGKA 4U97A 3EZRA 4JBPA 4WOVA 5J8IA 2HIWA 4CFFA 3AMBA 3SG8A 3ZZEA 5FQDC 5K4IA 4GS6A 2W1EA 1TVOA 3AGMA 4ZSAA 5JEBA 3FZTA 5E8UA 3KCFA 4A06A 2UW5A 3MYGA 4WNMA 4ID7A 4G6NA 4ZSGA 4ALUA 4APPA 3P0MA 2E2BA 3GU7A 1H28A 4CGAA 3TDWA 1NW1A 5AR8A 3DDQA 3L9PA 4IANA 1AGWA 2CN8A 1V0OA 3LM5A 5FG8A 1Q41A 3MESA 1I09A 3FI8A 4DA5A 2VNWA 4KSQA 4M3QA 2X2LA 4PF4A 5C4KA 2VX1A 4V0GA 4JIKA 5TT7A 1ZOEA 1ZYLA 2GMXA 1BI7A 4RLLA 5AV3A 4GUEA 2Z02A 4N70A 3U9CA 1H07A 4O82A 4FIJA 2XIYA 4EOQA 4CLJA 3UGCA 4AZSA 4O0YA 3ZC5A 4O0RA 2OKRA 4FIHA 1W83A 4CFXA 4ZY4A 4KABA 4CEGA 2C6LA 4G3EA 3NZ0A 1YDTE 5DN3A 1GOLA 3MTFA 4YC6A 4AQCA 4BTKA 4BVUA 5IG1A 4O83A 1WFCA 3T3UA 2C5OA 3ZBXA 3F3WA 5L8JA 4CMUA 2BTRA 3RK7A 2X6EA 3A62A 4AW2A 2R3HA 4IQ6A 2ETRA 2WTVA 3QTUA 4FSMA 3TJCA 3PLSA 3NUXA 4O38A 4U3YA 5B7VA 4QRCA 4YLJA 3V5PA 2GCDA 5IH5A 3QD0A 2W0JA 4L44A 5IA1A 1FVTA 4U43A 5IA0A 3HGKA 4W9XA 3VF8A 3BQRA 5KHXA 4NFNA 5K4JA 4J53A 5I4NA 5BX0A 5F4NA 3SRVB 5KZIA 3IDBA 3DK7A 3EN6A 2BZKB 3EQRA 4GYIA 4IC8A 2WTKB 4YP8A 3W2PA 5KMIA 4E6CA 4C4FA 3PXRA 3BPRA 4QTEA 4ZY6A 2QU5A 4RMZA 4UV0A 4C0TA 3QD2B 4XG4A 2WZJA 3TJDA 4AW1A 4OTGA 5KMMA 3HX4A 4I3ZA 4NZWB 4O0WA 2JIVA 3GQIA 5AUVA 5GJGA 4FK6A 1KE8A 1H25A 1ZYCA 5TO8A 3MFUA 5HG5A 5LMAA 3K3IA 2R3MA 2G01A 2H8HA 2J50A 1OUYA 1RW8A 1PXOA 3Q5IA 2R3OA 3W8LA 1BKXA 1LEWA 3JPVA 3WZEA 3HECA 3KF4A 3R1NA 2CKEA 4FSZA 2J5FA 5CENA 3TKIA 3DCVA 3ZHPC 4MXZA 4EBVA 4EWQA 4D2WA 4F9CA 2XF0A 3Q2JA 4EBWA 2Q0BA 4EYJA 3HRFA 4LUDA 3HV7A 5AP7A 2BDWA 3RVGA 5CVHA 4BWPA 4D1XA 2WAJA 2QKWB 5GZ9A 5A14A 4I92A 3T9TA 1DI9A 2WEIA 5EI2A 3PDTA 4JAIA 2F2CB 3MPTA 3NCZA 4JXFA 3BWJA 3CPCA 4CD0A 2W06A 4DH8A 4RIOA 2C0IA 4M69B 3DBCA 2F9GA 1OL1A 3DK3A 3MFTA 3TI1A 2HYYA 2W4KA 4ZMFA 4R5SA 4PP9A 5L8KA 3ZTXA 1KV1A 4F99A 4ZLOA 3PJCA 5L6PA 4LV5A 2Z7RA 1ZZLA 3MA6A 3HMMA 3CIKA 3RAWA 2PMNX 3F5GA 1QPDA 1M2QA 5ITAA 3U9NA 4AS0A 4K9YA 4YMJA 4LGHA 2OZAA 3Q4CA 4BKJA 1OL5A 3A7FA 2F49A 2VAGA 4X3FC 3O50A 2WTKC 2Z8CA 3BGZA 3EQPA 4OAUC 2DUVA 4D58A 3IOPA 2PPQA 3QC9A 4FG8A 1Q8UA 4FYOA 2PULA 4FV0A 4QP6A 4ZLZA 3KMWA 2VWZA 3OOGA 1R3CA 4MVFA 4NJ3A 3VHKA 4F1TA 3QCXA 3IECA 3WILA 2HAKA 3E92A 4HZRA 2QHMA 2QO2A 4DC2A 4XS2A 4FTUA 2G2FA 5IF1A 4LM5A 3LFCA 1F5QA 4KKEA 3OXIA 4ACCA 4FNXA 5LVOA 4GFGA 3B2TA 5BUJA 2QNJA 2YJRA 4IZ7A 3W8QA 3D83A 4DE4A 1YQJA 1G8SA 5IQAA 3D7TA 5EK7A 2FVDA 3FC1X 4IWDA 4KAOA 2CDZA 5E8ZA 4EHVA 1OBDA 1FQ1B 3CR0A 3LFEA 3Q9ZA 3VAPA 5IUHA 3CY3A 3OWJA 3PJ3A 4E73A 5E4HA 3ZO1A 2YITA 3ZUVA 1I44A 3POOA 5GNKA 3N9XA 1GIIA 1MP8A 3BHVA 3ENHA 4OBPA 1PKDA 4YZ9A 2ITTA 3I6UA 2XEZA 4ZAUA 3EN4A 2Y6OA 5HOAA 1OI9A 3RAIA 3NS9A 4C59A 1WAKA 5KO1A 1WVWA 4F7LA 3VUDA 4N4SA 4BDDA 4LOPA 2W4JA 2VO3A 2F2UA 2OI4X 2BHEA 2NO3A 3EQFA 4RVKA 1H08A 4C4IA 3VVHA 3BEGA 1L3RE 1W82A 2KTYA 3MIYA 4YNOA 4GK4A 4U81A 3AQVA 5HVYA 4WUAA 5BUIA 4EQMA 4YJTA 2Z7SA 5CEQA 5DEYA 3ROCA 3NW7A 4IB3A 4YSJA 3LE6A 5IQCA 4NM7A 4GVAA 2BHHA 2W1IA 3GVUA 4AZTA 3LCTA 3QCSA 3VUTA 4WG3A 2PHKA 1PMUA 3DBDA 1Q99A 3LFDA 1Q62A 5DT4A 4YTCA 3ORZA 3DB6A 3OROA 2YZAA 1DM2A 3KVXA 1JNKA 1U54B 2XBJA 4ACHA 3ATTA 2JKOA 4IWOA 5AUWA 4O7VA 3DBQA 2XKCA 3Q52A 3JYAA 3QTSA 3G0EA 3KU2A 2VWBA 4IJPA 3V6SA 4U7ZA 3A7IA 1YRPA 5HE3A 1IEPA 3VBVA 4FZ7A 3GBZA 2V7OA 3W2CA 2C6OA 5J5TA 2GNGA 2PUUA 3W2QA 4BZDA 3VJNA 4C4EA 4BWXA 4YR8A 1YHVA 1ZMVA 5BVFA 3D9VA 2EWAA 3CLYA 5TOZA 3QLFA 5FEEA 2CNUA 1Q8YA 4RLKA 5ETIA 4F7NA 1U5RA 4PMTA 4O2ZA 5I0BA 3KXZA 3FQEA 5I9XA 4KS8A 3E88A 2BPMA 2W7XA 4BTFA 5LWMA 4CKRA 4TYIA 4PDYA 5LMKA 2OSCA 4L46A 5HVKA 3FL4A 2I0YA 3PJ2A 2R64A 3GT8A 3PSDA 4FL2A 4FT3A 1PXLA 4V05A 3HRBA 2J2IB 4WNOA 2XZSA 4Y85A 3W2OA 3OFMA 4ZZOA 5HX6A 1M14A 4FV1A 4S34A 2G1TA 3FQHA 3BELA 3VW6A 4CTCA 5IMEA 2CKPA 3F66A 4JQ7A 4A9SA 3P86A 3ETAA 3RPSA 3QTXA 3NNUA 3W2RA 5CEPA 4FIEA 5M55A 5KHWA 3D5VA 4M68A 2ZV2A 1RJBA 3D2IA 5CLPA 5ICPA 5DYJA 2BDFA 4IFGA 4EZ7A 2VTQA 1ZYSA 2ONLA 4FTMA 4DF3A 3HV6A 5JSMA 3ZU7A 2ZVAA 3UJGA 5LCKA 3BYVA 4RC2A 1R0PA 3WZJA 4MEDA 2PVKA 4FBXA 3UP2A 3R7EA 2RF9A 4F08A 1KE7A 4AU8A 2OBJA 3MN3A 4FV7A 4IIRA 2FA2A 2R3IA 2ZB1A 4JG8A 4MD8E 3LCKA 5GJDA 4KINA 3A8XA 5DMZA 3HMOA 1M2RA 3M1SA 3NDMA 2G2HA 5L6WL 3LCSA 3U8WA 4WKQA 3VS4A 3EH9A 4M7IA 2XNEA 2FYSA 3HRCA 4FTKA 3U55A 4PL5A 4LQMA 3ZEPA 4Z16A 4XG2A 2HWPA 3OEZA 5IQEA 4PY1A 5AUUA 5K5NA 3BGPA 3E3BX 1K2PA 4I4FA 4DFYA 4XG6A 5HTIA 3DQXA 1Z9XA 3GU4A 4AZFA 3NPCA 5BVOA 2VNYA 3BGQA 4A9UA 4E4MA 4FT5A 3RKBA 4TL0A 1ZYJA 4DEAA 2V55A 2YERA 2VV9A 4AW0A 3NUPA 3OTUA 4PNKA 4HPUE 4MXYA 3F9NA 5HO6A 2C3JA 3TEIA 4QQTA 4EQUA 4BKZA 3GC9A 3V6RA 4B6LA 5CSWA 3FI3A 5FP5A 3QX4A 3V5JA 5DLSA 3Q9WA 3U51A 2JKKA 3D7ZA 3QRKA 4P5QA 4QP7A 2RKUA 2RFEA 3QL8A 3O51A 2WMBA 3R2BA 4U45A 3MA3A 5CQWA 5CU2A 1AD5A 4BGQA 4BDKA 5KMOA 5HCYA 4CMTA 4BCFA 4OTPA 5CSHA 4R78A 2YAKA 3HV3A 3KRLA 4FTOA 1FBNA 1MRYA 4KNBA 4FEQA 4C33A 4FKJA 3LMHA 3RP9A 4DEIA 3C51A 2IW6A 4O91A 2XNGA 2W1GA 5FBOA 2V0DA 5HIEA 3EQGA 4OTFA 5M4CA 2HZIA 3OXZA 3OC1A 5HVJA 5GJFA 5L2IA 4X2FA 1G8AA 1BL7A 4TYHB 3AOXA 5FDPA 4DCAA 3QBNA 5FD2A 4CV8A 4OAVB 3OF0A 3F6XA 5HX8A 4GKIA 1B38A 4C38A 3QD3A 5HESA 4GL9A 3TUCA 3R9HA 1YVJA 5BUEA 3QHRA 1CKIA 3QQUA 3KF7A 4UBAA 2C5YA 2VX3A 3D94A 3IGGA 1J3HA 5EHLA 3VUMA 1A48A 3EQBA 2XYNA 4B8LA 4DGNA 4H1JA 4J96A 3NLBA 3TN8A 4R5YA 4ZJJA 5H8BA 5AUZA 3OCTA 1JWHA 3W1FA 1M7QA 2CGWA 4ZP5A 4TT7A 3SW4A 4FKPA 3PPJA 5CZHA 1H00A 3CS9A 3MB6A 4O1PA 2W5AA 2R4BA 4RQKA 5E8TA 2GTNA 3F88A 3GI3A 3TL8A 3UODA 3RZBA 4XCUA 1RDQE 2DQ7X 1YKRA 2FO0A 2I0VA 4KIKB 4FKQA 1SYKA 3FMKA 3ORMA 5DRDA 3CP9A 5AP2A 4DG3E 2HK5A 1YXXA 4RJ4A 3A61A 2X8IA 4DCEA 1DI8A 3AT2A 4I1ZA 4OW8A 4NWMA 5LVMA 5DNRA 4RVLA 3E87A 3LXLA 2B55A 4QYYA 3PSBA 4MK0A 2QI8A 4M14A 5FBNC 3O96A 4MXXA 2OJIA 4PPAA 1XBCA 2GNHA 4EK4A 4D4YA 4F0IA 5K5XA 4IB5A 4JLCA 4CG9A 3WIGA 2BALA 3WE4A 4HCTA 4MKCA 4Q9SA 3WF6A 3L9LA 5A9UA 4BYIA 1W98A 2A1AB 3NUNA 5FTOA 4CRSA 2B4SB 2PVFA 2V62A 5F9EA 5HU9A 2YIWA 4NIFA 5HLPA 4D2RA 3TV4A 5IDNA 3FBVA 3EN9A 4O6EA 3R1YA 2A27A 2YCFA 2GNJA 2EU9A 2ZAZA 2ITOA 3MV5A 4IX3A 3WYYA 5CI7A 3EN5A 2B1PA 3FZ1A 3LQ8A 2J7TA 1LEZA 2O3PA 3MJ1A 5DWRA 5T68A 3ZM4A 2A19B 4BGHA 4CZUA 4JBOA 4I20A 3QRUA 1U46A 4WA9A 1SNUA 3ZYAA 4BCOA 4QMNA 5EM5A 1PXPA 5IQDA 4QO9A 2W4OA 1HCKA 2QOQA 3VUGA 2PUNA 3H4JA 3NNVA 3EHAA 3F5UA 2OH0E 3R2YA 5M44A 4R3PA 3EFKA 1IG1A 3HV5A 2BZIB 4EH4A 3PVGA 4LL5A 4DFZE 3TNQB 3BQCA 3VUHA 3K5VA 4BC6A 3OY3A 3PA5A 3HA6A 1U4DA 4DLJA 4YLKA 4D28A 3W33A 1H8FA 1MQ4A 2YCQA 2E9PA 3EL7A 4I0SA 4HNFA 1M7NA 3JR1A 4BBEA 1TKIA 2UUEA 4YPSA 5DGZA 4DEHA 2W1CA 1XH8A 2JBOA 2W99B 3PZHA 4EJNA 3QKMA 1H1WA 4X7QA 5CEKA 5TR6A 4CVAA 4ITHA 2GQGA 3PY1A 1ZLTA 3DJ6A 3COHA 1J7LA 4EH6A 3KREA 3K54A 4XG7A 2HZ0A 4FTNA 3C5UA 3CE3A 3E8EA 5AX3A 4EC9A 4RJ5A 3OW3A 2C3IB 4XG9A 4RVTA 1REJA 3NCGA 5CNNA 1ZMWA 4XYFA 1PXKA 3OEFX 3QCYA 3R8LA 3RCDA 1O6LA 2ZYBA 1PXNA 3UG1A 4QQJA 3GU6A 1OECA 4V01A 5CU3A 3UP7A 4XG8A 2XKEA 3VBWA 3IPHA 2RL5A 3BU3A 3NVKI 3ORIA 4E7WA 3Q96A 4PRJA 2CJMA 3W18A 4GT4A 2P0CA 5H8GA 2C6MA 2P3GX 3COIA 3PXQA 4O7YA 4I93A 2X4FA 4LI5A 4GU9A 2PUPA 3JUHA 3B8RA 3U6HA 4AZEA 4C4JA 3LFNA 4EH9A 4L42A 4RX9A 5AIRA 2GFCA 2J4ZA 4I23A 2LAVA 3BBWA 2OH4A 2XIRA 3DV3A 2PL0A 3HZTA 3D5WA 3LCDA 4FV2A 1P5EA 4OTHA 4UMQA 2R2PA 3UO5A 3VC4A 3K3JA 2GHMA 5ACKA 4NJDA 3QX2A 1UKHA 3ODZX 3RCJA 3BYOA 3BWFA 3ZO2A 2WEVA 2CCIA 4ZS0A 5EDRA 5HTBA 4FG7A 3Q5ZA 3LFQA 3LAUA 3CQEA 3A4OX 1QPEA 4IWQA 3VRZA 4MF1A 1NXKA 4WT6A 4YBKA 4YC8A 5A4EA 4B4LA 4I0TA 3QUDA 5CF8A 4GSBA 3NRMA 4FZFB 4E4XA 4NU1A 4BI0A 3F3VA 1UNLA 4JVGA 1OBGA 4M97A 2PSQA 4C3RA 2EB3A 3DJ5A 2WTDA 4RRVA 3VHEA 4DTKA 3FEGA 3DLSA 4BDBA 3WOWA 3RBWA 3UO4A 4QP2A 3F5PA 2WXVA 4QP4A 5HE1A 2PZIA 2AUHA 4P4CA 4YO4A 2JKMA 5AAFA 4C7TA 4XBRA 1DS5A 1MUOA 3MB7A 3H0YA 2NRYA 4E6AA 1J91A 5C03A 3OWLA 1OL6A 3BE9A 3V8SA 4DEEA 4NFMA 3BV2A 5BVWA 3SQQA 1DAWA 2XJ1A 4ZTRA 2IVSA 2V22A 4FC0A 1OM1A 3TZ8A 5F1ZA 3LKMA 4R77A 2FSLX 5LARA 2VWUA 4XBUA 4GMYA 2W1FA 1O6YA 2BDJA 3KXXA 4BFMA 5BYZA 2WHBA 3AC2A 3LZBA 2WFYA 2PMIA 3MH0A 4DG2E 3U54A 3NMUF 2Z7QA 2QLUA 3S2PA 1KUTA 4AE9A 4V0GB 3LQ3A 4IVBA 5GZAA 1SVGA 2DYLA 2HENA 4TW9A 4XG3A 4ACDA 2XNMA 4IBMA 1W0XC 4U42A 4AXAA 3QTRA 2XMYA 5AP5A 3G90X 3OHTA 3MDYA 2BCJA 4XLVA 3F2NA 3VS6A 4NEUA 4IAFA 2R7IA 4G5JA 4EOSA 4FVPA 4L7FA 3UE4A 2XIZA 5I9ZA 4D9UA 1OL2A 3UOHA 3MH1A 4U6RA
chains in the Genus database with same CATH superfamily
4WRSA 3L8XA 3GCSA 3V04A 2YACA 3ML1A 4FSWA 3F5XA 3OT8A 1DAYA 4YJRA 3GB2A 4H1MA 4DTBA 1JOWB 4EUTA 3KKVA 2IW9A 4AA0A 3QQHA 5EHYA 4ANNA 3FMJA 3OWPA 4WSQA 5M57A 2ERZE 5AP4A 5A3XA 4EH3A 4ARKA 2HY81 3R1QA 3VRYA 4BCHA 4ZMEA 3HL7A 3NYNA 3UZPA 3FZSA 3ZZWA 4BGGA 3QU0A 3UQFA 4CG8A 2AEGA 3FZOA 1YW2A 4IZAA 5CU4A 5KBRA 2EB2A 3MI9A 3EZVA 3GFWA 5DIAA 3EQDA 4QTCA 4OGRA 4UMTA 1YI4A 4EOPA 3KK8A 3RPYA 4Y5HA 2WMRA 3VF9A 4E6QA 4IZ5A 5FDXA 3GOPA 2UZLA 4EHZA 1GAGA 3EMGA 5EYCA 1B6CB 3LFFA 4QQCA 5C9CA 1J1BA 3O71A 5EOLA 4AT3A 3EOCA 4G31A 4XV2A 3RMFA 2J6MA 4FKUA 5E8WA 3V01A 4FI1A 4WNPA 5JT2A 2BILB 2VWXA 5C27A 4USEA 3PE1A 4D2SA 4ZTMA 2VD5A 4BCMA 3S0OA 2YIXA 4OT6A 4R1VA 3JVRA 4BI2A 3GP0A 4MNFA 1KE6A 2H34A 3DNDA 5I9UA 2UZDA 2R3NA 5ANDA 1Y6AA 3ULIA 4CMOA 4O7LA 2UZEA 5BMMA 2PZYA 5BVEA 5C8MA 4ZIMA 1PMEA 4YJSA 1V0BA 3H10A 5CANA 5CXZA 4NM0A 4FF8A 3I1AA 4HGTA 3DQWA 3I7CA 5LVNA 1Y6BA 2WMQA 3GENA 3Q4UA 4DHIB 5AP3A 2F7EE 1V0PA 2UW6A 4W4XA 3L8PA 3KXHA 4TPTA 3RZFA 3T9IA 4A07A 4M67A 5HTCA 3W0OA 1OL7A 3QQKA 4YTIA 4JQ8A 5CQUA 3DXQA 4QP1A 1PJKA 4L3PA 4YUQA 3ET7A 2VTSA 5HBEA 5IZFA 1YXUA 4ANOA 3FL5A 1FOTA 4JQEA 5HICA 2XUUA 3KMUA 3R0TA 4JG6A 2HY0A 4DFNA 5FLFA 4FX3A 4ZY5A 4BCQA 2FSMX 3R73A 3IW5A 4XP3A 3E7OA 4DG0E 5J9LA 3E3PA 3UDSA 3EQCA 1LR4A 5E1SA 5HCXA 2IVTA 4GK2A 4KB8A 4FEVA 3BLAA 2OZAB 5C01A 3ACJA 3II5A 4FNZA 2GQSA 4RZWA 4IAYA 5CVFA 5E91A 5J7HA 3V5QA 3MTLA 5DT3A 5HO7A 2VTNA 4QTAA 5CNOA 2BZHB 5IEVA 4FGRA 1URWA 4ITJA 5EM7A 4LUEA 2ITXA 4LL0A 4ACMA 4L00A 1QL6A 4C34A 2WMSA 3EWHA 1FVRA 2OGVA 2X7GA 5IUGA 3AC3A 5AM6A 4MQ1A 5L2SA 5FM2A 2XRWA 3D5UA 3LPBA 4J71A 1YI3A 2OXDA 2W1HA 5EM6A 4OTDA 2W1DA 5HO8A 4EKKA 2QCSA 4ZSLA 4I24A 5I9VA 2YDIA 4KSPA 3GOKA 4PV0A 2H96A 3Q4ZA 3S1HA 5HLNA 4ZXTA 4DAWA 2ZFYA 4UMUA 5M09A 4JOAA 3QLGA 2R3JA 3RNIA 2C6KA 4O7SA 3ZXZA 1JQHA 4BIBA 3E63A 4S31A 1WBOA 2YA9A 3BX5A 3O8PA 2OF4A 3PPZA 4D5HA 3ORKA 4EH8A 2XJ2A 2PVHA 4FKLA 1YHSA 4I6BA 4JAJA 2GHGA 1VYZA 2PK9A 1VR2A 2OK1A 1FGIA 1UU7A 4JS8A 4PNIA 5LMBA 3UMWA 2UW9A 2QLQA 4R7IA 4U9AA 2F7XE 2HELA 2I1MA 4EHEA 4RIYB 5HNIX 2Y7JA 4GFOA 4YO6A 5C4LA 2O5KA 4UX9A 4IFCA 2JFMA 2B53A 2X0PA 5KUPA 1JSVA 3CTHA 3GCQA 5AR7A 5B2LA 2OLCA 3GFEA 4X2JA 4RX8A 5GIPE 1T46A 2VO6A 4EZ5A 4CZYB 2XA4A 3N4TA 3QD4A 2ITVA 2O8YA 2UZWE 4YU2A 1YOMA 5DH3A 1ZARA 4O96A 5CZIA 4HOKA 5EYMA 3BHYA 3PFQA 3LXNA 2YM6A 3LMGA 4GG7A 4QMTA 2I0HA 4AF3A 1TQPA 2QOLA 3B8QA 4D2VA 4DLIA 3GXLA 3F3TA 4YTHA 3DU8A 2CLQA 2H6DA 4U41A 2YLFA 2JIIA 4WD5A 1JAMA 1OKYA 4FSQA 4BB4A 1YWNA 3PIYA 3R8MA 5AR3A 3VS0A 2FGIA 2DWBA 1U59A 2F4JA 2GNLA 3DY7A 4FV5A 5DPVA 3NFGB 4FTQA 4MBIA 3VWAA 4CYJA 4IVAA 2AC3A 5AR4A 3UTOA 1VYWA 4WO5A 1WBWA 2ZM1A 5C8NA 4W4WA 2HZNA 5FUTA 4EOLA 3BLHA 3P78A 4EL9A 4H3QA 2XNPA 5DOSA 4PTEA 5M4FA 4OTQA 5EI8A 4BIEA 3F82A 3TV7A 4JR7A 2PMLX 3G9NA 4F9WA 3FY0A 5IA4A 1GNGA 2PVLA 5AR5A 2C5NA 4G3GA 4QNYA 4HCVA 4QMZA 3PWDA 4C61A 4DT8A 4JIAA 4L3LA 3VULA 5AR2A 3LM0A 2YM5A 4HYSA 3AD4A 4PUZA 4KIQA 4EHGA 3RM7A 2ITPA 4WG4A 1L8TA 4I41A 3UOKA 2CMWA 4DFUA 1JVPP 3S00A 4NT4A 4QD6A 5GZ8A 2A0CX 2ACXA 4MTAA 3Q4TA 5JK3A 1H27A 4ANLA 3SKCA 1GIHA 2XS0A 3ANQA 4A7CA 3G6GA 5M56A 3GGFA 4CV9A 4UALA 5BVDA 3L8VA 4UXLA 3FKOA 3PYYA 3HMIA 1B39A 5E9EA 4TNBA 1XMLA 4EOIA 3PPKA 2UVYA 1QPJA 4O4EA 3HAMA 5CYIA 3LQ5A 3RK9A 3M11A 4MNEA 3SV0A 4EOMA 3R7UA 3PUPA 2O0UA 5CT7A 4F6SA 3QZIA 4IM2A 2OW3A 3IGOA 1UU3A 1KOAA 2NRUA 4FL1A 5J79A 1PF8A 2VU3A 3HYHA 5G1XA 1WVXA 2OICA 3QXOA 2GS2A 4PL3A 3DKFA 3WF5A 3W0RA 4EC8A 2QHNA 3UQCA 4IAKA 4X3FA 3E5AA 4OTIA 2X2KA 2VTTA 3RWQA 5A54A 2OG8A 4MXCA 2C1AA 2HW6A 1CKPA 3QUEA 3UNZA 3OVVA 2AYPA 3A8WA 5EKOA 4RWKA 4F6UA 1ZOHA 2JDTA 5LMKC 3WF8A 2J9MA 2A4LA 3KCKA 4JDJA 2V5QA 1UNGA 2OZOA 4W9WA 4MX9A 4HVHA 2IVUA 4TWPA 5F94A 2OIQA 4FSNA 4KUJA 4UZDA 2C0OA 4ALVA 2JBPA 2PZPA 4RWLA 2OO8X 5LVLA 3G9LX 4O7ZA 4TY1A 5GIOE 3P08A 3R1SA 3FY2A 4IAAA 3NNWA 4IX6A 4ZTSA 4BCNA 5A4LA 4AGCA 1PXIA 5EW9A 1NY3A 3OT3A 2H9VA 1ZYDA 4E6DA 4HYIA 2QOFA 3ZSIA 2B7AA 4C2WA 4DT9A 1T45A 3CD8A 4QQ5A 4NTTA 2C4GA 3PVBA 4KWPA 2PTKA 1UV5A 3WF9A 5E8XA 3L1SA 2UV2A 4LMNA 4C02A 5IQFA 1Q97A 2XM8A 4JDHA 3NYOA 2OIBA 5CAVA 1K9AA 1W7HA 2IWIA 2RGPA 4XRLA 4A4LA 5CSXA 3TNPC 3R63A 3QA0A 2YIQA 4IJ9A 1HOWA 3FQSA 2XJ0A 3ZM9A 3WBLA 2WOTA 5A4CA 3ORNA 4CQGA 1ZRZA 4XOYA 3AMAA 3QRIA 4O81A 4FVRA 1W2CA 1GZNA 4MWIA 5EW8A 3NSZA 5BVKA 2QO7A 3DAEA 1UU8A 4QTBA 2BRBA 3UPXA 4DITA 3T8OA 4ZK5A 3BRBA 4L68A 2ZV7A 4EQCA 4L52A 4JR3A 2UZUE 3C0IA 5J9ZA 3AC8A 2ITWA 3CY2A 4LRJA 2YIYA 3TNIA 4M12A 1EH4A 3DZQA 4KIPA 1WVYA 1XKKA 3A2CA 4HGLA 5EI6A 4AA4A 3ANRA 4U40A 3ULZA 3R02A 5EDQA 3TUBA 3V5WA 2HXQA 3L8SA 4M84A 3FPQA 1PRYA 5IEYA 5LJJA 5KMLA 5H2UA 3WE8A 2OIDA 1H4LA 1YOJA 3ZONA 3FHIA 4NCTC 1XH7A 4ZTHA 2X0QA 5ANJA 3R83A 4FIIA 5AUYA 3R8ZA 5BQ0A 5DG5A 3DBFA 5J95A 4KRCA 2EXCX 3OMVA 3JS2A 4C37A 5BMSA 3ZSGA 1CMKE 3GUBA 1ATPE 4M0YA 4U44A 5FXRA 1PYXA 2KULA 2ZMCA 1FINA 3RPRA 5C26A 3I5ZA 4NIFB 5DI1A 2X81A 3FLZA 4TWCA 3OUNB 4IHPA 1YWVA 4LYNA 3NW5A 5IH4A 2VTMA 4F63A 3VS3A 4GVJA 5AAGA 5E90A 3TCPA 1ZXEA 3R28A 2CNQA 4L3JA 4C35A 3SVVA 2NP8A 3UDTA 5HCZA 3TYKA 4AXEA 5HQ0A 2YWVA 3OG7A 2XKDA 4LG4A 4AG8A 4NL0A 4DTAA 3UOJA 3LLTA 2YZLA 4UWBA 4F7SA 5AV0A 4RGJA 4AN3A 1RQQA 2IPXA 4NH1A 3BLQA 4JX7A 2GQRA 3KRRA 3SA0A 2FUMA 4W8DA 2PY3A 5L6OA 3LFSA 5JZJA 2IVVA 2Y0AA 5HKMA 5CAOA 1XH5A 1E9HA 4AOTA 4BDEA 3M42A 2Y6MA 2WO6A 3H0ZA 3UYSA 3R8UA 3P7CA 4WBBB 3MFRA 3AD6A 1LUFA 5EW3A 3Q2MA 3V8WA 3D4QA 3QC4A 3GCUA 4IAZA 4ASDA 3GQLA 4OTWA 2CN5A 2IO6A 3MWUA 3U4WA 2BROA 4C4GA 4YTFA 4G5PA 5CF6A 3FXWA 4KS7A 2Z7LA 4X3JA 3GC8A 3PA4A 4I5CA 3UMXA 4B99A 4P7EA 1YOLA 3GU5A 5L2WA 4Y46A 2E9NA 2QOOA 3LFAA 2WMTA 4K6ZA 3TZMA 3WI6A 3QRTA 5CAQA 3OP5A 3PG3A 1UU9A 4ORKA 3ORXA 2JDRA 4LMUA 3SD0A 4C3PA 3MPMA 4NW6A 1JSTA 3W0MA 4FTAA 2Y9QA 4XMOA 5DE2A 4L45A 3SXFA 3TM0A 1H24A 3H9FA 3K2LA 1CM8A 4GRBA 5DRBA 2Z2WA 1BI8A 2A98A 1UWJA 4TTHB 2PE2A 5ETCA 1OIUA 5A4QA 5LWNA 3ZDIA 1NT2A 3P4KA 4AAAA 2F57A 4BR3A 4DINA 2W9ZB 3G33A 4QMQA 4FKSA 4QYEA 4BL1A 2VO0A 2XK7A 2QR8A 2R3PA 4QP9A 3IONA 2XK6A 3MPAA 3C50A 1E1VA 2OFVA 3EYGA 3PA3A 4QNAA 1ST4A 3F2RA 1PMVA 3WYXA 1H1RA 2JDSA 4KD1A 4M13A 4BBMA 4GFMA 5ANGA 3PXYA 4J52A 3P5JC 1QMZA 1H1SA 1JSUA 1XJDA 4IDVA 1LP4A 3BL9A 3HMNA 4ZTNA 4XV1A 5M4UA 4E20A 4FTJA 4D0WA 3FUPA 3A99A 4I21A 2XP2A 2YCRA 3BU5A 1PYEA 1WBSA 2IZRA 3EFWA 4G6OA 4C57A 2XARA 1PKGA 2CGVA 3R7OA 4EH7A 4J1RA 3KRJA 5HD4A 3PXFA 5I3RA 4G3CA 1XQZA 5D7AA 5L2TA 3SX9A 3UNKA 3FLYA 3ORTA 4GJ3A 2W1ZA 2PZRA 4BCKA 1R1WA 2W17A 4O0VA 4QPAA 4BDGA 4PMPA 3ORPA 5FTQA 3W2SA 1UVRA 4FTTA 1APME 3DFCB 4DH5A 5T6KA 4HGSA 4FSRA 2ITQA 4BIDA 4ONAA 5JFVA 2JGZA 3UQGA 2X39A 3C4XA 4O4DA 3FZPA 5EQEA 2QOCA 3WF7A 4IZYA 2NNWB 4EH2A 3ELJA 4XRJA 4QMXA 2WMXA 4I5MA 4AFEA 4FICA 3UYTA 1XWSA 3MJ2A 1H26A 2E9VA 2W05A 3CKXA 4LOQA 4DBXA 4C62A 5M53A 3JY9A 2QOIA 3CJGA 3SC1A 2VTRA 4E4NA 3RALA 3VONA 3CXWA 1O9UA 2G15A 3TDVA 2NPQA 3RHKA 3PTGA 4QMPA 4XHKB 4YNEA 4Y72A 4ENYA 5A4TA 4O84A 4DFXE 1X8BA 3H9OA 4D4RA 5JQ8A 2VTAA 3C13A 1H0WA 3NUYA 4FODA 4LDTA 1W8CA 3ZXTA 5KCVA 2QR7A 2XK9A 3FKLA 4FKGA 2BFYA 4FZDB 4ASXA 3FLNC 3N51A 4DEGA 5CF5A 3EIDA 4B0GA 5L8LA 3UPZA 3PIZA 4C3FA 3TG1A 2YM8A 4CFNA 3F69A 2XYUA 3FYJX 2RFSA 5ANIA 2WTWA 2BAJA 2C6EA 5J9YA 3C5IA 3ZLXA 1Q3WA 2ZJWA 3MY5A 2RFNA 2X0OA 4AOJA 5E1EA 3EQIA 4F9YA 3N4VA 5IKWA 1PHKA 3ZCLA 4FV3A 3CD3A 1GIJA 2BTSA 5I9YA 3PLAE 4BBFA 1SVEA 4TYJA 3W32A 4BF2A 5J5SA 1M17A 2WPAA 3U6JA 3DXPA 5HE2A 2B9IA 4H05A 4QMMA 4BDIA 1JBPE 4WBOA 4JBQA 3O5AA 2R3KA 3BIZA 2XCKA 3GCVA 1IA9A 5B2KA 1A9UA 2J0LA 4IAIA 5JMSA 4HNIA 4JJRA 4RQVA 4QEBA 4Q5EA 2A2AA 2VZ6A 3WZDA 3QZGA 1Z5MA 1KOBA 1R78A 3DBEA 3QF9A 2BIYA 2ESMA 3DS6A 4IB0A 4ASEA 1G8JA 4BI1A 1ERKA 4DGMA 4KIKA 4FR4A 4X0MA 4C8BA 4RA4A 2E9OA 3CTQA 4QT1A 3GC0A 2JKQA 4E5BA 3D15A 3NX8A 3BYUA 4FKIA 4CXAA 4UWYA 4AT4A 3QWJA 3NAYA 5CF4A 2C6TA 4FKOA 2WTJA 2YAAA 2XH5A 5J87A 4Z55A 2IG7A 4FT0A 4IACA 5FRIA 3C9WA 3DB8A 3R9RA 2AC5A 4O22A 4N57A 5D41A 1BX6A 1H01A 1URCA 4FEXA 4JMQA 4BCGA 3MVJA 3HP5A 3KN6A 5ANOA 3HDMA 5BYYA 1FMKA 4FIGA 3EKKA 4AX8A 1SZMA 3R04A 2X7OA 5CXHA 4U8ZA 1IAHA 3HDNA 4C36A 4F64A 4HCUA 4IW0A 2C0TA 4E26A 4RT7A 5CX9A 2XEYA 3AG9A 3ALNA 5D1JA 4BTJA 5EYKA 3NYVA 4QDVA 2VGPA 4RC3A 2YHVA 3S4QA 2JAMA 3AT3A 3PY0A 3LOKA 3OCGA 5ETFA 2WTIA 1PMNA 3F3ZA 4EKLA 3I4BA 4ACGA 3ZEWA 4DDGA 4FK3A 3FMLA 3VS1A 1Q8WA 1ZWSA 3RI1A 5BVNA 2Y4IB 1BUHA 5HORA 3NUAA 2ZDTA 3ROYA 3QFVA 3PP1A 4PMMA 3AXWA 1H0VA 3NUSA 4JBVA 4P2KA 3TKHA 3EB0A 3ZLWA 3ZLSA 4FKVA 2B52A 3H9RA 4CQEA 2XK4A 4XX9A 5B0XA 4MWHA 2HXLA 4ASZA 3DXNA 1CKJA 2XB7A 3PIXA 2XKFA 5EKNA 3G2FA 3V51A 3UZTA 2QKRA 3P5KA 1OKVA 5HIDA 4YJOA 4CTBA 4ZLYA 4FTLA 1VEBA 3RAKA 3G15A 4DYMA 2VUWA 3TTJA 2XVDA 3IO7A 4NTSA 4TWNA 3E8CA 4F0GA 4F1MA 4A4XA 1BLXA 2O63A 3E64A 3FMDA 2YM3A 3UVQA 5D7VA 3VJOA 4L53A 4E1ZA 5TKDA 1OMWA 4UMRA 4OLIA 4ZJVA 4QP8A 4MD7E 2FB8A 4ANQA 3HP2A 3NFFB 2PU8A 1Q5KA 4FE2A 5JRSA 3MY1A 3ZOSA 4L01A 4DEDA 4LV7A 1R39A 4CFVA 4J99A 1NVSA 3MFSA 3P7AA 1GY3A 4ZSJA 2W5BA 1ZAOA 3AMYA 3F7ZA 4ENXA 4MYGA 3PXZA 2CKOA 5HGIA 3VS2A 1W84A 3JXWA 2IZTA 2XNOA 3PZEA 3NGAA 5HD7A 4FV8A 4HYUA 3VBQA 4AUAA 3WIKA 1E1XA 1PXMA 3OBJA 5IISA 2BRMA 3DAJA 3M2WA 4O1OA 5LCJA 2JIUA 4HGEA 2B0QA 5CU0A 1OKZA 3R8VA 3RGFA 2J0IA 4G34A 4XEYA 3BYSA 2UZVA 2RG5A 3P79A 2HWOA 4TZRA 4CFWA 3FMNA 4FZ6A 3MW1A 4X2GA 2IZUA 4JDIA 2XALA 1K3AA 3ALOA 4FSUA 4TRLA 2XIKA 4RJ3A 4BDJA 4RX5A 4RIXA 4DH7A 3JVSA 4D1ZA 4EJ7A 1OITA 2Q0NA 4UB7A 3KXGA 5CSVA 3GNIB 2QOBA 4U0IA 3VQHA 3C4CA 4CCUA 3TTIA 4UY9A 4BDCA 4FSTA 1KSWA 1YXVA 3D0EA 1AQ1A 4IVDA 5IQBA 4CCBA 3ZFMA 2P2IA 5C1QB 2J0JA 3RWPA 3W0NA 4FTIA 2VGOA 3HLLA 4BDAA 5EG3A 4G9CA 3BEAA 3HVCA 5AJQA 5DBXA 4UZHA 3QRJA 2R0UA 4Z9LA 3NAXA 3O23A 4GIHA 4F09A 2OU7A 3E7VA 2B9HA 3DAKA 4H36A 4R6VA 4RPVA 3COKA 3PSCA 2CGXA 2YEXA 1Y57A 4FVQA 4OR5A 4NW5A 3QQGA 4K11A 4PL4A 3AC1A 4JX3A 3VS5A 1Z57A 3EKNA 3AKLA 3L9MA 3EL8A 5CU6A 3IDCA 1UKIA 3RNYA 3LJ1A 2P2HA 4YC3A 4CFUA 4AGWA 1UNHA 3HMPA 2JFLA 4FOCA 3NEWA 2W96B 4RFMA 4MAOA 3P7BA 2ERKA 5JKGA 1GJOA 2YWPA 3BZ3A 4RWJA 3ZBFA 3ZO4A 4AW5A 1UWHA 4J7BA 2OXXA 4NYEA 4XP0A 4YJNA 5JRQA 4I94A 1XHAA 3VS7A 4DFBA 4PMSA 3ACKA 4QMVA 4YPDA 3V8TA 1YDSE 5HBHA 4ZTQA 3D7TB 5IMXA 3TKUA 4E5AX 4FT9A 4AGDA 4DDIA 3AD5A 4R1YA 2FSTX 5K9IA 4GIIA 5IQHA 4F65A 3CQWA 4EI4A 1P14A 2PVRA 4TWOA 2XK8A 1J1CA 4L43A 3SOCA 4UWCA 4WRGA 2YIRA 5CASA 3KGAA 4U3ZA 3I0QA 5I3OA 4G1WA 4L6QA 3TZ7A 5IUIA 3BKBA 4RBLA 4FT7A 5CEIA 2GU8A 4AN9A 3P1AA 5D9HA 5KBQA 4BKYA 1P2AA 2X6DA 1SVHA 4MNEB 2QC6A 4NUSA 2CNVA 3SGCA 1LPUA 4B9DA 5M51A 2X1NA 1Y8GA 2VWVA 4O2PA 3G0FA 2JEDA 1IR3A 5CTPA 4FTCA 3KULA 3W55A 2CLXA 3KMMA 2QG5A 4FGBA 3A7GA 4G16A 2QU6A 2R0IA 4CLIA 3THBA 3O8UA 5CI6A 3EYHA 4QTDA 4X3FB 5F20A 1YHWA 4YZDA 5ANKA 4M66A 2XIXA 3UIUA 3PG1A 1OPKA 3UC4A 2RG6A 3C0HA 4ZZMA 3R9DA 2EXEA 4EOKA 4RIWA 2I40A 3R7VA 3RINA 4XOZA 2I0EA 3NWWA 4Y73A 5HG9A 2YM4A 2X4ZA 4Y83A 2I7QA 4KBAA 3WARA 3KXNA 3OOMA 4D55A 2VX0A 4PP7A 4Z7HA 4HJOA 5GINE 4N0SA 1ZZ2A 1OUKA 5D11A 4PDPA 5E92A 3N4UA 4FOBA 2G2IA 4WUNA 4LOOA 3C4FA 1XBAA 3ZSHA 4UXQA 3LJ2A 3VQUA 4CZTA 5AA8A 1WBNA 4AE6A 4GK3A 4P90A 4QYHA 3NNXA 4R8QA 3QKLA 5AM7A 4QPMA 4D4VA 2UZTA 2ZMDA 4DFLA 3QKKA 4M8TA 3BYMA 4YBJA 3OXTA 3POZA 3R8PA 1BL6A 4G6LA 4EEVA 2CKQA 4HVIA 3IKAA 3T3VA 1JKLA 5ETAA 4F4PA 5IU2A 2C5VA 3DT1A 3D5XA 4QMOA 4JL9A 4AGUA 1TQMA 3MGYA 4D2TA 3PY3A 3RPOA 5KKRB 4PDOA 2ITYA 4NKAA 5EFQA 2IJMA 4ZZNA 4IM0A 2PWLA 2QD9A 2QOHA 3TWJA 4BRXA 5I9WA 4O6LA 3RHXA 3HAVA 4O7WA 5IQGA 3Q32A 3CGFA 4GKHA 1A06A 3MVLA 4MH7A 2OFUA 1SNXA 4F9AA 4NM5A 4JRVA 5C8KA 4F6WA 2QURA 4MF0A 4PWNA 4A4OA 3LLAA 4UYAA 4WNKA 2BRHA 4MBLA 1W2FA 3QGYA 1XH4A 1YDRE 4O0SA 2JD5A 1VZOA 3HEGA 2VWYA 5AEPA 4IB1A 3FE3A 3VW8A 3KFAA 4GT5A 3WZUA 5HNGA 3H30A 3ENMA 2RFDA 4GUBA 4OT5A 4F0FA 2UW0A 4RSSA 3FC2A 3RJCA 4NK9A 4IX5A 3TXOA 3UNJA 5DR2A 4OTRA 4YJVA 2C5XA 4G17A 4PTGA 4UMPA 2VWIA 4ITIA 4KKHA 3ZLYA 4CYIA 1KV2A 2BIKB 3COMA 2ITUA 4QMYA 5EH0A 2YM7A 3PRFA 4YJPA 3A7HA 3UIXA 4XUFA 4ANBA 2YCSA 5FXQA 4O86A 1YXTA 3E93A 3LJ0A 4WIHA 3R9OA 2XK3A 3FI4A 2ZM4A 2BRNA 5AWMA 1R0EA 3I79A 1FPUA 3E62A 3FLQA 3Q60A 3SXSA 2QONA 1Q8ZA 2WU7A 3EN7A 3LMIA 3OCBA 4YLLA 3QGWA 4FL3A 5E7RA 3LHJA 1MRUA 4N6YA 4A9YA 2PYWA 3OZ6A 3AKKA 2B9FA 2ETKA 1JKKA 3SRVA 2BKZA 3ZUUA 1WBVA 2WU6A 4D1SA 5DVRA 4K77A 4EK8A 4TYGA 3PJ8A 4Q2AA 3O2MA 2PZ5A 2GSFA 4M0ZA 5JFWA 3TIYA 4RIYA 2JDVA 2WQBA 4ANSA 4KA3A 3RM6A 4FV9A 4LGGA 4D5KA 5EQPA 2GPHA 3E8NA 5ACBC 5KKRC 3EFLA 3ZRMA 4IC7A 3DDPA 3SXRA 4F7JA 5CALA 5J7BA 1YWRA 4XV9A 3OWKA 1BMKA 2UW7A 4Y8DA 3UZRA 5E8SA 3KQ7A 3CPBA 2W5HA 4FMQA 5HBJA 2XBAA 2WQEA 3FWQA 4RJ7A 4BHNA 5A6OA 5AV1A 3L9NA 4BYJA 4L7SA 4FKRA 3LFBA 4KBKA 4BN1A 3NR9A 2UVXA 2OWBA 1SMHA 2BR1A 2C3KA 1XH9A 2OJGA 3DTCA 4LRKA 2R9SA 3IK3A 4O4FA 4DHZA 3CKWA 4CFMA 3LIJA 4JDKA 3DGKA 2OJ9A 1BYGA 2ONLC 1Y8YA 1OIQA 3I5NA 3NUUA 4I6FA 2OF2A 3O8TA 1V1KA 2IZSA 4CKIA 2WMVA 4YZMA 2QG7A 5ANEA 3IW7A 5K0KA 3NVMB 3C0GA 3QZHA 4GU6A 3VO3A 2YJSA 5IA2A 3D2KA 3F61A 3FJQE 4UN0C 4GJ2A 2I6LA 5AP0A 4M69A 1U5QA 2WQMA 4KBCA 1GZKA 3UVPA 4IWPA 1WBTA 2X9EA 2P55A 3QZFA 4DH3A 1G3NA 3QQFA 3Q6WA 5EQYA 4ERKA 4P5ZA 2FSOX 3BL7A 3AC5A 3ZRLA 4EWHA 2C6IA 1GZ8A 2C30A 4O7RA 4E93A 3CQUA 1KE9A 4GH2A 2GS7A 3O17A 3MIAA 4KRDA 4S32A 1OPLA 4F9BA 4L9IA 2YLEA 4IVCA 3REPA 3C7QA 4DN5A 2CPKE 4J98A 4RA5A 1Q3DA 3QYZA 4XH6A 5KX8A 3H3CA 1IA8A 4O27B 3CCNA 4IEBA 4YHTA 4ZEGA 3QUPA 3IG7A 3R30A 4J8NA 3UOLA 1G5SA 3V5LA 5FM3A 5E8YA 4E3CA 1JKSA 2HZ4A 3KRWA 3UIMA 4C58A 3ITZA 2FH9A 3C4WA 4E4LA 5CEOA 3KC3A 3TZ9A 4LGDA 1P4FA 4CT1A 2WIHA 3FI2A 3QALE 5M4IA 1TQIA 2WIPA 3QXPA 2XRUA 4WG5A 1FVVA 4X21A 5J1VA 4FSYA 5AFVA 2R3LA 3BV3A 3O7LD 2X0GA 3PXKA 4LRMA 3KK9A 4Z3VA 4ZTLA 3HUCA 4H3PA 4V04A 3UG2A 4AZVA 5LXMA 3HA8A 3PP0A 3ZS5A 3GEQA 2O2UA 3KY2A 4IXPA 4RWIA 3ZC6A 1IAJA 5AADA 4RC4A 3Q9XA 4AA5A 4BDFA 4UEUA 2VTPA 4K2RA 5M07A 3DOGA 2J90A 1XH6A 3I7BA 2BRGA 3DK6A 3ERKA 3QTQA 4UYNA 5DR9A 4AACA 2X9FA 2IW8A 4DGGA 3LXKA