1XBBA

Crystal structure of the syk tyrosine kinase domain with gleevec
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
277
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title A Novel Mode of Gleevec Binding Is Revealed by the Structure of Spleen Tyrosine Kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xbbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xbbA01
3EZRA 3O96A 3GU6A 2G2FA 5F1ZA 4EZ5A 2NO3A 2W1CA 2WMWA 4UXQA 4IM3A 4XRLA 1R0EA 2Y6MA 2WTVA 3HMNA 4QYHA 3D2IA 2BALA 5DPVA 1Z9XA 3FLWA 3TG1A 3R21A 4S30A 4MEDA 4ZLZA 2UZUE 4BZNA 5DMZA 3PE2A 3DXNA 3QL8A 3RZBA 4R7BA 3LM0A 5BUJA 4U7ZA 1E9HA 3P4KA 2OXYA 2FO0A 5ANOA 4PPBA 4IIRA 5ANDA 3ALOA 3RAKA 3FC1X 4L6QA 5EM6A 4TWCA 3UG2A 5JGAA 4FT5A 2ERZE 2OIDA 3DAKA 3L8SA 4LFIA 2Z7LA 2ZMDA 2XA4A 3Q04A 4YHTA 5FLFA 4BDKA 4TT7A 3F66A 2ZB0A 3NPCA 4WRSA 4CVAA 2O64A 4H3PA 2XK9A 4O0RA 3U8WA 4AA0A 2YZLA 3CGOA 5AR3A 3HZTA 4GYGA 4QO9A 1YDTE 3BCEA 2CN5A 5LARA 1W98A 2BDWA 4NTSA 2ZV9A 3QX4A 5FD2A 4IAZA 5JN2A 4W4VA 4IVDA 2WQMA 1JVPP 4H05A 3MTLA 3SRVA 5IA5A 4HGLA 2CPKE 4NKSA 4F4PA 2E9VA 5CSHA 2FVDA 3Q4ZA 3U9CA 4BZOA 3DNDA 5M06A 2R0IA 1H0WA 1XH7A 4RJ3A 3LAUA 3ORMA 4H36A 3G6HA 2UW5A 4IX3A 5M55A 2VTLA 4J97A 4FL2A 4RT7A 1YI6A 4FVPA 2NPQA 1F0QA 4AP7A 2W0JA 1WVXA 3JVSA 2QO2A 3R63A 2VO7A 4J53A 4F9BA 1PRYA 1REKA 3FC2A 2WTKB 3ZLWA 4MQ1A 3QRUA 2UW8A 1VR2A 3LXNA 3QAME 3EN7A 4R8QA 4D1XA 1KE5A 1M7NA 2C69A 1G3NA 3CKXA 2QOCA 3N51A 4L44A 4TYGA 4D0WA 4B6LA 5L3AA 3AT3A 3PUPA 3EKKA 4JBQA 3QUEA 2XK4A 3W18A 4O0UA 5DWRA 2VWVA 1LP4A 4FNWA 4LI5A 2R3KA 4J1RA 4UY9A 4XH6A 5GHVA 4E93A 3ORIA 2JKMA 1WVYA 4EK3A 3QQGA 3U54A 3DNEA 1MRVA 4FIEA 4S34A 3VS7A 3MGYA 3U4WA 4F0GA 1G8SA 5TT7A 3O2MA 5CF5A 5IA2A 4G9RA 5E1EA 5JRSA 3A2CA 3DKGA 3IW6A 5K3YA 3AD5A 3QQFA 3ZFMA 4ASXA 4DEGA 1U4DA 3BE2A 1ZMVA 2OXXA 3Q9YA 3II5A 5KZIA 3V5LA 3UPZA 3R1NA 3LHJA 2OJJA 3RHXA 3R30A 3TNQB 5M44A 3VRZA 4NL0A 1WBOA 2OJ9A 3V8WA 4E5WA 3D2KA 3FZ1A 3IONA 1JNKA 3A60A 5CSXA 2VO0A 3Q2MA 3V5JA 3LFAA 3O8UA 4I24A 3ZO2A 2X9FA 3KRLA 1OPKA 4D2SA 4G6OA 3U6IA 2QLUA 5J9ZA 2WD1A 4H1MA 1SVEA 4AUAA 4R77A 4EK5A 1JLUE 3FKOA 3F5GA 2QOFA 3OXTA 4NCTA 3R7YA 2QR7A 3E8NA 5CAOA 4FEXA 3NMUF 2JFLA 5HTIA 3UNJA 3LFCA 1URWA 3OCTA 4OUCA 1WAKA 1H24A 2R9SA 4OTWA 4GK3A 3VBXA 4XV2A 4FV4A 3EIDA 3VUHA 1WBNA 3OBGA 2XP2A 3EN4A 3TACA 4FV3A 5FUTA 1H1PA 3DBDA 3C4EA 2Z7QA 4EOOA 4HYHA 3VW8A 1Q8YA 4EONA 5AFVA 5AR4A 4TWPA 4RJ5A 1OMWA 4ZY6A 4OBPA 4E6AA 2YLEA 2FSLX 4GMYA 5DR2A 3IK3A 1CTPE 3V04A 4BCJA 3SVVA 1Q97A 3MPTA 3QTUA 4FTIA 5KE0A 4O7ZA 1FVRA 5AV1A 2WB8A 3K2LA 2GCDA 2JEDA 2OIBA 3TL8A 2RIOA 3C9WA 4JR3A 2XNNA 3BWJA 3QBNA 1CKPA 3DAEA 4LYNA 2R3QA 4WSYA 3D5WA 3ZCLA 4CEGA 5LOHA 2W99B 5EDRA 4CNHA 3V8TA 1Q8ZA 5CF4A 4F1MA 2ITTA 1Q8WA 3KRWA 4C34A 3I81A 4NJ3A 3DZOA 1Q62A 2BZKB 3HP5A 4YNEA 2YDJA 3PJ1A 1REJA 3EN9A 2BAQA 4BZDA 2WIPA 1OL1A 2BFYA 2OLCA 1YXVA 3V3VA 2WMQA 2VNYA 1SNXA 4FK3A 5HORA 4K6ZA 3MH1A 4V04A 4PL5A 3FLQA 2RFDA 4YSJA 2NRUA 4F0IA 2P3GX 3PXZA 3ZUTA 4D2PA 2W1DA 4JX7A 4DHFA 4O6LA 1K9AA 4PRJA 5L8LA 2I0EA 2XCHA 3LMHA 2I6LA 4AZEA 3H10A 4U45A 4FZ7A 4RQVA 4DFZE 4FTUA 4FIIA 1KE9A 4AAAA 4IADA 4Y85A 3VIDA 4EK8A 5JZJA 3JS2A 4C7TA 5I9UA 3ZRKA 3DLSA 3QQJA 3UG1A 5CU3A 3SGCA 2YCSA 3NWWA 4GRBA 4WBOA 5CI7A 4USFA 4FA2A 5CAUA 3TEIA 5A6NA 1IAHA 3B2WA 1KOAA 2X0GA 4WNMA 2O8YA 3ORTA 3ETAA 4WUNA 4D4RA 2BILB 1J3HA 2J90A 1Y8GA 3MI9A 4Q9ZA 3S0OA 4FEVA 4RVLA 4FKTA 4ZZMA 2YCRA 4DH3A 1U59A 4C62A 2QD9A 4MWHA 3CY2A 4GS6A 4HCVA 5JFSA 2XBAA 3VN9A 4A4LA 5LMKC 5AEPA 3FPMA 5LVMA 2J50A 4I0TA 1FMOE 2GPHA 4ZSAA 4IAYA 2OZAB 3OCGA 3MY1A 3W2QA 4C4EA 5FXQA 2GHMA 2JKQA 2IW6A 1V0BA 2FYSA 4M66A 2NP8A 4AZTA 3ZDUA 3Q4TA 3BE9A 3TCPA 4ZS4A 4YC3A 3DT1A 4BI1A 1BL7A 3DKOA 4AW2A 4E3CA 4MVFA 3R8PA 2QNJA 4ZS0A 2OI4X 3MBLA 5FBNC 4MHAA 2C4GA 3IO7A 2PY3A 5IEYA 3QZFA 3LCTA 4G6NA 2PUNA 4I6FA 2QOBA 2IVUA 3BIZA 3C4WA 3OUNB 2W4JA 4KBCA 4PQNA 1ZYCA 3R7IA 1RE8A 2NNWB 2A19B 3RM7A 2W7XA 2VN9A 4C33A 3JVRA 4BDDA 4KINA 5HIBA 4F9AA 4ZTNA 4MBIA 5EDQA 1Q3DA 2XK6A 1UNGA 4BFMA 5IA3A 2WMAA 5J87A 4FV1A 3PJ3A 3GOPA 3HA8A 4TYEA 3AC3A 3Q9ZA 2IW8A 1SMHA 2HZ0A 3LVPA 3WOWA 4DH8A 4EUUA 1XH8A 5KCVA 3S3IA 1NY3A 1XQZA 2I0VA 4IDTA 2IG7A 3ORXA 2QHMA 4UWBA 5FXRA 3FMKA 3F2RA 2OZAA 4FT0A 4JDIA 3PSCA 4G9CA 5E7RA 4UMPA 3BLRA 3UIMA 3R9NA 3HMIA 4LOPA 4D1ZA 4L3PA 3PIYA 4XG7A 4JR7A 3UOHA 4PDPA 3HDMA 4YZNA 4D28A 5K5XA 1FVVA 3LXLA 3FQEA 2JDTA 2A27A 1JPAA 2OO8X 4RFMA 4YJNA 3QGWA 3HAMA 5CF8A 4AGDA 2P2HA 3KQ7A 1BUHA 3UOLA 2UVXA 4KKEA 4Y72A 5HHWA 1NVQA 3ZTXA 3EN6A 3BRBA 3PYYA 4FG8A 3FXZA 5BMSA 4MD9E 3QCXA 5HTCA 4J71A 4CSVA 4JXFA 4CKIA 3LXPA 4GYIA 4MXAA 1WMKA 4N6YA 4EH4A 4EHVA 5AIKA 3EQBA 1M7QA 2Y7JA 3DB8A 3NAXA 5J1WA 3FAAA 3IDBA 5DIAA 4FEWA 2WGJA 3PLAE 4PF4A 1YKRA 4XG4A 3ANRA 3NW6A 4O21A 5I9WA 4QYYA 3HRFA 5F95A 4DN5A 3U87A 4LOOA 4FIGA 4QP9A 2PWLA 3CIKA 5L6WL 5CF6A 1WZYA 4FX3A 2BFXA 4IJ9A 2UZOA 2WTIA 1OGUA 4QMXA 4EZ7A 3IGGA 5FEQA 2Z2WA 4ZZNA 1ZY4A 3UZPA 2LGCA 4MF0A 5ETAA 4FZFB 3RINA 5HX8A 4XV3A 4QMZA 3TZ9A 1J7UA 5JGDA 4A9YA 4IX4A 3PSDA 5C9CA 5AADA 1YOLA 1JSVA 3R73A 3CBLA 3NUPA 5C4KA 5F4NA 1T46A 4O1OA 4DGGA 4UYAA 5HE2A 4NYEA 5HU3A 5HG9A 2VTPA 4GFOA 2VX1A 4BDEA 5M4CA 4O86A 1WBVA 1OPJA 2J51A 4NIFA 4NM0A 5F94A 4F6UA 3TUDA 1XO2B 3E8EA 3IW4A 4TPTA 5L6OA 2EU9A 3LZBA 4RA5A 2BROA 2OZOA 3C4CA 3BLQA 3MY5A 4AOTA 3D14A 4QNAA 3Q5IA 4IM0A 4OAUC 4AZFA 4IZAA 3U51A 3BKBA 3ZONA 4ANQA 2X8DA 1PXIA 4RJ6A 4GG5A 4FC0A 2JDSA 5AUZA 1YWNA 3DK7A 5IA4A 3V5WA 3DA6A 3AT2A 5GIPE 4BCFA 2RFNA 2WMTA 5J9YA 4TY1A 5FTOA 3POZA 1E1VA 4PTCA 4HZRA 4XHKB 4YLJA 5IG1A 2PL0A 3DGKA 4XLVA 5KO1A 3C13A 4O7VA 3CPCA 3BEGA 2ETMA 4KSPA 4RZWA 2W17A 4XJ0A 5JMSA 5AUWA 4HVIA 5A46A 2VX0A 5AM7A 4EK4A 4B0GA 3F3WA 1NVRA 3W8QA 1ATPE 4IWQA 4WRGA 4CFWA 4XV9A 2CKQA 2VAGA 2X6EA 2ZJWA 3KF4A 4D58A 4KAOA 2C5VA 4QMSA 4G3GA 3BEAA 1YW2A 4KNBA 3OCBA 4RBLA 4RSSA 3PY1A 3VHEA 5C1QB 5AR7A 3DK6A 4KBAA 3ZS5A 2OU7A 5E8WA 4FZ6A 3OUKA 4X2GA 5BQ0A 4CMTA 1VYWA 3ET7A 4RX9A 5FEEA 4IWDA 3W32A 3HP2A 4ONAA 3O71A 4G5PA 3DKFA 3QD3A 4AF3A 2Q83A 2PE0A 4FNZA 3KGAA 5ANJA 2AC5A 5BMMA 3UP7A 3TKHA 4IAAA 1H4LA 4P2KA 5HCYA 4I4EA 2V7OA 2W96B 4O7SA 3OMVA 5CALA 5JQ8A 4I6QA 4S2ZA 4KRCA 4IVAA 5HOAA 4EOPA 1R78A 3JUHA 2WQEA 3PVGA 4YZMA 2XK3A 4E7WA 4IJPA 4BIEA 3SQQA 2BDJA 3D15A 4QD6A 1PW2A 1Q61A 2F57A 3KU2A 3HRCA 2R3IA 3HMOA 2PMLX 4TN6A 4D0XA 4EWHA 3PRIA 2XM9A 2VD5A 2CMWA 4Y5QA 5A9UA 5IQAA 3NYOA 3F7WA 4YBKA 3LFSA 3I7BA 2VTHA 3RK7A 5IUGA 4EH7A 2CLXA 4DFNA 5CNOA 4YJUA 4OTFA 4BWPA 4JL9A 2WEIA 2R3MA 4MXCA 3KMWA 3UZTA 4R1VA 3TZ8A 4UBAA 5J7BA 4QNYA 4O0TA 3T9IA 4TW9A 3R7EA 2C0OA 4H1JA 4N0SA 4RX5A 4IWPA 3R8ZA 5LJJA 4M69B 3SXSA 2PHKA 4FUXA 4BBMA 4NCTC 5DN3A 1OBGA 2E9NA 4OTGA 2JAMA 4D1SA 5A4QA 3LFDA 4ZOGA 4ZSGA 5BUEA 3BU5A 3VS6A 4DEIA 2YIWA 4FKVA 4FSWA 4FTLA 4QMUA 3FZTA 4X2KA 5JFWA 4XNEA 5I9ZA 4BDBA 4C37A 4YSMA 4FV6A 5FP6A 4AGWA 1Q99A 1FPUA 2XNMA 4J52A 3LM5A 3QA0A 5H9BA 3TKUA 2IO6A 4PNKA 3V5PA 4WT6A 3BHYA 1M17A 3CPBA 3QKKA 3R7OA 3ZSIA 2P55A 4P5ZA 4BYJA 2WHBA 4EHZA 3PJCA 3RK5A 3ZLXA 5GIOE 5CU6A 4IB5A 2OBJA 2V62A 3MYGA 2XRUA 5EG3A 4J95A 4U42A 2QURA 3LLAA 5DR6A 3WIGA 4O7WA 2C6MA 3BHTA 4QTBA 4YU2A 4CYJA 2EWAA 3B8RA 4CQGA 5LQFA 5IDPA 4Y46A 4RWIA 3UYSA 3MSSA 3NUXA 1GIHA 1ZAOA 4OTPA 3GCUA 3I0QA 4OTIA 4KKHA 4O6EA 4OTRA 1UVRA 4CMOA 2J0MB 2G9XA 1PMEA 2XNGA 4FIHA 3FXWA 4BN1A 2C3IB 2VWZA 3NS9A 4U81A 2WTDA 4MBJA 1OL6A 3VUDA 2BRBA 4BDFA 3FQSA 5EQPA 5IQFA 3UIXA 4MD8E 3EQCA 1UNLA 2XNEA 2OJIA 4MX9A 4PX6A 2IW9A 5B2MA 3KRXA 3PZEA 4S33A 5AUTA 1FINA 4KSQA 5AR5A 3GU7A 2QOQA 3IOPA 4J96A 3WZJA 5BPYA 5JEBA 2CCIA 3LFFA 3ERKA 3TZMA 2B9JA 3S95A 1H1QA 3D5UA 3EZVA 4RG0A 4BR3A 1QPCA 4MK0A 4APCA 4C59A 2Y6OA 4DF3A 2X4FA 3O51A 4XG6A 2C6KA 5A3XA 4C4IA 5EQYA 4MKCA 4F99A 2UW0A 2XYUA 2JC6A 3BLHA 2R7IA 5B0XA 5J8IA 4I1ZA 1I44A 3OEZA 2UZTA 3GP0A 1CSNA 4BY9E 3GU5A 3A61A 4BDAA 1JAMA 4B4LA 4E20A 2WMXA 4D2VA 3U55A 2C47A 5TKDA 1YHSA 4I6BA 3OTUA 4YTCA 3QD0A 4M7IA 4C57A 3R1QA 5HBEA 4FGBA 2YDIA 3I6UA 3FZPA 5H2UA 3UO4A 4DBNA 5HLWA 4XUFA 2R3JA 4DFBA 3VVHA 3F7ZA 3FMLA 3QD2B 5HG8A 4BCMA 5BNJA 4JIKA 5D7AA 4JBOA 4KA3A 2UW6A 2X2MA 1OITA 4HNFA 5HO8A 4DGLC 3AC4A 3UVPA 1ZMWA 5HBHA 3LCSA 3V6SA 4YPDA 3V8SA 3ZLSA 3LIJA 2JIVA 4DEHA 1O9UA 1TQMA 3LJ2A 4AOIA 1OIUA 4J7BA 3COMA 4ZTQA 3PY0A 3KREA 3OY1A 1H07A 1WVWA 4G3FA 2YM6A 5ICPA 4D2TA 4DGOA 4A9TA 4FNXA 1R39A 2P33A 4FV7A 5EOBA 5CVFA 5FG8A 4YJSA 4G34A 3UC3A 2XUUA 3VBQA 3E3BX 4APPA 4RX7A 3R8VA 4DFXE 5FDPA 4BGGA 3E5AA 5AP4A 3S2PA 2C6EA 1R3CA 4JNWA 1PXNA 2PSQA 3ZEWA 4CRLA 4WIHA 3EQFA 2UZEA 2Z60A 4QP7A 5AX9A 4DH5A 1XJDA 4TL0A 3F3TA 4EKLA 3QA8A 4AWIA 1G5SA 3QX2A 4EH6A 3SG9A 4QYGA 3G0FA 2XKDA 1XH5A 3HUBA 2BIKB 1H28A 2DYLA 3ACJA 4I3ZA 3QTXA 3BU6A 3EN5A 3OW4A 4ZJVA 3ATTA 4FKQA 2G01A 5DT0A 3RK9A 4PMPA 2ITQA 5IPJA 3IGOA 3FY2A 2IZTA 2W1FA 3SXRA 3M11A 1PMUA 4F0FA 4AT5A 3I4BA 4IZYA 4LMNA 3QTIA 5HO6A 5K4JA 4RWKA 3PP0A 4GJ2A 2Y9QA 4KRDA 4IDVA 2PVKA 2ITWA 3QRKA 4FTTA 4W4YA 2BHHA 4JG6A 3NUAA 3F3ZA 2H96A 2VTJA 3PE1A 4YJQA 2E9UA 3CTQA 4RVKA 4WO5A 4CV9A 3MV5A 1LPUA 5HKMA 4BDIA 3HLLA 4Q9SA 4KBKA 3MB6A 5HD4A 1ZZLA 4C4FA 2FA2A 5CXZA 4AZVA 4QMMA 3AXWA 3KVWA 4FR4A 5CSWA 1SM2A 3VUKA 2PULA 4IB3A 3VF8A 4Z16A 3G5DA 4O22A 5EYKA 2HWOA 4YBJA 4H3BA 2HK5A 5I9YA 3MH2A 4ALVA 3U6JA 4L52A 3KY2A 4M8TA 4DEDA 2J5FA 2WTCA 4FZAB 2YCFA 4ZLOA 1ZYLA 4CYIA 4UEUA 4X6QC 1H1SA 4ASZA 3JXWA 3GC8A 3N4VA 5AV4A 1M2RA 3TTJA 2WTJA 4CFVA 1PMVA 4BHZA 5FTGA 3QWJA 3WF9A 3QALE 2VO3A 4FSNA 3G0EA 5HESA 4NFNA 4RC3A 5DGZA 4F7LA 4WG4A 5AA9A 5TOZA 2R3NA 5DBXA 4BWXA 5M08A 4YTFA 3UVQA 5I0BA 1SNUA 3C4ZA 1HCLA 5C8KA 3V01A 1A48A 2BDFA 5A14A 2J0IA 2ZM3A 2BZHB 4CT1A 5IF1A 2HAKA 5H8GA 4ENXA 5L8JA 2YLFA 3E7VA 4MXXA 4DEAA 2HCKA 5H8EA 4EOMA 4JS8A 2QOKA 2A4LA 4BRXA 3P78A 1NVSA 4RJ4A 3MS9A 4FL1A 2VGOA 4RIXB 3R8MA 5IQDA 3UIBA 3I60A 2GQGA 5B7VA 4ZP5A 2J0LA 5IQCA 4NUSA 3R9DA 3PWYA 2J7TA 3MVMA 3KXZA 4UWYA 3S4QA 5EI2A 4D55A 5LVNA 1PMNA 3DBEA 3CEKA 3ZM9A 3BYMA 1PJKA 4TNBA 4AU8A 4TNDA 4IVCA 4W4WA 3L9LA 2OICA 1W7HA 1CKJA 3K5UA 4N4SA 4PV0A 3ZO3A 3MTFA 4KWPA 2F9GA 5BVOA 1BLXA 3OEFX 3SX9A 3UE4A 1JWHA 4NW6A 4G31A 4YC8A 5E8YA 1OZ1A 1SVGA 1NA7A 4YJOA 4D5HA 2BRHA 4IQ6A 3BZ3A 4L68A 4NH1A 2UW9A 4TYHB 5IQHA 3A7IA 5M51A 4DEBA 3VHKA 1DI9A 3LXKA 5CENA 3SG8A 1QCFA 3RMFA 2ETKA 4BI0A 2HXLA 3H4JA 4GFMA 3RWPA 2OF4A 4JAIA 5HO7A 3FSKA 5L2SA 5EYDA 2PYWA 3N4UA 3UQGA 3VUGA 3AG9A 2BMCA 2YIXA 4A9UA 1PKDA 2OK1A 3CE3A 4C36A 3W33A 4CD0A 5ACKA 2C30A 2QHNA 3BV2A 1TKIA 4DLJA 5I4NA 5M57A 3CTJA 3TNHA 3OWLA 4RIXA 3QQLA 4WHZA 5DFPA 4PP7A 3E64A 3U6HA 4NJDA 5BVEA 5D9HA 1Q3WA 4DLIA 1RDQE 4TWNA 4AGCA 2ZV2A 1VEBA 5K0XA 3NYNA 3DBQA 4KUJA 4LMUA 5AX3A 3RCDA 1PYEA 1ZXEA 5KHXA 4BCNA 4J8MA 3R1SA 2B54A 3GBZA 3PPZA 2J9MA 3W16A 1QL6A 1YDSE 1YRPA 2W1GA 3ZZWA 3COKA 4OBQA 4G3DA 2WMSA 4RIWB 1NT2A 3DV3A 3L9MA 2YJSA 1W82A 5BVKA 5KMKA 5HVKA 3A62A 3CCNA 4KABA 2W05A 2B9FA 3CSVA 1OL5A 3HMPA 4IHPA 3OOGA 4CFXA 4I5HA 3A7FA 4UMUA 3E88A 3FE3A 1S9JA 2EUFB 4IAFA 3BWFA 2PUPA 2VTAA 3N9XA 2GFSA 3FY0A 3QD4A 5M09A 3VUIA 2WXVA 3QZGA 2UW4A 3NZ0A 4DH7A 3IW8A 4TYHA 2CNQA 2FB8A 4BTMA 3P9JA 3P0MA 3TNWA 5IUIA 3MVJA 4FSRA 1XBAA 2CDZA 4OTHA 5CTPA 4BIBA 4PUZA 4JI9A 1XWSA 3DXPA 4DE4A 4S32A 5E8VA 4BIDA 4I0SA 3Q5ZA 4ZJIA 4JIAA 2XEYA 3Q4CA 5LVLA 5LCJA 5FRIA 5KX8A 3WF8A 4CZTA 4FEUA 2DQ7X 4BGHA 3KF7A 4OT6A 2IZUA 3QTZA 3OF0A 1H8FA 1PXMA 4FEQA 4XRJA 1PYXA 3LLTA 5BX0A 5GZ8A 4Y83A 1SVHA 3QU0A 3O8TA 4XOZA 3W2RA 3CY3A 4EORA 4Q5EA 1L8TA 4BB4A 2GS7A 1I09A 3KMUA 3NR9A 3FKLA 3QCYA 1UKIA 1ZYSA 4FKJA 2B53A 1NXKA 4FKSA 2VWXA 1IA8A 4LM5A 5BYZA 4RIWA 5CEQA 4O7LA 1ZOGA 4FVRA 5T68A 1PXKA 1G8AA 1W8CA 3FMEA 5EOLA 4JBVA 4PDOA 4FOCA 3DCVA 5CASA 4GT4A 4RWLA 5TE0A 2F7EE 5HE1A 4DC2A 4CG9A 2VWIA 3P7AA 1AGWA 2H8HA 3TNIA 1DS5A 3PPKA 4FSQA 4A07A 3PRFA 4ZSJA 3WF6A 1RQQA 3AC5A 4RJ7A 2VWWA 5TF9A 4I5PA 3TI1A 2X7FA 4L3JA 2BRNA 2IZSA 5EI8A 3ZZEA 3QKLA 4DYMA 3H9OA 2YDKA 3IG7A 4U9AA 2VTOA 5EM8A 1GAGA 3KCKA 5A4CA 5EI6A 3GUBA 2J5EA 3R1YA 5IMXA 4TXCA 5JK3A 4C2WA 1K2PA 4PMMA 3Q32A 3L1SA 4GU9A 4MBLA 3HEGA 2C6IA 1YXSA 2YM8A 3BGZA 3BYUA 4NU1A 3UZRA 5IA0A 2CLQA 2RL5A 3ZOSA 3KN5A 1PY5A 3DOGA 2HW6A 1H08A 2YM4A 2C3LA 3ODYX 4NM5A 5AR2A 2XF0A 5CEIA 3D4QA 1OPLA 2XNBA 4RQKA 4OLIA 5TR6A 4AOJA 4UB7A 4DCAA 4AA5A 2GNFA 4I20A 1JOWB 4I92A 5E91A 3OZ6A 4IH8A 5A54A 4XP2A 5AP5A 1YVJA 4ALWA 3MPMA 2PVJA 4IAKA 2UZBA 3G6GA 1ZY5A 4BBEA 4LG4A 3LFNA 4ACCA 3FZOA 4WNOA 2RGPA 5LMAA 1VJYA 4RPVA 4E5BA 5ANGA 4QRCA 3QHWA 4L8MA 5KZ0A 2O2UA 3FI4A 2H9VA 4ALUA 5I5ZA 5FWKK 4AW0A 3EQGA 5AP3A 3ACKA 4UMRA 4DG3E 5C27A 3KULA 2JAVA 3LQ5A 3RPOA 2ZVAA 3KK8A 4E8AA 3A4OX 3A4PA 3AQVA 2GSFA 2ITPA 1GJOA 3FI2A 4FSMA 2GDOA 3HGKA 3TJDA 2ERKA 2BPMA 5FP5A 2QVSE 3DAJA 4ZSEA 3VBWA 2JDVA 2QLQA 3GCSA 3LPBA 4GV1A 3CP9A 3EL7A 4HGSA 3UO5A 3POOA 3KA0A 2XB7A 4UMTA 1CM8A 1M14A 4ZY5A 5JSMA 4O27B 3F82A 3NW5A 2X8EA 4JBPA 4QP8A 3G2FA 5K9IA 3FLZA 4IFCA 1U5RA 4Q5HA 3EFWA 2O5KA 4QQCA 5EH0A 5HZNA 3THBA 2ZAZA 2R5TA 3OC1A 3OG7A 1Y8YA 3VRYA 4ANBA 2YITA 4C4JA 5DI1A 4R3CA 2Y8OA 3EH9A 4LGGA 5T6KA 4M3QA 2VTQA 4JDJA 4I23A 5IMEA 3VS0A 3WE4A 2VZ6A 3W8LA 5J9LA 1MUOA 4JG7A 4AT3A 2GS2A 2R0UA 3UOJA 4R7IA 3HX4A 4GW8A 3R00A 3OROA 3E3PA 4W8DA 1K3AA 3FZSA 3OWJA 1UU3A 4CKJA 1JQHA 3IDCA 4QQ5A 5GZ9A 5ETIA 4AG8A 3MJ2A 2Y4PA 4D9TA 4C3FA 4ERWA 4IZ5A 2QOHA 3ZH8A 3CD8A 4DINA 2BZIB 3TTIA 5FM3A 3NUSA 4IWOA 2OXDA 4O1PA 4TYIA 2XJ2A 1E1XA 3D83A 3OXZA 5E8XA 4U79A 2C68A 4KS7A 1H27A 4MQ2A 1SYKA 4EKKA 5CSPA 5KMIA 3PA3A 4YNOA 3DS6A 4B99A 5AR8A 2QC6A 2GHLA 4MD7E 5HBJA 4ZJJA 3C1XA 2PE1A 2VTIA 3HV7A 1APME 1B38A 2GFCA 4W9XA 2W4OA 4X7QA 3D7TB 1CDKA 1OKYA 1XBCA 1LUFA 3UJGA 3PXFA 4GSBA 3NUYA 4KIQA 3PPJA 4XYFA 4S31A 3BQCA 4QMTA 3HA6A 1OBDA 2BAKA 4AZSA 1AQ1A 1F3MC 5E90A 1OVEA 2CNVA 4AXAA 4NIFB 3OD6X 4UZDA 1J1CA 4FNYA 4YO4A 3NNUA 2EXMA 4FKIA 4GT5A 4ASEA 5AUVA 2ITVA 1ERKA 5CS6A 2UW3A 2PTKA 4GU6A 3HUCA 5C8MA 3QKMA 3HMMA 1NW1A 3AC2A 2GNJA 2OWBA 2HOGA 3E87A 4XG3A 3PY3A 3TDWA 4TKSA 5EM7A 5CANA 3FMDA 3CQWA 4WBBB 3ZM4A 3NCZA 5EW8A 2W5AA 5CEMA 1CKIA 3SHEA 5CWZA 1YDRE 5M4UA 3OCSA 4QPMA 5JH6A 4BDGA 3U9NA 5J95A 5EM5A 1M2PA 1RJBA 5AUYA 5EQEA 1FGIA 1FQ1B 3VWAA 4EOJA 3Q9WA 5HI2A 3K3JA 2BRGA 4ENYA 3W2OA 3R8LA 2IN6A 2PVLA 5C03A 2WELA 4BF2A 4ZAUA 2PMIA 2G1TA 2PZIA 2WQBA 3EQRA 3OOMA 3PVBA 3MFRA 3BYVA 4NEUA 5D11A 5DLSA 1J91A 3VBYA 3D7TA 5HNGA 2Z8CA 3P7BA 2FSOX 3PXRA 4O0XA 5DT4A 4FL3A 1GIJA 4O0WA 4FTAA 5EK7A 4BCKA 1ND4A 5ANEA 1P14A 2Y0AA 4LQMA 4WUAA 4YO6A 2XIXA 3DK3A 2CGUA 3CQUA 5DR9A 3D94A 4DTBA 3GC7A 3IW7A 2WIHA 4M0ZA 4R6VA 2VX3A 2XKCA 4PNIA 5CZHA 4E4NA 3P7CA 4EJ7A 3D0EA 4NM7A 2EB2A 1ZWSA 4ANMA 4F65A 5AA8A 4G2FA 2YJRA 2X7GA 3QLGA 5EDPA 4JT3A 3TWJA 3MJ1A 4L67A 4KIOA 2OH4A 2QU6A 4EOIA 4ACDA 3R9HA 3R9RA 2P0CA 4QTDA 3FPQA 5KMNA 4RGJA 4C38A 4AX8A 2ONLA 3F61A 3H0ZA 4I6HA 3EB0A 3IPHA 1B6CB 3BV3A 5CX9A 4IVBA 4EH2A 4I41A 2O63A 2HZ4A 4LRMA 4ZY4A 3L8VA 3PA4A 1Q41A 4OW8A 2F2UA 3AC1A 3MFTA 4GIIA 4RFZA 1CMKE 5CSVA 2QG7A 4EC9A 3CXWA 5LXMA 4KD1A 5HE3A 5ETFA 3TZ7A 4U8ZA 3MN3A 5DA3A 1WBTA 5FQDC 4YLLA 2V55A 3Q6UA 4HVDA 5EYMA 5JKGA 2W9ZB 3A7GA 3C4FA 4FTRA 4G5JA 5CEKA 4RVTA 4YJTA 2WO6A 3EOCA 3QHRA 1P4FA 4FT9A 3MW1A 4L7SA 1SZMA 4U41A 1H26A 5HE0A 3ULZA 2IWIA 4MXOA 4FV9A 4F9CA 3PLSA 4AGUA 1UNHA 4CGAA 3TNPC 3DJ5A 4U6RA 4BHNA 5LVOA 4IACA 1YOJA 4WSQA 3LQ3A 2G2HA 4ZLYA 4OTQA 3R7UA 4JQ8A 4RLLA 4XG9A 3SW7A 4DT9A 5KMLA 2FUMA 1PXOA 1IR3A 2V7AA 4M0YA 3TIZA 3FMNA 3WILA 4BKZA 2QI8A 2J6MA 4EEVA 4YMJA 2QOOA 4DA5A 4DCEA 4U5JA 3ANQA 4PP9A 4O0SA 2AYPA 3ZEPA 2B0QA 2DWBA 3I1AA 1Q8TA 4U3ZA 3DJ7A 3E63A 5HVJA 5FGKA 3A7HA 1Y57A 4AW1A 1P5EA 3T9TA 3F5UA 2YCQA 4ANOA 3IS5A 4IX5A 3PFQA 5AV3A 4HGTA 4QMQA 3S1HA 2UZNA 3QWKA 3FI8A 2X2LA 4EHGA 3H9RA 2BRMA 2C5OA 4BC6A 3V51A 2VGPA 3NYXA 4FKOA 3R28A 5T3QA 2X9EA 4NTTA 5DE2A 4O83A 1BX6A 4GUBA 2W5HA 3O23A 4FYOA 4BKJA 3BHVA 2XM8A 1R0PA 4HOKA 4J98A 3MIYA 4BCOA 4FV2A 5KUPA 2XIZA 2CKEA 3W55A 4X21A 5DVRA 2YN8A 3G51A 4XCUA 3FLNC 3VC4A 4M14A 1Q8UA 4AS0A 4UYNA 3T8OA 2PZRA 3PA5A 3E92A 3F9NA 2I0HA 4BVUA 2ACXA 2PVNA 3F5PA 5C4LA 4GUEA 3PJ2A 2ITXA 3EQHA 5E9EA 3LJ1A 1LEZA 2W06A 2R64A 2Z7SA 2B52A 1O6KA 4WG5A 3BBTB 3P1AA 2EB3A 3Q60A 3VAPA 2O65A 4EYMA 4EBWA 4A4XA 4CFFA 5IUHA 2QU5A 4MF1A 3MA3A 4XBRA 2QKRA 2J0JA 3DFCB 5GNKA 3PG1A 4B7TA 4FTMA 2ZB1A 3VULA 3REPA 1S9IA 2GTNA 4K9YA 4IXPA 4RJ8A 1UWJA 5ITAA 4NT4A 4JRVA 3Q6WA 3A99A 4CRSA 5IA1A 3CJFA 4RVMA 3C4XA 4GG7A 4I21A 3TKIA 4N70A 3HV4A 3FXXA 3OS3A 4QMOA 4XEYA 4A4OA 3F3UA 4CLIA 4EOQA 4E6QA 3OY3A 3AD6A 2YM3A 2RKUA 1F5QA 3A8XA 5CLPA 4CZYB 3RI1A 5DHJA 3WF7A 3BGPA 2E2BA 2C5XA 2OJFE 4YJVA 1XH6A 4F08A 3W2PA 3A7JA 3E62A 3P79A 2BVAA 3COHA 1OKVA 4Z9LA 5L8KA 3EQIA 3KVXA 5C01A 2HELA 4EI4A 5HCXA 4FIFA 5BVNA 4JQEA 2ZYBA 3HV3A 3PXKA 3Q2JA 4I94A 3TN8A 4L01A 4RWJA 4TWOA 3ZBXA 3I6WA 5LVPA 2YISA 4QP4A 1WBWA 4L3LA 3WI6A 2WQNA 3NGAA 1IG1A 3OBJA 2GQSA 3ID6C 4TYJA 1V1KA 5AMNA 4LUEA 3SDJA 3BHUA 4BBFA 5LWNA 3HECA 1TQPA 3HL7A 3EFKA 3AMBA 5IQEA 3GCPA 4AZWA 1PHKA 4C8BA 4I0RA 2PUIA 2J2IB 4X6RA 1JKLA 2XNPA 4U97A 2EXEA 4LRKA 4WKQA 4Q2AA 4UWCA 5LCKA 2PU8A 3CKWA 3DBCA 4FICA 3I5ZA 4RFYA 4XX9A 2QR8A 5E4HA 2C0IA 2OW3A 4O38A 4HGEA 3QYZA 5HQ0A 2YWPA 4IMYA 3EYGA 4RIYB 3SAYA 1QMZA 3MFSA 3WIKA 4AE6A 1Y6AA 3NW7A 4YUQA 3ROYA 4QMYA 4CCBA 5G1XA 5L6PA 4IC7A 3DXQA 3O50A 3FUPA 1MQBA 2HY0A 4YTHA 2F7XE 1OKZA 3ALNA 4D5KA 4UX9A 4LOQA 3ZHPC 3FJQE 2AUHA 4A06A 3RBWA 1OL7A 2ESMA 4EH9A 3MA6A 2UVYA 2R3RA 3F69A 3EFLA 3SXFA 3HV5A 2A1AB 3DLZA 4R1YA 5EHLA 4J8NA 1MRUA 3ZXZA 4ITHA 1JKTA 4P5QA 3LE6A 5E1SA 4K33A 4X3FC 2OF2A 3GU8A 2CGXA 3VUMA 1OKWA 4FMQA 2B7AA 4QTCA 4V01A 2IVTA 2Y4IC 4FSYA 5HIDA 3UPXA 4O0VA 4IZ7A 4NKAA 5GINE 5BUIA 3RNIA 2A0CX 3EWHA 2VNWA 3EYHA 3BGQA 3FLSA 3FQHA 3UC4A 4YC6A 5KBRA 4HNIA 4G1WA 3RJCA 2BKKA 1YOMA 2W1IA 3MB7A 5E8SA 5EW3A 4MNEA 4HPTE 2IVSA 2VRXA 4U80A 1A9UA 4RIYA 5B2LA 3M1SA 4OT5A 4JLCA 3LMGA 2V5QA 2IJMA 3ORZA 3R2YA 3OXIA 2C5NA 3IQ7A 5CU0A 4QQTA 3NYVA 3RP9A 1YI4A 3T3VA 4O82A 1TVOA 3Q52A 3QUPA 3RPSA 3VJNA 2Z02A 2P4IA 2GNIA 3GFWA 1OM1A 2VWYA 3EFJA 4X2JA 1FMKA 5A4EA 5DG5A 4B8MA 5A4TA 3JPVA 1H00A 3TV6A 3GVUA 2X81A 5AAFA 3FKNA 2XJ0A 3GEQA 3EMGA 5FEDA 2W1HA 3BPRA 3P86A 2VWBA 3FHIA 3C50A 3R0TA 1W83A 4ZSLA 3AMAA 1GIIA 3VS2A 1MRYA 4D2WA 4C61A 1P4OA 3QTSA 2ETRA 4IM2A 4EOSA 3ZSGA 2CSNA 3KFAA 4G17A 5AP0A 4ZXTA 3SW4A 4DGMA 4YHJA 3PSBA 5E92A 5M4FA 2HXQA 4M84A 3VNTA 3MY0A 4FV8A 4HCTA 2X39A 3QYWA 3KRRA 4M67A 3CLYA 4ITIA 2W5BA 4FODA 5CZIA 2YACA 3JR1A 4JDHA 5ETCA 5BYYA 2UUEA 3QTQA 2VV9A 3QQKA 2BTSA 3ZUVA 3ULIA 4II5A 1EH4A 4EH5A 3VS4A 3SV0A 3OFMA 4JAJA 1YXXA 4M15A 3OP5A 4QQJA 5D1JA 3UQFA 2QONA 2X8IA 4MH7A 5CNNA 3R02A 3L9NA 4I5MA 3CTHA 2JKKA 4H3QA 1MP8A 4IB0A 3R8UA 2QO9A 2AC3A 3TIYA 1IA9A 4ZMFA 4FK6A 3R9OA 3PZHA 5H8BA 3F3VA 2WTWA 4M68A 4Y8DA 4MTAA 3G9LX 4YJRA 5HLNA 3FMMA 2ZMCA 1KUTA 3RPRA 3EKNA 2OJGA 2CHLA 3LFEA 4RC2A 3CQEA 4C58A 2X2KA 2XIKA 3O7LD 4C2VA 4WA9A 3NVMB 5IQIA 2PPQA 4AA4A 3MH0A 3M2WA 4N6ZA 5AUXA 2WQOA 3BQRA 4DTKA 4HVSA 4FT7A 5G6VA 4F70A 4MYGA 2FGIA 4GL9A 2WMUA 3AD4A 4HJOA 4GK2A 5I9XA 5IH5A 1BKXA 1PXLA 3QC4A 3OTVA 3RPVA 4FV0A 3JY0A 2XMYA 3KKVA 5HG7A 3ZC5A 2XH5A 3FWQA 1WFCA 4YGAA 2YAKA 4ORKA 1UU7A 4PDYA 3D9VA 2RG6A 5D10A 2F7ZE 5AJQA 4O2ZA 2PMNX 3L9PA 2ITYA 3KXHA 3VS5A 3W2CA 3ROCA 2EVAA 4AW5A 5JRQA 3KK9A 3SA0A 2IPXA 3R01A 1ZYDA 4XLIA 1Y91A 3UOKA 3DDQA 2XIYA 1ZOHA 4F9YA 1UU9A 4GFGA 1WBPA 2ZV7A 3ZMMA 4XV1A 4HPUE 1UWHA 2P2IA 4EQUA 5KHWA 3EQDA 4A9RA 4ANSA 5B2KA 1XR1A 4HYUA 4DFYA 2ZM1A 1U54B 2R3HA 3AGMA 2C3JA 4FYNA 1GZKA 2ONLC 3FL5A 3IECA 4DBXA 2F4JA 3UQCA 3R6XA 5M53A 1VZOA 3Q96A 2JD5A 4E4MA 1KE6A 1IASA 3I5NA 4BTKA 1BL6A 3LOKA 4NSTA 2UV2A 3LFBA 2R3FA 3HV6A 5A4LA 4BDJA 4USDA 4XP3A 2JGZA 4DAWA 3NUUA 2WAJA 3V6RA 4YJPA 4A7CA 4C4HA 4EBVA 2PK9A 3E8CA 5KNJA 4FG9A 4F1OA 1T45A 2WOUA 3P08A 5KMJA 5L2IA 2JBPA 2WU6A 2VTMA 3DDPA 3DY7A 4NK9A 4LL5A 3TT0A 5HCZA 5F9EA 4QP3A 4O2PA 4FSTA 4FTOA 5HNBA 3O0GA 5AP6A 3E7OA 4L00A 1O6YA 4RMZA 3GQLA 1HCKA 2I1MA 5AIRA 4CQEA 3VF9A 2C6OA 3GXLA 3QTRA 2ZOQA 4FTKA 4LRJA 4M12A 4RZVA 2UZWE 3SOAA 1AD5A 4JDKA 4AT4A 5DRDA 2UZDA 3UODA 2QQ7A 4RRVA 1PXJA 2F49A 1KV2A 2PVMA 4OGRA 4EQCA 3PVWA 5CAVA 5JGBA 4XS2A 4K18A 2YM7A 2YIYA 1U54A 4O91A 3COIA 2R4BA 3LW0A 4JG8A 1Q5KA 3CD3A 4CG8A 5AV2A 3AT4A 3Q53A 4FVQA 3MWUA 5I3RA 4FKUA 2VO6A 4DTAA 2BTRA 2QOLA 5L2WA 5IEXA 4G6LA 3TXOA 1BMKA 4X2FA 1XH4A 4F63A 3NNXA 3GENA 2OSCA 2NRYA 3NNVA 1YWVA 3QXOA 3ZO1A 3HRBA 4F6SA 2H34A 3TV7A 1J7LA 2GU8A 2UW7A 2UZVA 3AC8A 2B4SB 3AOXA 3OVVA 4GK4A 5BVFA 3C5UA 3ZFYA 2DS1A 4U40A 4UMQA 2BIYA 4FG7A 1BI7A 4YZBA 4WD5A 4EJNA 1X8BA 3KULB 3NSZA 3PWDA 3QQUA 3DTWA 5AM6A 5AP1A 3V5TA 2YZAA 3RAIA 5GJGA 3OWPA 3EJ1A 2PVFA 3KRJA 4KS8A 1DAYA 3P5KA 4JJRA 2C3KA 3BYOA 5J5SA 3TV4A 4L53A 5EFQA 4RX8A 4F7JA 1HOWA 2PMOX 4EQMA 4UN0C 4KIKB 4IBMA 2OH0E 4X3FB 2HW7A 4RIOA 5M4IA 1BI8A 4ZK5A 4PPAA 4BDCA 5CU4A 2Y4IB 2EXCX 4QT1A 3EL8A 3C0HA 5JZNA 4FI1A 3AMYA 5AP2A 2JDOA 3ZXTA 2X6DA 1OIYA 2GNGA 3VBVA 3N4TA 1PF8A 4FOBA 5JFVA 2Z7RA 3PTGA 3FYJX 4OTDA 4IFGA 4K8AA 4IAIA 1OI9A 3ENMA 2GQRA 3NCGA 4CV8A 4EOKA 2OG8A 4CTBA 1YHVA 2C0TA 3WE8A 3WZUA 1OIRA 2CJMA 2VU3A 4XMOA 4AFEA 3R22A 4FSZA 4C4GA 3RWQA 4Z7HA 4AACA 4IC8A 4HVGA 3LJ0A 3R7GA 2JDRA 4KKGA 1H1WA 5CT7A 5DNRA 3VQHA 3WBLA 4ACMA 4BCPA 5KMMA 4FBXA 1XHAA 1H25A 2XRWA 2YFXA 3NEWA 5FM2A 4CXAA 1ZZ2A 4ACHA 5DEYA 4PY1A 4HW7A 4PWNA 2CGWA 5J5TA 5HLPA 1GNGA 4L43A 4FKRA 4KIKA 2BZJA 3KL8A 4MAOA 4XG8A 2H6DA 3QFVA 4K1BA 4FKGA 4X3FA 2XZSA 4DEEA 1UV5A 2I0YA 2XS0A 4DT8A 4QMLA 3PIXA 1UA2A 3O7LB 3M42A 1OIQA 4FKLA 3DU8A 1Q24A 2WNTA 3GGFA 1PXPA 3VS3A 3RNYA 4XP0A 3D7ZA 3UMWA 4I4FA 3H30A 4D4SA 4O0YA 3RKBA 2ZDUA 3ZC6A 3W2SA 4GKHA 3QLFA 3VO3A 5HVYA 4I22A 1Z5MA 3OT8A 2KULA 4GVAA 3UTOA 3Q3BA 3LCKA 4O96A 3WYYA 3KXGA 3ZYAA 1ZMUA 2WMRA 3CR0A 5KMOA 4NZWB 5KBQA 4LV8A 4FKPA 1J7IA 4YZDA 4MXYA 1GOLA 2QKWB 4BL1A 5A6OA 3QRTA 4UXLA 4DFLA 4QMPA 3ORNA 3Q9XA 4J99A 2V0DA 5CY3A 4JQ7A 3QXPA 1Q4LA 2J4ZA 2WU7A 3DQWA 4BTFA 4CKRA 4ZTLA 3VS1A 4V0GB 4DH1A 5GJFA 2BKZA 4GEOA 4QMWA 3ZBFA 4ACGA 1VYZA 5EW9A 4AN3A 2GHGA 4G3CA 1V0PA 2WOTA 5CQUA 2VTRA 3QF9A 4R78A 2HYYA 5HNIX 3R83A 1GY3A 4IW0A 3VQUA 4BWKA 2JFMA 3QC9A 4BKYA 2CN8A 3ENHA 4QYFA 4UALA 5CXHA 5I3OA 1GZOA 2C5YA 1M2QA 2YWVA 3K5VA 4DG2E 3BHHA 4EZ3A 5E8ZA 4O84A 2B55A 1KE7A 1A06A 3P23A 3SKCA 1JSUA 4D4VA 4WG3A 2IVVA 3LQ8A 4Z55A 4KB8A 3MESA 4NM3A 2FH9A 3HDNA 4EH3A 2CNUA 2R7BA 4ANLA 4JX3A 3E93A 5KKRC 4BCGA 3DB6A 4WOVA 2XK7A 4M13A 4BCQA 3ITZA 4E26A 5JT2A 3NUNA 3ELJA 4DG0E 5CVGA 2HENA 4R5SA 4C35A 2JIUA 5GZAA 3GC0A 4GKIA 3O8PA 4K11A 4YLKA 5AP7A 2VTNA 4HZSA 3WARA 3CGFA 5EHOA 4R7HA 1GZNA 3R04A 5IU2A 3GCQA 4QP1A 4C0TA 2X7OA 4YZ9A 2IZRA 4MCVA 4V0GA 4X3JA 4D4YA 4YPSA 2HIWA 3JYAA 3G15A 3ORKA 3GI3A 2UVZA 3QCQA 3CS9A 2XCKA 1R1WA 3FI3A 4ZTRA 3FEGA 4OBOA 4PMTA 5CQWA 2ZV8A 3Q4UA 4K77A 3RPYA 5K5NA 2YABA 5IDNA 3QZHA 4AN9A 4JOAA 3RALA 3RHKA 3C7QA 3TUBA 2YIRA 5DH3A 4P7EA 3K3IA 1STCE 5HU9A 3UO6A 4G3EA 1JBPE 4ITJA 2C6DA 4RC4A 4ANNA 3R7VA 3OHTA 1H1RA 3G9NA 4EC8A 1FOTA 1U5QA 3LCOA 4H58A 3NLBA 2BR1A 2HWPA 1L3RE 2XIRA 3G33A 5IZFA 4E1ZA 3PJ8A 4K2RA 1RW8A 3BBWA 3CJGA 2SRCA 5HIEA 3C51A 3JY9A 3NIEA 3C0IA 5IEVA 4GH2A 4GJ3A 5M07A 5L2QA 1KV1A 3GCVA 3IW5A 4A9SA 4B9DA 1H0VA 4ID7A 5EKNA 3W1FA 3UGCA 4W8EA 3EQPA 3RCJA 5J79A 2PZ5A 5JFXA 3IOKA 1QPJA 1KWPA 4QP6A 5H3QA 3H3CA 4CZUA 2R3OA 3K54A 3AGLA 2E9PA 2BHEA 3MVLA 5EYCA 4Y73A 3WYXA 2GNHA 4IE9A 2PVRA 2YEXA 3B8QA 3PP1A 4LUDA 1Z57A 4WNKA 5D12A 4NW5A 5F20A 4B8LA 5IISA 3EHAA 4D2RA 1JSTA 2YERA 5DRBA 3G90X 4MNFA 5IH4A 4YURA 5LWMA 4GVJA 3ORLA 1V0OA 4P90A 2KTYA 1YI3A 3MPAA 3OWKA 3PIZA 3QRIA 4L7FA 1YHWA 4LV5A 1YXTA 5CEOA 2ITUA 4AQCA 3PXQA 5FDXA 1OB3A 4LL0A 3BX5A 1PKGA 4WNPA 4L42A 5CI6A 4FTCA 5HD7A 3UVRA 4R3RA 3FHRA 4X2NA 3I79A 3VJOA 2QCSA 4AFJA 1J1BA 3QRJA 1XKKA 1FBNA 2X4ZA 1DAWA 3HVCA 4IANA 5EHYA 4EHEA 3QGYA 2VTTA 5GJDA 2QO7A 3FV8A 3L8PA 4YHFA 3B2TA 4LGHA 4L46A 5CAPA 3KXMA 4P4CA 2OIQA 2JIIA 4EL9A 4QTEA 2B1PA 4EK6A 3KN6A 1IAJA 4QPAA 2GMXA 2XEZA 5LMBA 5M56A 3TUCA 1XBBA 2W9FB 5CEPA 4EOLA 4ARKA 4F64A 2VUWA 4E6DA 2WZJA 4BCIA 5DEWA 3DJ6A 4W9WA 3ZO4A 3ZUUA 5K4IA 2V22A 2PZYA 3VBTA 3BELA 3FMJA 3QUDA 3DTCA 4PDSA 3GQIA 4Y5HA 2HZIA 5FXSA 1KSWA 4FE2A 3GC9A 2JLDA 3WZDA 4E4LA 2REIA 1OUYA 3FMHA 3PVUA 5IH6A 3ATSA 4QYEA 3MIAA 2PVHA 2JITA 1KOBA 2HZNA 2O3PA 2PZPA 3NAYA 4QMNA 2XBJA 3DKCA 5IQGA 2JKOA 2QOIA 3LFQA 5E8UA 5IQBA 1FGKA 2VTSA 3UDBA 4E5AX 4FKWA 1TQIA 3HNGA 2YHVA 5CAQA 1LR4A 3F5XA 3FDNA 4U44A 4Z7GA 2PVYA 1W0XC 5L4QA 3UIUA 4FGRA 4PL3A 4K0YA 4HYIA 4Z3VA 4FT3A 4BCHA 1GZ8A 4CFMA 4QMVA 4F7NA 4CLJA 3LMIA 4AN2A 5BYLA 4GT3A 4EH8A 2O0UA 3SC1A 3F2AA 3OT3A 2I7QA 4O81A 4JRNA 4O7YA 3NNWA 2XVDA 2OKRA 4PMSA 3GFEA 2C6TA 2ITZA 5E8TA 4NFMA 4D9UA 4F9WA 3TDVA 3H9FA 4USEA 4XG2A 3KXNA 3DZQA 4EWQA 4FTQA 1OUKA 3UNKA 4TTHB 4RLKA 1ZOEA 3S00A 2ZDTA 3BU3A 5I9VA 2XNOA 3MFUA 1KE8A 2GTMA 2QG5A 2W4KA 3FZRA 4L9IA 3PG3A 2PUUA 4CFNA 5DYJA 3HYHA 4F09A 3GOKA 2G2IA 4QPSA 5D7VA 1URCA 4FZDB 2WTKC 4C02A 3FSFA 4QOXA 4BI2A 1ZARA 4DGNA 5D41A 4FUYA 4CCUA 1H01A 1U46A 1B39A 2FSMX 1BYGA 2QODA 4G16A 2B9IA 4FTJA 3R71A 2X1NA 1ZYJA 4MWIA 4QP2A 4R3PA 2LAVA 4YZCA 4Y95A 4W4XA 4BICA 5AAEA 2XKEA 5BVDA 3HAVA 3QQHA 4L45A 3BI6A 3KCFA 3KXXA 4ASDA 2ITOA 2Q0BA 3FBVA 3UBDA 3PDTA 3W10A 3V5QA 5L2TA 4O7NA 3KMMA 4DFUA 2CCHA 3OW3A 5HEZA 5C8NA 4NWMA 5C26A 2W1EA 2OFUA 2R3LA 2ITNA 3LCDA 3ORPA 4V05A 3LKMA 2BCJA 2YM5A 3DPKA 4ZEGA 4OR5A 4CT2A 1IRKA 4HCUA 3RGFA 4CTCA 4IEBA 4JVGA 4ERKA 5ACBC 2CGVA 2I40A 2BAJA 3O17A 3UYTA 3ZRLA 3SLSA 3D5VA 1OL2A 4KIPA 5J7HA 5CYIA 3KC3A 5AV0A 2JBOA 4U3YA 2YAAA 1JKSA 4XBUA 3C0GA 4FIJA 5CU2A 5HGIA 3ZLYA 5DT3A 5CT0A 4M69A 2HY81 3RVGA 5LMKA 3FL4A 3NRMA 2C1BA 5KKRB 3KB7A 2CKOA 3GT8A 1UU8A 3FYKX 3L8XA 3F88A 3F2NA 4UZHA 2PE2A 3FLYA 4ZTSA 3RZFA 3TM0A 1DM2A 2DUVA 5EKOA 4N57A 3IKAA 3ZDIA 4EUTA 4CMUA 4XOYA 4MNEB 3MVHA 4RA4A 4ZIMA 4PL4A 3BYSA 2Q0NA 3ODZX 4YTIA 3VUTA 4HYSA 3ZU7A 5AWMA 3DBFA 4TRLA 2ZM4A 3CC6A 2RF9A 4M97A 5CVHA 5FBOA 1OECA 3QZIA 5TO8A 3RAHA 4X0MA 4FF8A 1IEPA 2XYNA 3GB2A 3HKOA 3T3UA 4O7TA 1MQ4A 2OFVA 2YA9A 5AAGA 1QPDA 3DQXA 2G15A 4YP8A 3I7CA 1YWRA 2RG5A 3RAWA 3WF5A 3PXYA 2WKMA 5HG5A 3TJCA 4E6CA 4EYJA 3RM6A 4OAVB 4I5CA 4YR8A 2XJ1A 1XH9A 3IDPA 4PPCA 4FV5A 3VW6A 3ZFXA 4F7SA 3NVKI 2A2AA 1P2AA 4IX6A 3GU4A 4MXZA 3U4UA 3ZSHA 4F6WA 4UV0A 1Y6BA 2RFEA 2W1ZA 2CKPA 2E9OA 3NDMA 4FTNA 4R5YA 4E73A 4QTAA 4I93A 4HVHA 2XKFA 3NIZA 3H0YA 4PTGA 2C6LA 4AE9A 5J1VA 4CFUA 3E8DA 4BTJA 5HX6A 2F2CB 3KEXA 2WPAA 3ZRMA 5BVWA 4BYIA 5JQ5A 4ZTMA 1ZLTA 1O6LA 4C3RA 1UKHA 4GIHA 1FVTA 2WFYA 4O7RA 3NX8A 2RFSA 5HICA 1YXUA 2RSVA 3RTPA 4LGDA 4ZMEA 2UZLA 4E4XA 4ZTHA 1WCCA 5IKWA 3C5IA 2J0KA 3QTWA 2WEVA 3UP2A 3DFAA 3I0OA 4BGQA 1M52A 4PTEA 3SOCA 2OGVA 3A8WA 2FSTX 2WMVA 4BDHA 2B9HA 2R3PA 1YQJA 2BUJA 2WMBA 4U0IA 3WZEA 4F1TA 3D5XA 3MH3A 1W84A 3MDYA 4FSUA 5FTQA 3SD0A 5AUUA 2GNLA 2XK8A 4ZZOA 1LEWA 3WZKA 4U43A 2R2PA 2R3GA 1ZRZA 2C1AA 4TZRA 1WBSA 2YIQA 3R2BA 4H39A 1DI8A 3F6XA 1JKKA 4GCJA 4C3PA 4IB1A 5HTBA 2VWUA 1QPEA 2GS6A 5K0KA 5ANIA 3GNIB 3UNZA 5DOSA 4DITA 5ANKA 3SRVB 3UMXA 3QCSA
chains in the Genus database with same CATH superfamily
3EZRA 3O96A 3GU6A 2G2FA 5F1ZA 4EZ5A 2NO3A 2W1CA 2WMWA 4UXQA 4IM3A 4XRLA 1R0EA 2Y6MA 2WTVA 3HMNA 4QYHA 3D2IA 2BALA 5DPVA 1Z9XA 3FLWA 3TG1A 3R21A 4S30A 4MEDA 4ZLZA 2UZUE 4BZNA 5DMZA 3PE2A 3DXNA 3QL8A 3RZBA 2NYAA 4R7BA 3LM0A 5BUJA 4U7ZA 2XAMA 1E9HA 3P4KA 2OXYA 2FO0A 5ANOA 4PPBA 4IIRA 5ANDA 3ALOA 3RAKA 3FC1X 4L6QA 5EM6A 4TWCA 3UG2A 5JGAA 4FT5A 2ERZE 2OIDA 3DAKA 3L8SA 4LFIA 2Z7LA 2ZMDA 2XA4A 3Q04A 4YHTA 5FLFA 4BDKA 4TT7A 3F66A 2ZB0A 3NPCA 4WRSA 4CVAA 2O64A 4H3PA 2XK9A 4O0RA 3U8WA 4AA0A 2YZLA 3CGOA 5AR3A 3HZTA 4GYGA 4QO9A 1YDTE 2AQXA 2CN5A 3BCEA 5LARA 1W98A 2BDWA 4NTSA 2ZV9A 3QX4A 5FD2A 4IAZA 5JN2A 4W4VA 4IVDA 2WQMA 1JVPP 4H05A 3MTLA 3SRVA 5IA5A 4HGLA 2CPKE 4NKSA 4F4PA 2E9VA 5CSHA 2FVDA 3Q4ZA 3U9CA 4BZOA 3DNDA 5M06A 2R0IA 1H0WA 1XH7A 4RJ3A 3LAUA 3ORMA 4H36A 3G6HA 2UW5A 4IX3A 5M55A 2VTLA 4AAYA 4J97A 4FL2A 4RT7A 1YI6A 4FVPA 2NPQA 1F0QA 4AP7A 2W0JA 1WVXA 3JVSA 2QO2A 3R63A 2VO7A 4J53A 4F9BA 1PRYA 1REKA 3FC2A 2WTKB 3ZLWA 4MQ1A 3QRUA 2UW8A 1VR2A 3LXNA 3QAME 3EN7A 4R8QA 4D1XA 1KE5A 1M7NA 2C69A 1G3NA 3CKXA 2QOCA 3N51A 4L44A 4TYGA 4D0WA 4B6LA 5L3AA 3AT3A 3PUPA 3EKKA 4JBQA 3QUEA 2XK4A 3W18A 4O0UA 5DWRA 2VWVA 1LP4A 4FNWA 4LI5A 2R3KA 4J1RA 4UY9A 4XH6A 5GHVA 4E93A 3ORIA 2JKMA 1WVYA 4EK3A 3QQGA 3U54A 3DNEA 1MRVA 4FIEA 4S34A 3VS7A 3MGYA 3U4WA 4F0GA 1G8SA 5TT7A 3O2MA 5CF5A 5IA2A 4G9RA 5E1EA 5JRSA 3A2CA 3DKGA 3IW6A 5K3YA 3AD5A 3QQFA 3ZFMA 4ASXA 4DEGA 1U4DA 3BE2A 1ZMVA 2OXXA 3Q9YA 3II5A 5KZIA 3V5LA 3UPZA 3R1NA 3LHJA 2OJJA 3RHXA 3R30A 3TNQB 5M44A 3VRZA 4NL0A 1WBOA 2OJ9A 3V8WA 4E5WA 3D2KA 3FZ1A 3IONA 1JNKA 3A60A 5CSXA 2VO0A 3Q2MA 3V5JA 3LFAA 3O8UA 4I24A 3ZO2A 2X9FA 3KRLA 1OPKA 4D2SA 4G6OA 3U6IA 2QLUA 5J9ZA 2WD1A 4H1MA 4AQKA 1SVEA 4AUAA 4R77A 4EK5A 1JLUE 3FKOA 3F5GA 2QOFA 3OXTA 4NCTA 3R7YA 2QR7A 3E8NA 5CAOA 4FEXA 3NMUF 2JFLA 5HTIA 3UNJA 3LFCA 1URWA 3OCTA 4OUCA 1WAKA 1H24A 2R9SA 4OTWA 4GK3A 3VBXA 4XV2A 4FV4A 3EIDA 3VUHA 1WBNA 3OBGA 2XP2A 3EN4A 3TACA 4FV3A 5FUTA 1H1PA 3DBDA 3C4EA 2Z7QA 4EOOA 4HYHA 3VW8A 1Q8YA 4EONA 5AFVA 5AR4A 4TWPA 4RJ5A 1OMWA 4ZY6A 4OBPA 4E6AA 2YLEA 2FSLX 4GMYA 5DR2A 3IK3A 1CTPE 3V04A 4BCJA 3SVVA 1Q97A 3MPTA 3QTUA 4FTIA 5KE0A 4O7ZA 1FVRA 5AV1A 2WB8A 3K2LA 2GCDA 2JEDA 2OIBA 3TL8A 2RIOA 3C9WA 4JR3A 2XNNA 3BWJA 3QBNA 1CKPA 3DAEA 4LYNA 2R3QA 4WSYA 3D5WA 3ZCLA 4CEGA 5LOHA 2W99B 5EDRA 4CNHA 3V8TA 1Q8ZA 5CF4A 4F1MA 2ITTA 1Q8WA 3KRWA 4C34A 3I81A 4NJ3A 3DZOA 1Q62A 2BZKB 3HP5A 4YNEA 2YDJA 3PJ1A 1REJA 3EN9A 2BAQA 4BZDA 2WIPA 1OL1A 2BFYA 2OLCA 1YXVA 3V3VA 2WMQA 2VNYA 1SNXA 4FK3A 5HORA 4K6ZA 3MH1A 4V04A 4PL5A 3FLQA 2RFDA 4YSJA 2NRUA 4F0IA 2P3GX 3PXZA 3ZUTA 4D2PA 2W1DA 4JX7A 4DHFA 4O6LA 1K9AA 4PRJA 5L8LA 2I0EA 2XCHA 3LMHA 2I6LA 4AZEA 1ST0A 3H10A 4U45A 4FZ7A 4RQVA 4DFZE 4FTUA 4FIIA 1KE9A 4AAAA 4IADA 4Y85A 3VIDA 4EK8A 5JZJA 3JS2A 4C7TA 5I9UA 3ZRKA 3DLSA 3QQJA 3UG1A 5CU3A 3SGCA 2YCSA 1TFFA 3NWWA 4GRBA 4WBOA 5CI7A 4USFA 4FA2A 5CAUA 3TEIA 5A6NA 1IAHA 3B2WA 1KOAA 2X0GA 4WNMA 2O8YA 3ORTA 3ETAA 4WUNA 4D4RA 2BILB 1J3HA 2J90A 1Y8GA 3MI9A 4Q9ZA 3S0OA 4FEVA 4RVLA 4FKTA 4ZZMA 2YCRA 4DH3A 1U59A 4C62A 2QD9A 4MWHA 3CY2A 4GS6A 4HCVA 5JFSA 2XBAA 3VN9A 4A4LA 5LMKC 5AEPA 3FPMA 5LVMA 2J50A 4I0TA 1FMOE 2GPHA 4ZSAA 4IAYA 2OZAB 3OCGA 3MY1A 3W2QA 4C4EA 5FXQA 2GHMA 2JKQA 2IW6A 3NFGB 1V0BA 2FYSA 4M66A 2NP8A 4AZTA 3ZDUA 3Q4TA 3BE9A 3TCPA 4ZS4A 4YC3A 3DT1A 4BI1A 1BL7A 3DKOA 4AW2A 4E3CA 4MVFA 3R8PA 2QNJA 4ZS0A 2OI4X 3MBLA 5FBNC 4MHAA 2C4GA 3IO7A 2PY3A 5IEYA 3QZFA 3LCTA 4G6NA 2PUNA 4I6FA 2QOBA 2IVUA 3BIZA 3C4WA 3OUNB 2W4JA 4KBCA 4PQNA 1ZYCA 3R7IA 1RE8A 2NNWB 2A19B 3W0SA 3RM7A 2W7XA 2VN9A 4C33A 3JVRA 4BDDA 4KINA 5HIBA 4F9AA 4ZTNA 4MBIA 5EDQA 1Q3DA 2XK6A 1UNGA 4BFMA 5IA3A 2WMAA 5J87A 4FV1A 3PJ3A 3GOPA 3HA8A 4TYEA 3AC3A 3Q9ZA 2IW8A 1SMHA 2HZ0A 3LVPA 3WOWA 4DH8A 4EUUA 1XH8A 5KCVA 3S3IA 1NY3A 1XQZA 2I0VA 4IDTA 2IG7A 3ORXA 2QHMA 4UWBA 5FXRA 3FMKA 3F2RA 2OZAA 4FT0A 4JDIA 3PSCA 4G9CA 5E7RA 4UMPA 3BLRA 3UIMA 3R9NA 3HMIA 4LOPA 4D1ZA 4L3PA 3PIYA 4XG7A 4JR7A 3UOHA 4PDPA 3HDMA 4YZNA 4D28A 5K5XA 1FVVA 3LXLA 3FQEA 2JDTA 2A27A 1JPAA 2OO8X 4RFMA 4YJNA 3QGWA 3HAMA 5CF8A 4AGDA 2P2HA 3KQ7A 1BUHA 3UOLA 2UVXA 4KKEA 4Y72A 5HHWA 1NVQA 3ZTXA 3EN6A 3BRBA 3PYYA 4FG8A 3FXZA 5BMSA 4MD9E 3QCXA 5HTCA 4J71A 4CSVA 4JXFA 3PUFC 4CKIA 3LXPA 4GYIA 4MXAA 1WMKA 4N6YA 4EH4A 4EHVA 5AIKA 3EQBA 1M7QA 2Y7JA 3DB8A 3NAXA 5J1WA 3FAAA 3IDBA 5DIAA 4FEWA 2WGJA 3PLAE 4PF4A 1YKRA 4XG4A 3ANRA 4AXFA 3NW6A 4O21A 5I9WA 4QYYA 3HRFA 5F95A 4DN5A 3U87A 4LOOA 4FIGA 4QP9A 2PWLA 3CIKA 5L6WL 5CF6A 1WZYA 4FX3A 2BFXA 4IJ9A 2UZOA 2WTIA 1OGUA 4QMXA 4EZ7A 3IGGA 5FEQA 2Z2WA 4ZZNA 1ZY4A 3UZPA 2LGCA 4MF0A 5ETAA 4FZFB 3RINA 5HX8A 4XV3A 4QMZA 3TZ9A 1J7UA 5JGDA 4A9YA 4IX4A 3PSDA 5C9CA 5AADA 1YOLA 1JSVA 3R73A 3CBLA 3NUPA 5C4KA 5F4NA 1T46A 4O1OA 4DGGA 4UYAA 5HE2A 4DHZA 4NYEA 5HU3A 5HG9A 2VTPA 4GFOA 2VX1A 4BDEA 5M4CA 4O86A 1WBVA 1OPJA 2J51A 4NIFA 4NM0A 5F94A 4F6UA 3TUDA 1XO2B 3E8EA 3IW4A 4TPTA 5L6OA 4F78A 2EU9A 3LZBA 4RA5A 2BROA 2OZOA 3C4CA 3BLQA 3MY5A 4AOTA 3D14A 4QNAA 3Q5IA 4IM0A 4OAUC 4AZFA 4IZAA 3U51A 3BKBA 3ZONA 4ANQA 2X8DA 1PXIA 4RJ6A 4GG5A 4FC0A 4AXEA 2JDSA 5AUZA 1YWNA 3DK7A 5IA4A 2XAOA 3V5WA 3DA6A 3AT2A 5GIPE 4BCFA 2RFNA 2WMTA 5J9YA 4TY1A 5FTOA 3POZA 1E1VA 4PTCA 4HZRA 4XHKB 4YLJA 5IG1A 2PL0A 3DGKA 4XLVA 5KO1A 3C13A 4O7VA 3CPCA 3BEGA 2ETMA 4KSPA 4RZWA 3UDZA 2W17A 4XJ0A 5JMSA 5AUWA 4HVIA 5A46A 2VX0A 5AM7A 4EK4A 4B0GA 3F3WA 3W0NA 1NVRA 3W8QA 1ATPE 4IWQA 4WRGA 4CFWA 4XV9A 2CKQA 2VAGA 2X6EA 2ZJWA 3KF4A 4D58A 4KAOA 2C5VA 4QMSA 4G3GA 3BEAA 1YW2A 4KNBA 3OCBA 4RBLA 4RSSA 3PY1A 3VHEA 5C1QB 5AR7A 3DK6A 4KBAA 3ZS5A 2OU7A 4DDGA 5E8WA 4FZ6A 3OUKA 4X2GA 5BQ0A 4CMTA 1VYWA 3ET7A 4RX9A 5FEEA 4IWDA 3W32A 3HP2A 4ONAA 3O71A 4G5PA 3DKFA 3QD3A 4AF3A 2Q83A 2PE0A 4FNZA 3KGAA 5ANJA 2AC5A 5BMMA 3UP7A 3TKHA 4IAAA 1H4LA 4P2KA 5HCYA 4I4EA 2V7OA 2W96B 4O7SA 3OMVA 5CALA 5JQ8A 1W2CA 4I6QA 4KRCA 4IVAA 4S2ZA 5HOAA 4EOPA 1R78A 3JUHA 2WQEA 3PVGA 4YZMA 2XK3A 4E7WA 4IJPA 4BIEA 3SQQA 2BDJA 3D15A 4QD6A 1PW2A 1Q61A 2F57A 3KU2A 3HRCA 2R3IA 3HMOA 2PMLX 4TN6A 4D0XA 4EWHA 3PRIA 2XM9A 2VD5A 2CMWA 4Y5QA 5A9UA 5IQAA 3NYOA 3F7WA 4YBKA 3LFSA 3I7BA 2VTHA 3RK7A 5IUGA 4EH7A 2CLXA 4FRFA 5CNOA 4DFNA 4YJUA 4OTFA 4BWPA 4JL9A 2WEIA 2R3MA 4MXCA 3KMWA 3UZTA 4R1VA 3TZ8A 4UBAA 5J7BA 1W2DA 4QNYA 4O0TA 3T9IA 4TW9A 3R7EA 2C0OA 4H1JA 4N0SA 4RX5A 4IWPA 3R8ZA 5LJJA 4M69B 3SXSA 2PHKA 4FUXA 4BBMA 4NCTC 5DN3A 1OBGA 2E9NA 4OTGA 2JAMA 4D1SA 5A4QA 3LFDA 3TMOA 4ZOGA 4ZSGA 5BUEA 3BU5A 3VS6A 4DEIA 2YIWA 4FKVA 4FSWA 4FTLA 4QMUA 3FZTA 4X2KA 5JFWA 4XNEA 5I9ZA 4BDBA 4C37A 4YSMA 4FV6A 5FP6A 4AGWA 1Q99A 1FPUA 2XNMA 4J52A 3LM5A 3QA0A 5H9BA 3TKUA 2IO6A 4PNKA 3V5PA 4WT6A 3BHYA 1M17A 3CPBA 3QKKA 3R7OA 3ZSIA 2P55A 4P5ZA 4BYJA 2WHBA 4EHZA 3PJCA 3RK5A 3ZLXA 5GIOE 5CU6A 4IB5A 2OBJA 2V62A 3MYGA 2XRUA 5EG3A 4J95A 4U42A 2QURA 3LLAA 5DR6A 3WIGA 4O7WA 2C6MA 4DDIA 3BHTA 4QTBA 4YU2A 4CYJA 2EWAA 3B8RA 4CQGA 5LQFA 5IDPA 4Y46A 4RWIA 3UYSA 3MSSA 3NUXA 1GIHA 1ZAOA 4OTPA 3GCUA 3I0QA 4OTIA 4KKHA 4O6EA 4OTRA 1UVRA 4CMOA 2J0MB 2G9XA 1PMEA 2XNGA 4FIHA 3FXWA 4BN1A 2C3IB 2VWZA 3NS9A 4U81A 2WTDA 4MBJA 1OL6A 3VUDA 2BRBA 4BDFA 3FQSA 5EQPA 5IQFA 3UIXA 4O4BB 4MD8E 3EQCA 1UNLA 2XNEA 2OJIA 4MX9A 4PX6A 2IW9A 5B2MA 3KRXA 3PZEA 4S33A 5AUTA 1FINA 4KSQA 5AR5A 3GU7A 2QOQA 3IOPA 4J96A 3WZJA 5BPYA 5JEBA 2CCIA 3LFFA 3ERKA 3TZMA 2B9JA 3S95A 1H1QA 3D5UA 3EZVA 4RG0A 4BR3A 1QPCA 4MK0A 4APCA 4C59A 2Y6OA 4DF3A 2X4FA 3O51A 4XG6A 2C6KA 5A3XA 4C4IA 5EQYA 4MKCA 4F99A 2UW0A 2XYUA 2JC6A 3BLHA 2R7IA 5B0XA 5J8IA 4I1ZA 1I44A 3OEZA 2UZTA 3GP0A 1CSNA 4BY9E 3GU5A 3A61A 4BDAA 1JAMA 4B4LA 4E20A 2WMXA 4D2VA 2ZFYA 3U55A 2C47A 5TKDA 1YHSA 4I6BA 3OTUA 4YTCA 3QD0A 4M7IA 4C57A 3R1QA 5HBEA 4FGBA 2YDIA 3I6UA 3FZPA 5H2UA 3UO4A 4DBNA 5HLWA 4XUFA 2R3JA 4DFBA 3VVHA 3F7ZA 3FMLA 3QD2B 5HG8A 4BCMA 5BNJA 2IEWA 4JIKA 5D7AA 4JBOA 4KA3A 2UW6A 2X2MA 1OITA 4HNFA 5HO8A 4DGLC 3AC4A 3UVPA 1ZMWA 5HBHA 3LCSA 3V6SA 4YPDA 3V8SA 3ZLSA 3LIJA 2JIVA 4DEHA 1O9UA 1TQMA 3LJ2A 4AOIA 1OIUA 4J7BA 3COMA 4ZTQA 3PY0A 3KREA 3OY1A 1H07A 1WVWA 4G3FA 2YM6A 5ICPA 4D2TA 4DGOA 4A9TA 4FNXA 1R39A 2P33A 4FV7A 5EOBA 5CVFA 5FG8A 4YJSA 4G34A 3UC3A 2XUUA 3VBQA 3E3BX 4APPA 4RX7A 3R8VA 4DFXE 5FDPA 4BGGA 3E5AA 5AP4A 3S2PA 2C6EA 1R3CA 4JNWA 1PXNA 2PSQA 3ZEWA 4CRLA 4WIHA 3EQFA 2UZEA 2Z60A 4QP7A 5AX9A 4DH5A 1XJDA 4TL0A 3F3TA 4EKLA 3QA8A 4AWIA 1G5SA 3QX2A 4EH6A 3SG9A 4QYGA 3G0FA 2XKDA 1XH5A 3HUBA 2BIKB 1H28A 2DYLA 3ACJA 4I3ZA 3QTXA 3BU6A 3EN5A 3OW4A 1W2FA 4ZJVA 4FKQA 2G01A 5DT0A 3RK9A 4PMPA 3ATTA 2ITQA 5IPJA 3IGOA 3FY2A 2IZTA 2W1FA 3SXRA 3M11A 1PMUA 4F0FA 4AT5A 3I4BA 4IZYA 4LMNA 3QTIA 5HO6A 5K4JA 4RWKA 3PP0A 4GJ2A 2Y9QA 4KRDA 4IDVA 2PVKA 2ITWA 3QRKA 4FTTA 4W4YA 2BHHA 4JG6A 3BL7A 3NUAA 3F3ZA 2H96A 2VTJA 3PE1A 4YJQA 2E9UA 3CTQA 4RVKA 4WO5A 4CV9A 3MV5A 1LPUA 5HKMA 4BDIA 3HLLA 4Q9SA 3ML1A 4KBKA 3MB6A 5HD4A 1ZZLA 4C4FA 2FA2A 5CXZA 4AZVA 4QMMA 3AXWA 3KVWA 4FR4A 5CSWA 1SM2A 3VUKA 2PULA 4IB3A 3VF8A 4Z16A 3G5DA 4O22A 5EYKA 2HWOA 4YBJA 4H3BA 2HK5A 5I9YA 3MH2A 4ALVA 3U6JA 4L52A 3KY2A 4M8TA 4DEDA 2J5FA 2WTCA 4FZAB 2YCFA 4ZLOA 1ZYLA 4CYIA 4UEUA 4X6QC 1H1SA 4ASZA 3JXWA 3GC8A 3N4VA 5AV4A 1M2RA 3TTJA 2WTJA 4CFVA 1PMVA 4BHZA 5FTGA 3QWJA 3WF9A 3QALE 2VO3A 4FSNA 3G0EA 5HESA 4NFNA 4RC3A 5DGZA 4F7LA 4WG4A 5AA9A 3UDSA 5TOZA 2R3NA 5DBXA 4BWXA 5M08A 4YTFA 3UVQA 5I0BA 1SNUA 3C4ZA 1HCLA 5C8KA 3V01A 1A48A 2BDFA 5A14A 2J0IA 2ZM3A 2BZHB 4CT1A 5IF1A 2HAKA 5H8GA 4ENXA 5L8JA 2YLFA 3E7VA 4MXXA 4DEAA 2HCKA 5H8EA 4EOMA 4JS8A 2QOKA 2A4LA 3W0QA 4BRXA 3P78A 1NVSA 4RJ4A 3MS9A 4FL1A 2VGOA 4RIXB 3R8MA 5IQDA 3UIBA 3I60A 2GQGA 5B7VA 4ZP5A 2J0LA 5IQCA 4NUSA 3R9DA 4QDVA 3PWYA 2J7TA 3MVMA 3KXZA 4UWYA 3S4QA 5EI2A 4D55A 5LVNA 1PMNA 3DBEA 3CEKA 3ZM9A 3BYMA 1PJKA 4TNBA 4AU8A 4TNDA 4IVCA 4W4WA 3L9LA 2OICA 1W7HA 1CKJA 3K5UA 4N4SA 4PV0A 3ZO3A 3MTFA 4KWPA 3W0PA 2F9GA 5BVOA 1BLXA 3OEFX 3SX9A 3UE4A 1JWHA 4NW6A 4G31A 4YC8A 5E8YA 1OZ1A 1SVGA 1NA7A 4YJOA 4D5HA 2BRHA 4IQ6A 3BZ3A 4L68A 4NH1A 2UW9A 4TYHB 5IQHA 3A7IA 5M51A 4DEBA 3W0OA 3VHKA 1DI9A 3LXKA 5CENA 3SG8A 1QCFA 3RMFA 2ETKA 4BI0A 2HXLA 3H4JA 4GFMA 3RWPA 2OF4A 4JAIA 5HO7A 3FSKA 5L2SA 5EYDA 2PYWA 3N4UA 3UQGA 3VUGA 3AG9A 2BMCA 2YIXA 4A9UA 1PKDA 2OK1A 3CE3A 4C36A 3W33A 4CD0A 5ACKA 2C30A 2QHNA 3BV2A 1TKIA 4DLJA 5I4NA 5M57A 3CTJA 3TNHA 3OWLA 4RIXA 3QQLA 4WHZA 5DFPA 4PP7A 3E64A 3U6HA 4NJDA 5BVEA 5D9HA 1Q3WA 4DLIA 1RDQE 4TWNA 4AGCA 2ZV2A 1VEBA 5K0XA 3NYNA 3DBQA 4KUJA 4LMUA 5AX3A 3RCDA 1PYEA 1ZXEA 5KHXA 4BCNA 4J8MA 3TYKA 3R1SA 2B54A 3GBZA 3PPZA 2J9MA 3W16A 1QL6A 1YDSE 1YRPA 2W1GA 3ZZWA 3COKA 4OBQA 4G3DA 2WMSA 4RIWB 1NT2A 3DV3A 3L9MA 2YJSA 1W82A 5BVKA 5KMKA 5HVKA 3A62A 3CCNA 4KABA 2W05A 2B9FA 3CSVA 1OL5A 3HMPA 4IHPA 3OOGA 4CFXA 4I5HA 3A7FA 4UMUA 3E88A 3FE3A 1S9JA 2EUFB 4IAFA 3BWFA 2PUPA 2VTAA 3N9XA 2GFSA 3FY0A 3QD4A 5M09A 3VUIA 2WXVA 3QZGA 2UW4A 3NZ0A 4DH7A 3IW8A 4TYHA 2CNQA 2FB8A 4BTMA 3P9JA 3P0MA 3TNWA 5IUIA 3MVJA 4FSRA 4DHJA 1XBAA 2CDZA 4OTHA 5CTPA 4BIBA 4PUZA 4JI9A 1XWSA 3DXPA 4DE4A 4S32A 5E8VA 4BIDA 4I0SA 3Q5ZA 4ZJIA 4JIAA 2XEYA 3Q4CA 5LVLA 5LCJA 5FRIA 5KX8A 3WF8A 4CZTA 4FEUA 2DQ7X 4BGHA 3KF7A 4OT6A 2IZUA 3QTZA 3OF0A 1H8FA 1PXMA 4FEQA 4XRJA 1PYXA 3LLTA 5BX0A 5GZ8A 4Y83A 1SVHA 3QU0A 3O8TA 4XOZA 3W2RA 3CY3A 4EORA 4Q5EA 1L8TA 4BB4A 2GS7A 1I09A 3KMUA 3NR9A 3FKLA 3QCYA 1UKIA 1ZYSA 4FKJA 2B53A 1NXKA 4FKSA 2VWXA 1IA8A 4LM5A 5BYZA 4RIWA 5CEQA 4O7LA 1ZOGA 4FVRA 5T68A 1PXKA 1G8AA 1W8CA 3FMEA 5EOLA 4JBVA 4PDOA 2A98A 4FOCA 3DCVA 5CASA 4GT4A 4RWLA 5TE0A 2F7EE 5HE1A 4DC2A 4CG9A 2VWIA 3P7AA 1AGWA 2H8HA 3TNIA 1DS5A 3PPKA 4FSQA 4A07A 3PRFA 4ZSJA 3WF6A 1RQQA 3AC5A 4RJ7A 2VWWA 5TF9A 4I5PA 3TI1A 2X7FA 4L3JA 2BRNA 2IZSA 5EI8A 3ZZEA 3QKLA 4DYMA 3H9OA 2YDKA 3IG7A 4U9AA 2VTOA 5EM8A 1GAGA 3KCKA 5A4CA 5EI6A 3GUBA 2J5EA 3R1YA 5IMXA 4TXCA 5JK3A 4C2WA 1K2PA 4PMMA 3Q32A 3L1SA 4GU9A 4MBLA 3HEGA 2C6IA 1YXSA 2YM8A 3BGZA 3BYUA 4NU1A 3UZRA 5IA0A 2CLQA 2RL5A 3ZOSA 4AXCA 3KN5A 1PY5A 3DOGA 2HW6A 1H08A 2YM4A 2C3LA 3ODYX 4NM5A 5AR2A 2XF0A 5CEIA 3D4QA 1OPLA 2XNBA 4RQKA 4OLIA 5TR6A 4AOJA 4UB7A 4DCAA 4AA5A 2GNFA 4I20A 1JOWB 4I92A 5E91A 3OZ6A 4IH8A 5A54A 4XP2A 5AP5A 1YVJA 4ALWA 3MPMA 2PVJA 4IAKA 2UZBA 3G6GA 1ZY5A 4BBEA 4LG4A 3LFNA 4ACCA 3FZOA 4WNOA 2RGPA 5LMAA 1VJYA 4RPVA 4E5BA 5ANGA 4QRCA 3QHWA 4L8MA 5KZ0A 2O2UA 3FI4A 2H9VA 4ALUA 5I5ZA 5FWKK 4AW0A 3EQGA 5AP3A 3ACKA 4UMRA 4DG3E 5C27A 3KULA 2JAVA 3LQ5A 3RPOA 2ZVAA 3KK8A 4E8AA 3A4OX 3A4PA 4O4FA 2X0PA 3AQVA 2GSFA 2ITPA 1GJOA 3FI2A 4FSMA 2GDOA 3HGKA 3TJDA 2ERKA 2BPMA 5FP5A 2QVSE 3DAJA 4ZSEA 3VBWA 2JDVA 2QLQA 3GCSA 3LPBA 4GV1A 3CP9A 3EL7A 4HGSA 3UO5A 3POOA 3KA0A 2XB7A 4UMTA 1CM8A 1M14A 4ZY5A 5JSMA 4O27B 3F82A 3NW5A 2X8EA 4JBPA 4QP8A 3G2FA 5K9IA 3FLZA 4IFCA 1U5RA 4Q5HA 3EFWA 2O5KA 4QQCA 5EH0A 5HZNA 3THBA 2ZAZA 2R5TA 3OC1A 3OG7A 1Y8YA 3VRYA 4ANBA 2YITA 4C4JA 5DI1A 4R3CA 2Y8OA 3EH9A 4LGGA 5T6KA 4M3QA 2VTQA 4LDTA 3KIOC 4JDJA 4I23A 5IMEA 3VS0A 3WE4A 2VZ6A 3W8LA 5J9LA 1MUOA 4JG7A 4AT3A 2GS2A 2R0UA 3UOJA 4R7IA 3HX4A 4GW8A 3R00A 3OROA 3E3PA 4W8DA 1K3AA 3FZSA 3OWJA 1UU3A 4CKJA 1JQHA 3IDCA 4QQ5A 5GZ9A 5ETIA 4AG8A 3MJ2A 2Y4PA 4D9TA 4C3FA 1VLRA 4ERWA 4IZ5A 2QOHA 3ZH8A 3CD8A 4DINA 3O5AA 2BZIB 3TTIA 5FM3A 3NUSA 4IWOA 2OXDA 4O1PA 4TYIA 2XJ2A 1E1XA 3D83A 3OXZA 5E8XA 4U79A 2C68A 4KS7A 1H27A 4MQ2A 1SYKA 4EKKA 5CSPA 5KMIA 3PA3A 4YNOA 3DS6A 4B99A 5AR8A 2QC6A 2GHLA 4MD7E 5HBJA 4ZJJA 3C1XA 2PE1A 2VTIA 3HV7A 1APME 1XMLA 1B38A 2GFCA 4W9XA 2W4OA 4X7QA 3D7TB 1CDKA 1OKYA 1XBCA 1LUFA 3UJGA 3PXFA 4GSBA 3NUYA 4KIQA 3PPJA 4XYFA 4S31A 3NFFB 3BQCA 4QMTA 3HA6A 1OBDA 2BAKA 4AZSA 1AQ1A 1F3MC 5E90A 1OVEA 2CNVA 4AXAA 4NIFB 3OD6X 4UZDA 1J1CA 4FNYA 4YO4A 3NNUA 2EXMA 4FKIA 4GT5A 4ASEA 5AUVA 2ITVA 1ERKA 5CS6A 2UW3A 2PTKA 4GU6A 3HUCA 5C8MA 3QKMA 3HMMA 1NW1A 3AC2A 2GNJA 2OWBA 2HOGA 3E87A 4XG3A 3PY3A 3TDWA 4TKSA 5EM7A 5CANA 3FMDA 3CQWA 4WBBB 3ZM4A 3NCZA 5EW8A 2W5AA