1XBBA

Crystal structure of the syk tyrosine kinase domain with gleevec
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
277
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title A Novel Mode of Gleevec Binding Is Revealed by the Structure of Spleen Tyrosine Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xbbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xbbA01
2B9IA 4YC6A 1JNKA 4HGLA 3HV4A 5J7BA 1FGIA 1IG1A 4AFJA 4NM3A 4FTTA 1HCLA 2IO6A 1JPAA 2W0JA 2O8YA 3RCJA 4LGHA 4YTCA 4XNEA 3D94A 4B8MA 4EH6A 5BPYA 3QBNA 3TKHA 4BC6A 1J7IA 2NNWB 4C0TA 4XV2A 4AW5A 3EYHA 3FDNA 2ETRA 5IQGA 3UO4A 3ZO4A 4YNEA 3R01A 4F1OA 5ITAA 3MPTA 5CSXA 5JSMA 2VTOA 4BCOA 2JGZA 4WBOA 4NM0A 4IH8A 4JG8A 2GQGA 3QUEA 4RWIA 3AC3A 5IA5A 3TZ8A 3ELJA 3HKOA 2JBPA 4JX7A 3WI6A 3ZOSA 3AQVA 3M11A 2YIWA 4H3PA 3QC9A 2BRMA 4QP3A 3TDWA 1ZZ2A 2WU6A 4EOSA 2GFSA 1YQJA 3Q6WA 4W4YA 4L46A 2VX1A 4GW8A 3UODA 4AFEA 2ERZE 4QMPA 4EBVA 5A6OA 3OMVA 3ZCLA 3H0ZA 3C4EA 1CDKA 2R7IA 1M7QA 4CCBA 4GIIA 5CVGA 3RTPA 4EUUA 3MY5A 4L45A 4MCVA 1Q8TA 4Y72A 4BZNA 4FUYA 3ZDIA 1V1KA 2QO9A 4U40A 5KE0A 4CFXA 1DAWA 5KZIA 2UUEA 4FV5A 3WF9A 4CZTA 4KD1A 4O0VA 2R4BA 2J50A 4YPSA 3QL8A 3ZDUA 3LLAA 2X4ZA 5AIKA 4GMYA 2WTVA 3RZBA 3B2TA 4TYGA 2BIKB 4AOIA 1H26A 1WBTA 5FBOA 2FB8A 4X6RA 2B9FA 2B54A 3UOJA 1Q4LA 1X8BA 2XCHA 4R7BA 2WXVA 3E93A 4AW1A 1PW2A 4AACA 2QVSE 3KCFA 2W4KA 3OFMA 5BNJA 3PXKA 2WTDA 3G33A 3PTGA 4ZTRA 3ZSGA 2R3LA 3VBTA 3MSSA 2QODA 4O7LA 4JRNA 4UWYA 5CEMA 3S2PA 5C1QB 2CMWA 5F4NA 1WBNA 5CSWA 3AG9A 4QP7A 4AF3A 3UO5A 4OTIA 5C01A 3WZKA 5IZFA 2FSMX 2UZEA 2X7OA 3HRBA 3R71A 5EFQA 2ITZA 3MY0A 4NW5A 4F7JA 4EOPA 4FKRA 2HAKA 3A8XA 2QONA 3MPMA 2CGUA 2OGVA 1NT2A 2YDIA 4O82A 1URWA 3PUPA 4WA9A 4EHGA 4FEWA 4EOLA 3KXNA 4KAOA 3KN6A 4YHTA 3PVUA 5EM8A 4ALVA 1Y6BA 4C58A 4N70A 2Z7QA 4ZSJA 1YDSE 4I0RA 4UMRA 5G1XA 3I4BA 2EU9A 5HIDA 4ZK5A 2OJJA 4D0WA 2WQEA 3RKBA 1XH7A 4O6LA 4G6NA 5F1ZA 2CNVA 3CCNA 3BEGA 3BU6A 2ZAZA 4G6LA 4IAFA 3WOWA 4E1ZA 4RJ7A 1XR1A 2XS0A 3A4PA 2PK9A 3FUPA 3LQ3A 1GZ8A 2W4OA 5EKNA 4GK4A 4H39A 3EFLA 5EQEA 5TT7A 3F2RA 3DU8A 2A2AA 3GC8A 4IX5A 3QTQA 2A19B 4G34A 3HAVA 2XKDA 1REKA 5BMMA 3UIMA 3U55A 2WMBA 4H36A 5AM7A 5BVNA 1G8SA 4RJ3A 4BHNA 2GS2A 5B0XA 4R5SA 2VTMA 4I22A 3VJNA 5M4CA 3JY0A 4FYNA 5EI2A 5HO6A 3HEGA 3OEZA 3C4ZA 3Q04A 1YWNA 3RPOA 4BWPA 5I9YA 4LFIA 5E8XA 1IASA 4UY9A 4MVFA 5C26A 4GUEA 4J98A 4QYGA 5HCYA 3OBGA 4IM2A 5L8KA 3D83A 2BAQA 4A9UA 3WF8A 4KUJA 3NYXA 4BDFA 2XRUA 5G6VA 3UQFA 2GTNA 2WGJA 1J7LA 4IB1A 4PTCA 3UC4A 1FBNA 3MVLA 3II5A 4GFGA 4IJPA 4K77A 3PA5A 2JIIA 1J1BA 5EG3A 3NSZA 2BZJA 2ITNA 2J0LA 2XRWA 4RX7A 4D4RA 4IZAA 5EM5A 2C3IB 3U87A 3VULA 2HY81 2RGPA 3DBEA 1UVRA 4XYFA 1GZOA 3V01A 5EYKA 4HJOA 4IAYA 3LFEA 4IX4A 4DH5A 3OT3A 1W83A 3W2PA 4E4LA 4EH4A 4IC8A 4ZIMA 4FNYA 4A4LA 3WIGA 5L2WA 4GFOA 4MHAA 5AV1A 3Q2JA 3G15A 3T8OA 2GS6A 2WO6A 4U3YA 4DC2A 3U6JA 5M44A 1XKKA 4HYSA 5A4QA 1P4OA 4BZOA 1GIIA 2PE2A 1BI7A 4NM7A 5HX6A 3FMLA 2ZVAA 3ET7A 4CZYB 2YDKA 3FI3A 4ZZMA 3VF9A 3EYGA 4GJ3A 4GVJA 3FV8A 4FC0A 4M15A 4MKCA 4U6RA 3HECA 3V6SA 5TR6A 3RMFA 3VS3A 3KMWA 3D5UA 4CLIA 3W10A 3H9FA 4BIBA 1K3AA 3MV5A 1P2AA 4E73A 2QCSA 3QTXA 3AOXA 3LIJA 2PMNX 3NVMB 3SLSA 4BBEA 1OKWA 1OKVA 2OH4A 3FI8A 3D5WA 2F57A 1XBCA 3GUBA 4P2KA 4ACGA 2BRHA 3G6GA 4NCTC 3EIDA 3SG8A 3FE3A 1VR2A 4FSYA 3WE8A 1WBVA 5ACKA 2PE0A 3ZRKA 2R3IA 4FSTA 3VUKA 3LE6A 1AQ1A 4EK5A 4F9BA 2ONLC 1E1VA 3VBYA 4EK8A 5AADA 4KSQA 3CR0A 3S95A 3CSVA 3BZ3A 3HAMA 5E91A 5L2IA 1Y91A 5GZAA 5J1VA 3ATTA 3OY3A 2XBJA 3DBQA 3AMYA 3KRRA 4J71A 1HCKA 4EZ7A 4YTFA 1K9AA 1H07A 3BLRA 5KHWA 2JIUA 3PVWA 4CTBA 2Y0AA 2JDSA 3QRIA 4YZCA 3ALOA 3OWKA 1J3HA 3NDMA 4I94A 3UVQA 3I6UA 3FQEA 5CENA 4A9YA 4X3JA 2QKWB 5HG8A 1KUTA 4KRCA 1YI4A 4FGRA 3RCDA 4FG9A 4QPSA 2CSNA 2OXXA 4MD7E 4DFZE 5J5SA 5FP5A 3NMUF 5AP3A 3PJ2A 4YJQA 3ERKA 1ZY5A 5L2QA 2CHLA 2J90A 4MBJA 4NEUA 2BTSA 3BYMA 3DK3A 2PVMA 4RFZA 4NTTA 5HBEA 1ZMUA 4EH9A 4Q9ZA 3MJ1A 3DFCB 4EWHA 3S1HA 4WOVA 3OCTA 3R0TA 4KKHA 3FXXA 5B2KA 4D2WA 4F0IA 5A46A 4YGAA 5E92A 5JKGA 4CEGA 4EK6A 4W9WA 4DFXE 4IX3A 5DOSA 4PP7A 5KX8A 3RAIA 4PPCA 3R8MA 4M7IA 4O6EA 4LYNA 4D5KA 3HA6A 4NFNA 4G9RA 4XHKB 4I5CA 4Z9LA 4O0XA 4S34A 2HY0A 4DH7A 4DTAA 3NYVA 3F6XA 1FMKA 2EXCX 3EN6A 1OM1A 4AZEA 4IAZA 1PMEA 4FTCA 3MS9A 2QKRA 2PUPA 3V5WA 1PXNA 3GC0A 2R7BA 2IZTA 3ODYX 3VUTA 2GPHA 3R6XA 2PWLA 5J9LA 3K3IA 2C5VA 4EL9A 4N57A 3TTJA 5E4HA 4PP9A 1M14A 4ZEGA 3N4UA 5EQPA 2X1NA 4DH3A 3OCBA 3CTQA 4PX6A 5L6WL 2B52A 3FYKX 3M1SA 5AR2A 1ZWSA 3KCKA 4DCAA 5DE2A 4EH2A 4ERKA 3QD0A 4XEYA 3COMA 2V7AA 4AAAA 1QL6A 5K4IA 3I7BA 3FYJX 5C8KA 1JSTA 3QQHA 2CKOA 2WQMA 4FSNA 1YDTE 5GJDA 3NEWA 3NUYA 4BCJA 3PE1A 2W99B 4ACMA 2JDVA 4FIIA 2C0OA 2PSQA 4I5MA 3VUHA 1ZOGA 3CLYA 3TDVA 5HHWA 4FTKA 4FT9A 5CASA 3MY1A 1OL1A 3F88A 4BF2A 4BZDA 1WFCA 2I0VA 3Q9YA 2ITOA 5HZNA 3R9DA 2HXQA 3V8WA 1ZRZA 3PA4A 3S3IA 3U54A 5AUWA 4E7WA 3QALE 2XMYA 5IA1A 5AUTA 4AQCA 2C6TA 1RJBA 4BKZA 5LMKA 4FEXA 2QR7A 5FQDC 3RALA 2BZKB 1MUOA 4FIJA 4XG4A 3HUBA 4G1WA 2QO7A 2R3HA 2Z60A 1ZYDA 5DN3A 1A9UA 3IECA 4TWOA 4EQCA 2VX0A 3ANQA 1YW2A 3BBWA 4IB0A 3TKUA 1K2PA 5M57A 2B4SB 4IZ5A 5ETCA 2G2IA 2WMUA 1Q97A 4A4XA 5JMSA 3WZJA 3GCQA 3FMJA 2P4IA 3TKIA 3VUGA 1E1XA 4DAWA 3OWLA 5EHOA 4BHZA 1FVTA 4N6YA 3F5XA 4XRJA 4BBMA 5E9EA 2C6IA 4GKHA 3VS4A 3FY0A 4U5JA 3OXZA 3QRJA 4U44A 1TVOA 3GFWA 1Q62A 1GIJA 3NAYA 5HICA 2GQRA 5FLFA 2JFMA 4UWCA 5M55A 4O7RA 2XK8A 4ZMFA 1ZAOA 3QKMA 3JPVA 1REJA 3A7FA 5BUJA 1VYZA 4E5WA 2OH0E 3PZEA 3V51A 4EH7A 4X3FB 5BX0A 3ZXZA 2C6OA 3MH1A 5DI1A 1TQPA 1YRPA 4H58A 3KMUA 5JGAA 4Y5QA 1PKDA 4KIQA 1B38A 3FQSA 3A8WA 5C9CA 5J1WA 3QXOA 2EVAA 4JBOA 3VN9A 4WSYA 2IZSA 5HCZA 4YC8A 4CFVA 5HG9A 4YZBA 1J7UA 4L3PA 4RSSA 2GTMA 4FV0A 4GS6A 4FTRA 3V5LA 4CT2A 4QP8A 3LXKA 4EJNA 2RL5A 2BDJA 1OUKA 4CYJA 1URCA 2EXMA 1G8AA 4FSZA 5HE2A 3V5TA 4ZLOA 3EH9A 5I9VA 2PMIA 4RA5A 3T3VA 2VGOA 3D5VA 4FGBA 2XUUA 4L3JA 4RVTA 5AV4A 4QNAA 1JQHA 3BYUA 4KBCA 5EHLA 2OJGA 4HVGA 2J9MA 1WVXA 1U54B 2PTKA 3O50A 1PXIA 3N51A 2YIRA 4LM5A 3NGAA 4LG4A 4ZAUA 4ANLA 3JR1A 2PUUA 5KMOA 3EJ1A 1NY3A 2Q0BA 3L8VA 4KB8A 3V6RA 3KB7A 3UNJA 3F2NA 4HGEA 3UPXA 3MGYA 4L9IA 4FMQA 3GI3A 3JXWA 4FVPA 4ALWA 4ITHA 1R3CA 4C34A 3WIKA 4Q5EA 4EQMA 2OSCA 4ACCA 3Q60A 3QZFA 2UW4A 2VNYA 3WZDA 3FPMA 3UIUA 3GU8A 3IW7A 2NRUA 4BB4A 2OK1A 4X3FC 4TY1A 5K0XA 2EB3A 3O96A 1JWHA 3QLFA 1YHVA 2BCJA 3HV5A 5AM6A 4A9SA 3BQCA 1V0BA 2I6LA 3UGCA 3GOPA 4DGLC 4CV9A 4E3CA 1B39A 3ZUUA 2W1GA 2HENA 3BHTA 4S32A 5A4EA 3F2AA 5T6KA 5DEWA 3DPKA 3W2OA 3BU3A 5HOAA 4TYHA 5JFXA 3IOPA 3P1AA 3OUNB 4GU6A 4O7NA 1M2RA 1OI9A 3Q9ZA 2X6EA 1M2QA 4WBBB 4ZTQA 3SRVB 1SYKA 5HLPA 1PXLA 2B0QA 3LHJA 4QPAA 2C69A 4MF1A 3PY3A 3JUHA 2C4GA 3QU0A 5CU4A 5ANIA 4M12A 3VBVA 5GIPE 4RPVA 5L3AA 2RG5A 4NZWB 4NT4A 2JDRA 3JS2A 4XV9A 5FDPA 4ZY6A 4FKSA 2OXYA 4D2SA 3NNVA 3DJ7A 1FINA 4YNOA 2P55A 4PMPA 3GXLA 4BDAA 3CGFA 2PE1A 3ZH8A 3RJCA 5HTIA 2Y8OA 5IUGA 2BALA 3TUBA 4EOKA 3GEQA 5KNJA 4AXAA 4QPMA 4FTQA 2UW9A 4L43A 4F6SA 5IEVA 5EYDA 1DM2A 5EDPA 3ENHA 3C50A 1V0PA 3FSFA 5FDXA 4A9TA 2GFCA 1RQQA 1JKLA 3PG3A 2HWOA 1O6LA 2X81A 3KL8A 3GB2A 4R5YA 3VNTA 4XG2A 3FKNA 3QA8A 4AG8A 1OPKA 3KY2A 4TWCA 3DXNA 4XH6A 3TV6A 4RIYB 1PY5A 3UE4A 5T68A 3DZQA 2XA4A 2XIXA 2P33A 2V62A 3MPAA 3EZVA 4KNBA 4WSQA 4BY9E 4JBVA 4Z7GA 1W82A 1CM8A 5L8LA 4G3EA 4UN0C 3UOHA 4BDKA 5D11A 3CE3A 4PL5A 2DYLA 3VUIA 3Q5ZA 4LV8A 4G31A 3ZYAA 4FKWA 3QX4A 3ZU7A 4XV1A 3AC1A 4NK9A 3MB7A 4FZ7A 3LFDA 2CGXA 3AC2A 4BDIA 3LOKA 2GHMA 4FV7A 4UB7A 4RJ6A 5CSHA 2XJ1A 5CAQA 4J7BA 3VO3A 3AD5A 3IDBA 3SKCA 1NVRA 2R3QA 4FKPA 4WUAA 4DEAA 3U8WA 2OWBA 2WMSA 4GT4A 5AR8A 5HGIA 2VUWA 4Y5HA 3SQQA 4DEEA 2BZHB 3DB6A 2ETKA 2XKEA 3E8EA 4GFMA 4ZSGA 4Y8DA 3AC8A 1HOWA 1SMHA 3G0FA 4BWKA 2J0MB 3RK9A 5AP2A 4MWIA 4QMSA 3WE4A 4FIEA 3LXNA 4L68A 4BYIA 4RQKA 1YOJA 3IGGA 3QCQA 2GSFA 4F99A 4O27B 4YMJA 1RDQE 4KIPA 4EZ5A 5AR7A 3GGFA 2Y4PA 3RNIA 4OW8A 5AJQA 4WG5A 4IX6A 2UZNA 3RPVA 4O0YA 4QYHA 3TNWA 2QHMA 3KN5A 1YXVA 5JRSA 3A7IA 4LGDA 3ZFXA 2RIOA 2JDTA 1Q41A 3NW7A 3D2KA 5EK7A 2E9OA 1DI9A 4QQCA 4MH7A 5H8EA 2CPKE 3GP0A 2PULA 4IQ6A 4X2KA 5AAEA 3OP5A 5C27A 4W4XA 3GT8A 5EM7A 5HVYA 4B9DA 4B99A 4I0TA 4I4FA 1JKTA 1S9IA 4XMOA 3G51A 2C3JA 4O1PA 3VJOA 4ZLYA 3TUDA 5FEDA 4QYFA 4C4JA 3MH0A 3ZC6A 3OW4A 2XJ2A 2Z2WA 5HIEA 1LEWA 5AX3A 4M8TA 3QD3A 3V5QA 4I21A 2ZYBA 2AC5A 2PZIA 3O8TA 4NFMA 2VTHA 4V05A 2FO0A 3KEXA 5FXSA 4CFNA 4FV4A 4EOMA 5M53A 3QGYA 2GCDA 3NWWA 2V22A 3GCSA 5IQAA 1OIRA 2OXDA 4KIKB 5FWKK 3UZTA 3VS5A 2PVKA 4BGQA 4X3FA 1P4FA 5EQYA 3SXFA 4BDEA 4LRMA 4CYIA 5JEBA 5CNOA 3DGKA 4JQ7A 4NUSA 1UU7A 4USDA 4YLKA 5E8WA 4QT1A 2XNEA 3HGKA 5ETIA 2R3NA 3QLGA 2EUFB 3F3VA 4RVLA 4WNKA 3UC3A 5J9ZA 5AUYA 3UOLA 3VW8A 4BYJA 4JAIA 4D2PA 1O9UA 4FA2A 4RWKA 3EQGA 2BRNA 2ITVA 3GU5A 4HOKA 4QMOA 1YXTA 3WYYA 3T3UA 4H3QA 4FNXA 4C7TA 5IEYA 2QC6A 1R78A 4A06A 2PZ5A 5CLPA 3TTIA 5LVNA 4L44A 2H8HA 4ZP5A 4HNFA 2VWZA 4P4CA 1ZLTA 1PKGA 5AV3A 1KWPA 3HDMA 2YAKA 3QRUA 3R04A 3SX9A 4DCEA 3DCVA 2V55A 3CY2A 1UKIA 4PL3A 1OGUA 3W33A 4E4NA 1R39A 1OPLA 3P7BA 4OBQA 5CI7A 2YIYA 5CT7A 5IQEA 4E6DA 2ZMDA 5I3RA 2CDZA 3UG1A 1U54A 3O71A 5A4CA 3I0QA 3BKBA 5AEPA 3BGPA 2W1FA 2QU5A 5F9EA 3FZ1A 4F6WA 5J7HA 1R0PA 2C6KA 4G16A 3R7EA 2IZRA 3BLQA 2JAVA 4IHPA 4FT7A 2I0YA 2CKPA 3TM0A 3UP7A 4D4YA 3GENA 2YLEA 4TNBA 3TZ9A 4AP7A 2YM6A 3BGQA 1F0QA 3QTIA 4HYHA 1STCE 2XK4A 3KK9A 5DR2A 5DT4A 3TZMA 1YOMA 3IS5A 3UIXA 4FKVA 3UBDA 4EH3A 5HVJA 1YXSA 2XNNA 2WZJA 3LFAA 5J87A 4HPTE 4DA5A 3D4QA 1VJYA 1U5RA 4K2RA 3TG1A 4QMLA 4D9UA 5FUTA 2BIYA 3P5KA 3NUNA 4I24A 3FLZA 3MW1A 4FT5A 4OAUC 1OKZA 4HVSA 4MWHA 4BKYA 3RM6A 5BVDA 4GV1A 5KMLA 3REPA 3K5UA 4C59A 3NW6A 1JOWB 4D1XA 5T3QA 5ETAA 2Z02A 4P90A 2XH5A 3OUKA 3SRVA 5LVPA 3VC4A 4QMMA 4YU2A 4GKIA 4DFBA 4IAIA 3QZHA 3CY3A 5FG8A 2XZSA 2VTLA 3M42A 4ARKA 4DEIA 3AD6A 4S31A 2Y9QA 2ITTA 4JX3A 4PL4A 4E5AX 3PE2A 5HU9A 5J79A 3ZFMA 4XG7A 4ANNA 4A07A 3TEIA 1IAJA 3IONA 4O22A 4IACA 3ENMA 4GRBA 4FK6A 4IFCA 1PMNA 4IDTA 5DG5A 3CIKA 4DFNA 3SVVA 4W9XA 3CJGA 3EQFA 5H8GA 3SDJA 1WBPA 4B4LA 2X39A 4HYUA 3QD2B 1F3MC 3OY1A 3E92A 3PY0A 4PQNA 4XP0A 5D1JA 4PDYA 4N0SA 4MX9A 3RGFA 3ZSHA 2VRXA 4XG3A 2O2UA 2R3JA 4R3CA 5LVMA 5M09A 1H4LA 4RIYA 4BBFA 5HG7A 1TQMA 4BDGA 2G1TA 5HNBA 3NUAA 3LQ5A 4KS8A 2JKKA 2JLDA 4DBXA 4H05A 2ZDTA 5AV0A 4EQUA 2UZWE 5M4FA 4JJRA 3UMWA 4BGGA 4PY1A 2YABA 1P5EA 2VWBA 1LUFA 3UYTA 4ASEA 4XLIA 4DG0E 4OBPA 3BYVA 3BPRA 3PLAE 3ZBXA 4LL0A 4GJ2A 3FEGA 4L00A 1M17A 4U97A 4YSMA 2UZDA 1MRYA 3CD3A 3LXLA 4CGAA 4FG7A 4JS8A 2W5HA 2ZB1A 3SOAA 2C0TA 3O7LD 2AUHA 1ZMWA 3L9NA 5AR3A 3UZPA 4HYIA 3HP2A 5GNKA 2PVRA 1PJKA 3KC3A 2KTYA 4BCKA 2PZYA 5IQDA 4BICA 2WTIA 3H9RA 4CT1A 3U9NA 2C6DA 3G9LX 4BKJA 1OKYA 4U41A 4FV2A 5BUEA 3CKWA 2RKUA 5K5NA 3TV7A 3ODZX 2PU8A 5HD7A 4APPA 3GOKA 5HNGA 1UKHA 4GSBA 4UZHA 5IA4A 3A7GA 4LOPA 4ZTHA 4EJ7A 5K9IA 2JIVA 5FEQA 5E8UA 5EW9A 4FSUA 5CNNA 4PMSA 4N6ZA 4DINA 3RAKA 2BAKA 4L53A 4G3DA 3KRLA 4IAAA 2QOLA 3EZRA 4FZDB 4OTHA 4QMZA 1BMKA 2YWPA 4RZWA 2YCSA 4XRLA 2UZVA 4B7TA 2C5XA 5DMZA 4BDCA 5EYCA 4FTOA 5HLNA 3ROYA 2JKOA 3GQIA 3FMKA 1MRVA 4FX3A 4K33A 3D2IA 5AUZA 2WU7A 3ZEPA 2YACA 3CC6A 4AT5A 3ANRA 3COIA 3ZO2A 2JDOA 5H3QA 4GU9A 4QMXA 3ZBFA 3KULA 5HO7A 3LAUA 5CI6A 3U6HA 4D2VA 4IM0A 1Q99A 2OI4X 3BHVA 4JDJA 3MFRA 1W84A 5FEEA 3B8QA 3FI4A 2GDOA 3IDCA 2R0IA 3MVMA 5CT0A 4TZRA 4PRJA 4DTBA 4TT7A 4CTCA 3VS7A 5CF5A 1T45A 3FAAA 4OR5A 3V3VA 4EEVA 5J9YA 5LMBA 4O81A 1GAGA 4EONA 4GL9A 3FJQE 1U46A 1JBPE 3EN7A 3MBLA 4R7HA 5HI2A 3U4UA 3ZTXA 4C2WA 4I6QA 3O17A 3KREA 3V8SA 2XNPA 4KIKA 4AWIA 3R73A 4L8MA 4C8BA 2X6DA 4RC4A 5CU2A 4G3GA 4BCMA 3FHIA 4IMYA 2SRCA 5LMKC 5FTGA 5KMNA 1GZKA 2YITA 3A60A 4YO6A 5DPVA 2JKMA 5JK3A 3ACJA 3ROCA 3LJ2A 4HNIA 5DBXA 2CCIA 4CD0A 4CMOA 2CJMA 3R2BA 1NVQA 5CZHA 3AC5A 5CQWA 1SZMA 3HA8A 4FV8A 4MNFA 4C33A 3FY2A 4AOTA 4IWDA 2YJSA 2IN6A 2QO2A 3BYOA 4D4SA 1XH4A 3BV2A 1WZYA 3B8RA 4XOYA 3C5IA 3E88A 4G3FA 3TCPA 3F5GA 3G9NA 4XLVA 3R8LA 3TACA 4CFUA 4I5PA 2IVVA 3THBA 4FSRA 4ASZA 3MFTA 3BQRA 4GH2A 2V0DA 4C4GA 2RFNA 2WTKB 3RNYA 1JSVA 3LFQA 5IG1A 3OTVA 5JT2A 2VN9A 3LFSA 3DKGA 2YM7A 4WNOA 1OBGA 4BCHA 4O21A 4UMQA 3FI2A 1NXKA 1LP4A 5FGKA 4DE4A 4TRLA 4FIHA 3QAME 4E6QA 4DH1A 4I6BA 1A06A 4FL3A 3ORLA 3CTJA 2I0HA 4AN9A 4PDOA 3BRBA 4XG9A 4RIWB 4BTFA 4EWQA 1Q8WA 5A4TA 4D55A 4DT9A 4WT6A 5HE3A 2WMAA 4PPAA 5EH0A 4OT5A 3QYZA 3HMIA 2VU3A 3JY9A 4TYHB 2G2HA 2XNMA 4UZDA 4MD9E 1H1PA 4FVQA 2YDJA 3KVXA 4AA0A 2G2FA 1F5QA 4ACDA 5A3XA 5LVLA 4K6ZA 3GU7A 3OCGA 3DK7A 4IM3A 5LARA 5TKDA 3F5PA 4I93A 5DT3A 3OEFX 4OTDA 3PVGA 5E8YA 4F65A 3C9WA 2XBAA 2QOHA 2VWXA 2VWIA 3MH3A 4RX9A 5LOHA 3F3WA 1IA9A 4I92A 4YC3A 1WVWA 4XOZA 4TN6A 3TI1A 2X7GA 3HV7A 2OW3A 4JDIA 2FSOX 2UVYA 4KS7A 2XIKA 4TXCA 4FL2A 3G90X 1R1WA 4QTDA 5KKRB 2YWVA 2PL0A 1PMVA 3O23A 2UW5A 4U43A 4BDJA 1Q8UA 3LJ1A 3QYWA 4BTJA 4YZMA 5AUXA 3BBTB 3TJDA 1KE8A 2WTKC 3PPJA 4BTMA 1W8CA 3E3BX 3VBWA 4DF3A 4HVDA 5D12A 4G5JA 1XBBA 3L1SA 3D15A 3GNIB 2CGWA 3P08A 1WMKA 4DG3E 1ZYSA 1QPEA 3HMPA 4JR3A 4MAOA 4JT3A 3TNPC 3ZMMA 1IAHA 3ETAA 3UPZA 1PXOA 3HVCA 3EN9A 3R7GA 1ZY4A 2UZUE 1QPDA 2YZAA 3GU6A 4AX8A 1KOBA 2I0EA 3D0EA 2VWVA 1PXMA 4ZTLA 2OICA 1AD5A 3NZ0A 5FRIA 2ZOQA 4FOBA 3ZLXA 3PP1A 3C4WA 4EC8A 4IIRA 1YDRE 4O7WA 2WEVA 4EYMA 4HCTA 5BVWA 2HK5A 4FTAA 1ZZLA 4FL1A 5M06A 3KFAA 4J8NA 3UVPA 2PHKA 4UMUA 1H28A 1GJOA 3P23A 3PJ8A 5L6OA 2F7EE 3W2QA 3UNZA 1OECA 4FKUA 4XP3A 2HYYA 3CPBA 5IQIA 3QKKA 3CJFA 3RK7A 4JBQA 4QYYA 2HIWA 2R3KA 5HQ0A 2C47A 3L9PA 5IQCA 2PVJA 3BHHA 2O3PA 1Q24A 3K54A 4BFMA 3P0MA 4R6VA 2FUMA 2W4JA 4R8QA 5BVOA 2FGIA 5KKRC 4N4SA 4OUCA 3F61A 5EW8A 5LMAA 4FT0A 4PDPA 4EHEA 4YBJA 4FE2A 3HMNA 3OXTA 4O0TA 2QOQA 3EFJA 3QTUA 2BFXA 3VRYA 3Q4TA 3PJCA 3RPYA 3AMBA 4X0MA 4ACHA 3AT4A 2R9SA 2R64A 4TTHB 5ANEA 2BVAA 4JRVA 5HE1A 3EKKA 4O7SA 3CXWA 4LL5A 4V0GB 4FKJA 3ZSIA 4O86A 1CKJA 4FTIA 1QPJA 3PJ3A 5GHVA 4JLCA 4F08A 2O64A 4O0WA 4FI1A 2H34A 4FZAB 5KHXA 5CWZA 2OIBA 4L52A 4AW2A 5CXZA 5A6NA 1W0XC 2QR8A 4JG7A 3OF0A 3RZFA 5IU2A 5IA3A 5AUVA 2HOGA 2QOBA 3R1YA 3DZOA 4CNHA 5HVKA 2BILB 3P4KA 4FR4A 3R7UA 3PRIA 5CVFA 3AT3A 1E9HA 3BWFA 3DLZA 4O83A 2C6EA 4YZ9A 3FZSA 4YBKA 4DEGA 4TPTA 3QTSA 4BRXA 4DFUA 3OVVA 4RQVA 4IADA 2G01A 2W9FB 3OWPA 3EQDA 2E2BA 2C6LA 1Y57A 4IWPA 4ZY5A 4JG6A 5E8ZA 5J5TA 1YKRA 4RGJA 5D9HA 5EOLA 2YIXA 5HU3A 5TO8A 3AGMA 2WOUA 4HGTA 4ANMA 3NYNA 3FSKA 2XKFA 4WO5A 4F64A 2VD5A 4QMTA 3TWJA 2YAAA 1MP8A 2Q83A 2JD5A 4OTQA 4F09A 3QUDA 2XP2A 2YCQA 4I6FA 4U42A 5AR4A 4IVDA 4C2VA 4DGOA 4F7LA 4F9YA 1DI8A 1G5SA 3A2CA 3P7AA 3GVUA 4AGWA 5AAGA 1BL7A 4DBNA 3KQ7A 4I1ZA 5F20A 3PWDA 4BDBA 3F3UA 5LWMA 1SVGA 3C4FA 4AGCA 3W55A 4NW6A 4EC9A 4HPUE 2W1DA 3A7HA 4QMVA 1UWJA 3DBFA 5HE0A 4EOIA 2QOIA 3HZTA 2JAMA 5IH4A 3EHAA 3O7LB 4FTNA 1CTPE 1TQIA 1CKPA 2WMTA 3LZBA 5E7RA 4APCA 4C3FA 2O0UA 4KABA 4TYEA 4U7ZA 3UP2A 5TF9A 2WMQA 4W4WA 3DT1A 5CF4A 1ZYLA 3QZIA 4DITA 4ANSA 3E7OA 3DDPA 4NKSA 4DG2E 4F70A 2AC3A 3RPRA 4LUEA 3UJGA 2WKMA 3ZUVA 3FL4A 2R5TA 4ZS0A 2WELA 4UALA 5AR5A 4BI0A 3EKNA 1OL2A 1YI6A 4MF0A 5A54A 5GZ9A 3KXMA 3QQFA 5CX9A 3UYSA 4X2NA 1JKKA 3PYYA 5CVHA 4Z55A 3MI9A 2C1AA 5CALA 4FBXA 4FSMA 4IWQA 1ND4A 5EM6A 4WRGA 1H0VA 5M07A 3FBVA 1XJDA 3LXPA 2YN8A 3FZRA 2QOOA 4BCPA 1PHKA 2R2PA 2CN8A 3DY7A 2WQBA 1YWRA 4R78A 1PF8A 3H0YA 5JGDA 2FSTX 4TKSA 3EN4A 1Q61A 3R7OA 1J91A 3I1AA 4F6UA 3OZ6A 4L7FA 3CS9A 3H9OA 2UW0A 4MEDA 3EMGA 1V0OA 4JQ8A 4NWMA 5DA3A 2GMXA 3VAPA 3R30A 5BQ0A 5K4JA 1U5QA 3OWJA 4RIWA 3D5XA 4KKGA 2WMRA 3FWQA 3FLQA 2XIYA 4FTJA 2C3KA 4GVAA 3EOCA 4L67A 5CU3A 5HLWA 1CMKE 4X2JA 3P86A 4RX5A 1ZXEA 2ZM3A 3NX8A 4V04A 3OS3A 3ORIA 4M68A 3R9RA 2VTPA 4MD8E 4TNDA 1SVEA 5IF1A 3IW5A 2PMLX 2FYSA 2QU6A 5ANOA 5FM3A 2WOTA 4BI2A 4DEHA 4OTRA 3COHA 2QURA 2RSVA 3QHWA 2IVSA 3TN8A 1IRKA 3NR9A 4AZVA 1CKIA 4M69A 3K2LA 2HZ4A 2VTIA 3NUUA 4F9CA 2XM9A 5JQ5A 1KE6A 3JVSA 4UXLA 3VS1A 3NNWA 2W5BA 3IW6A 3VHKA 1PXPA 1H08A 4MBIA 4AZSA 3PIYA 4ONAA 2CLXA 1UWHA 4GG7A 4ZSAA 3C5UA 3DOGA 4YJVA 5AA8A 1GNGA 3A99A 4IDVA 4PMMA 4ASXA 4WG3A 4CQGA 3ZO1A 4O7VA 4RFMA 4C36A 1FGKA 2J2IB 2G15A 4MTAA 4CG9A 4F7NA 4IFGA 1PRYA 3SXRA 3TV4A 4RA4A 4QQJA 3R9HA 2IZUA 2LGCA 3DFAA 3R8ZA 3WF5A 2BHEA 3V5PA 3DV3A 4BL1A 2G9XA 2X8DA 3N9XA 3NYOA 3P79A 3PSBA 4QTAA 4XBRA 4KINA 4CFWA 3LMGA 2BDWA 4RJ4A 4DGNA 2VO7A 1H0WA 3VUDA 3BWJA 3WZUA 4FKLA 4P5QA 4EH5A 4O91A 3D9VA 5IKWA 2P0CA 1R0EA 4W4VA 5AP0A 1U4DA 4F4PA 3E8CA 1BL6A 2BROA 2OJ9A 4IB3A 5EYMA 3ZRLA 2H6DA 3SGCA 3HUCA 3JYAA 4P7EA 1KE5A 1OVEA 5KUPA 5FXQA 5I3OA 3HV3A 2F7ZE 4UYAA 2R3FA 3DQXA 4K9YA 4WD5A 3RK5A 4PWNA 3CKXA 4C3RA 2HW7A 2UW8A 2HXLA 2WHBA 4NJ3A 3PXYA 4GCJA 4QNYA 4JBPA 4XUFA 5CTPA 1APME 2J0JA 3DTWA 3Q32A 3TNQB 3NNXA 3ZFYA 4G17A 2XNOA 4Q2AA 4CKJA 3OTUA 5IH6A 2XK9A 1W7HA 3CQWA 5KO1A 5CEIA 5DVRA 3DAJA 3E8DA 2WIHA 1M2PA 4J52A 5AWMA 4UMTA 5BYLA 3OC1A 3PSDA 4J99A 5E8VA 4USEA 3HL7A 5HNIX 4O96A 1T46A 3NLBA 2V7OA 3U4WA 4O38A 4UXQA 3W16A 4RVKA 4FK3A 2ZJWA 4QMWA 2J5EA 1OIYA 3A61A 3EQRA 3OOMA 3NPCA 4FTMA 2PMOX 3C4CA 3W8LA 2BR1A 3I6WA 1MQ4A 3I79A 3LM0A 1UU3A 4C4IA 4CRSA 3BV3A 2REIA 5ANJA 4G2FA 4V0GA 5CU0A 2RFEA 3W2CA 4E6CA 4F1TA 4LRJA 4XBUA 4BDHA 5GIOE 2UVXA 3A4OX 4DFLA 3TJCA 1KE7A 2GNLA 3DJ6A 5CSVA 4AA4A 3FPQA 5HESA 3IKAA 5IUHA 4DEBA 4L6QA 5EKOA 1JLUE 2ITYA 4BIDA 5HD4A 2XNGA 4YR8A 2F2CB 4J8MA 2J0KA 2R3PA 4W8EA 4I5HA 3MVJA 4Y95A 3KULB 4BI1A 2BZIB 3GC7A 4BVUA 4FV6A 4PNIA 3O2MA 2I7QA 3TIZA 5IQBA 3KXZA 4A4OA 1J1CA 3Q4UA 5CU6A 2H96A 2X8EA 3VS2A 3FMNA 1IEPA 3FXWA 3POZA 2FVDA 3BLHA 4II5A 3PG1A 5CF6A 1I44A 2EWAA 4WIHA 4YJRA 4RX8A 5HKMA 4GG5A 2XYNA 5HX8A 4IAKA 4NU1A 2BDFA 3QHRA 2E9PA 4Q9SA 4YO4A 4M97A 3H3CA 2OF2A 4R1YA 5B7VA 3GBZA 4EOQA 5H8BA 2HWPA 4X2GA 3FZPA 5AP5A 5AX9A 3NUSA 4D9TA 3OCSA 4LRKA 4K8AA 4IC7A 2YM3A 2LAVA 5LWNA 5FTOA 1PYXA 4IXPA 1MQBA 4FKOA 3ZXTA 2GQSA 5FP6A 4FUXA 2VO6A 2YM5A 4TWNA 1YWVA 5EDQA 3F69A 2IWIA 3ITZA 4KA3A 3FXZA 1IR3A 4KBKA 4M14A 1PXKA 4ZY4A 4IE9A 5FTQA 2GHLA 1G3NA 3HRCA 4IVAA 2WTCA 1OUYA 2PY3A 1O6YA 3DAEA 4YJSA 4UX9A 3R28A 4BCQA 4GEOA 4MXOA 2YHVA 2RFDA 3C1XA 3SC1A 4BIEA 3DKCA 4QP2A 3AC4A 1SNUA 3LQ8A 3PWYA 5TE0A 4ZLZA 5AP4A 3SV0A 5BYZA 3O0GA 2PZRA 4QRCA 4JDHA 3FLYA 1H24A 2GS7A 3I60A 3V8TA 2IVUA 3LW0A 3BHUA 4FEUA 4JOAA 1H00A 4E6AA 5JRQA 3W18A 4EH8A 4AGDA 3N4TA 3FZTA 2WQOA 2VTJA 3F3TA 4O2ZA 4E4MA 4GUBA 4L3LA 5AA9A 4UEUA 1RW8A 4FNZA 3GQLA 3IO7A 4C4EA 2VTRA 4LOQA 2OF4A 4EZ3A 2OIQA 3HP5A 4RLKA 4YLJA 2Y7JA 4YTHA 5DNRA 2CNUA 5EI6A 4IB5A 4HCUA 4D1SA 4JAJA 2F9GA 1M7NA 3CBLA 4XV3A 3O51A 5DRBA 4RWJA 2XK7A 4WUNA 4CQEA 3LCTA 4DH8A 3LM5A 2YISA 3R1QA 4FG8A 4FICA 3ZLSA 4K11A 3P9JA 3HRFA 4U8ZA 4RJ5A 4YJOA 4DLJA 3FL5A 5ANKA 5E90A 5CXHA 3TXOA 4C4HA 4ANBA 5AMNA 3IK3A 3R9OA 3IW4A 4FIFA 3VUMA 4AE6A 3JVRA 4YJNA 4EK3A 1LEZA 2J51A 4MNEA 5CEPA 1H8FA 5I5ZA 4L7SA 5CQUA 2ETMA 4CV8A 4ASDA 4JIAA 4MXCA 4GT3A 3RM7A 4ZXTA 3QRKA 2UV2A 3PXQA 2OFVA 2W1HA 4R3RA 4JL9A 4P5ZA 3RBWA 3RAHA 5AV2A 3UMXA 4TL0A 4CG8A 5IQFA 2RFSA 3FKOA 1JAMA 2VWUA 4F63A 3MA6A 3ZONA 4HCVA 5E1EA 3ULZA 1OL7A 2CN5A 1FQ1B 2QOKA 2VO3A 3BCEA 2BRBA 3H4JA 3LPBA 5DT0A 1H1RA 3FQHA 4H1MA 4QYEA 2J5FA 3VRZA 4F9AA 4NIFA 3CTHA 4RT7A 5I9ZA 2IG7A 3LMIA 3TT0A 3GFEA 3QA0A 3SW4A 3MIAA 1M52A 4D28A 4MK0A 4DLIA 3E3PA 4EI4A 2P2IA 4K18A 3C13A 3UQGA 5CAUA 3ORNA 1QPCA 1UNHA 4KKEA 4G9CA 1SM2A 2XK6A 2O5KA 3TZ7A 3DTCA 2WD1A 3I0OA 2OIDA 5DR6A 3W1FA 4CSVA 4CKIA 4MXZA 4V01A 3G2FA 5DGZA 4QMQA 5JN2A 2YLFA 2ZV7A 2QOCA 2VTQA 4K1BA 2BFYA 4IEBA 3R1NA 5AP1A 3FC1X 3UO6A 3NUXA 4ZS4A 2WNTA 4W8DA 3WILA 4DT8A 3KRWA 3IGOA 5LVOA 2W17A 3TNIA 2R0UA 5K5XA 3S4QA 3SAYA 2B53A 2WPAA 1OIUA 4XP2A 4LV5A 5L2TA 3H30A 2HZNA 4PMTA 5HO8A 4CLJA 2ZV2A 5IUIA 5BVEA 2BTRA 3RAWA 5JFWA 5JZJA 5L4QA 5M4IA 1AGWA 2XM8A 2VWYA 4BTKA 2NPQA 3NAXA 4FF8A 3GCVA 3DNDA 2W1EA 3DXQA 5CEQA 3SXSA 2OZAA 4WKQA 2WMXA 4ENXA 2QOFA 4FV1A 3QGWA 4JDKA 3W32A 3ZZWA 3KXGA 2YCRA 1KV2A 3FMEA 2XIRA 2ZV9A 4FKGA 4ENYA 2Z7RA 3E87A 4O7TA 2BKKA 4GT5A 4UMPA 4NJDA 3F7WA 2XJ0A 4EOJA 4AT3A 2XEYA 3BI6A 5B2MA 4UYNA 3R7IA 4RC3A 3E63A 5DLSA 4Z7HA 2YCFA 1SNXA 5CY3A 1DS5A 1Q8ZA 5LCKA 3L9LA 4Y73A 3U51A 5DH3A 4MQ1A 3G5DA 3F3ZA 4QMNA 2Z7LA 3ZZEA 4C38A 5HBJA 3HYHA 3GC9A 2B7AA 3C4XA 5JFSA 4DTKA 5C4LA 2W9ZB 3L8SA 4ZJJA 3ZM4A 2UZOA 4FV9A 4MQ2A 3WF6A 3S0OA 2PUNA 5TOZA 3ZUTA 3PPKA 4O0UA 1XQZA 4BN1A 2C6MA 3ORPA 5L8JA 3RHXA 2V5QA 4K0YA 4NSTA 4PDSA 3A7JA 3PLSA 4YLLA 3QKLA 1YHSA 4ZTMA 1FPUA 3WARA 4AU8A 4RIXA 4RLLA 1FOTA 2JKQA 3KRJA 2ACXA 5BMSA 3R2YA 3NS9A 4S30A 1OL6A 1FVVA 2GU8A 1BI8A 4FT3A 3L8XA 3MFUA 1KSWA 2X2LA 3FLSA 4MYGA 4RZVA 4ITIA 1Z9XA 2C30A 3PVBA 2PUIA 3ALNA 5HTCA 2ERKA 3ORTA 5E1SA 2B9JA 2WMVA 4E20A 1UU8A 3KXHA 4QQTA 3OW3A 4CRLA 1YI3A 5LXMA 1NW1A 3LFFA 3DKOA 2YFXA 2UW6A 3QTRA 4XG6A 3DBCA 5AP7A 2QG5A 3MDYA 4F9WA 3EQIA 2GNJA 3D7TA 4GIHA 2NRYA 4USFA 3Q52A 2PVYA 3MESA 4RRVA 3BYSA 4H1JA 5JFVA 2QHNA 1NVSA 3VS6A 2O65A 3VIDA 3KGAA 5KBQA 1BKXA 3F66A 4FODA 4OTPA 3QQLA 1BUHA 3T9IA 2CKQA 3MH2A 2O63A 3L9MA 5J8IA 2C5OA 1KV1A 4QD6A 1WAKA 4QTEA 5CAVA 4FSWA 2QG7A 3LMHA 3PFQA 1ATPE 2C3LA 3AT2A 5DIAA 4MXYA 4X21A 3UDBA 5K3YA 2C68A 4U9AA 4BWXA 5CZIA 3FLNC 5DYJA 1BYGA 4HVHA 2EXEA 2OJFE 4O7ZA 5I0BA 4LGGA 3QUPA 1P14A 2ZM4A 2AYPA 4UBAA 4XX9A 4J95A 3PRFA 3QWJA 2ITPA 4PF4A 4C61A 3HV6A 4D2TA 1RE8A 4NL0A 4IWOA 2J6MA 1Q5KA 3F5UA 4OTFA 3R63A 4FKIA 3NRMA 4JR7A 2ITXA 4QP1A 4DYMA 3WYXA 3BX5A 2A4LA 4O0RA 2BMCA 3HNGA 4RFYA 2GNHA 3LCKA 4M0ZA 2DS1A 3BE2A 4EUTA 4RVMA 2X2KA 2UZBA 2XIZA 4JIKA 3CPCA 3NIEA 2X7FA 3EWHA 5D7VA 4YTIA 2P3GX 3Q3BA 2WTWA 1PXJA 1YHWA 4H3BA 3OHTA 4EOOA 1YVJA 2OG8A 3MJ2A 1Y6AA 4M3QA 2VTAA 2VGPA 3KXXA 3NIZA 4M69B 4QMYA 4ZSLA 3HDNA 3VS0A 4AS0A 3VF8A 3OBJA 4E8AA 4YUQA 5GJFA 2NP8A 3C7QA 5L2SA 3MA3A 4PTEA 4OTGA 5KCVA 4NH1A 3ORKA 2F49A 2A27A 3KVWA 3LCDA 3Q96A 4J1RA 3ULIA 3UOKA 4IZYA 4RC2A 4C35A 4CFFA 1I09A 4L42A 5ANDA 4C57A 3QTWA 5HIBA 4FNWA 3U9CA 2BUJA 2FSLX 2IVTA 4TYJA 1OB3A 4AGUA 3CGOA 1FVRA 3NUPA 4ZJVA 4ALUA 2IW8A 5LJJA 4O7YA 3KMMA 4EKKA 3ORZA 3BHYA 3CEKA 3RPSA 1MRUA 4UV0A 3QCXA 1A48A 4AOJA 2Z8CA 4O1OA 3OT8A 3BGZA 2Y6MA 3QZGA 3UG2A 2BRGA 4R1VA 3SOCA 4HGSA 4E4XA 5B2LA 3OG7A 3BEAA 3O8PA 3QF9A 3ACKA 4X7QA 3QQUA 4CMUA 3AGLA 5CSPA 2XEZA 4Q5HA 5EOBA 3ID6C 3DNEA 4RIOA 3P78A 3WBLA 3G6HA 3LCOA 4AZTA 3E64A 2ESMA 3L8PA 4R77A 4MBLA 5FXRA 5ICPA 4I41A 4ORKA 5FD2A 2PYWA 3BE9A 3R02A 1GZNA 4ID7A 5M4UA 3KF7A 4J53A 3R83A 3QWKA 3GU4A 5L6PA 1QMZA 5CYIA 4YJUA 3QQGA 2W1CA 4YSJA 3P7CA 5HORA 2F4JA 3IG7A 2XK3A 4M67A 1OMWA 3U6IA 1XBAA 1SVHA 3QQKA 2BPMA 2E9UA 3N4VA 3CQEA 2OO8X 3QTZA 5I9UA 2R3OA 2A1AB 3KF4A 3DB8A 4DN5A 2X9EA 4ANOA 3E8NA 3I5ZA 4PPBA 5EW3A 3TUCA 2H9VA 4HZSA 2HZIA 3PXFA 5IA0A 5IEXA 2YM4A 4D58A 2YIQA 3LJ0A 2ITWA 4KSPA 4YPDA 3PA3A 4KRDA 2J4ZA 1WCCA 2VZ6A 3PY1A 4IZ7A 4PV0A 4RMZA 3RINA 5E8TA 4DFYA 4AN2A 1GY3A 2W7XA 3B2WA 3KKVA 5DHJA 3DJ5A 2C5NA 4NYEA 1PYEA 4XS2A 2PPQA 2VO0A 4PNKA 3KK8A 2DWBA 3FZOA 4IVCA 5FM2A 1UNLA 4IVBA 1JSUA 1NA7A 5M08A 4U80A 3EQBA 4CFMA 3RP9A 4B6LA 3VW6A 3D14A 3T9TA 4IJ9A 3S00A 5HG5A 2X4FA 4A7CA 2PVFA 4AA5A 5KMMA 4E26A 3NW5A 2YA9A 4OBOA 3C0IA 3WF7A 2PVLA 3LLTA 3MTLA 2BKZA 2RG6A 3R00A 4O2PA 5AUUA 4LOOA 5E8SA 3MTFA 5A9UA 1ZOEA 5HBHA 2OBJA 3KA0A 5JGBA 2J7TA 4ZJIA 4F0GA 2XNBA 2W05A 3MFSA 3MYGA 4R3PA 4CVAA 1OITA 4JQEA 4X6QC 4Y85A 3R8VA 4C3PA 1H27A 4FYOA 1GOLA 5JH6A 4FZFB 5BVFA 3EN5A 2XCKA 4ZTSA 1H1QA 3QXPA 4FTLA 4MXAA 2B1PA 3FLWA 2FA2A 1XO2B 4KIOA 5HCXA 2P2HA 1Q3DA 4D2RA 3DS6A 3EL8A 4S33A 4YJTA 4ZSEA 2BAJA 2ZM1A 4G3CA 4D0XA 4RJ8A 1H1WA 3C0GA 4F1MA 4AE9A 2DQ7X 5I4NA 4ZTNA 4ZMEA 4NCTA 3QFVA 4BGHA 1WBSA 5CAPA 2PZPA 1H1SA 4AZWA 2JBOA 3R21A 5F94A 2PVNA 2WIPA 3LFBA 4FV3A 2W1IA 2X8IA 4XJ0A 3RI1A 4YURA 3SW7A 4Y83A 2VAGA 2JEDA 3R8PA 4BDDA 4I3ZA 2I1MA 5DWRA 2XYUA 5H2UA 1TKIA 4NM5A 2VX3A 3D7ZA 3RWPA 1EH4A 2BHHA 2ONLA 3ZC5A 1JKSA 4J97A 5M56A 2PVHA 2W06A 2IPXA 1KOAA 2WAJA 4OT6A 3QRTA 5F95A 2J0IA 1OL5A 3NCZA 3ZM9A 4EHZA 1S9JA 4MXXA 3ORXA 4BR3A 1OBDA 3SHEA 4FKQA 4I4EA 2HW6A 5GZ8A 5JQ8A 1Y8YA 2JC6A 3OROA 4M13A 3EQCA 4QP9A 1Z57A 5GJGA 3K5VA 2W5AA 2FH9A 4FSQA 2VTTA 5JZNA 3PXRA 4X2FA 3FMHA 4F7SA 5A14A 2X0GA 3PPZA 3VQUA 1WVYA 4ANQA 2KULA 2ZV8A 3IQ7A 3ZO3A 3GCUA 3NNUA 3RHKA 5CAOA 5BUIA 1O6KA 2VWWA 5IISA 2JITA 3QCYA 4YHJA 4C02A 2F7XE 4AT4A 4ERWA 3EFKA 1XHAA 5I9XA 3PXZA 2JFLA 3FHRA 3I5NA 3ZHPC 3VVHA 3QC4A 4FVRA 4D4VA 3R1SA 3ZRMA 5C8NA 1CSNA 4HVIA 2UZLA 5D41A 4QP4A 3Q4CA 5C4KA 2WFYA 2R3MA 5IDNA 1H25A 3SD0A 4C62A 3K3JA 3Q5IA 5HTBA 4JXFA 2YJRA 1YXUA 2RF9A 3GCPA 4LMNA 4KBAA 1H01A 5KMJA 4MNEB 2OU7A 2ZMCA 4L01A 4QMUA 4WRSA 2C5YA 1OPJA 3TIYA 5D7AA 5C03A 4EBWA 2W96B 4U45A 5C8MA 3RWQA 2CGVA 2ZB0A 3R8UA 4J96A 2F2UA 2UW3A 3V5JA 5KZ0A 3KRXA 3ZEWA 5AFVA 4B8LA 3VQHA 2WQNA 3O8UA 1ZOHA 2X2MA 4ZZOA 4I0SA 3R7VA 4BCFA 3OD6X 3RVGA 4OAVB 4LQMA 2UVZA 3F9NA 4E93A 4YJPA 4GK3A 2YEXA 5CF8A 3DA6A 2UW7A 5I9WA 2NO3A 3QX2A 3TL8A 4AN3A 5EDRA 1L8TA 4OGRA 3V04A 3ZLWA 4NIFB 3DK6A 3HX4A 1Z5MA 4KWPA 3SG9A 3EFWA 5DEYA 3IOKA 4LI5A 4Y46A 4ZOGA 4O84A 4O0SA 1ZMVA 1GIHA 2XB7A 1YOLA 4CZUA 4CKRA 4TYIA 3QCSA 1JVPP 1PMUA 1BX6A 3DKFA 2I40A 4WNPA 4PUZA 4YZNA 3ZS5A 4IANA 4OLIA 3DLSA 4EYJA 1WBOA 4U81A 2EB2A 2Y4IB 3FC2A 3IDPA 1Q8YA 3FMMA 3MIYA 4I20A 4S2ZA 5A4LA 5AAFA 3C0HA 3E7VA 4DEDA 3DBDA 4BCNA 4G6OA 4U0IA 4WG4A 3VHEA 5M51A 5BVKA 4AZFA 3BU5A 2B55A 4OTWA 5EI8A 4JNWA 4CMTA 3COKA 3A62A 4ZZNA 2OLCA 3G0EA 3EQHA 1W98A 1ZARA 4ITJA 4CXAA 3AD4A 2GNIA 2DUVA 3HMOA 4TW9A 3R9NA 1DAYA 5K0KA 3ORMA 1U59A 3PJ1A 3BELA 3Q4ZA 4B0GA 4BCIA 1FMOE 4C4FA 4M66A 3VWAA 2YZLA 4BCGA 2OZAB 5KMKA 2CNQA 2VV9A 2YM8A 3PDTA 4HW7A 3UNKA 5D10A 1BLXA 3TNHA 1LPUA 5IPJA 1UA2A 3QQJA 3WZEA 4F0FA 5IMEA 4NKAA 3W2RA 4IBMA 3Q6UA 5H9BA 2R3GA 3UVRA 3PIZA 1L3RE 3BIZA 2VNWA 5AP6A 2ITQA 2WMWA 3M2WA 2YERA 4JI9A 3EB0A 4EKLA 1VYWA 2Q0NA 4M0YA 3Q2MA 3SA0A 3F82A 1ZYCA 4RG0A 5LQFA 3ZLYA 3I81A 3PSCA 1Y8GA 4GK2A 3LVPA 4UWBA 1ERKA 3CQUA 4FOCA 4G5PA 2VTSA 5AIRA 1XH8A 4NTSA 4QO9A 4LMUA 2CLQA 3VBQA 1UNGA 3R7YA 4EK4A 3IPHA 3DXPA 2Y4IC 4EHVA 3I7CA 3H10A 3R22A 5HEZA 1XWSA 3OOGA 3POOA 4FIGA 3E5AA 5ETFA 5J95A 4C37A 3UQCA 3MWUA 3MN3A 4U3ZA 2XF0A 5DFPA 5LCJA 3FMDA 3OXIA 1KE9A 3Q9XA 2GHGA 2XKCA 1VEBA 2B9HA 3C51A 2ITUA 4FTUA 2QLUA 4AW0A 4A9RA 3EQPA 3LFCA 2E9NA 3AMAA 4DHFA 2QD9A 4RIXB 5EHYA 4M84A 2VTNA 2GNGA 3EL7A 3CP9A 3KU2A 2A0CX 3PIXA 4DGMA 2HCKA 3F7ZA 4QP6A 1QCFA 5KBRA 4QQ5A 4FEQA 4RWLA 4D1ZA 4HZRA 4R7IA 5CS6A 2W1ZA 4U79A 1YXXA 4PTGA 3AXWA 4YZDA 3E62A 5ACBC 3PZHA 1UU9A 2R3RA 2WEIA 2OZOA 3DAKA 4JVGA 3UIBA 2E9VA 4EORA 3ATSA 5GINE 5IDPA 3MVHA 3DDQA 4LUDA 3LKMA 2X9FA 3CD8A 2QLQA 2OFUA 1XH6A 2C0IA 4I6HA 5IQHA 4I23A 1Q3WA 1WBWA 1UV5A 4CCUA 2IW6A 5IA2A 5IH5A 3D7TB 1IA8A 2Z7SA 4E5BA 2UZTA 3IW8A 4QTCA 5DRDA 4YP8A 4QTBA 3Q9WA 3NCGA 1VZOA 1XH9A 1OIQA 4RBLA 5KMIA 4IW0A 2ZDUA 2HZ0A 4YHFA 3QD4A 5ANGA 3PP0A 4GYIA 4WNMA 4XCUA 3VBXA 3MB6A 4Z16A 2IJMA 3UZRA 2CKEA 2QI8A 1B6CB 5DR9A 4AUAA 4WHZA 2CCHA 2WB8A 2IW9A 5CEKA 3NVKI 4FEVA 5FBNC 3UTOA 1XH5A 3DQWA 1LR4A 3W2SA 4QOXA 2OJIA 2OKRA 2C1BA 2WTJA 2Y6OA 4DGGA 5BYYA 3LCSA 3W8QA 4Z3VA 4FZ6A 3HLLA 2XVDA 4D5HA 1OZ1A 1ZYJA 4GYGA 3LFNA 3Q53A 4FKTA 4TWPA 3HMMA 5CEOA 5CANA 5IMXA 4XG8A 2GNFA 2QNJA 2HELA 2QQ7A 3FKLA
chains in the Genus database with same CATH superfamily
2B9IA 4YC6A 3UDSA 1JNKA 4HGLA 3HV4A 5J7BA 1FGIA 1IG1A 4AFJA 4NM3A 4FTTA 1HCLA 2IO6A 1JPAA 2W0JA 2O8YA 3RCJA 4LGHA 4YTCA 4XNEA 3D94A 4B8MA 4EH6A 5BPYA 3QBNA 3TKHA 4BC6A 1J7IA 2NNWB 4C0TA 4XV2A 4AW5A 3EYHA 3FDNA 2ETRA 5IQGA 3UO4A 3ZO4A 1W2CA 4YNEA 3R01A 4F1OA 5ITAA 3MPTA 5CSXA 5JSMA 2VTOA 4BCOA 2JGZA 4WBOA 4NM0A 4IH8A 4JG8A 2GQGA 3QUEA 4RWIA 3AC3A 5IA5A 3TZ8A 3ELJA 3HKOA 2JBPA 4JX7A 3WI6A 3ZOSA 3AQVA 3M11A 2YIWA 4H3PA 3QC9A 2BRMA 4QP3A 3TDWA 1ZZ2A 2WU6A 4EOSA 2GFSA 1YQJA 3Q6WA 4W4YA 4L46A 2VX1A 4GW8A 3UODA 4AFEA 2ERZE 4QMPA 4EBVA 5A6OA 2X0OA 3OMVA 3ZCLA 3H0ZA 3C4EA 1CDKA 2R7IA 1M7QA 4CCBA 5BV3A 4GIIA 5CVGA 3RTPA 4EUUA 3MY5A 4L45A 4MCVA 1Q8TA 4Y72A 4BZNA 4FUYA 3ZDIA 1V1KA 2QO9A 4U40A 5KE0A 4CFXA 1DAWA 5KZIA 2UUEA 4FV5A 3WF9A 4CZTA 4KD1A 4O0VA 2R4BA 2J50A 4YPSA 3QL8A 3ZDUA 3LLAA 2X4ZA 5AIKA 4GMYA 2WTVA 3RZBA 3B2TA 4TYGA 2BIKB 4AOIA 1H26A 1WBTA 5FBOA 2FB8A 4X6RA 2B9FA 2B54A 3UOJA 1Q4LA 1X8BA 2XCHA 4R7BA 2WXVA 3E93A 4AW1A 1PW2A 4AACA 2QVSE 3KCFA 2W4KA 3OFMA 5BNJA 3PXKA 2WTDA 3G33A 3PTGA 4ZTRA 3ZSGA 2R3LA 3VBTA 3MSSA 2QODA 4O7LA 4JRNA 4UWYA 5CEMA 3S2PA 5C1QB 2CMWA 5F4NA 1WBNA 5CSWA 3AG9A 4QP7A 4AF3A 3UO5A 4OTIA 5C01A 3WZKA 5IZFA 2FSMX 2UZEA 2X7OA 3HRBA 3R71A 5EFQA 2ITZA 3MY0A 4NW5A 4F7JA 4EOPA 4FKRA 2HAKA 3A8XA 2QONA 3MPMA 2CGUA 2OGVA 1NT2A 2YDIA 4O82A 1URWA 3PUPA 4WA9A 4EHGA 4FEWA 4EOLA 3KXNA 4KAOA 3KN6A 4YHTA 3PVUA 5EM8A 4ALVA 1Y6BA 4C58A 4N70A 2Z7QA 4ZSJA 1YDSE 4I0RA 4UMRA 5G1XA 3I4BA 2EU9A 5HIDA 4ZK5A 2OJJA 4D0WA 2WQEA 3P5JC 3RKBA 1XH7A 4FJVA 4O6LA 4G6NA 5F1ZA 2CNVA 3CCNA 3BEGA 3BU6A 2ZAZA 4G6LA 4IAFA 3WOWA 2AEGA 4E1ZA 4RJ7A 1XR1A 2XS0A 3A4PA 2PK9A 3FUPA 3LQ3A 1GZ8A 2W4OA 5EKNA 4GK4A 4H39A 3EFLA 5EQEA 5TT7A 3F2RA 3DU8A 2A2AA 3GC8A 4IX5A 3QTQA 2A19B 4G34A 3HAVA 2XKDA 1REKA 5BMMA 3UIMA 3U55A 2WMBA 4H36A 5AM7A 5BVNA 1G8SA 4RJ3A 4BHNA 2GS2A 5B0XA 4R5SA 2VTMA 4I22A 3VJNA 5M4CA 3JY0A 4FYNA 5EI2A 5HO6A 3HEGA 3OEZA 3C4ZA 3Q04A 1YWNA 3RPOA 4BWPA 5I9YA 4LFIA 5E8XA 1IASA 4UY9A 4MVFA 5C26A 4GUEA 4J98A 4QYGA 5HCYA 3OBGA 4IM2A 5L8KA 3D83A 2BAQA 4A9UA 3WF8A 4KUJA 3NYXA 4BDFA 2XRUA 5G6VA 3UQFA 2GTNA 2WGJA 1J7LA 4IB1A 4PTCA 3UC4A 1FBNA 3MVLA 3II5A 4GFGA 4IJPA 4K77A 3PA5A 3ML1A 2JIIA 1J1BA 5EG3A 3NSZA 2BZJA 2ITNA 2J0LA 2XRWA 4RX7A 4D4RA 4IZAA 5EM5A 2C3IB 3U87A 3VULA 2HY81 2RGPA 3DBEA 1UVRA 4XYFA 1GZOA 3V01A 5EYKA 4HJOA 4IAYA 3LFEA 4IX4A 4DH5A 3OT3A 1W83A 3W2PA 4E4LA 4EH4A 4IC8A 4ZIMA 4FNYA 4A4LA 3WIGA 5L2WA 4GFOA 4MHAA 5AV1A 3Q2JA 3G15A 3T8OA 2GS6A 2WO6A 4U3YA 4DC2A 3U6JA 5M44A 1XKKA 4HYSA 5A4QA 1P4OA 4BZOA 1GIIA 2PE2A 1BI7A 4NM7A 5HX6A 3FMLA 2ZVAA 3ET7A 4CZYB 2YDKA 3FI3A 4ZZMA 3VF9A 3EYGA 4GJ3A 3TMOA 4GVJA 3FV8A 4FC0A 4M15A 4MKCA 4U6RA 3HECA 3V6SA 5TR6A 3RMFA 3VS3A 3KMWA 3D5UA 4CLIA 3W10A 3H9FA 4BIBA 1K3AA 3MV5A 1P2AA 4E73A 2QCSA 3QTXA 3AOXA 3LIJA 2PMNX 3NVMB 3SLSA 4BBEA 1OKWA 1OKVA 2OH4A 3FI8A 3D5WA 2F57A 1XBCA 3GUBA 4P2KA 4ACGA 2BRHA 3G6GA 4NCTC 3EIDA 3SG8A 3FE3A 1VR2A 4FSYA 3WE8A 1WBVA 5ACKA 2PE0A 3ZRKA 2R3IA 4FSTA 3VUKA 3LE6A 1AQ1A 4EK5A 4F9BA 2ONLC 1E1VA 3VBYA 4EK8A 5AADA 4KSQA 3CR0A 3S95A 3CSVA 3BZ3A 3HAMA 5E91A 5L2IA 1Y91A 5GZAA 5J1VA 3ATTA 3OY3A 2XBJA 3DBQA 3AMYA 3KRRA 4J71A 1HCKA 4EZ7A 4YTFA 1K9AA 1H07A 3BLRA 5KHWA 2JIUA 3PVWA 4CTBA 3TYKA 2Y0AA 2JDSA 3QRIA 4YZCA 3ALOA 3OWKA 1J3HA 3NDMA 4I94A 3UVQA 3I6UA 3FQEA 5CENA 4A9YA 4X3JA 2QKWB 5HG8A 1KUTA 4KRCA 1YI4A 4FGRA 3RCDA 4FG9A 4QPSA 2CSNA 2OXXA 4MD7E 4DFZE 5J5SA 5FP5A 3NMUF 5AP3A 3PJ2A 4YJQA 3ERKA 1ZY5A 5L2QA 2CHLA 2J90A 4MBJA 4NEUA 2BTSA 3BYMA 3DK3A 2PVMA 4RFZA 4NTTA 5HBEA 1ZMUA 4EH9A 4Q9ZA 3MJ1A 3DFCB 4EWHA 3S1HA 4WOVA 3OCTA 3R0TA 4KKHA 3FXXA 5B2KA 4D2WA 4F0IA 5A46A 4LDTA 4YGAA 5E92A 5JKGA 4CEGA 4EK6A 4W9WA 4DFXE 4IX3A 5DOSA 4PP7A 5KX8A 3RAIA 4PPCA 3R8MA 4M7IA 4O6EA 4LYNA 4D5KA 3HA6A 4NFNA 4G9RA 4XHKB 4I5CA 4Z9LA 4O0XA 4S34A 2HY0A 4DH7A 4DTAA 3NYVA 3F6XA 1FMKA 4I6LA 2EXCX 3EN6A 4AXEA 1OM1A 4AZEA 4IAZA 1PMEA 4FTCA 3MS9A 2QKRA 2PUPA 3V5WA 1PXNA 3GC0A 2R7BA 2IZTA 3ODYX 3VUTA 2GPHA 3R6XA 2PWLA 5J9LA 3K3IA 3AKLA 2C5VA 4EL9A 1W2DA 4N57A 3TTJA 5E4HA 4PP9A 1M14A 4ZEGA 3N4UA 5EQPA 2X1NA 4DH3A 3OCBA 3CTQA 4PX6A 5L6WL 2B52A 4DDGA 3FYKX 3M1SA 5AR2A 1ZWSA 3KCKA 4DCAA 5DE2A 4EH2A 4ERKA 3QD0A 4XEYA 3COMA 2V7AA 4AAAA 2XAMA 1QL6A 5K4IA 3I7BA 3FYJX 5C8KA 1JSTA 3QQHA 2CKOA 2WQMA 4FSNA 1YDTE 5GJDA 3NEWA 3NUYA 4BCJA 3PE1A 2W99B 4ACMA 2JDVA 4FIIA 2C0OA 2PSQA 4I5MA 3VUHA 1ZOGA 3CLYA 3TDVA 5HHWA 4FTKA 4FT9A 5CASA 3MY1A 1OL1A 3F88A 4BF2A 4BZDA 1WFCA 2I0VA 3Q9YA 2ITOA 5HZNA 3R9DA 2HXQA 3V8WA 1ZRZA 3PA4A 3S3IA 3U54A 5AUWA 4E7WA 3QALE 2XMYA 5IA1A 5AUTA 4AQCA 2C6TA 1RJBA 4BKZA 5LMKA 4FEXA 2QR7A 5FQDC 3RALA 2BZKB 1MUOA 4FIJA 4XG4A 3HUBA 4G1WA 2QO7A 2R3HA 2Z60A 1ZYDA 5DN3A 1A9UA 3IECA 4TWOA 4EQCA 2VX0A 3ANQA 1YW2A 3BBWA 4IB0A 3TKUA 1K2PA 5M57A 2B4SB 4IZ5A 5ETCA 2G2IA 2WMUA 1Q97A 4A4XA 5JMSA 3WZJA 3GCQA 3FMJA 2P4IA 3TKIA 3VUGA 1E1XA 4DAWA 3OWLA 5EHOA 4BHZA 1FVTA 4N6YA 3F5XA 4XRJA 4BBMA 5E9EA 2C6IA 4GKHA 3VS4A 3FY0A 4U5JA 3OXZA 3QRJA 4U44A 1TVOA 3GFWA 1Q62A 1GIJA 3NAYA 5HICA 2GQRA 5FLFA 2JFMA 4UWCA 5M55A 4O7RA 2XK8A 4ZMFA 1ZAOA 3QKMA 3JPVA 1REJA 3A7FA 5BUJA 1VYZA 4E5WA 2OH0E 3PZEA 3V51A 4EH7A 4X3FB 5BX0A 3ZXZA 2C6OA 3MH1A 5DI1A 1TQPA 1YRPA 4H58A 3KMUA 5JGAA 4Y5QA 1PKDA 4KIQA 1B38A 3FQSA 3A8WA 5C9CA 5J1WA 1TZDA 3QXOA 2EVAA 4JBOA 3VN9A 4WSYA 2IZSA 5HCZA 4YC8A 4CFVA 5HG9A 4YZBA 1J7UA 4L3PA 4RSSA 2GTMA 4FV0A 4GS6A 4FTRA 3V5LA 4CT2A 4QP8A 3LXKA 4EJNA 2RL5A 2BDJA 4DHIB 1OUKA 4CYJA 1URCA 2EXMA 1G8AA 4FSZA 5HE2A 3V5TA 4ZLOA 3EH9A 5I9VA 2PMIA 4RA5A 3T3VA 2VGOA 3D5VA 4FGBA 2XUUA 4L3JA 4RVTA 5AV4A 4QNAA 1JQHA 3BYUA 4KBCA 5EHLA 2OJGA 4HVGA 2J9MA 1WVXA 1U54B 2PTKA 3O50A 1PXIA 3N51A 2YIRA 4LM5A 3NGAA 4LG4A 4ZAUA 4ANLA 3JR1A 2PUUA 5KMOA 3EJ1A 1NY3A 2Q0BA 3L8VA 4KB8A 3V6RA 3KB7A 3UNJA 3F2NA 4HGEA 3UPXA 3MGYA 4L9IA 4FMQA 3GI3A 3JXWA 4FVPA 4ALWA 4ITHA 1R3CA 4C34A 3WIKA 4Q5EA 4EQMA 2OSCA 4ACCA 3Q60A 3QZFA 2UW4A 2VNYA 3WZDA 3FPMA 3UIUA 3GU8A 3IW7A 2NRUA 4BB4A 2OK1A 4X3FC 4TY1A 5K0XA 2EB3A 3O96A 3W0NA 1JWHA 3QLFA 1YHVA 2BCJA 3HV5A 5AM6A 4A9SA 3BQCA 1V0BA 2I6LA 3UGCA 3GOPA 4DGLC 4CV9A 4E3CA 1B39A 3ZUUA 2W1GA 2HENA 3BHTA 4S32A 5A4EA 3F2AA 5T6KA 5DEWA 3DPKA 3W2OA 3BU3A 5HOAA 4TYHA 5JFXA 3IOPA 3P1AA 3OUNB 4GU6A 4O7NA 1M2RA 1OI9A 3Q9ZA 2X6EA 1M2QA 4WBBB 4ZTQA 3SRVB 1SYKA 5HLPA 1PXLA 2B0QA 3LHJA 4QPAA 2C69A 4MF1A 3PY3A 3JUHA 2C4GA 3QU0A 5CU4A 5ANIA 4M12A 3VBVA 5GIPE 4RPVA 5L3AA 2RG5A 4NZWB 4NT4A 2JDRA 3JS2A 4XV9A 5FDPA 4ZY6A 4FKSA 2OXYA 4D2SA 4AXDA 3NNVA 3DJ7A 1FINA 4YNOA 2P55A 4PMPA 3GXLA 4BDAA 3CGFA 2PE1A 3ZH8A 3RJCA 5HTIA 2Y8OA 5IUGA 2BALA 3TUBA 4EOKA 3GEQA 5KNJA 4AXAA 4QPMA 4FTQA 2UW9A 4L43A 4F6SA 5IEVA 5EYDA 1DM2A 5EDPA 3ENHA 3C50A 1V0PA 3FSFA 5FDXA 4A9TA 2GFCA 1RQQA 1JKLA 3PG3A 2HWOA 1O6LA 2X81A 3KL8A 3GB2A 4R5YA 3VNTA 4XG2A 3FKNA 3QA8A 4AG8A 1OPKA 3KY2A 4TWCA 3DXNA 4XH6A 3TV6A 4RIYB 1PY5A 3UE4A 5T68A 3DZQA 2XA4A 2XIXA 2P33A 2V62A 3MPAA 3EZVA 4KNBA 4WSQA 4BY9E 4JBVA 4Z7GA 1W82A 1CM8A 5L8LA 4G3EA 4UN0C 3UOHA 4BDKA 5D11A 3CE3A 4PL5A 2DYLA 3VUIA 3Q5ZA 4LV8A 4G31A 3ZYAA 4FKWA 3QX4A 3ZU7A 4JMQA 4XV1A 3AC1A 4NK9A 3MB7A 4FZ7A 3LFDA 2CGXA 3AC2A 4BDIA 3LOKA 2GHMA 4FV7A 4UB7A 4RJ6A 5CSHA 2XJ1A 5CAQA 4J7BA 3VO3A 3AD5A 3IDBA 3SKCA 1NVRA 2R3QA 4FKPA 4WUAA 4DEAA 3U8WA 2OWBA 2WMSA 4GT4A 5AR8A 5HGIA 2VUWA 4Y5HA 3SQQA 4DEEA 2BZHB 3DB6A 2ETKA 2XKEA 3E8EA 4GFMA 4ZSGA 4Y8DA 3W0MA 3AC8A 1HOWA 1SMHA 3G0FA 4BWKA 2J0MB 3RK9A 5AP2A 4MWIA 4QMSA 3WE4A 4FIEA 3LXNA 4L68A 4BYIA 4RQKA 1YOJA 3IGGA 3QCQA 2GSFA 4F99A 4O27B 4YMJA 1RDQE 4KIPA 4EZ5A 5AR7A 3GGFA 2Y4PA 3RNIA 4OW8A 5AJQA 4WG5A 3O5AA 4IX6A 2UZNA 3RPVA 4O0YA 4QYHA 3TNWA 2QHMA 3KN5A 1YXVA 5JRSA 3A7IA 4LGDA 3ZFXA 2RIOA 2JDTA 1Q41A 3NW7A 3D2KA 5EK7A 2IEWA 2E9OA 1DI9A 4QQCA 4MH7A 5H8EA 2CPKE 3GP0A 2PULA 4IQ6A 4X2KA 5AAEA 3OP5A 5C27A 4W4XA 3GT8A 5EM7A 5HVYA 4B9DA 4B99A 4I0TA 4I4FA 1JKTA 1S9IA 4XMOA 3G51A 2C3JA 4O1PA 3VJOA 4ZLYA 3TUDA 5FEDA 4QYFA 4C4JA 3MH0A 3ZC6A 3OW4A 2XJ2A 2Z2WA 5HIEA 1LEWA 5AX3A 4M8TA 3QD3A 3V5QA 4I21A 2ZYBA 2AC5A 3BLAA 2PZIA 3O8TA 4NFMA 2VTHA 4V05A 2FO0A 3KEXA 5FXSA 4CFNA 4FV4A 4EOMA 5M53A 3QGYA 2GCDA 3NWWA 2V22A 3GCSA 5IQAA 1OIRA 2OXDA 4KIKB 5FWKK 3UZTA 3VS5A 2PVKA 4BGQA 4X3FA 1P4FA 5EQYA 3SXFA 4BDEA 4LRMA 4CYIA 5JEBA 5CNOA 3DGKA 4JQ7A 4NUSA 1UU7A 4USDA 4YLKA 5E8WA 4QT1A 2XNEA 3HGKA 5ETIA 2R3NA 3QLGA 2EUFB 3F3VA 4RVLA 4WNKA 3UC3A 5J9ZA 5AUYA 3UOLA 3VW8A 4BYJA 4JAIA 4D2PA 1O9UA 4FA2A 4RWKA 3EQGA 2BRNA 2ITVA 3GU5A 4HOKA 4QMOA 1YXTA 3WYYA 3T3UA 4QEBA 4H3QA 4FNXA 4C7TA 5IEYA 2QC6A 1R78A 4A06A 2PZ5A 5CLPA 3TTIA 5LVNA 4L44A 3BL7A 2H8HA 4ZP5A 4HNFA 2VWZA 4P4CA 1ZLTA 1PKGA 5AV3A 1KWPA 3HDMA 2YAKA 3QRUA 3R04A 3SX9A 4DCEA 3DCVA 2V55A 3CY2A 1UKIA 4PL3A 1OGUA 3W33A 4E4NA 1R39A 1OPLA 3P7BA 4OBQA 5CI7A 2YIYA 5CT7A 5IQEA 4E6DA 2ZMDA 5I3RA 2CDZA 3UG1A 1U54A 3O71A 5A4CA 3I0QA 2NYAA 3BKBA 5AEPA 3BGPA 2W1FA 2QU5A 5F9EA 3FZ1A 4F6WA 5J7HA 1R0PA 2C6KA 4G16A 3R7EA 2IZRA 3BLQA 2JAVA 4IHPA 4FT7A 2I0YA 2CKPA 3TM0A 3UP7A 2XAOA 4D4YA 3GENA 2YLEA 4TNBA 3TZ9A 4AP7A 2YM6A 3BGQA 1F0QA 3QTIA 4HYHA 1STCE 2XK4A 3KK9A 5DR2A 5DT4A 3TZMA 1YOMA 3IS5A 3UIXA 4FKVA 3UBDA 4EH3A 5HVJA 1YXSA 2XNNA 2WZJA 3LFAA 5J87A 4HPTE 4DA5A 3D4QA 1VJYA 1U5RA 4K2RA 3TG1A 4QMLA 4D9UA 5FUTA 2BIYA 3P5KA 3NUNA 4I24A 3FLZA 3MW1A 4FT5A 4OAUC 1OKZA 4HVSA 4MWHA 4BKYA 3RM6A 5BVDA 4GV1A 5KMLA 3REPA 3K5UA 4C59A 3NW6A 1JOWB 4D1XA 5T3QA 5ETAA 2Z02A 4P90A 2XH5A 3OUKA 3SRVA 5LVPA 3VC4A 4QMMA 4YU2A 4GKIA 2XALA 4DFBA 4IAIA 3QZHA 3CY3A 5FG8A 2XZSA 2VTLA 3AKJA 3M42A 4ARKA 4DEIA 3AD6A 4S31A 2Y9QA 2ITTA 4JX3A 4PL4A 4E5AX 3PE2A 5HU9A 5J79A 3ZFMA 4XG7A 4ANNA 4A07A 3TEIA 1IAJA 2X0PA 3IONA 4O22A 4IACA 3ENMA 4GRBA 4FK6A 4IFCA 1PMNA 4IDTA 5DG5A 3CIKA 4DFNA 3SVVA 4W9XA 3CJGA 3EQFA 5H8GA 3SDJA 1WBPA 4B4LA 2X39A 4HYUA 3QD2B 1F3MC 3OY1A 3E92A 3PY0A 4PQNA 4XP0A 5D1JA 4PDYA 4N0SA 4MX9A 3RGFA 3ZSHA 2VRXA 4XG3A 2O2UA 2R3JA 4R3CA 5LVMA 5M09A 1H4LA 4RIYA 4BBFA 5HG7A 1TQMA 4BDGA 2G1TA 5HNBA 3NUAA 3LQ5A 4KS8A 2JKKA 2JLDA 4DBXA 4H05A 2ZDTA 5AV0A 4EQUA 2UZWE 5M4FA 4JJRA 3UMWA 4BGGA 4PY1A 2YABA 1P5EA 2VWBA 1LUFA 3UYTA 4ASEA 4XLIA 4DG0E 4OBPA 3BYVA 3BPRA 3PLAE 3ZBXA 4LL0A 4GJ2A 3FEGA 4L00A 1M17A 4U97A 4YSMA 2UZDA 1MRYA 3CD3A 3LXLA 4CGAA 4FG7A 4JS8A 2W5HA 2ZB1A 3SOAA 2C0TA 3O7LD 2AUHA 1ZMWA 3L9NA 5AR3A 3UZPA 4HYIA 3HP2A 5GNKA 2PVRA 1PJKA 3KC3A 2KTYA 4BCKA 2PZYA 5IQDA 4BICA 2WTIA 3H9RA 4CT1A 3U9NA 2C6DA 3G9LX 4BKJA 1OKYA 4U41A 4FV2A 5BUEA 3CKWA 2RKUA 5K5NA 3TV7A 3ODZX 2PU8A 5HD7A 4APPA 3GOKA 5HNGA 1UKHA 4GSBA 4UZHA 5IA4A 3A7GA 4LOPA 4ZTHA 4EJ7A 5K9IA 2JIVA 5FEQA 5E8UA 5EW9A 4FSUA 5CNNA 4PMSA 4N6ZA 4DINA 3RAKA 2BAKA 4L53A 4G3DA 3KRLA 4IAAA 2QOLA 3EZRA 4FZDB 4OTHA 4QMZA 1BMKA 2YWPA 4RZWA 2YCSA 4XRLA 2UZVA 4B7TA 2C5XA 5DMZA 4BDCA 5EYCA 4FTOA 5HLNA 3ROYA 2JKOA 3GQIA 3FMKA 1MRVA 4FX3A 4K33A 3D2IA 5AUZA 2WU7A 3ZEPA 2YACA 3CC6A 4AT5A 3ANRA 3COIA 3ZO2A 2JDOA 5H3QA 4GU9A 4QMXA 3ZBFA 3KULA 5HO7A 3LAUA 5CI6A 3U6HA 4D2VA 4IM0A 1Q99A 2OI4X 3BHVA 4JDJA 3MFRA 1W84A 5FEEA 2ZFYA 3B8QA 3FI4A 2GDOA 3IDCA 2R0IA 3MVMA 5CT0A 4TZRA 4PRJA 4DTBA 4TT7A 4CTCA 3VS7A 5CF5A 1T45A 3FAAA 4OR5A 3V3VA 4EEVA 5J9YA 5LMBA 4O81A 1GAGA 4EONA 4GL9A 4AXCA 3FJQE 1U46A 1JBPE 3EN7A 3MBLA 4R7HA 5HI2A 3U4UA 3ZTXA 4C2WA 4I6QA 3O17A 3KREA 3V8SA 2XNPA 4KIKA 4AWIA 3R73A 4L8MA 4C8BA 2X6DA 4RC4A 5CU2A 4G3GA 4BCMA 3FHIA 4IMYA 2SRCA 5LMKC 5FTGA 5KMNA 1GZKA 2YITA 3A60A 4YO6A 5DPVA 2JKMA 5JK3A 3ACJA 3ROCA 3LJ2A 4HNIA 1G8JA 5DBXA 2CCIA 4CD0A 4CMOA 2CJMA 3R2BA 1NVQA 5CZHA 3AC5A 5CQWA 1SZMA 3HA8A 1W2FA 4FV8A 4MNFA 4C33A 3FY2A 4AOTA 4IWDA 2YJSA 2IN6A 2QO2A 3BYOA 4D4SA 1XH4A 3BV2A 1WZYA 3B8RA 4XOYA 3C5IA 3E88A 4G3FA 3TCPA 3F5GA 3G9NA 4XLVA 3R8LA 3TACA 4CFUA 4I5PA 2IVVA 3THBA 4FSRA 4ASZA 3MFTA 3BQRA 4GH2A 2V0DA 4C4GA 2RFNA 2WTKB 3RNYA 1JSVA 3LFQA 5IG1A 3VONA 3OTVA 5JT2A 2VN9A 3LFSA 3DKGA 2YM7A 4WNOA 1OBGA 4BCHA 4O21A 4UMQA 3FI2A 1NXKA 1LP4A 5FGKA 4DE4A 4TRLA 4FIHA 3QAME 4E6QA 4DH1A 4I6BA 1A06A 4FL3A 3ORLA 3CTJA 2I0HA 4AN9A 4PDOA 3BRBA 4XG9A 4RIWB 4BTFA 4EWQA 1Q8WA 5A4TA 4D55A 4DT9A 4WT6A 5HE3A 2WMAA 4PPAA 5EH0A 4OT5A 3QYZA 3HMIA 2VU3A 3JY9A 4TYHB 2G2HA 2XNMA 4UZDA 4MD9E 1H1PA 4FVQA 2YDJA 3KVXA 4AA0A 2G2FA 1F5QA 4ACDA 5A3XA 5LVLA 4K6ZA 3GU7A 3OCGA 3DK7A 4IM3A 5LARA 5TKDA 3F5PA 4I93A 5DT3A 3OEFX 4OTDA 3PVGA 5E8YA 4F65A 3C9WA 2XBAA 2QOHA 2VWXA 2VWIA 3MH3A 4RX9A 5LOHA 3F3WA 1IA9A 4I92A 4YC3A 1WVWA 4XOZA 4TN6A 3TI1A 2X7GA 3HV7A 2OW3A 4JDIA 2FSOX 2UVYA 4KS7A 2XIKA 4TXCA 4FL2A 3G90X 1R1WA 4QTDA 5KKRB 2YWVA 2PL0A 1PMVA 3O23A 2UW5A 4U43A 4BDJA 1Q8UA 3LJ1A 3QYWA 4BTJA 4YZMA 5AUXA 3BBTB 3TJDA 1KE8A 2WTKC 3PPJA 4BTMA 1W8CA 3E3BX 3VBWA 4DF3A 4HVDA 5D12A 4G5JA 1XBBA 3L1SA 3D15A 3GNIB 2CGWA 3P08A 1WMKA 4DG3E 1ZYSA 1QPEA 3HMPA 4JR3A 4MAOA 4JT3A 3TNPC 3ZMMA 1IAHA 3ETAA 3UPZA 1PXOA 3HVCA 3EN9A 3R7GA 1ZY4A 2UZUE 1QPDA 2YZAA 3GU6A 4AX8A 1KOBA 2I0EA 3D0EA 2VWVA 1PXMA 4ZTLA 2OICA 1AD5A 3NZ0A 5FRIA 2ZOQA 4FOBA 3ZLXA 3PP1A 3C4WA 4EC8A 4IIRA 1YDRE 4O7WA 2WEVA 4EYMA 4HCTA 5BVWA 2HK5A 4FTAA 1ZZLA 4FL1A 5M06A 3KFAA 4J8NA 3UVPA 2PHKA 4UMUA 1H28A 1GJOA 3P23A 3PJ8A 5L6OA 2F7EE 3W2QA 3UNZA 1OECA 4FKUA 4XP3A 2HYYA 3CPBA 5IQIA 3QKKA 3CJFA 3RK7A 4JBQA 4QYYA 2HIWA 2R3KA 5HQ0A 2C47A 3L9PA 5IQCA 2PVJA 3BHHA 2O3PA 1Q24A 3K54A 4BFMA 3P0MA 4R6VA 2FUMA 2W4JA 4R8QA 5BVOA 2FGIA 5KKRC 4N4SA 4OUCA 3F61A 5EW8A 5LMAA 4FT0A 4PDPA 4EHEA 4YBJA 4FE2A 3HMNA 3OXTA 4O0TA 2QOQA 3EFJA 3QTUA 2BFXA 3VRYA 3Q4TA 3PJCA 3RPYA 3AMBA 4X0MA 4ACHA 3AT4A 2R9SA 2R64A 4TTHB 5ANEA 2BVAA 4JRVA 5HE1A 3EKKA 4O7SA 3CXWA 4LL5A 4V0GB 4FKJA 3ZSIA 4O86A 1CKJA 4FTIA 1QPJA 3PJ3A 5GHVA 4JLCA 4F08A 2O64A 4O0WA 4FI1A 2H34A 4FZAB 5KHXA 5CWZA 2OIBA 4L52A 4AW2A 5CXZA 5A6NA 1W0XC 2QR8A 4JG7A 3OF0A 3RZFA 5IU2A 5IA3A 5AUVA 2HOGA 2QOBA 3R1YA 3DZOA 4CNHA 5HVKA 2BILB 3P4KA 4FR4A 3R7UA 3PRIA 5CVFA 3AT3A 1E9HA 3BWFA