4O21A

Product complex of metal-free pkac, atp-gamma-s and sp20.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Metal-Free cAMP-Dependent Protein Kinase Can Catalyze Phosphoryl Transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 111
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o21A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o21A02
4FIGA 4LGGA 1Q3DA 3MBLA 1KE8A 3BGZA 3PXKA 4KIPA 2PY3A 2VWIA 5KKRC 3UIXA 3Q2JA 4FC0A 1H1QA 2ONLA 2QO2A 3KY2A 4U7ZA 5D12A 5AX9A 3E62A 4FSMA 4RA5A 4D4SA 3KK8A 5CAQA 4L7SA 5AP4A 3V3VA 2JAMA 2J50A 3E8NA 1F0QA 1ZZ2A 4XX9A 2Z7QA 2QO9A 3O51A 4XCUA 4RWKA 3QTWA 3HUBA 1O9UA 1FVTA 2XNBA 2FA2A 3G2FA 2ETMA 3F88A 2BRHA 4JDIA 5E8UA 3W10A 3EIDA 4FTTA 4ANOA 5HE1A 2VTRA 2VV9A 2ZAZA 1M52A 3EHAA 3ZYAA 4DE4A 1MRUA 1XWSA 2BRGA 4QPAA 1U54A 2VUWA 2XNOA 3AGLA 2R9SA 3KMUA 4FK3A 1LEZA 5AUTA 4RQKA 5C8MA 3HDNA 3QXOA 4GK4A 5JT2A 3T9TA 1PF8A 2W1FA 3AC2A 2W1CA 1FGKA 3PP0A 5CF6A 4F7NA 1GOLA 1BI7A 4FL1A 2A19B 5EOLA 5HG9A 2VWWA 1G8AA 1UU8A 3DQWA 3R01A 4H3QA 3GEQA 4FTMA 3CD8A 4OW8A 4C4EA 3KMWA 1RJBA 4RJ6A 3CD3A 5IA3A 2X8DA 3QX2A 5EM8A 5CANA 4KS7A 5M55A 3GFEA 3R8ZA 4BHNA 1URWA 3F5UA 4AZWA 4A7CA 1PMUA 1IR3A 2PUUA 3B8RA 3O96A 5E8TA 5FEDA 1GAGA 3P78A 5ETAA 3ZBFA 4C3FA 4FUXA 5DR2A 3DB8A 3BBWA 2EVAA 5EDPA 3TIYA 1H8FA 2VO7A 2G2IA 3V5TA 2C5NA 4AE6A 3RVGA 4IDVA 3QCSA 4NYEA 3GQIA 3WF5A 3GQLA 5KBRA 4FTKA 4BYIA 3AC4A 3GU8A 4M3QA 4WIHA 3DOGA 5EDRA 3RINA 3UP2A 4IC8A 2Y8OA 3W1FA 2FGIA 3NLBA 2VGOA 1PHKA 1WBTA 4OUCA 5CY3A 5LVOA 4LMUA 2DQ7X 2X7OA 5E90A 4RC2A 4FTLA 4JRNA 3IONA 4AX8A 3HV4A 4G9CA 1QPDA 3W16A 2DUVA 4EC9A 2OXYA 3JR1A 2VGPA 3FLYA 5DRBA 4BTKA 5IA1A 1PYXA 2UZDA 3JY0A 2QI8A 2VX0A 1ERKA 2XYUA 4NM0A 4USFA 2ZDUA 3VS2A 2JBPA 2CN8A 4GRBA 4NWMA 2JFLA 5C1QB 3EQFA 3Q53A 1Q62A 2ZMDA 1BKXA 4CVAA 2GFSA 3CCNA 3QZIA 2HY0A 5BQ0A 5L3AA 4I3ZA 2XRUA 2FH9A 3BHVA 4M13A 1X8BA 3UZPA 4I1ZA 2Y4IC 3PPZA 4LGHA 3UYSA 4EYJA 2R64A 3RZFA 5TKDA 3W55A 2CLXA 1YW2A 4F0GA 4L8MA 3Q2MA 4OBOA 2YCSA 3HECA 4F0IA 4C02A 2XKEA 3HMMA 1PXIA 4ITJA 4W9XA 4YO6A 2ZYBA 3C5UA 2E9NA 4UXLA 1FQ1B 5J95A 2GNGA 2CMWA 2OH0E 3R7VA 3VBXA 5IH4A 1U59A 2GNLA 3UIUA 5K0KA 3R9NA 2ZM1A 5BYYA 3AMBA 3S1HA 2R3QA 2JKQA 1CKIA 2B53A 3W2CA 4BI1A 4BDDA 1FGIA 1IG1A 4CCUA 1QMZA 1WBOA 1WZYA 3R00A 5HO8A 5DPVA 4Y95A 1URCA 4PDOA 4H3BA 1JPAA 4QMPA 2J0IA 4U6RA 3I81A 4M84A 2XJ0A 5LVLA 1ZYLA 4FGBA 3FSFA 4O7NA 4HCTA 2C3IB 2GMXA 1JSVA 3KA0A 3OCSA 4EOLA 3FXXA 2UW9A 3NGAA 4XUFA 4IAAA 2UW5A 4AW2A 1BUHA 2CPKE 4JBVA 2V55A 1ZARA 1YDTE 3MH2A 3FLZA 4GV1A 4NUSA 1H25A 2EB3A 3QQKA 5KE0A 2C30A 3UOLA 3MPTA 5CXHA 3AD4A 2HZ0A 1QPEA 3I5ZA 3PP1A 1H28A 2GHLA 5IQHA 1VYZA 1O6KA 4LL5A 2B4SB 3PZEA 3R2YA 4G34A 4EBVA 3AC3A 1J1CA 3I1AA 4LGDA 4MBIA 4G3EA 4F0FA 3CXWA 4O81A 4HNFA 1HCLA 2HW6A 5AR8A 2WMWA 4CLJA 3RI1A 4GIHA 5CEOA 3M2WA 5L2QA 2PZYA 3RAKA 3QX4A 3IGGA 3AC8A 4KIKA 4U45A 4UYNA 3UNZA 1OBDA 3NYVA 3NYOA 1PXMA 4BDBA 2WQOA 4BDAA 3KXZA 2RF9A 4QMNA 4Y85A 1F5QA 3HYHA 3F3TA 4BIEA 3OTUA 2XYNA 2QG7A 3PPJA 1ATPE 3KF7A 4RJ3A 5AUYA 1YWNA 3UTOA 3FI2A 3LMIA 2YDKA 1DI9A 3EH9A 4F9WA 3SRVB 4JOAA 2JBOA 2OIQA 3OOGA 4YJRA 4BICA 5AP0A 5J1WA 3Q52A 1YDRE 2JITA 3OROA 5HKMA 2XCHA 4WNPA 3Q4CA 3LW0A 4MCVA 5A9UA 5CF4A 4O82A 5FXQA 5IEVA 1W98A 2B54A 4FSNA 4BDHA 2XP2A 4QTBA 5I9UA 3KFAA 4IIRA 4UX9A 3GUBA 2VTSA 2PUNA 3QTRA 4U0IA 1M17A 2X8IA 3F66A 3THBA 3QRUA 5AV2A 3ZLXA 3G6HA 2WAJA 3OUKA 2OJIA 2X6EA 1RW8A 2C6KA 2VWXA 2BZJA 2Z7LA 2XIKA 3FMNA 4OTIA 3FXWA 3TT0A 2G2HA 3KRRA 2PMNX 2XMYA 3QQFA 4JR3A 4TYHB 4YHFA 5EYCA 5TE0A 3SAYA 4D0WA 3KXNA 5LARA 4FEUA 3F69A 3H30A 4MF0A 4ZTNA 2QKWB 1M7QA 2PVJA 3JXWA 4IC7A 2XK3A 3HRFA 4RT7A 1V0PA 5AIRA 5AA9A 2BALA 5HTBA 3I6WA 4O0RA 2ITOA 3AD5A 4C34A 4F1MA 5DFPA 3LVPA 4I4FA 3IDPA 4XG7A 2RFSA 2VTQA 4J97A 3GB2A 2YM3A 3ITZA 3NR9A 4G3GA 3KXGA 5AV4A 1IEPA 2O8YA 3QZFA 3QZGA 4GJ3A 2VWYA 1CDKA 3R1YA 5HE0A 3VW8A 4HGSA 4IB5A 5CSXA 3FZ1A 1PXNA 4YJQA 4KS8A 5KMOA 3NYXA 4UEUA 1XBAA 2VO6A 3TV4A 5IQFA 3ATTA 5GZ8A 4QP7A 4I5HA 3RTPA 2CLQA 3AMAA 1DS5A 5CT0A 3HA8A 4IWDA 4XG4A 5E8VA 1UVRA 3CTHA 3ZFYA 4EONA 4BWXA 3F3UA 2YJRA 4LM5A 4G5JA 4K9YA 1JLUE 4WOVA 1Q8ZA 4OTDA 4AA4A 3CTJA 4E1ZA 4MBJA 1MP8A 2YIQA 4QMSA 5KX8A 3TNQB 1PKDA 1OL1A 5H8BA 3VF8A 3GOKA 4NL0A 3G9LX 4PY1A 1Q8WA 1HCKA 2F2UA 4S30A 3VUTA 3T8OA 5EKNA 2QOKA 3W2SA 2X9FA 1UU9A 2Z7SA 2Q0NA 3O50A 4WUNA 4XH6A 5ANJA 3VUDA 4C4JA 5DEWA 4WG4A 5HU9A 3SG8A 4XLIA 3UO5A 5JEBA 4ALUA 5JGDA 5D1JA 2YFXA 1OECA 3DNEA 3HMIA 4GFOA 4PF4A 3W8QA 5CTPA 3FMHA 5KCVA 4UMPA 2VTLA 1OKWA 4G3DA 4A9UA 2I6LA 4PPAA 3U4WA 3SKCA 4BI2A 4MQ2A 1STCE 2BIYA 5FXRA 3C4FA 3HUCA 3QGWA 3KMMA 2ITTA 3IO7A 3O0GA 2HWPA 4FV1A 4LUDA 4GU6A 5TT7A 4YZMA 3MTLA 3OW3A 3QBNA 3QU0A 5C9CA 4GG5A 3FMLA 2O3PA 2QLUA 4TYIA 4F65A 4JNWA 1OI9A 4IB3A 1ZWSA 3PJ2A 3MJ1A 3OHTA 4IDTA 5M57A 4DA5A 4GSBA 4RIXA 4U41A 4O22A 4F7JA 2PMOX 2DS1A 3KULB 4OR5A 5I0BA 4H39A 4WNKA 4UWBA 5JQ8A 3GC9A 1JOWB 4C38A 2CN5A 4JAJA 5G1XA 5JRSA 5HTIA 1BYGA 1PXJA 4I93A 1YXXA 3ORLA 3FMEA 3TV6A 5HOAA 1W84A 3L9MA 4M69B 4CG8A 1Q99A 4MNEB 2OZAB 1M14A 4TRLA 4BCPA 4OGRA 3OOMA 2Q83A 4J71A 4RX9A 1Z9XA 4S31A 2O0UA 4H58A 3Q4ZA 3BHHA 4FKJA 2CNQA 4KIOA 4RFYA 1XJDA 3CR0A 4UMUA 4PPBA 2ZV2A 4XP0A 5AP3A 4W9WA 2C6TA 5AUXA 3PXRA 4IB1A 3BELA 5CLPA 5DT3A 4AFJA 3GU4A 4QD6A 2PPQA 2WQNA 4CFNA 4YR8A 3ZU7A 4EZ3A 4DEEA 4R7HA 2PU8A 4O6EA 3DFAA 2R3MA 4NFNA 3WF8A 4E3CA 1Y57A 3ZM9A 4ZLYA 1P14A 5TF9A 4BC6A 3PXQA 2QHMA 4EHZA 5E1SA 4IB0A 3V51A 1MUOA 4BGGA 4BBEA 5FUTA 4AFEA 3DV3A 3HV5A 2OF2A 3M1SA 1J7IA 2QO7A 2F7XE 3VBQA 5EG3A 5LJJA 3NSZA 2QNJA 3HAMA 2P33A 1BLXA 1JQHA 3ZO1A 2VTMA 4XV2A 3A7FA 2YM4A 4O7YA 2XF0A 1UU7A 2V62A 4KWPA 3LE6A 1XO2B 3NAYA 4J8NA 4PWNA 3TZ9A 2QR7A 4FOCA 3V5PA 2O63A 5BVDA 2PVFA 1H24A 2PUIA 2EB2A 4Y5QA 3HDMA 4CFMA 2XKFA 5CYIA 4YHJA 4U81A 2W4JA 5I9ZA 4LRMA 2AUHA 2B55A 4A9SA 2GCDA 2RFDA 2IWIA 4E5AX 3SDJA 4BCJA 3W2RA 3PG1A 4OTHA 3FYKX 3N4VA 4FT7A 3S95A 5M56A 2ERZE 1NVSA 2R3FA 2W5AA 3KU2A 3R04A 4BBFA 5B2LA 4GEOA 4FZDB 4ZZNA 2V5QA 3EZVA 2RSVA 3DZOA 3UMXA 4R7IA 3RK5A 4HJOA 4FR4A 3LCOA 4ITHA 5C03A 3HX4A 5AR2A 1SMHA 2HCKA 3EQGA 4GT5A 4QOXA 2UVYA 3AC1A 4U43A 1E1XA 3R9DA 3CP9A 2QOLA 1ZMUA 4ANSA 5AAFA 2XK9A 4BDJA 3OFMA 2VX3A 4JRVA 2EXMA 3FJQE 3FKOA 2Y4PA 4I6FA 4XMOA 5CXZA 2ZV9A 3O71A 1W82A 4EBWA 3TWJA 4IM3A 2OICA 3BYMA 2OZOA 2W17A 4QP6A 3R1NA 4KBAA 3LHJA 4P5QA 3DAKA 2PE0A 4DTBA 4FE2A 2PVLA 2RG5A 4MWIA 4TL0A 5M07A 1Q41A 3QTIA 4U80A 4M0ZA 5CSWA 3UDBA 3NIZA 1DAYA 2I0HA 1OL6A 2C0OA 1P2AA 2VO0A 3PSCA 3QWJA 5HNBA 4QP9A 5M4UA 3COMA 4RMZA 5B2MA 3G9NA 3TL8A 2YEXA 4J98A 3MWUA 4KAOA 3GNIB 4B9DA 3TUCA 1PXLA 2HZIA 4GVJA 3VULA 2EU9A 4YU2A 2PMLX 3FZRA 2J90A 2JDSA 2CKQA 3OF0A 3PG3A 2E9PA 4XG6A 4S34A 3EL7A 4IX5A 1ZLTA 4DBNA 4ZTLA 2NNWB 3TDVA 2V22A 4IZ5A 4O86A 4JT3A 3IQ7A 3U6JA 1VYWA 2CCIA 2FSOX 3BWFA 4OBQA 5FD2A 3OWJA 4RVKA 4OAUC 5E8SA 4W8DA 4AAAA 2YHVA 4ALWA 4DGNA 3C4EA 5F4NA 3RM6A 3T3VA 3LXNA 3OBJA 2QOCA 3EN5A 4O6LA 4QYHA 4TNBA 4Z7GA 4EK3A 4C0TA 4EQCA 3KREA 5HCXA 2CKEA 2F2CB 2Q0BA 5DA3A 4ZJJA 1WMKA 2WPAA 2CGXA 1W7HA 2QLQA 2HXLA 3D9VA 3EYHA 3MJ2A 3R7OA 3TNIA 4D2PA 1TQIA 5HBJA 4EJ7A 4GFGA 4GMYA 1HOWA 4W4YA 4Z3VA 3FZSA 3ZRKA 1Q8UA 3OWLA 4WD5A 1CSNA 3VS3A 3SXFA 2UW0A 1I44A 2X4FA 5A6NA 4RQVA 2XZSA 5J9YA 3K3IA 3BYOA 3DLZA 4TT7A 3V01A 3REPA 1FMOE 3POZA 4QMVA 4LV8A 3ZTXA 4R77A 3TUBA 3H4JA 2BHEA 5DR9A 3FZTA 4WNMA 4PL5A 4RZVA 4CNHA 5I9YA 4FSUA 4LL0A 2CCHA 3FLQA 5JMSA 4DTAA 3HP2A 3VS0A 3BYSA 1WAKA 4NM5A 3RBWA 4WBOA 1KOBA 5AADA 3F2RA 1VEBA 2PVKA 4FMQA 4JG6A 3ZLYA 3DXNA 3FPMA 5DI1A 5AAGA 4RRVA 3MY5A 2B7AA 5E1EA 3LJ0A 3WZDA 3TDWA 3Q32A 2WGJA 3LCDA 4ZJVA 3ORIA 3LM0A 5EM7A 4QP8A 3PIZA 2XEYA 3NUAA 2R3JA 4EK6A 1OVEA 4D55A 1O6LA 4GUBA 1RE8A 4KABA 1IASA 4DITA 3RPRA 3ZEPA 3R83A 3UVQA 3V6RA 4CV8A 3LM5A 4FKVA 2WTIA 3K5VA 5AV3A 3E7OA 4U5JA 3SGCA 5BMMA 4DN5A 5F94A 4YMJA 5HLPA 3TI1A 2E9VA 5EI8A 3ZONA 3FL5A 5CAPA 3HMOA 5I4NA 1YOJA 3IECA 2GTMA 4ID7A 3OUNB 5JZNA 2BROA 4RX8A 2OBJA 3OMVA 4CEGA 2J5EA 3DA6A 4AACA 3DZQA 4BL1A 2FUMA 3R7UA 3MA6A 4PL3A 2WTKB 4CQGA 4CGAA 2QG5A 3EOCA 2OO8X 4PMPA 3QCQA 3UE4A 2ZMCA 2YIYA 3NUSA 3DS6A 5L8LA 5AJQA 4D9UA 4DF3A 2I1MA 4EWHA 3ODZX 4EH4A 2VTPA 5KZ0A 4USDA 3VS4A 4L45A 4JBOA 4CYJA 4G16A 5CALA 1KE7A 4C3RA 3RM7A 2J6MA 5TOZA 3BGPA 4AUAA 3EYGA 5HHWA 3FEGA 5DVRA 5GJFA 5F1ZA 2G15A 4EOOA 2OW3A 2X8EA 4I0SA 3L8PA 4KKEA 4BZDA 3ZLWA 5EDQA 4H1MA 4G5PA 2BAJA 4LOOA 5E4HA 3MW1A 5ANGA 3E8DA 2GNJA 5IA0A 3CQUA 4XRJA 4RSSA 1LR4A 3GU6A 3I0QA 3PVWA 3O8PA 4FA2A 4FIEA 3PZHA 5LVNA 2VNYA 1WBVA 4FTQA 3ULIA 4G1WA 5HBHA 3L1SA 2YN8A 2G9XA 2WD1A 4D2TA 5HICA 5DR6A 5C27A 3EQIA 1NW1A 1YKRA 4QRCA 4JQEA 5E8WA 3VN9A 2IZTA 2P2IA 2BZKB 2J0LA 2GDOA 3PSBA 4FKRA 1L8TA 5HO6A 2W1DA 4WO5A 5FEEA 4IQ6A 4EHEA 4RBLA 5AP1A 3QRJA 2UZEA 3GT8A 4QMWA 2JDTA 3DU8A 4D1SA 5FP5A 3GGFA 3A8XA 3VVHA 4DHFA 3ZSIA 3NCGA 2YCRA 1J91A 4BCIA 2W5HA 4FG8A 4IAZA 2ZM4A 4OTWA 5EHYA 4A4XA 1J7UA 2XM9A 3D2IA 3R9HA 5TO8A 4E73A 3VS1A 2J2IB 3ZUUA 4MKCA 5A4QA 1OBGA 3OVVA 4XV1A 2YAAA 3H9FA 3ET7A 1KE5A 4IWQA 4YNEA 3PXFA 4WRGA 3HAVA 1ZOGA 3GI3A 2YITA 1OM1A 2PSQA 1YOLA 3ACJA 4YLKA 4F9AA 3QLFA 2UZUE 4L9IA 2RKUA 3FYJX 4ACMA 4ERKA 2PULA 3V8WA 5ANEA 1Q61A 5IMEA 4O0XA 3PJ3A 1Q4LA 4K18A 4I4EA 4QMXA 4ARKA 4Z55A 1ZMVA 2X39A 3WF7A 1XH9A 4FV0A 4GL9A 4B4LA 3CLYA 3R2BA 2YCQA 1Q8YA 2C1AA 2R3LA 2WTVA 3NNWA 3NRMA 5IUHA 3EFWA 4AU8A 4NIFB 3P86A 1KWPA 3WILA 3EJ1A 3NVMB 2X2LA 2JIVA 5KZIA 1TVOA 4RWLA 1ZOEA 4E5WA 3DDPA 3TJDA 3LZBA 1JWHA 4E6AA 2ERKA 3UOKA 3HRBA 4U9AA 3MYGA 4WT6A 3BE2A 4GFMA 4IEBA 4FNWA 3MIAA 5EFQA 5J9ZA 3PTGA 3CE3A 3E3PA 1V0BA 4YP8A 1DAWA 4K8AA 1CKJA 5BUEA 1KE9A 2HY81 2X2KA 2NRYA 4H1JA 2VTIA 4NZWB 3PJCA 4PX6A 4W8EA 3LFNA 4FK6A 3WOWA 3FQEA 4HYHA 4R8QA 3ZSGA 5IG1A 4IBMA 2OK1A 4GT4A 4A4LA 4HPUE 4LI5A 4V0GA 4TPTA 4BWKA 2AYPA 5L6PA 1UNHA 4FV5A 2ITVA 3QWKA 2C5OA 1MRYA 4EK5A 4F6UA 3QFVA 4HVIA 1U54B 3ETAA 5FGKA 1OUKA 3IK3A 4G6OA 3PIXA 4KIQA 1QPJA 2CDZA 3K3JA 5K5NA 4I5MA 4X6RA 5CASA 3RPSA 3G6GA 4PTGA 4QTDA 3SV0A 4QT1A 4BBMA 2YACA 4FVQA 4I22A 4MXXA 4EKKA 4EQUA 3TIZA 2IJMA 2P3GX 3O7LB 1OMWA 4KB8A 1OKZA 5CI6A 1G8SA 4OTGA 4RLLA 3PFQA 2PVYA 4U40A 5CU0A 2R3NA 4WA9A 4MYGA 3TN8A 4QMTA 2UZTA 3PA5A 2XB7A 3RAHA 3LCSA 3VJNA 3FC2A 3PJ1A 3ZFXA 3MFSA 3QZHA 4FTUA 4AZFA 5LMBA 1H1PA 5BVFA 5KKRB 4LOPA 2OJJA 4ZTQA 4CLIA 2FSLX 3DAEA 3E64A 3VBWA 4IJ9A 2UW7A 5FTGA 2GQGA 3P7BA 3UZRA 5DHJA 4OTQA 4D2SA 2EUFB 3DGKA 2C6DA 4APPA 4PNIA 4GH2A 3OCGA 3ANQA 3H9RA 2C5XA 4NFMA 4XG8A 4D0XA 3P9JA 4RIWA 3NYNA 2W9ZB 5DOSA 3FY2A 2QU6A 4FSTA 5CX9A 2YDIA 3F6XA 4JX3A 1JVPP 4QO9A 5ACKA 3SOAA 4EUTA 1IRKA 5A46A 3IOPA 2PUPA 3RPVA 3QUDA 5I9VA 1OL5A 4IE9A 4JR7A 2WTDA 3PRFA 1ND4A 3G90X 2C0IA 4XYFA 3C4ZA 4W4VA 1CM8A 2DWBA 4O84A 3O23A 5FDXA 4EEVA 3PVGA 4I0RA 3IKAA 3F3VA 3PLAE 2GS2A 4BDFA 3A61A 2XUUA 2HWOA 2R3PA 3F5PA 2XA4A 3HGKA 3HL7A 4RJ8A 3ZCLA 3MESA 4BGHA 2Y0AA 3UQGA 1UA2A 3OW4A 2UZLA 2Y7JA 3W8LA 3N4TA 1FPUA 3QD0A 4G3FA 4PRJA 5CQUA 1YI3A 3DY7A 4FV9A 3F61A 5CI7A 4QQCA 5F95A 4H05A 3SW7A 1ZY4A 2JKKA 2ZM3A 4KKGA 5LWNA 1XH5A 4G31A 4F7SA 4J1RA 4IAIA 1O6YA 4BTMA 4IM0A 4DINA 4DFBA 4O0YA 2B1PA 2W1ZA 3H10A 2X7GA 5HBEA 1OKVA 3FLSA 5CVHA 5A4LA 3MH3A 3NUYA 3VUHA 2YISA 1UNGA 3LFFA 3NZ0A 3U9NA 3G0EA 4G6NA 2BKZA 4WUAA 5D10A 3DNDA 1GIJA 5L4QA 4ZSLA 3MVJA 4LFIA 3LOKA 5FWKK 1Q5KA 5HIDA 5CENA 4NJDA 2UW8A 1P5EA 3NW5A 5LXMA 3GVUA 4CMUA 1OIRA 4DEGA 2WIHA 4D5KA 3OBGA 5BVEA 3C4CA 3RHKA 3L8VA 3R8VA 2F7EE 4FX3A 4UN0C 5ANKA 1YHWA 5F20A 4RA4A 3KGAA 2QHNA 3C13A 5IUGA 4O7LA 3MH0A 4G17A 4GUEA 2AC3A 4BB4A 4AOIA 1Q24A 3FSKA 4I23A 1FBNA 3R9RA 2B9HA 3QD4A 2UZBA 4DGOA 2NPQA 4QMLA 5EOBA 5AMNA 1BL6A 2V7OA 5HZNA 3FMKA 4TYEA 2HXQA 4U79A 3H0YA 3HA6A 4YGAA 3EQPA 4K0YA 4M14A 5CS6A 2Y4IB 1NT2A 2PZRA 1FVVA 2BFYA 2HYYA 5FRIA 4XS2A 4RGJA 5CAOA 4TXCA 4KD1A 3V5JA 3S3IA 5FBOA 4DT8A 4YZBA 2PZPA 5EYKA 4FGRA 4CYIA 4PDSA 3LJ1A 4HYUA 3F82A 2GS6A 2CHLA 2XKCA 4C4IA 1YI6A 2C4GA 3AD6A 1YXTA 4KIKB 2H9VA 4KRDA 4YURA 5A4EA 4ANLA 3OWPA 3VS6A 5AM7A 3R73A 3G51A 3EL8A 4G2FA 2VWBA 4K11A 3V5WA 3W2OA 3V5LA 2HZ4A 4ZEGA 3D5XA 3D5WA 3UODA 4EH3A 5LVPA 3ZO3A 4FNYA 1FOTA 4ANNA 2QOFA 2NP8A 3MN3A 2VZ6A 3MY1A 4I6BA 3WE4A 2OWBA 2WNTA 2Z2WA 4FIHA 4FNZA 4FOBA 4AP7A 4FL2A 5KMLA 5AR5A 2UZVA 3P79A 1H0WA 2WEVA 5JQ5A 1WCCA 3FL4A 4RVLA 5ETIA 2IVUA 5HD4A 3FHRA 1U46A 5FLFA 4XEYA 2BFXA 3RWPA 4C2WA 4Z16A 3L9NA 2J0KA 4O2PA 4R3CA 4RC4A 3NW6A 4O0VA 4DEHA 3BPRA 4E7WA 1XBBA 3FV8A 4RIYA 4BKZA 2IO6A 3F5XA 1R39A 4RJ5A 4UMRA 3QF9A 3KEXA 3V04A 4C3PA 2FSTX 2X9EA 4AF3A 5IQEA 4ZP5A 2PVHA 4FSYA 1VR2A 5CAVA 4YJTA 3ORMA 3TKUA 4UZDA 4NTTA 4D1XA 2JKOA 5T3QA 2QODA 3DLSA 3OT8A 1BL7A 2R5TA 4JX7A 4FIFA 3RNYA 2H96A 1P4OA 5D7VA 4BY9E 1SVHA 5C8KA 2YIXA 4L53A 4BKJA 3MPMA 4JXFA 4R1YA 2VTOA 2OJGA 5M4CA 2BTRA 2LAVA 4BFMA 4ZMFA 3NUXA 5JFSA 4FKPA 4JG7A 4MEDA 1JKLA 5GIPE 2NRUA 4HCUA 3FI8A 4ZSJA 3I60A 4GS6A 3MY0A 4PMTA 5DIAA 5IA5A 4AT5A 2REIA 3FI4A 4PPCA 1GJOA 1PXPA 2WTCA 3R22A 3W2QA 3LLTA 5IQDA 3R8PA 4QTAA 4M68A 3I4BA 2IVTA 1PXOA 5FTQA 3U55A 1UV5A 3HKOA 2OU7A 3D4QA 3U87A 4CXAA 3ORPA 4DLJA 3CKXA 4NW6A 2F7ZE 2I0YA 3ORXA 4UV0A 3CGOA 3FE3A 3PUPA 2B9JA 3SA0A 3Q9XA 2OIDA 3C51A 3D7TA 3GU7A 4II5A 5HEZA 2W1HA 3Q96A 3SLSA 3TKIA 5EQYA 4C35A 2ITYA 4YTIA 3GOPA 3S0OA 4DFUA 3EN4A 1MQBA 2YIRA 2XEZA 3OCBA 2WO6A 4HVHA 4BCNA 4X2JA 5C4LA 4MK0A 4AGDA 4FEVA 2J5FA 5IA4A 3EN7A 3D7TB 3M42A 3DBQA 3FI3A 4D4RA 5I9WA 5ANOA 1SVGA 2YABA 1REKA 4X2FA 3MA3A 2YM7A 4A4OA 3ROCA 3WE8A 2VWZA 3QTXA 4YPDA 4LG4A 4BCKA 4DFNA 3F7WA 4HYIA 3BYUA 3KCFA 4NKAA 5JSMA 1XH6A 3HV3A 3AMYA 4R3RA 5EW3A 5CT7A 3PY0A 5CU3A 2GU8A 3ZZEA 4BZNA 3G15A 3LPBA 4AS0A 4BVUA 4BHZA 3R30A 4V04A 4DFLA 4QP3A 3KRXA 3LFDA 4IHPA 2WIPA 3VRYA 3UIBA 1R1WA 2C5VA 3RAIA 5C4KA 5AV0A 2QOBA 4RIXB 3BV2A 5FXSA 2QC6A 3QQUA 4HGTA 3FZOA 4ACGA 5KO1A 4FV2A 4O83A 4GG7A 3V5QA 4P7EA 1H1RA 3QRIA 4ITIA 1K3AA 4YZNA 3VBVA 3BLRA 4ASZA 4F9CA 3CIKA 5ICPA 4IXPA 5AV1A 2CKPA 4WHZA 4ZK5A 4J99A 4YC8A 4XLVA 4AW1A 4BGQA 1H01A 5M53A 4HNIA 3A62A 2J7TA 4RVMA 3ZMMA 1ZYJA 1ZZLA 3DFCB 4JQ8A 4OTPA 5E8ZA 3UVRA 1XH7A 4CZUA 5CAUA 3R21A 3ORKA 4FKLA 3PXYA 3KK9A 4E8AA 4FTIA 4MD7E 5D9HA 3RCDA 1ZY5A 3A7HA 2BDWA 4QNYA 4TNDA 3QCXA 4TYGA 1R78A 2C6IA 3ZRLA 2W1EA 4F64A 3WYYA 4L67A 4ACCA 4C36A 5C8NA 3OP5A 3PA3A 3VRZA 2Z7RA 1B39A 3GXLA 3ZRMA 5LCKA 1OPJA 1XR1A 4MX9A 3W2PA 4B99A 3ULZA 2YWVA 5IQAA 2YZAA 5ACBC 1G3NA 2YCFA 3DBFA 4I24A 1V0OA 2GS7A 2QOHA 5ETCA 4MXYA 1XHAA 3LQ5A 2R3KA 2DYLA 3D0EA 1FVRA 4B8MA 3TUDA 2W06A 3D2KA 4NT4A 2UUEA 2GQRA 2BTSA 3ORTA 3LCKA 3LIJA 5DYJA 4IWPA 4IAKA 4YSMA 4EH6A 4MD9E 2A27A 1K2PA 2HELA 2HENA 3UIMA 4X2NA 2ZVAA 2C3JA 3SG9A 3E93A 3HEGA 3Q4UA 3CBLA 1SM2A 3EQCA 4HVSA 4IAFA 3PDTA 2WMUA 3OS3A 4LV5A 2XK8A 1TQMA 1YXUA 3BIZA 2XBAA 3BV3A 5KHXA 4YNOA 4E4XA 4S33A 3I7BA 2XVDA 3NS9A 3D14A 3UMWA 4FI1A 4K1BA 3IPHA 4CV9A 4I21A 3DKCA 4IMYA 4Z7HA 4CG9A 3CPBA 2ITQA 1GZOA 4UXQA 2ZB1A 3OCTA 2QVSE 3Q5ZA 4V05A 3QAME 3RHXA 1XH8A 3FMDA 3MDYA 3Q3BA 4QQJA 4OAVB 3VBTA 4Q9SA 4BN1A 1AGWA 4ZY5A 5E9EA 4D4YA 4KKHA 3BQCA 2WQMA 3CY2A 2GSFA 1WBPA 4CFFA 3G0FA 3DT1A 4UWCA 4U44A 3QA8A 3TJCA 3K5UA 3AC5A 3TNPC 2ZOQA 3QRKA 3SQQA 4FSRA 2OG8A 3FMJA 4O91A 3BBTB 4CKJA 2VTTA 4QMYA 4IACA 5BMSA 4YZCA 2W7XA 3N9XA 5HG8A 4EQMA 2CJMA 3DKOA 3PRIA 2R0UA 5HLNA 3V6SA 5JFXA 1YVJA 4R78A 4NH1A 5B7VA 5A4CA 1ZAOA 4IZYA 2PVMA 2B52A 5IPJA 4F1TA 4O7TA 2YJSA 4F70A 4CRLA 3TXOA 4FTRA 3F3WA 3DPKA 3VIDA 1PMNA 2HK5A 4KSPA 4QPMA 4BDCA 4BR3A 2R0IA 4MXZA 3GCVA 3EFKA 2X4ZA 2X2MA 4CSVA 3DBEA 4IANA 4RLKA 4H36A 5IH6A 4A07A 5HTCA 2RFNA 3LCTA 2XK4A 3KC3A 4Q5HA 5DNRA 3ZEWA 5JKGA 2JDRA 3KCKA 3MFRA 3VW6A 4I6HA 2H6DA 3PXZA 3U9CA 3R71A 4FZFB 5K0XA 3QHRA 5ANIA 5HNGA 3D83A 3F9NA 4ZTHA 5DMZA 4BCOA 1WBSA 4FIJA 3KXHA 4ERWA 3AQVA 5BUIA 5CNNA 2PL0A 3HLLA 2GNIA 4K77A 5KMIA 4FNXA 5E7RA 3PYYA 3E5AA 1Y6AA 4DEIA 2CSNA 4EWQA 4O0TA 2KULA 5CQWA 3QTZA 3VUGA 4FTOA 3QC9A 3MIYA 5EK7A 5FQDC 3E8CA 4L7FA 5IZFA 5JZJA 3QA0A 5CVGA 4C61A 1B6CB 5DLSA 3AXWA 4YUQA 2BKKA 4DG0E 3QCYA 3LFCA 2JAVA 3PIYA 2YM5A 1JSTA 5G6VA 3B2WA 3ZXTA 3DBCA 1YI4A 4FUYA 4M67A 5L2IA 4L01A 5CNOA 3OXTA 4AZSA 2VRXA 2BZHB 3I7CA 3C0HA 4J53A 5E8XA 4OT6A 4XP2A 4U3YA 3R8UA 4AWIA 3G33A 4ZAUA 2VX1A 4YHTA 1RQQA 3F2NA 2JIUA 2WOTA 3R7GA 1BMKA 5AAEA 4CMOA 5L6WL 4IZ7A 3C4WA 4HGLA 3P1AA 3P5KA 2ZV7A 4LMNA 4KSQA 3UG1A 2OSCA 4AGCA 5CSPA 2Y6MA 3AT4A 3D5UA 3ZFMA 3RMFA 4YJNA 4AA5A 5D11A 1ZMWA 3ZM4A 5AFVA 3QTQA 5KMJA 4DLIA 3UNJA 3FDNA 5L2WA 3CGFA 4FT5A 3BE9A 2ETKA 1PYEA 3AGMA 5AP7A 3VWAA 4RX7A 4CFXA 5HVJA 2QD9A 2XBJA 3QQLA 1A48A 2C3KA 2UW3A 3BLQA 4EHGA 3KQ7A 4C4HA 4ZLZA 3IW4A 3C5IA 4PTEA 2ITWA 5K5XA 3OD6X 4FKOA 3N51A 4B8LA 3N4UA 3GC8A 4FBXA 4F4PA 4E4LA 3P4KA 4QQTA 5LMKC 2X0GA 3FY0A 1XH4A 3QD3A 2ITXA 2YLEA 3KKVA 3MVLA 4MVFA 5CVFA 3L8SA 3Q9ZA 3QYZA 5HX6A 4EJNA 4L43A 4UALA 4XV3A 2QKRA 4XBUA 4ZZMA 4NSTA 5BYLA 5EW8A 4TW9A 4RVTA 3VS5A 3LXKA 4LUEA 4YJVA 3OXIA 5D7AA 4E4NA 2VWUA 4M7IA 3QKLA 4FVPA 1SNUA 4FT0A 2IVVA 2PWLA 2WMAA 4TYJA 2BRNA 3BHUA 2V0DA 5B0XA 4CTBA 4EOQA 4CT1A 3OT3A 3QQGA 2ITNA 4N57A 2EWAA 3F7ZA 3IW8A 3Q04A 4XP3A 2WMTA 2C6OA 5TR6A 3UBDA 3NUNA 2GTNA 2BZIB 3BEGA 4IADA 4H3PA 4AZVA 1OIQA 3BU3A 4K33A 3U8WA 4TY1A 1V1KA 5HESA 3WZJA 4M97A 4P4CA 4ZZOA 2OXXA 3Q60A 1YHSA 5AP5A 4I5PA 1WBNA 5CEQA 3UO4A 2GFCA 2VD5A 4JDKA 3VAPA 5J7BA 1H1WA 4ZJIA 4JAIA 5E92A 3W32A 1OB3A 2WELA 5HE2A 1Z57A 3A4OX 5LMKA 1SVEA 4KUJA 1FMKA 2BAQA 5A14A 1DM2A 3SX9A 4N6YA 4BCQA 2OF4A 3LAUA 4CCBA 4DTKA 4PDPA 5HVKA 4FYOA 5AEPA 2HZNA 2UW4A 3KB7A 3QUEA 4XNEA 4QP2A 3MGYA 1AQ1A 5H8GA 5HQ0A 4AGUA 3BQRA 4EH5A 5L2TA 3EKNA 2HAKA 4LQMA 4QNAA 4UB7A 4QYGA 4X2KA 3MVHA 3DCVA 2IW8A 4DFZE 3A7GA 3I79A 4NU1A 2ZV8A 4RPVA 3WI6A 3ZC5A 3UZTA 3RK9A 1H00A 4NJ3A 3EN6A 1IA9A 2CNVA 4OTFA 3DK6A 3P7AA 5JGBA 4IFCA 4ONAA 4BDKA 4RJ4A 3COIA 4C62A 4EI4A 5FDPA 4FZAB 4C8BA 4PNKA 5JH6A 2F57A 3GFWA 2YAKA 5AP6A 3D15A 4XRLA 1J3HA 4IVCA 4AGWA 5EW9A 3E7VA 1Q8TA 4NEUA 5IQBA 3U6HA 3R63A 2YDJA 2JD5A 4FKSA 4BZOA 5CSVA 2XNMA 3DBDA 3ROYA 4EH9A 4O0UA 3QC4A 3L8XA 5CEIA 4RG0A 4C33A 3EFLA 4DCEA 3U6IA 3L9PA 5K9IA 2WKMA 4L3JA 3NDMA 3I6UA 4DH3A 4GYIA 2IZUA 4ZTSA 3E92A 2OIBA 2OI4X 4R6VA 3I0OA 3NAXA 5EI2A 4F6SA 4C57A 4DFXE 4FL3A 1REJA 4D4VA 4E6CA 5JFWA 1KV2A 2WMBA 4QMMA 2I0EA 2J0JA 2O5KA 3JS2A 4O38A 4N70A 2VO3A 4CFWA 2W5BA 2Z02A 2VNWA 2ITZA 4TTHB 4J7BA 4RX5A 4FTCA 1NY3A 1GZ8A 1I09A 4QTEA 4R5YA 1UWJA 4IVBA 4CQEA 3NNXA 2F4JA 4M66A 2FVDA 4WSYA 1NVQA 4NW5A 2Z8CA 2JFMA 4AZEA 1VZOA 3FQHA 5B2KA 2WHBA 5FG8A 3DXQA 3DDQA 4LRKA 4FF8A 2HIWA 3COHA 5CU2A 5FTOA 3COKA 4FG7A 5AP2A 3HMPA 4YBJA 5HE3A 4YO4A 2B9IA 3HNGA 4GK3A 5I5ZA 4O7VA 3KVXA 4BI0A 4FT9A 5BUJA 5DWRA 3PPKA 1R0EA 2BVAA 4XBRA 4V0GB 2OFVA 3BX5A 3VHEA 1YHVA 2WTWA 1UNLA 3FLWA 5AUVA 1OITA 4U97A 5ANDA 3ZDIA 3UNKA 4MAOA 4CTCA 2PK9A 2QCSA 1U5QA 5CWZA 4WG3A 3NNUA 4GIIA 4BTFA 4AOJA 4IX3A 5HCYA 5H2UA 4DEBA 4G9RA 2R3IA 4Y83A 4IX4A 4I0TA 4Y8DA 3R8MA 4ORKA 4A9RA 4DBXA 1ZYCA 2I40A 2OGVA 1WFCA 4EC8A 1PKGA 3SC1A 4YJPA 3S2PA 4BCFA 2WMSA 2OH4A 3OTVA 3QLGA 3WIGA 1PMVA 2B9FA 2BDFA 4R1VA 4WNOA 4ZOGA 2C1BA 3C50A 3NIEA 4HVDA 4EOIA 3E87A 4DH7A 5J1VA 5BX0A 1WVXA 2W05A 4JLCA 3DJ7A 5T68A 3UJGA 5AIKA 3RPOA 3A7JA 4FIIA 1JBPE 3JPVA 4OTRA 4ALVA 4ANBA 4S2ZA 3BKBA 3R02A 2W1GA 3DQXA 1DI8A 2PE1A 3QKMA 3ENMA 3QQHA 3NWWA 3R9OA 3ALNA 3A7IA 5HGIA 3WARA 4LOQA 3ZXZA 2J9MA 2PZ5A 3F5GA 3R7YA 3DJ6A 1A9UA 4JIKA 2E9UA 2IW6A 4GVAA 2O65A 4YZDA 3ZDUA 4RIWB 4F7LA 3PSDA 3CC6A 5GZAA 4DT9A 2P4IA 3AT2A 4D2RA 4IAYA 2X6DA 3WZKA 4ZIMA 1YDSE 2J51A 2XJ2A 4FV3A 2XNNA 4WKQA 3NNVA 4ANMA 4A9TA 3QTUA 5IEYA 4P2KA 2CGVA 2QONA 4JBQA 4L6QA 4D9TA 3EWHA 1ZOHA 3ODYX 3DKGA 3QKKA 4W4WA 4YBKA 5J5SA 5L6OA 1IAHA 5EHLA 3C9WA 4QYFA 5FEQA 5IISA 3TEIA 4HCVA 5IQIA 5HIBA 4QP4A 1U4DA 3K54A 3D5VA 3VQHA 3WZUA 5GJGA 4L68A 3EQRA 3RCJA 4R7BA 4X7QA 5GNKA 5CEPA 3MFUA 2YZLA 5K4IA 2OJ9A 3H0ZA 4QTCA 3OEZA 3LMGA 3HP5A 4I6QA 1M7NA 3ORNA 4LYNA 4AW5A 4CMTA 5T6KA 5I9XA 1FINA 3VNTA 1XKKA 2YIWA 3ENHA 4JI9A 4OBPA 3RKBA 3P23A 5EQPA 2XNEA 2PZIA 3SHEA 1R0PA 4AE9A 4JG8A 4ZY6A 4TWCA 2WFYA 3OY3A 3ERKA 3HZTA 2P2HA 4QYYA 4W4XA 1YRPA 4FKTA 4C7TA 3L9LA 3EN9A 4D5HA 2QOQA 4ASEA 2WMQA 2JDOA 1T45A 2BR1A 4BDGA 2IPXA 4A06A 4IX6A 4X6QC 5BVKA 3VUMA 4FV6A 2PHKA 3VHKA 3LMHA 1UKIA 2PMIA 5C26A 3ALOA 2HW7A 3MB7A 2YM8A 3DXPA 3CPCA 4X0MA 3QL8A 4ASDA 1ZYDA 2E2BA 4L00A 2Y9QA 2JDVA 3B8QA 3O2MA 5K4JA 3K2LA 4RFMA 3BLHA 2QR8A 2PYWA 3FWQA 4FKQA 4Y72A 3POOA 1KUTA 4YTCA 4AT3A 2C6EA 1OUYA 2AC5A 4S32A 3A4PA 5IKWA 4IM2A 3C0IA 2LGCA 3DTWA 5J8IA 4F08A 4F09A 4UWYA 5DT4A 3PJ8A 3EQHA 4O21A 5A54A 3FHIA 5GZ9A 1LEWA 5EH0A 1OGUA 5KMNA 4KINA 4EK4A 3RP9A 4D58A 1WVYA 3IOKA 4GKHA 1H0VA 2XKDA 3TCPA 3HRCA 4RC3A 2W1IA 3BHYA 3C4XA 2C69A 3GENA 4U42A 2R4BA 1JKSA 1GIHA 2BPMA 3PWYA 3RAWA 3TNWA 3BGQA 3SXSA 4OLIA 4RJ7A 3LFSA 4XOZA 4M15A 5LOHA 4YC3A 4PP7A 2GPHA 5BVOA 4QMZA 1H07A 4C4GA 5IA2A 5I3OA 2YA9A 4ZTRA 3T9IA 1Y91A 1CKPA 4LRJA 4WBBB 3SRVA 3WF6A 1IAJA 1WVWA 3FQSA 3PE1A 1GZKA 1JSUA 3LJ2A 5GIOE 5HVYA 4AZTA 4BIDA 4DH8A 2Z60A 2PVNA 3BRBA 3ZOSA 3UVPA 4DGLC 4MBLA 3BU5A 3JVSA 5EKOA 2BUJA 2XK6A 3RJCA 4O27B 1CMKE 5DN3A 2CKOA 3CSVA 3ZHPC 2VTAA 3ANRA 3HV6A 3EZRA 3VBYA 3BWJA 4BCHA 5LWMA 3DJ5A 3NW7A 4TWPA 5HO7A 4JQ7A 4FSQA 2IVSA 4EZ7A 4RIYB 1T46A 4XOYA 4TYHA 1YOMA 1NA7A 3QTSA 2RGPA 3WYXA 1XQZA 2O2UA 3WF9A 4YSJA 3D7ZA 4WG5A 4YPSA 3DK7A 3ZZWA 4ZSAA 4RWIA 4PDYA 2VAGA 5DH3A 3TG1A 4KNBA 4WSQA 3IG7A 2G2FA 2IZRA 3P0MA 4MQ1A 2C47A 5C01A 4YJUA 4YLJA 1RDQE 4MWHA 5HIEA 4ZSEA 2WU7A 3EQBA 3KN5A 4O7WA 5HLWA 1GY3A 1EH4A 4EYMA 3IGOA 3BI6A 1E9HA 3FPQA 3UPXA 4G6LA 1H1SA 2C5YA 2QOOA 3IW7A 4IH8A 4BF2A 3Q9YA 3SW4A 5I3RA 2OKRA 3PY3A 3WIKA 3SXRA 1APME 3NCZA 5EHOA 3LKMA 3VS7A 4JS8A 4Y73A 3S00A 1TKIA 4E6QA 4YC6A 2IG7A 3FBVA 5JN2A 1YXSA 3LQ8A 1H27A 4I20A 4XV9A 5JGAA 4X3FC 3TZ8A 1WBWA 3FLNC 1Y8GA 3BCEA 3U54A 4MTAA 2ETRA 3BU6A 3EB0A 4MXAA 1BX6A 4ZLOA 4EORA 1KE6A 4ACDA 4NCTC 3FAAA 4FV8A 2XNGA 2I0VA 3PLSA 2UZOA 5IU2A 3GU5A 4DGGA 1M2RA 5AX3A 1J1BA 5ETFA 4IW0A 2FO0A 3VJOA 2YERA 5LVMA 3R1SA 5CF5A 3E8EA 2XM8A 4FICA 4B7TA 4BCMA 4CZYB 2BMCA 4FT3A 5KBQA 4XJ0A 1GZNA 3TTIA 1J7LA 3O8TA 1IA8A 3KXMA 1UWHA 3ELJA 4FSWA 4ACHA 1LPUA 4I5CA 4GCJA 4PV0A 4EK8A 4FODA 5HCZA 5KMKA 2P55A 4EHVA 4DFYA 3PVUA 4KBKA 4EKLA 3MVMA 4O2ZA 3OXZA 1UU3A 2OJFE 4IVAA 4U8ZA 4JIAA 4QMOA 5KNJA 4O7SA 4QPSA 4TWOA 5E91A 3CY3A 4ZS4A 4JL9A 2WXVA 4D2VA 3NPCA 4JBPA 1M2QA 3KRWA 4BYJA 4D2WA 1KV1A 3UYTA 2PE2A 3TM0A 4EH7A 1PMEA 2WQBA 3KULA 2WMXA 4X3FA 2JC6A 5IQGA 1ZXEA 2EXCX 4NKSA 2BHHA 2XRWA 3NEWA 5A3XA 3ZO2A 3OZ6A 5BVNA 3ZSHA 4E20A 4USEA 3U4UA 3A60A 2H34A 2R3RA 4FVRA 2RIOA 4GT3A 4EL9A 2UVZA 1W0XC 5FBNC 1PY5A 2GHGA 4EOJA 5CEMA 3KN6A 3VQUA 4O0SA 3GCSA 4X3FB 2VTJA 3MH1A 1QPCA 4KRCA 4M69A 4NCTA 4B0GA 4L3PA 3GCUA 2QU5A 4FZ7A 4MNEA 3UO6A 1JKTA 2OZAA 2R3OA 2W4OA 3TZ7A 3FZPA 3JYAA 4L42A 5J9LA 3TZMA 4HGEA 5IDNA 3OWKA 2W9FB 3JY9A 5EM6A 4FV7A 4MD8E 4DH1A 3CEKA 3JVRA 5F9EA 3R28A 1BI8A 3A8WA 2W99B 2FB8A 2YWPA 2QOIA 3OG7A 3VF9A 3LXPA 2W4KA 3CJFA 4FEWA 4AG8A 4NM7A 3VO3A 4UZHA 2XS0A 3NVKI 1H4LA 3FXZA 4GW8A 4APCA 2F9GA 4HW7A 4YJSA 5LQFA 4FTNA 3IDCA 5HORA 4DYMA 4C59A 5L2SA 2I7QA 5CU4A 3ZUVA 2VTNA 2YM6A 4FSZA 1YQJA 4FKWA 3QUPA 4AN3A 3HV7A 2A0CX 4Z9LA 4OT5A 2CNUA 2GNFA 3LFEA 3F3ZA 4DCAA 1H08A 1S9JA 3NX8A 3LFAA 3FKLA 4ZXTA 4Q9ZA 2F49A 2PVRA 2WTJA 3LLAA 4RFZA 4O7RA 1E1VA 4HYSA 4CRSA 1S9IA 2WU6A 4UMTA 3UC4A 1PXKA 2VWVA 2XH5A 4GJ2A 5BYZA 4KBCA 4O0WA 3WBLA 1VJYA 2RG6A 5CSHA 5J87A 3F2AA 5DE2A 2ITPA 4MHAA 3E3BX 3BHTA 3C0GA 3R1QA 3V8TA 4HZRA 3VC4A 4QMQA 4P90A 4GK2A 5L8JA 5LMAA 4FEXA 4L46A 2NO3A 5J5TA 4NM3A 4IWOA 5EYDA 4EOMA 3W33A 1QL6A 3PE2A 2WQEA 4HPTE 4PUZA 3UQFA 4E4MA 4F63A 4FTJA 4L52A 2E9OA 4PMMA 4QYEA 3ZC6A 4N0SA 3CJGA 4BDIA 4O1PA 2A4LA 2SRCA 4F99A 5LCJA 4BDEA 1LP4A 4YTFA 2WEIA 5CEKA 4TWNA 5BNJA 3UP7A 4YJOA 1SZMA 2BRBA 2C0TA 3FMMA 5IDPA 2C6MA 1SNXA 3E63A 4V01A 1B38A 4QQ5A 2XIXA 3H3CA 3Q5IA 3P08A 4NK9A 4ASXA 4C37A 5IH5A 4YZ9A 3MI9A 3MS9A 4FYNA 3QGYA 3ZO4A 1YWVA 1GIIA 5A4TA 4CFVA 3A99A 4O7ZA 3D94A 2ITUA 3NUUA 5HI2A 2CGWA 3Q6UA 1PJKA 4PMSA 3UGCA 2JIIA 4BRXA 4Y46A 4ZSGA 2JKMA 5E8YA 1PW2A 5AUWA 1PRYA 5EQEA 3ZBXA 1AD5A 2ZB0A 1OIUA 1GNGA 4F9BA 3R0TA 4O1OA 3PY1A 4O96A 3AT3A 4C2VA 2XJ1A 4FTAA 5J7HA 1YWRA 4FKUA 5AA8A 4CZTA 2PTKA 4FKIA 5KUPA 2O64A 4UBAA 2R2PA 3VUIA 4E5BA 2BAKA 4Y5HA 4CD0A 1A06A 5JRQA 3GP0A 3KF4A 3GC7A 4MF1A 4ENYA 5JK3A 2ZJWA 3MTFA 2QURA 4F6WA 4AOTA 3CS9A 4TN6A 3UOHA 4GKIA 1SYKA 4R3PA 5K3YA 3BYVA 5FM3A 4C58A 5M4FA 1NVRA 3O8UA 2XIRA 4Q5EA 5HG7A 5GINE 4N6ZA 2FYSA 3EKKA 3GCPA 3MPAA 4JDHA 3UQCA 3KVWA 3FC1X 4E93A 3PWDA 4K6ZA 3U51A 4L44A 4F1OA 4ANQA 4JVGA 5EI6A 4ZMEA 3IW5A 4XHKB 2UZNA 3H9OA 4AA0A 3DB6A 2WTKC 4JDJA 5H9BA 3GCQA 3EMGA 2BIKB 4X2GA 1G5SA 3GBZA 2KTYA 3JUHA 3O7LD 4RIOA 3MFTA 1F3MC 5DBXA 4RWJA 3ORZA 5CZHA 5M06A 5AUUA 2UVXA 2A1AB 2ACXA 4K2RA 4M12A 5M09A 3RPYA 1OKYA 2JLDA 2B0QA 4BTJA 4J96A 1JKKA 5DGZA 4QP1A 1OL2A 3W18A 5M4IA 3OEFX 3UPZA 3OC1A 2OFUA 4UYAA 4DAWA 3TNHA 3LQ3A 4IZAA 2H8HA 4IJPA 4EOSA 3CTQA 4EUUA 5M51A 1OPKA 2ZDTA 3EFJA 5AR4A 5IUIA 4X21A 4E6DA 1OZ1A 3CQWA 4PQNA 3DTCA 4FZ6A 3T3UA 3HVCA 4CFUA 4DH5A 5HNIX 2XNPA 3S4QA 4QMUA 2UW6A 4AN9A 5M44A 4EOPA 2OXDA 4TZRA 4ZS0A 3UG2A 3QXPA 2A2AA 4BIBA 1U5RA 2ESMA 2EXEA 3R6XA 4NTSA 2IZSA 4M0YA 4FEQA 5AR3A 4I41A 3C7QA 4AXAA 5JFVA 3R7IA 3SVVA 2C6LA 3QQJA 4XG3A 1CTPE 4YLLA 4EH8A 5IF1A 2BRMA 1W83A 5BPYA 5CF8A 5IMXA 1ZRZA 3ZH8A 3BZ3A 5DEYA 4AW0A 2RFEA 5H3QA 4CKIA 2XCKA 3BEAA 3QALE 4RZWA 3FUPA 3SOCA 1QCFA 3MV5A 4HOKA 2G01A 4ZTMA 3UOJA 5L8KA 3QHWA 3RGFA 5J79A 4IVDA 3TKHA 4G3CA 3WZEA 5A6OA 3LFBA 3ID6C 1NXKA 4CT2A 4ENXA 2WOUA 5FM2A 1H26A 1R3CA 4R5SA 3ACKA 4EH2A 5IQCA 4ZY4A 2GQSA 2GNHA 1ZYSA 3B2TA 3A2CA 4KA3A 4YTHA 3RZBA 3IS5A 1TQPA 3QYWA 3V8SA 3PA4A 4FV4A 2VU3A 2GHMA 3KL8A 4JJRA 3RALA 4DC2A 2UZWE 4DEAA 2C3LA 3OY1A 2Y6OA 4PL4A 3ZS5A 4TKSA 3NUPA 1JNKA 3O17A 2IW9A 3KXXA 4J8MA 5DG5A 1Y6BA 5EM5A 4BWPA 2VTHA 5FP6A 5GJDA 3NMUF 4D28A 3I5NA 4M8TA 3ZUTA 5M08A 5H8EA 2J0MB 2R7BA 4UY9A 2XIZA 2HOGA 3HMNA 2WZJA 3PVBA 4X3JA 1W8CA 4J95A 4MH7A 5EYMA 3DAJA 3E88A 4AT4A 3QD2B 1Q97A 3MSSA 4DG3E 1OL7A 5KMMA 2C68A 2VN9A 3TTJA 5ITAA 3TACA 2BDJA 3CQEA 1OPLA 2WB8A 2XIYA 4AN2A 3DK3A 4N4SA 3LFQA 1LUFA 3RNIA 4C4FA 4DGMA 3G5DA 3KRJA 4IFGA 2FSMX 2R3GA 3Q6WA 1KSWA 1Q3WA 3RK7A 4Q2AA 5IEXA 5GHVA 1K9AA 4GYGA 4EZ5A 1XBCA 2XK7A 3LXLA 2ONLC 5HD7A 2JEDA 4UMQA 2QQ7A 3FKNA 2UV2A 3MB6A 5CU6A 4WRSA 3R8LA 4E26A 2X81A 4FG9A 1OIYA 3P7CA 2P0CA 3CKWA 2X7FA 3GC0A 5AUZA 3DKFA 3EQDA 3Q4TA 2OLCA 4I92A 1KOAA 2G1TA 3R7EA 1L3RE 4U3ZA 4EOKA 3C1XA 5DT0A 2WMRA 1JAMA 4BCGA 2W96B 4XG9A 5AWMA 4F9YA 4J52A 5BVWA 3AOXA 4PP9A 5CZIA 4B6LA 3AG9A 3M11A 2BCJA 2V7AA 4MNFA 1M2PA 2RL5A 2IN6A 3VUKA 4BKYA 3IDBA 4FKGA 2CGUA 5HX8A 2YLFA 5AM6A 4A9YA 3Q9WA 5DRDA 5AR7A 3QRTA 4HVGA 3KRLA 4PTCA 1Y8YA 2JGZA 1MQ4A 3II5A 4GU9A 4CKRA 5HU3A 1YXVA 2BILB 2R7IA 3ZLSA 3TV7A 4MXOA 3ATSA 4I94A 3RWQA 5KHWA 5HG5A 2W0JA 1P4FA 4L3LA 4P5ZA 4D1ZA 5D41A 4NIFA 2X1NA 3IW6A 2WMVA 2R3HA 1MRVA 4MXCA 3SD0A 4DG2E 4HZSA 4XG2A 4AQCA 2J4ZA 1UKHA 3UC3A 4DEDA 1Z5MA
chains in the Genus database with same CATH superfamily
4FIGA 4LGGA 1Q3DA 3MBLA 1KE8A 3BGZA 3PXKA 4KIPA 2PY3A 2VWIA 5KKRC 3UIXA 3Q2JA 4FC0A 1H1QA 2ONLA 2QO2A 3KY2A 4U7ZA 5D12A 5AX9A 3E62A 4FSMA 4RA5A 4D4SA 3KK8A 5CAQA 4L7SA 5AP4A 3V3VA 2JAMA 2J50A 3E8NA 1F0QA 1ZZ2A 4XX9A 2Z7QA 2QO9A 3O51A 4XCUA 4RWKA 3QTWA 3HUBA 1O9UA 1FVTA 2XNBA 2FA2A 3G2FA 2ETMA 3F88A 2BRHA 4JDIA 5E8UA 3W10A 3EIDA 4FTTA 4ANOA 5HE1A 2VTRA 2VV9A 2ZAZA 1M52A 3EHAA 3ZYAA 4DE4A 1MRUA 2XALA 1XWSA 2BRGA 4QPAA 1U54A 2VUWA 2XNOA 3AGLA 2R9SA 3KMUA 4FK3A 1LEZA 5AUTA 4RQKA 5C8MA 3HDNA 3QXOA 4GK4A 5JT2A 3T9TA 1PF8A 2W1FA 3AC2A 2W1CA 1FGKA 2IEWA 3PP0A 5CF6A 4F7NA 1GOLA 1BI7A 4FL1A 2A19B 5EOLA 5HG9A 2VWWA 1G8AA 1TFFA 4QEBA 1UU8A 3DQWA 3R01A 4H3QA 3GEQA 1OGYA 4FTMA 3CD8A 4OW8A 4C4EA 4FRFA 3KMWA 1RJBA 4RJ6A 3CD3A 5IA3A 2X8DA 3QX2A 5EM8A 5CANA 4KS7A 3UDSA 5M55A 3GFEA 3R8ZA 4BHNA 1URWA 3F5UA 4O4DA 4A7CA 1PMUA 4AZWA 1IR3A 2PUUA 3B8RA 3O96A 5E8TA 5FEDA 1GAGA 3P78A 5ETAA 3ZBFA 4C3FA 4FUXA 5DR2A 3DB8A 3BBWA 2EVAA 5EDPA 3TIYA 1H8FA 2VO7A 2G2IA 3V5TA 2C5NA 4AE6A 3RVGA 4IDVA 3QCSA 4NYEA 3GQIA 3WF5A 3GQLA 5KBRA 4FTKA 4BYIA 3AC4A 3GU8A 4M3QA 4WIHA 3DOGA 5EDRA 3RINA 3UP2A 4IC8A 2Y8OA 3W1FA 2FGIA 3NLBA 2VGOA 1PHKA 1WBTA 4OUCA 5CY3A 5LVOA 4LMUA 2DQ7X 2X7OA 5E90A 4RC2A 4FTLA 4JRNA 3IONA 4AX8A 3HV4A 4G9CA 1QPDA 3W16A 2DUVA 4EC9A 2OXYA 3JR1A 2VGPA 3FLYA 5DRBA 4BTKA 5IA1A 1PYXA 2UZDA 3JY0A 2QI8A 2VX0A 1ERKA 2XYUA 4NM0A 4USFA 2ZDUA 3VS2A 2JBPA 2CN8A 4GRBA 4NWMA 2JFLA 5C1QB 3W0SA 3EQFA 3Q53A 1Q62A 2ZMDA 1BKXA 4CVAA 2GFSA 3CCNA 3QZIA 2HY0A 5BQ0A 5L3AA 4I3ZA 2XRUA 2FH9A 3BHVA 4M13A 1X8BA 3UZPA 4I1ZA 2Y4IC 3PPZA 4LGHA 3UYSA 4EYJA 2R64A 3RZFA 5TKDA 3W55A 2CLXA 1YW2A 4F0GA 4L8MA 3Q2MA 4OBOA 2YCSA 3HECA 4F0IA 4C02A 2XKEA 3HMMA 1PXIA 4ITJA 4W9XA 4YO6A 2ZYBA 3C5UA 2E9NA 4UXLA 1FQ1B 5J95A 2GNGA 2CMWA 2OH0E 3R7VA 3VBXA 5IH4A 4DHZA 1U59A 2GNLA 3UIUA 5K0KA 3R9NA 2ZM1A 5BYYA 3AMBA 3S1HA 2R3QA 2JKQA 1XMMA 1CKIA 2B53A 3W2CA 4BI1A 4BDDA 1FGIA 1IG1A 4CCUA 1QMZA 1WBOA 1WZYA 3P5JC 3R00A 5HO8A 5DPVA 4Y95A 1URCA 4PDOA 4H3BA 1JPAA 4QMPA 2J0IA 4U6RA 3I81A 4M84A 2XJ0A 5LVLA 1ZYLA 4FGBA 3FSFA 4O7NA 4HCTA 2C3IB 2GMXA 1JSVA 3KA0A 3OCSA 4EOLA 3FXXA 2UW9A 3NGAA 4XUFA 4IAAA 2UW5A 4AW2A 1BUHA 2CPKE 4JBVA 2V55A 1ZARA 1YDTE 3MH2A 3FLZA 4GV1A 4NUSA 1H25A 2EB3A 3QQKA 5KE0A 2C30A 3UOLA 3MPTA 5CXHA 3AD4A 2HZ0A 1QPEA 3I5ZA 3PP1A 1H28A 2GHLA 5IQHA 1VYZA 1O6KA 4LL5A 2B4SB 3PZEA 3R2YA 4G34A 4EBVA 3AC3A 1J1CA 3I1AA 4LGDA 4MBIA 4G3EA 4F0FA 3CXWA 4O81A 4HNFA 1HCLA 2HW6A 5AR8A 2WMWA 4CLJA 3RI1A 4GIHA 5CEOA 3M2WA 5L2QA 2PZYA 3RAKA 3QX4A 3IGGA 3AC8A 4KIKA 4U45A 4UYNA 3UNZA 1OBDA 3NYVA 3NYOA 1PXMA 4BDBA 2WQOA 4BDAA 3KXZA 2RF9A 4QMNA 4Y85A 1F5QA 3HYHA 3F3TA 4BIEA 3OTUA 2XYNA 4O4CA 2QG7A 3PPJA 1ATPE 3KF7A 4RJ3A 5AUYA 1YWNA 3UTOA 3FI2A 3LMIA 2YDKA 1DI9A 3EH9A 4F9WA 3SRVB 4JOAA 2JBOA 2OIQA 3OOGA 4YJRA 4BICA 5AP0A 5J1WA 3Q52A 1YDRE 2JITA 3OROA 5HKMA 2XCHA 4WNPA 3Q4CA 3LW0A 4MCVA 5A9UA 5CF4A 4O82A 5FXQA 5IEVA 1W98A 2B54A 4FSNA 4BDHA 2XP2A 4QTBA 5I9UA 3KFAA 4IIRA 4UX9A 3GUBA 2VTSA 2PUNA 3QTRA 4U0IA 1M17A 2X8IA 3F66A 3THBA 3QRUA 5AV2A 3ZLXA 3G6HA 2WAJA 3OUKA 2OJIA 2X6EA 1RW8A 2C6KA 2VWXA 2BZJA 2Z7LA 2XIKA 3FMNA 4OTIA 3FXWA 3TT0A 2G2HA 3KRRA 2PMNX 2XMYA 3QQFA 4JR3A 4TYHB 4YHFA 5EYCA 5TE0A 3SAYA 4D0WA 3KXNA 5LARA 4FEUA 4DDGA 3F69A 3H30A 4MF0A 4ZTNA 2QKWB 1M7QA 2PVJA 3JXWA 4IC7A 2XK3A 3HRFA 4RT7A 1V0PA 5AIRA 5AA9A 2BALA 5HTBA 3I6WA 4O0RA 2ITOA 3AD5A 4C34A 4F1MA 5DFPA 3LVPA 4I4FA 3IDPA 4XG7A 2RFSA 2VTQA 4J97A 3GB2A 2YM3A 3ITZA 3NR9A 4G3GA 3KXGA 5AV4A 1IEPA 2O8YA 3QZFA 3QZGA 4GJ3A 2VWYA 1CDKA 3R1YA 5HE0A 3VW8A 4HGSA 4IB5A 5CSXA 3FZ1A 1PXNA 4YJQA 4KS8A 5KMOA 3NYXA 4UEUA 1XBAA 2VO6A 3TV4A 5IQFA 3W0PA 3ATTA 5GZ8A 4QP7A 4I5HA 3RTPA 2CLQA 3AMAA 1DS5A 5CT0A 3HA8A 4IWDA 4XG4A 5E8VA 1UVRA 3CTHA 3ZFYA 4EONA 4BWXA 3F3UA 2YJRA 4LM5A 4G5JA 4K9YA 1JLUE 4WOVA 1Q8ZA 4OTDA 4AA4A 3CTJA 4E1ZA 4MBJA 1MP8A 2YIQA 4QMSA 5KX8A 3TNQB 1PKDA 1OL1A 5H8BA 3VF8A 3GOKA 4NL0A 3G9LX 4PY1A 1Q8WA 1HCKA 2F2UA 4S30A 3VUTA 3T8OA 5EKNA 2QOKA 3W2SA 2X9FA 1UU9A 2Z7SA 2Q0NA 3O50A 4WUNA 4XH6A 5ANJA 3VUDA 4C4JA 5DEWA 4WG4A 5HU9A 3SG8A 4XLIA 3UO5A 5JEBA 4ALUA 5JGDA 5D1JA 2YFXA 1OECA 3DNEA 3HMIA 4GFOA 4PF4A 3W8QA 5CTPA 3FMHA 5KCVA 4UMPA 2VTLA 1OKWA 4G3DA 4A9UA 2I6LA 4PPAA 3U4WA 3SKCA 4BI2A 4MQ2A 1STCE 2BIYA 5FXRA 3C4FA 3HUCA 3QGWA 3KMMA 2ITTA 3IO7A 3O0GA 2HWPA 4FV1A 4LUDA 4GU6A 5TT7A 4YZMA 3MTLA 3OW3A 3QBNA 3QU0A 5C9CA 4GG5A 3FMLA 2O3PA 2QLUA 4TYIA 4F65A 4JNWA 1OI9A 3AKJA 4IB3A 1ZWSA 3PJ2A 3MJ1A 3OHTA 4IDTA 5M57A 4DA5A 4GSBA 4RIXA 4U41A 4O22A 4F7JA 2PMOX 2DS1A 3KULB 4OR5A 5I0BA 4H39A 4WNKA 4UWBA 5JQ8A 3GC9A 1JOWB 4C38A 2CN5A 4JAJA 5G1XA 5JRSA 5HTIA 1BYGA 1PXJA 4I93A 1YXXA 3ORLA 3FMEA 3TV6A 3W0MA 5HOAA 1W84A 3L9MA 4M69B 4CG8A 1Q99A 4MNEB 2OZAB 1M14A 4TRLA 4BCPA 4OGRA 4AXCA 3OOMA 2Q83A 4J71A 4RX9A 1Z9XA 4S31A 2O0UA 4H58A 3Q4ZA 3BHHA 4FKJA 2CNQA 4KIOA 4RFYA 1XJDA 3CR0A 4UMUA 4PPBA 2ZV2A 4XP0A 5AP3A 4W9WA 2C6TA 5AUXA 3PXRA 4IB1A 3BELA 5CLPA 5DT3A 4AFJA 3GU4A 4QD6A 2PPQA 2WQNA 4CFNA 4YR8A 3ZU7A 4EZ3A 4DEEA 4R7HA 2PU8A 4O6EA 3DFAA 2R3MA 4NFNA 3WF8A 4E3CA 1Y57A 3ZM9A 4ZLYA 1P14A 5TF9A 4BC6A 3PXQA 2QHMA 4EHZA 5E1SA 4IB0A 3V51A 1MUOA 4BGGA 4BBEA 5FUTA 4AFEA 3DV3A 3HV5A 2OF2A 3M1SA 1J7IA 2QO7A 2F7XE 3VBQA 5EG3A 5LJJA 3NSZA 2QNJA 3HAMA 2P33A 1BLXA 1JQHA 3ZO1A 2VTMA 4XV2A 3A7FA 2YM4A 4O7YA 2XF0A 1UU7A 2V62A 4KWPA 3LE6A 1XO2B 3NAYA 4J8NA 4PWNA 3TZ9A 2QR7A 4FOCA 3V5PA 2O63A 5BVDA 2PVFA 1H24A 2PUIA 2EB2A 4Y5QA 3HDMA 4CFMA 2XKFA 5CYIA 4YHJA 4U81A 2W4JA 5I9ZA 4LRMA 2AUHA 2B55A 4A9SA 2GCDA 2RFDA 2IWIA 4E5AX 3SDJA 4BCJA 3W2RA 3PG1A 4OTHA 3FYKX 3N4VA 4FT7A 3S95A 5M56A 2ERZE 1NVSA 2R3FA 2W5AA 3KU2A 3R04A 4BBFA 5B2LA 4GEOA 4FZDB 4ZZNA 2V5QA 3EZVA 2RSVA 3DZOA 3UMXA 4R7IA 3RK5A 4HJOA 4FR4A 3LCOA 4ITHA 5C03A 3HX4A 5AR2A 1SMHA 2HCKA 3EQGA 4GT5A 4QOXA 2UVYA 3AC1A 4U43A 1E1XA 3R9DA 3CP9A 2QOLA 1ZMUA 4ANSA 5AAFA 2XK9A 4BDJA 3OFMA 2VX3A 4JRVA 2EXMA 3FJQE 3FKOA 2Y4PA 4I6FA 4XMOA 5CXZA 2ZV9A 3O71A 1W82A 4EBWA 3TWJA 4IM3A 2OICA 3BYMA 2OZOA 2W17A 4QP6A 3R1NA 4KBAA 3LHJA 4P5QA 3DAKA 2PE0A 4DTBA 4FE2A 2PVLA 2RG5A 4MWIA 4TL0A 5M07A 1Q41A 3QTIA 4U80A 4M0ZA 5CSWA 3UDBA 3NIZA 1DAYA 2I0HA 1OL6A 2C0OA 1P2AA 2VO0A 3PSCA 3QWJA 5HNBA 4QP9A 5M4UA 3COMA 4RMZA 5B2MA 3G9NA 3TL8A 2YEXA 4J98A 3MWUA 4KAOA 3GNIB 4B9DA 3TUCA 1PXLA 2HZIA 4GVJA 4F78A 3VULA 2EU9A 4YU2A 2PMLX 3FZRA 2J90A 2JDSA 2CKQA 3OF0A 3PG3A 2E9PA 4XG6A 4S34A 3EL7A 4IX5A 1ZLTA 4DBNA 4ZTLA 2NNWB 3TDVA 2V22A 4IZ5A 4O86A 4JT3A 3IQ7A 3U6JA 1VYWA 1ST4A 2CCIA 2FSOX 3BWFA 4OBQA 5FD2A 3OWJA 4RVKA 4OAUC 5E8SA 4W8DA 4AAAA 2YHVA 4ALWA 4DGNA 3C4EA 5F4NA 3RM6A 3T3VA 3LXNA 3OBJA 2QOCA 3EN5A 4O6LA 4QYHA 4TNBA 4Z7GA 4EK3A 4C0TA 4EQCA 3KREA 5HCXA 2CKEA 2F2CB 2Q0BA 5DA3A 4ZJJA 1WMKA 2WPAA 2CGXA 1W7HA 2QLQA 2HXLA 3D9VA 3EYHA 3MJ2A 3R7OA 3TNIA 4D2PA 1TQIA 5HBJA 4EJ7A 4GFGA 4GMYA 1HOWA 4W4YA 4Z3VA 3FZSA 3ZRKA 1Q8UA 3OWLA 4WD5A 1CSNA 3VS3A 3SXFA 2UW0A 1I44A 2X4FA 5A6NA 4RQVA 2XZSA 5J9YA 3K3IA 3BYOA 3DLZA 4TT7A 3V01A 3REPA 1FMOE 3POZA 4QMVA 4LV8A 3ZTXA 4R77A 3TUBA 3H4JA 2BHEA 5DR9A 3FZTA 4WNMA 4PL5A 4RZVA 4CNHA 5I9YA 4FSUA 4LL0A 2CCHA 3FLQA 5JMSA 4DTAA 3HP2A 3VS0A 3BYSA 1WAKA 4NM5A 3RBWA 4WBOA 1KOBA 5AADA 3F2RA 1VEBA 2PVKA 4FMQA 4JG6A 3ZLYA 3DXNA 3FPMA 5DI1A 5AAGA 4RRVA 3MY5A 2B7AA 5E1EA 3LJ0A 3WZDA 3NFGB 3TDWA 3Q32A 2WGJA 3LCDA 2X0PA 4ZJVA 3ORIA 3LM0A 5EM7A 4QP8A 3PIZA 2XEYA 3NUAA 2R3JA 4EK6A 1OVEA 4D55A 1O6LA 4GUBA 4QDEA 1RE8A 4KABA 1IASA 4DITA 3RPRA 3ZEPA 3R83A 3UVQA 3V6RA 4CV8A 3LM5A 4FKVA 2WTIA 3K5VA 5AV3A 3E7OA 4U5JA 3SGCA 5BMMA 4DN5A 5F94A 4YMJA 5HLPA 3TI1A 2E9VA 5EI8A 3ZONA 3FL5A 5CAPA 3HMOA 5I4NA 1YOJA 3IECA 2GTMA 4ID7A 3OUNB 5JZNA 2BROA 4RX8A 2OBJA 3OMVA 4CEGA 2J5EA 3DA6A 4QDVA 4AACA 3DZQA 4BL1A 2FUMA 3R7UA 3MA6A 4PL3A 2WTKB 4CQGA 4CGAA 2QG5A 3EOCA 2OO8X 4PMPA 3QCQA 3UE4A 2ZMCA 2YIYA 3NUSA 3DS6A 5L8LA 5AJQA 4D9UA 4DF3A 2I1MA 4EWHA 3ODZX 4EH4A 2VTPA 5KZ0A 4USDA 3VS4A 4L45A 4JBOA 4CYJA 4G16A 5CALA 1KE7A 4C3RA 3RM7A 2J6MA 5TOZA 3BGPA 4AUAA 3EYGA 5HHWA 3FEGA 5DVRA 5GJFA 5F1ZA 2G15A 4EOOA 2OW3A 2X8EA 4I0SA 3L8PA 4KKEA 4BZDA 3ZLWA 5EDQA 4H1MA 4G5PA 2BAJA 4LOOA 5E4HA 3MW1A 5ANGA 3E8DA 2GNJA 5IA0A 3CQUA 4XRJA 4RSSA 1LR4A 3GU6A 3I0QA 3PVWA 3O8PA 4FA2A 3NFFB 4FIEA 3PZHA 5LVNA 2VNYA 1WBVA 4FTQA 3ULIA 4G1WA 5HBHA 3L1SA 2YN8A 2G9XA 2WD1A 4D2TA 5HICA 5DR6A 5C27A 3EQIA 1NW1A 1YKRA 4QRCA 4JQEA 5E8WA 3VN9A 2IZTA 2P2IA 2BZKB 2J0LA 2GDOA 3PSBA 4FKRA 4AXDA 1L8TA 5HO6A 2W1DA 4WO5A 5FEEA 4IQ6A 4EHEA 4RBLA 5AP1A 3QRJA 2UZEA 3GT8A 4QMWA 2JDTA 3DU8A 4D1SA 5FP5A 3GGFA 3A8XA 3VVHA 4DHFA 3ZSIA 3NCGA 2YCRA 1J91A 4BCIA 2W5HA 4FG8A 4IAZA 2ZM4A 4OTWA 5EHYA 4A4XA 1J7UA 2XM9A 3D2IA 3R9HA 5TO8A 4E73A 3VS1A 2J2IB 3ZUUA 4MKCA 5A4QA 1OBGA 3OVVA 4XV1A 2YAAA 3H9FA 3ET7A 1KE5A 4IWQA 4YNEA 3PXFA 4WRGA 3HAVA 1ZOGA 3GI3A 2YITA 1OM1A 2PSQA 1YOLA 3ACJA 4YLKA 4F9AA 3QLFA 2UZUE 4L9IA 2RKUA 3FYJX 4ACMA 4ERKA 2PULA 3V8WA 5ANEA 1Q61A 5IMEA 4O0XA 3PJ3A 1Q4LA 4K18A 4I4EA 4QMXA 4ARKA 4Z55A 1ZMVA 2X39A 3WF7A 1XH9A 4FV0A 4GL9A 4B4LA 3CLYA 3R2BA 2YCQA 1Q8YA 2C1AA 2R3LA 2WTVA 3NNWA 3NRMA 5IUHA 3EFWA 4AU8A 4NIFB 3P86A 1KWPA 3WILA 3EJ1A 3NVMB 2X2LA 2JIVA 5KZIA 1TVOA 4RWLA 1ZOEA 4E5WA 3DDPA 3TJDA 3LZBA 1JWHA 4E6AA 2ERKA 3UOKA 3HRBA 4U9AA 3MYGA 4WT6A 3BE2A 4GFMA 4IEBA 4FNWA 3MIAA 5EFQA 5J9ZA 3PTGA 3CE3A 3E3PA 1V0BA 4YP8A 1DAWA 4K8AA 1CKJA 5BUEA 1KE9A 2HY81 2X2KA 2NRYA 4H1JA 2VTIA 4NZWB 3PJCA 4PX6A 4W8EA 3LFNA 4FK6A 3WOWA 3FQEA 4HYHA 4R8QA 3ZSGA 5IG1A 4IBMA 2OK1A 4GT4A 4A4LA 4HPUE 4LI5A 4V0GA 4TPTA 4BWKA 2AYPA 5L6PA 1UNHA 4FV5A 2ITVA 3QWKA 2C5OA 4BJJA 1MRYA 4EK5A 4F6UA 3QFVA 4HVIA 1U54B 3VONA 3ETAA 5FGKA 1OUKA 3IK3A 4G6OA 3PIXA 4KIQA 1QPJA 2CDZA 3K3JA 5K5NA 4I5MA 4X6RA 5CASA 3RPSA 3G6GA 4PTGA 4QTDA 3SV0A 4QT1A 4BBMA 2YACA 4FVQA 4I22A 4MXXA 4EKKA 4EQUA 3TIZA 2IJMA 2P3GX 3O7LB 1OMWA 4KB8A 1OKZA 5CI6A 1G8SA 4OTGA 4RLLA 3PFQA 2PVYA 4U40A 5CU0A 2R3NA 4WA9A 4MYGA 3TN8A 4QMTA 2UZTA 3PA5A 2XB7A 3RAHA 3LCSA 3VJNA 3FC2A 3PJ1A 3ZFXA 3MFSA 3QZHA 4FTUA 4AZFA 5LMBA 1H1PA 5BVFA 5KKRB 4LOPA 2OJJA 4ZTQA 4CLIA 2FSLX 3DAEA 3E64A 3VBWA 4IJ9A 2UW7A 5FTGA 2GQGA 3P7BA 3UZRA 5DHJA 4OTQA 4D2SA 2EUFB 3DGKA 2C6DA 4APPA 4PNIA 4GH2A 3OCGA 3ANQA 3H9RA 2C5XA 4NFMA 4XG8A 4D0XA 3P9JA 4RIWA 3NYNA 2W9ZB 5DOSA 3FY2A 2QU6A 4FSTA 5CX9A 2YDIA 3F6XA 4JX3A 1JVPP 4QO9A 5ACKA 3SOAA 4EUTA 1IRKA 5A46A 3IOPA 2PUPA 3RPVA 3QUDA 5I9VA 1OL5A 4IE9A 4JR7A 2WTDA 3PRFA 1ND4A 3G90X 2C0IA 4XYFA 3C4ZA 4W4VA 1CM8A 2DWBA 4O84A 3O23A 5FDXA 4EEVA 3PVGA 4I0RA 3IKAA 3F3VA 4LV7A 3PLAE 2GS2A 4BDFA 3A61A 2XUUA 2HWOA 2R3PA 3F5PA 2XA4A 3HGKA 3HL7A 4RJ8A 3ZCLA 3MESA 4BGHA 2Y0AA 3UQGA 1UA2A 3OW4A 2UZLA 2Y7JA 3W8LA 3N4TA 1FPUA 3QD0A 4G3FA 4PRJA 5CQUA 3W0QA 1YI3A 3DY7A 4FV9A 3F61A 5CI7A 4QQCA 5F95A 4H05A 3SW7A 1ZY4A 2JKKA 2ZM3A 4KKGA 5LWNA 1XH5A 4G31A 4F7SA 4J1RA 4IAIA 1O6YA 4BTMA 4IM0A 4DINA 4DFBA 4O0YA 2B1PA 2W1ZA 3H10A 2X7GA 5HBEA 1OKVA 3FLSA 5CVHA 5A4LA 3MH3A 3NUYA 3VUHA 2YISA 1UNGA 3LFFA 3NZ0A 3U9NA 3G0EA 4G6NA 2BKZA 4WUAA 5D10A 3DNDA 1GIJA 5L4QA 1TZDA 3MVJA 4LFIA 3LOKA 4ZSLA 1Q5KA 5FWKK 5HIDA 5CENA 4NJDA 2UW8A 1P5EA 3NW5A 5LXMA 3GVUA 4CMUA 1OIRA 4DEGA 2WIHA 4D5KA 1W2CA 3OBGA 5BVEA 3C4CA 3RHKA 3L8VA 3R8VA 2F7EE 4FX3A 4UN0C 5ANKA 1YHWA 5F20A 4RA4A 3KGAA 2QHNA 3C13A 5IUGA 4O7LA 3MH0A 4G17A 4GUEA 2AC3A 4BB4A 4AOIA 1Q24A 3FSKA 4I23A 1FBNA 3R9RA 2B9HA 3QD4A 2UZBA 4DGOA 2NPQA 4QMLA 5EOBA 5AMNA 1BL6A 2V7OA 5HZNA 3FMKA 4TYEA 2HXQA 4U79A 3H0YA 3HA6A 4YGAA 3EQPA 4K0YA 4M14A 5CS6A 2Y4IB 1NT2A 2PZRA 1FVVA 2BFYA 2HYYA 5FRIA 4XS2A 1G8KA 4RGJA 5CAOA 4TXCA 4KD1A 3V5JA 3S3IA 5FBOA 4DT8A 4YZBA 2PZPA 5EYKA 4FGRA 4CYIA 4PDSA 3LJ1A 4HYUA 3F82A 2GS6A 2CHLA 2XKCA 4C4IA 1YI6A 2C4GA 3AD6A 1YXTA 4KIKB 2H9VA 4KRDA 4YURA 5A4EA 4ANLA 3OWPA 3VS6A 5AM7A 3R73A 3G51A 3EL8A 4G2FA 2VWBA 4K11A 3V5WA 3W2OA 3V5LA 2HZ4A 4ZEGA 3D5XA 3D5WA 3UODA 4EH3A 5LVPA 3ZO3A 4FNYA 1FOTA 4ANNA 2QOFA 2NP8A 3MN3A 2VZ6A 3MY1A 4I6BA 3WE4A 2OWBA 2WNTA 2Z2WA 4FIHA 4FNZA 4FOBA 4AP7A 4FL2A 5KMLA 5AR5A 2UZVA 3P79A 1H0WA 2WEVA 5JQ5A 1WCCA 3FL4A 4RVLA 5ETIA 2IVUA 5HD4A 3FHRA 1U46A 5FLFA 4XEYA 2BFXA 3RWPA 4C2WA 4Z16A 3L9NA 2J0KA 4O2PA 4R3CA 4RC4A 3NW6A 4O0VA 2XAMA 4DEHA 3BPRA 4E7WA 1XBBA 3FV8A 4RIYA 4BKZA 2IO6A 3F5XA 1R39A 4RJ5A 4UMRA 3QF9A 3KEXA 3V04A 4C3PA 2FSTX 2X9EA 4AF3A 5IQEA 4ZP5A 2PVHA 4FSYA 1VR2A 5CAVA 4YJTA 3ORMA 3TKUA 4UZDA 4NTTA 4D1XA 2JKOA 5T3QA 2QODA 3DLSA 3OT8A 1BL7A 2R5TA 4JX7A 4FIFA 3RNYA 2H96A 1P4OA 5D7VA 4BY9E 1SVHA 5C8KA 2YIXA 4L53A 4BKJA 3MPMA 4JXFA 4R1YA 2VTOA 2OJGA 5M4CA 2BTRA 2LAVA 4O4FA 4BFMA 4ZMFA 3NUXA 5JFSA 4FKPA 4JG7A 4MEDA 1JKLA 5GIPE 2NRUA 4HCUA 3FI8A 4ZSJA 3I60A 4GS6A 3MY0A 4PMTA 5DIAA 5IA5A 4AT5A 2REIA 3FI4A 4PPCA 1GJOA 1PXPA 2WTCA 3R22A 3W2QA 3LLTA 5IQDA 3R8PA 4QTAA 4M68A 3I4BA 2IVTA 1PXOA 5FTQA 3U55A 1UV5A 3HKOA 2OU7A 3D4QA 3U87A 4CXAA 3ORPA 4DLJA 3CKXA 4NW6A 2F7ZE 2I0YA 3ORXA 4UV0A 3CGOA 3FE3A 3PUPA 2B9JA 3SA0A 3Q9XA 2OIDA 3C51A 3D7TA 3GU7A 4II5A 5HEZA 2W1HA 3Q96A 3SLSA 3TKIA 5EQYA 4C35A 2ITYA 4YTIA 3GOPA 3S0OA 4DFUA 3EN4A 1MQBA 2YIRA 2XEZA 3OCBA 2WO6A 4HVHA 4BCNA 4X2JA 5C4LA 4MK0A 4AGDA 4FEVA 2J5FA 5IA4A 3EN7A 3D7TB 3M42A 3DBQA 3FI3A 4D4RA 5I9WA 5ANOA 1SVGA 2YABA 1REKA 4X2FA 3MA3A 2YM7A 4A4OA 3ROCA 3WE8A 4O4BB 2VWZA 3QTXA 4YPDA 4LG4A 4BCKA 4DFNA 3F7WA 4HYIA 3BYUA 3KCFA 4NKAA 5JSMA 1XH6A 3HV3A 3AMYA 4R3RA 5EW3A 5CT7A 3PY0A 5CU3A 2GU8A 3ZZEA 4BZNA 3G15A 3LPBA 4AS0A 4BVUA 4BHZA 3R30A 4V04A 4DFLA 4QP3A 3KRXA 3LFDA 4IHPA 2WIPA 3VRYA 3UIBA 1R1WA 2C5VA 3RAIA 5C4KA 5AV0A 2QOBA 4RIXB 3BV2A 5FXSA 2QC6A 3QQUA 4HGTA 3FZOA 4ACGA 5KO1A 4FV2A 4O83A 4GG7A 3V5QA 4P7EA 1H1RA 3QRIA 4ITIA 1K3AA 4YZNA 3VBVA 3BLRA 4ASZA 4F9CA 3CIKA 5ICPA 4IXPA 5AV1A 2CKPA 4DDIA 4WHZA 4ZK5A 4J99A 4YC8A 4XLVA 4AW1A 4BGQA 1H01A