4O21A

Product complex of metal-free pkac, atp-gamma-s and sp20.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Metal-Free cAMP-Dependent Protein Kinase Can Catalyze Phosphoryl Transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 111
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o21A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o21A02
4C3FA 3UIUA 3GC9A 4AWIA 1O6LA 4L44A 1PXPA 2B53A 4EH6A 5DRDA 5AP4A 2WOUA 3QTUA 2PZRA 2XNBA 4N6YA 4OGRA 4XG6A 4YLJA 4W8EA 2X4FA 4I5HA 1NW1A 4PWNA 3QRTA 2FB8A 3VC4A 5M44A 2J5FA 4XP0A 5A9UA 1J3HA 5FUTA 3NX8A 3QHRA 3UIBA 3MYGA 2QKRA 3CKWA 3R1YA 3SW7A 2QODA 4V05A 3LJ1A 4FICA 4YJNA 3L8XA 4AGUA 5JGAA 2CDZA 3WOWA 1ZYSA 4BI0A 4D2TA 3U9CA 5HBJA 4YBKA 3FXWA 4B8LA 4BVUA 2YIYA 4G16A 4XV9A 2H8HA 2NP8A 4QP3A 4XG9A 4Y83A 2UW8A 3R28A 4WUAA 1Y6AA 1WMKA 2PZYA 4WOVA 3ZH8A 5AV4A 1YHSA 1YHVA 4OTHA 2EVAA 3VS2A 2FSTX 2XP2A 3D4QA 3G5DA 4I3ZA 4K11A 5KNJA 5BYLA 3LJ2A 3U51A 4YO6A 1VR2A 2PUUA 4TL0A 4I4FA 4ZY5A 2VTHA 3ZEWA 2PE0A 5TR6A 3M11A 5I3RA 4R77A 3OG7A 3AC1A 3R21A 2BRBA 2ITZA 2X6DA 3QGWA 3ZUVA 4BDCA 3R6XA 4NL0A 4A4XA 2RIOA 4UMUA 4RJ7A 3VJNA 1Y57A 4X2NA 2G01A 2PMLX 1CKJA 5I5ZA 4FG8A 3UMXA 2ZJWA 2IW8A 4IQ6A 3O8PA 3BYOA 1U4DA 2JKQA 5J1WA 4FC0A 4RX5A 5EQPA 3EB0A 1TKIA 3FJQE 3WILA 4HPUE 5L8JA 1Q5KA 2OXXA 4IB5A 5DWRA 2GNIA 3T8OA 4DYMA 2X8EA 3IGGA 5EOLA 3VUMA 3A99A 3UIXA 5IQIA 4LG4A 2C69A 3M1SA 3NNUA 3PE1A 3SDJA 5M09A 3QL8A 5DLSA 3G51A 2C5OA 3EFWA 3FMNA 2WOTA 3NNXA 4L46A 1XBBA 3V8TA 3N4VA 5E1SA 4I20A 5CAPA 3L9NA 4MVFA 3QXPA 4A4LA 2ZOQA 1U5QA 2R3PA 3EZVA 5IQBA 4QQ5A 1YOJA 4AAAA 3QQGA 4BCQA 3A4OX 3EQDA 3EQFA 4XOYA 4PMSA 4H1MA 4B9DA 3MVJA 5HLPA 4EH5A 4BZOA 3KK9A 2V55A 5IA2A 3E88A 3HAMA 4J97A 4E1ZA 4EH2A 3RAWA 2I0YA 4IAIA 4K9YA 4MBLA 5HIEA 2VTNA 1VEBA 2HAKA 4ITHA 3DNDA 3OCGA 4OR5A 4BZNA 3EZRA 2Q0NA 3W8QA 2Y6MA 2PULA 3FMKA 3CKXA 1YWRA 1PY5A 3NUXA 1OKYA 3GUBA 4L45A 4PX6A 5DIAA 4ASEA 2DWBA 3PRIA 4O7NA 3CSVA 4CTBA 3DBCA 3E8EA 1OMWA 3VS5A 5IF1A 2XMYA 3Q9YA 3COHA 1URCA 5HBEA 3VBVA 3AD5A 4PTGA 4E93A 4DEAA 1XJDA 2H9VA 2BRGA 3FPMA 4EOJA 4BKYA 2ZVAA 4CKJA 4FKTA 4KINA 3IO7A 2IVSA 4U3YA 3V8WA 2PVKA 2X2MA 3UNZA 5F9EA 2CGXA 4XUFA 3V51A 4UXLA 4FSQA 4V04A 4QP7A 4W4YA 4Y72A 4JG8A 2WTJA 4BWKA 5DYJA 1ZZ2A 3D2IA 1Q4LA 3KB7A 5DT3A 4XMOA 5IA1A 2BROA 2PTKA 3BYMA 1FQ1B 5E9EA 2WTKC 2QLUA 4ZTLA 4WO5A 4EZ7A 1P2AA 3HP2A 5G1XA 2WEVA 3R7OA 2WQMA 5K0KA 3IKAA 1JKKA 2OBJA 4MWHA 3TIYA 5A6OA 4PDOA 5HOAA 3NNVA 4GKIA 4LGGA 3MWUA 2FVDA 1IEPA 3NVKI 4PF4A 3AD4A 4X21A 1H1SA 3D7ZA 5IEYA 4FK3A 3CGFA 3TJCA 2XJ1A 3ZTXA 1M14A 1WBOA 3R7YA 1CKPA 4MH7A 4EI4A 3NAXA 2HXQA 4DBXA 1JKLA 3PIXA 4H05A 2HZIA 2WMAA 2IO6A 4QP6A 4NJ3A 3CJFA 3SA0A 3UPXA 3G0EA 1LEZA 3F82A 4FE2A 2WELA 5CLPA 5TF9A 4L01A 3C0GA 3FXZA 3RK5A 4U6RA 2A2AA 3G0FA 4FSMA 1JNKA 2RSVA 2ETKA 4ZZOA 3PA3A 3GOPA 3QA8A 4X3FB 2J0IA 4NZWB 2YLFA 3A7GA 2QCSA 4JRNA 4OTRA 3W10A 4V0GB 3KXGA 4QP4A 3G90X 3DY7A 1H4LA 1T45A 3WF5A 4BCPA 2CCIA 1Q8UA 3MA3A 3P7AA 4D1SA 5AEPA 2VUWA 4G3DA 3ZS5A 4DEHA 3NDMA 4NWMA 4JQ8A 4Z7GA 4FSTA 2VX1A 5HTCA 3UP7A 4Y85A 5DFPA 2QD9A 5D12A 2WMTA 3E3BX 1R0PA 4NCTA 1BLXA 3K2LA 4BI2A 4ANOA 1YI4A 4GW8A 3VBYA 1APME 3QZIA 5M4FA 4EH3A 2IZUA 1O6YA 3G33A 2PYWA 3C51A 3WF9A 2PVNA 2BFXA 2Y9QA 3RBWA 3DGKA 4XG3A 4UXQA 2JIUA 1DAYA 4ENXA 1ND4A 4BBMA 3QZFA 3DJ5A 3GCSA 5FRIA 5AJQA 1DI8A 1OUKA 1OL6A 1JSTA 3QLGA 3VHEA 1XQZA 3A7IA 3QQHA 4I5PA 3ZLXA 1RDQE 2EUFB 5H8BA 4ASXA 2W17A 3MPMA 1H28A 5M4IA 3CGOA 4IDTA 4D58A 4F1OA 5AA9A 3PSCA 4O7RA 4FTMA 3UZPA 4UMPA 5ANGA 5BPYA 2OWBA 3DXNA 5JZJA 3UQCA 2W1HA 4Y95A 1CTPE 2XIRA 4HVDA 2ZM3A 2R3FA 1YW2A 4RWKA 1MP8A 2P2HA 3FMEA 1ZMUA 4Y5HA 5JSMA 4CGAA 1K9AA 4ASZA 5CZHA 3C4CA 2XBAA 4Y5QA 2BZIB 2DYLA 3R63A 5JZNA 2ERZE 4HNIA 1ZLTA 2XK7A 4YHTA 5EYCA 1R78A 4DEIA 2JDTA 2A4LA 3F3VA 3KGAA 3WYYA 2XA4A 5JH6A 4NFNA 2FSOX 2QURA 4G3CA 4LUEA 3B8RA 4YJVA 4YZMA 3AGLA 3TT0A 4QMNA 4M0YA 2R3HA 3U4WA 4BHZA 4WUNA 3W33A 3LXNA 2ITUA 4EKKA 2Y6OA 4KKEA 3EQGA 4FV9A 1H00A 4USFA 3MBLA 5E7RA 2PVYA 5F4NA 5AR5A 3BLHA 4EH8A 4ORKA 3LFDA 4PP7A 2YM6A 2ITWA 2PE1A 2YZAA 5JK3A 1TVOA 4BI1A 2OZAA 2OIBA 1YWVA 4KB8A 4CCBA 1KWPA 2ITXA 2Z2WA 4G2FA 4D4VA 4AN3A 5AAFA 5KZIA 2YCFA 4QTAA 3LXLA 4RWJA 3WF7A 3TI1A 2QOCA 4MYGA 1Q3WA 4L67A 2CN8A 5HG9A 2C0IA 3FLNC 3MFUA 2F2CB 3OWLA 3FLZA 2XRWA 3DT1A 4K33A 1Y6BA 4FZ7A 4BIBA 4EHGA 4EEVA 4PPBA 4L3LA 5IQDA 2G15A 4WG4A 3LM5A 5C4LA 2AYPA 3K5UA 4RVLA 3ZLYA 4F09A 3R01A 3CXWA 4QD6A 2RL5A 5DVRA 1Y91A 4C37A 2IN6A 3GXLA 4BB4A 4ZMFA 5ETAA 4YSJA 3HA6A 1P14A 2IZRA 4GU9A 4AOIA 4UX9A 2X8DA 5K5XA 3QWJA 3OCBA 5J95A 3FI4A 4ZY6A 3FLYA 3KEXA 1PYXA 4YJSA 2C3IB 4ZJJA 2E2BA 4W8DA 4TYHB 5CEQA 4JJRA 5HU3A 4FZAB 4HZSA 4GVJA 3CS9A 1MRYA 3C4ZA 3CD3A 3UOKA 2QOIA 4O0WA 4G31A 2C1BA 4YC3A 3P78A 4NJDA 4BDDA 4Z9LA 4GG7A 2FSMX 5C26A 5L2TA 4O7VA 2XK3A 5M57A 3VQUA 3TL8A 4FIFA 3HV5A 3FEGA 4EBVA 4DGNA 3GC8A 3PPJA 2BUJA 3GC0A 1PRYA 3UNKA 1ZMVA 2KTYA 4YZ9A 5TE0A 4CKIA 4R6VA 2YHVA 3NYOA 5AFVA 5M07A 3MH0A 1TQIA 3LOKA 4XG4A 4AFEA 3S0OA 5BMMA 3F5GA 4O1OA 2H6DA 3FV8A 4Q2AA 4RJ6A 5A6NA 5BUIA 1LUFA 2Z60A 3SV0A 5D9HA 1H1RA 3LAUA 2O64A 4U79A 2QG7A 3BLQA 4FV4A 5H3QA 1PYEA 2AUHA 2ZB1A 4IFCA 4ANBA 2UVYA 3OY3A 4TYEA 1KE7A 3MY0A 4KNBA 2ZM4A 3V01A 4ASDA 3QZGA 4JQEA 4IVDA 4PRJA 4WKQA 4MD7E 3RCDA 3GU5A 4AGWA 4R8QA 3KVXA 3I6WA 3L8VA 2XKEA 2WIPA 4QMWA 2HZNA 3QKMA 3V5QA 4GUBA 5HVKA 3F69A 5IQAA 3DKFA 1E1VA 5HTBA 3AC3A 2VTSA 4DCAA 3ANRA 3EN5A 1ERKA 4OUCA 4CCUA 4D2WA 2WQBA 4OT5A 2BALA 3LHJA 5J9ZA 3IGOA 4FSRA 4BHNA 1J7UA 3R7VA 3WF8A 3ACJA 1FVTA 3K54A 4M68A 4F9WA 4CQGA 3DQWA 3QQUA 2GS2A 2IVVA 2WQNA 3MIYA 4IC8A 3ORTA 5AP1A 5EHYA 3W8LA 4ALVA 3KF4A 5IA5A 2XKFA 5HO7A 2WMWA 2UW0A 3VF9A 5DHJA 2Z02A 4QMVA 3RNYA 3RM7A 1FVVA 3CE3A 1MRVA 3CQWA 4DFYA 1W83A 3D5XA 4QPAA 3SHEA 4DH7A 4I21A 5GZ9A 2ETRA 3NW6A 4RIOA 1MQ4A 4I4EA 4C2VA 3ZXZA 4I5MA 2XIKA 3BZ3A 3CPCA 4ZY4A 4PTEA 5ETCA 5F94A 4HYSA 4NKSA 4BWXA 4PDSA 3N9XA 3R83A 4DG3E 3IW6A 3UNJA 2J50A 2IG7A 2Q83A 3PJCA 4RGJA 2X81A 5CSVA 5E8TA 2X7GA 3FHIA 3O96A 1KOAA 3OP5A 3HRFA 4L9IA 4F1TA 4CZYB 3MVMA 4QYYA 5E8VA 4FOBA 4AE6A 5BX0A 4XRLA 4BGGA 5IEXA 3R2YA 2G9XA 1FMKA 3AGMA 4DLJA 2FO0A 5AR3A 4C4GA 5E8YA 5J7HA 2EU9A 2B9IA 2PMNX 2OFUA 3FLWA 4G9CA 4IAAA 2WIHA 3CLYA 3GB2A 3R8ZA 3QCSA 4C57A 1VYZA 3VJOA 4AN2A 3CCNA 3PLAE 2XVDA 5DG5A 4F0IA 5EKNA 3PG1A 4FUYA 5DMZA 4XH6A 3NUNA 4FKQA 4YBJA 4BCHA 4O0VA 4XHKB 4L68A 3E3PA 4C7TA 3CPBA 4EC8A 2ZM1A 4AN9A 5CEMA 4J98A 3ZU7A 4DCEA 4ZOGA 5DR9A 4YR8A 4EOIA 3IECA 2J2IB 2WU6A 3E8DA 2XRUA 4QMPA 1W84A 3VULA 2GU8A 4N0SA 2CKOA 4QO9A 3L8PA 1NVSA 3NCGA 4RX8A 4EUUA 4JLCA 1OB3A 3R22A 3ZRMA 2QO7A 3QGYA 3DXPA 2RG5A 3TTIA 4D0XA 3FYJX 4NM5A 4DG0E 4EOMA 1ZY4A 5AP6A 5KO1A 5E8UA 3TM0A 2PWLA 3G6HA 3QALE 3VUKA 3EJ1A 2OIDA 4IAKA 4QMUA 2BHEA 3KVWA 5EQEA 4ANSA 4FK6A 4YNEA 2PVLA 5CF6A 4FV3A 3G9LX 4D9TA 3W2SA 3LMGA 1K2PA 3KCFA 2HIWA 3LFSA 2XB7A 5DOSA 4BTFA 3QD4A 1JVPP 4AZTA 1ZAOA 5CSXA 5BYZA 5K4IA 3MV5A 5CSPA 3DJ6A 4HYUA 5AV2A 3BHUA 4HGLA 4MQ2A 3SD0A 1BI8A 1NY3A 4R1YA 4E3CA 3TNHA 3RM6A 3N4TA 2C6DA 4O81A 2GQSA 4AP7A 3DAEA 4FVPA 3QLFA 4EL9A 1LR4A 5BUJA 3LQ8A 4ZSJA 2GMXA 2UZVA 4R5YA 4WSYA 3BWFA 1SYKA 4H39A 4IB0A 3V5LA 4MD9E 4L7FA 4FR4A 3UDBA 4BDKA 2Y4IB 4YJQA 2CNVA 2X4ZA 3ELJA 3V5PA 4GCJA 2GNLA 2HY0A 2XIZA 4NIFA 3H30A 2VZ6A 4W4VA 3W2OA 5D10A 3OTVA 3EQRA 3BPRA 2GPHA 3NMUF 4BTKA 3ZYAA 4YJPA 3PYYA 3ZM9A 4MNFA 3V04A 3BHYA 3BKBA 3ACKA 2J4ZA 3FLQA 2F4JA 3CQUA 3P7CA 2DS1A 5A4QA 5J9YA 2REIA 1PXNA 2V7OA 4WHZA 1PKGA 3UG1A 2W5AA 4O7WA 1GZKA 4O96A 3A4PA 3FZRA 4NM0A 2X9EA 4G1WA 4FTIA 3ZC6A 3HRBA 4EYMA 2PVMA 3C5IA 4CTCA 4GFGA 1XHAA 2UW5A 4A9YA 4MTAA 3T3UA 4BCIA 2QONA 4U7ZA 3CTJA 4F9YA 3DKOA 4WBOA 2J0JA 3BYSA 4JBOA 5AUZA 2IW6A 4JBVA 4JX7A 5GJFA 5HG5A 3MS9A 3THBA 4J8NA 4M3QA 4RLLA 5CQWA 5EDQA 5IUGA 2W1ZA 3MESA 5G6VA 4IAZA 3FSFA 3FZSA 4HNFA 4AXAA 3A60A 4F65A 4HVSA 2ONLC 3LE6A 4N57A 3NUAA 4QMSA 1Q97A 4XG8A 3EQPA 5B7VA 3WZUA 4FEQA 4RJ8A 5BVDA 5IQHA 4X0MA 2VWIA 5GJGA 3SOCA 5GZAA 5FD2A 4FSNA 3OEZA 4R7HA 5HEZA 2O2UA 3FZ1A 1W8CA 5HE1A 4K77A 1QPDA 3BE9A 5F95A 4APPA 4KBAA 4ZIMA 5IH4A 4FTTA 2X1NA 2UW3A 3D7TB 4YC6A 3IK3A 4FTNA 3EFKA 5HD4A 3C7QA 4RQKA 3NW5A 1A9UA 4O0UA 5T6KA 2R3KA 2UVXA 3OC1A 4FMQA 4FEVA 3Q4TA 3LFBA 2B9FA 2R4BA 3UODA 5AV3A 3SRVA 3KC3A 3FMDA 4CYJA 1W82A 4IB1A 5A54A 2OIQA 2IZSA 1ZOGA 2CMWA 3MFTA 3WF6A 4FL3A 5C8KA 3RPSA 3I4BA 5CU3A 1OPJA 3FZOA 2ACXA 3KKVA 4IAYA 4MAOA 2BILB 2ITNA 2P3GX 4G17A 5B2LA 3L1SA 5C01A 3LFQA 3KFAA 3QD2B 2C6OA 4TWNA 1XH7A 1URWA 4EHVA 3ODZX 4ZS0A 3KMUA 2V22A 5M53A 2HWOA 5M08A 4CVAA 3KXZA 4BRXA 2XM8A 3ZXTA 4ZJVA 3BEGA 5CNOA 4W4WA 4JXFA 3VRYA 3EQIA 4UV0A 4GK3A 4AT5A 2PVJA 2X0GA 4JIAA 4OW8A 2OXYA 3RCJA 4TYGA 5T3QA 4DEEA 5GNKA 4J71A 4D5HA 4ALUA 2JAVA 4IVCA 5EI8A 4O0XA 3EOCA 4FTKA 3QTRA 3EYHA 3EFLA 4JIKA 3FKNA 5FXRA 2PSQA 4G6OA 4CFWA 4AG8A 1CKIA 2JGZA 5IH5A 3E5AA 3LZBA 2C5VA 2CHLA 4LUDA 5BMSA 3C5UA 3VAPA 2VRXA 1PW2A 5HNIX 2HENA 1EH4A 2RKUA 4JX3A 2V5QA 5CNNA 5ETIA 3KRXA 3KA0A 3MI9A 4F70A 4ZJIA 2KULA 4RZWA 4AS0A 2AC5A 3UP2A 4CFMA 2YWPA 4O0SA 4IZ7A 4D9UA 3FMHA 4U45A 4HCVA 5HNGA 2WQEA 5CVFA 3FZPA 2XK8A 4BDAA 3ANQA 4EYJA 3QRJA 3GENA 4NSTA 1TQPA 4CD0A 3BBWA 3TACA 3GI3A 4LMNA 3JR1A 3RAKA 4J8MA 3PXYA 4EQUA 3KRJA 1Q8TA 1WVWA 4KBCA 5BUEA 4O86A 4G5PA 3HGKA 5K5NA 3RI1A 3OT8A 2WU7A 3HV4A 5HO8A 3W2PA 4CKRA 4DGGA 4CRLA 2IPXA 4IWOA 4M12A 3ZUUA 2OK1A 3PJ2A 2BRNA 4LL5A 4EZ3A 3G15A 2J7TA 3I5NA 5JFWA 2ZMCA 4DE4A 1YOLA 1OBGA 5IMEA 4FYNA 3QBNA 4M84A 4KIKB 4FL2A 4G6NA 2OFVA 2BZKB 4C4FA 1YOMA 1MRUA 3DB6A 3BGPA 4R5SA 4AOTA 1B39A 3V3VA 4RSSA 5A46A 3LQ5A 1WCCA 4E4NA 3TZMA 2X8IA 4D2SA 4UALA 4ZLZA 4NYEA 4HGEA 3FDNA 2C1AA 2A27A 2W1GA 4RFYA 3HKOA 5FGKA 2C5YA 2W1FA 3C0IA 3HECA 5T68A 3W2RA 3DBFA 4QTEA 4RG0A 2ETMA 2NPQA 2G2HA 3GCUA 2JKOA 4HYHA 5HI2A 3U9NA 4BIEA 2J0KA 2UZWE 4RIXB 1PMUA 3KN5A 2IJMA 4B0GA 3MPAA 4C4HA 1KE9A 3SXRA 3TCPA 4CQEA 1JQHA 4DFBA 3DKGA 4YPDA 3U87A 4GMYA 5E8ZA 3JYAA 3H9RA 5CT0A 5EDPA 3R9HA 2EB2A 1OIYA 2BZJA 1CM8A 5D41A 4JDKA 1J1CA 3ZDIA 5IISA 4DT9A 4YLLA 1KV2A 1OGUA 2VTOA 2J90A 5JMSA 2BR1A 4GSBA 3S4QA 5EHOA 2HOGA 3C13A 3FUPA 4P90A 4BDJA 3EWHA 4E8AA 4C34A 2V62A 5D1JA 4GK4A 4RC3A 5CEOA 5HLNA 3UZRA 3ORZA 5LXMA 2VTJA 2R64A 1DAWA 5ITAA 4ERKA 1OPKA 2OICA 2E9PA 5EYDA 2HELA 2R3GA 4A06A 5CU4A 2QOBA 2OZAB 2UW4A 4FKRA 4IWQA 4WRGA 5EI2A 3QC4A 4FTCA 4Q5HA 4FKIA 3VUGA 4TT7A 3E63A 3OT3A 3I0QA 2OJIA 3MSSA 2ZDTA 2G2IA 4M69A 3QUPA 4U80A 3W55A 1PF8A 4Q9ZA 3DAKA 3JPVA 1LPUA 2GNHA 2WTIA 3LCSA 4V01A 3I5ZA 1LEWA 4FKPA 4AZEA 4KWPA 2HXLA 3E64A 5KKRB 2OJGA 3PWDA 4MXYA 3GGFA 2UVZA 3ZBXA 2RGPA 3DLSA 1O6KA 4LYNA 3V5JA 3VS3A 5KMLA 4FEWA 5DE2A 5C27A 3RPVA 3LFCA 3NGAA 3ZBFA 2HCKA 5FTGA 4PDPA 3AXWA 4RWIA 4M67A 3ENMA 4QQTA 4YC8A 1H8FA 2PMOX 3IW4A 4DA5A 4H3BA 1T46A 3HNGA 4BYIA 4CMOA 2CKEA 2JIIA 3FQEA 4IM3A 3PIYA 4NUSA 4FGBA 3CJGA 1R39A 2R3RA 4TYIA 3RZFA 2ITTA 4NH1A 3FE3A 4RIWA 4M14A 3DK7A 3OS3A 3VUTA 5CU0A 1Q8YA 3PVBA 4LGDA 3R71A 4RX7A 3O2MA 3Q4CA 3E62A 3QCQA 4EC9A 3U6JA 5HVJA 4G3FA 4YZDA 4DEGA 2CKQA 2E9VA 3LIJA 4GT4A 1ZZLA 3Q9WA 3TNIA 4FA2A 4PMTA 1WVXA 4O0RA 4DEBA 2C3JA 4UZHA 5KBQA 2BAQA 5AUVA 4ANQA 4QMOA 3OVVA 4F4PA 3TDWA 3TKIA 3M2WA 1U59A 2HWPA 3QCYA 4PY1A 4DFUA 3GEQA 2ZDUA 3BELA 4DT8A 4UEUA 3GNIB 4PNIA 5HIBA 3TNPC 3KXHA 1GIIA 4J99A 5IA4A 2EXEA 3GBZA 3AD6A 3PUPA 4N6ZA 2WMRA 3O7LB 4FUXA 3QXOA 2W1EA 3NUYA 4LL0A 3LCDA 3P1AA 3AC8A 4C3PA 4YMJA 1OL2A 2QU6A 1CMKE 3LM0A 4OT6A 2EB3A 3MIAA 3GU8A 4F1MA 3PVGA 4M8TA 4IVAA 4RFMA 2EWAA 2C6MA 3SXFA 2XYUA 3FSKA 1UVRA 4Z7HA 1UU7A 5HQ0A 4PPCA 4IXPA 4I92A 4IWDA 4I0RA 4BGQA 3DPKA 4C38A 3SKCA 4JS8A 1STCE 4EWQA 2ONLA 3BX5A 5K0XA 3F88A 4D2RA 3OEFX 3A61A 1Q62A 1H01A 4EJNA 2HW6A 3NIZA 4U8ZA 5HD7A 4DH5A 3HA8A 1UWJA 4YTCA 2JC6A 4FG7A 4JAIA 5L3AA 3C9WA 5AP2A 4FKVA 3LFEA 3R73A 3A62A 5D7AA 4K1BA 4X6RA 5AV1A 4EQCA 4EHZA 3DDPA 3HMMA 4FIIA 5I9XA 1BL6A 3E87A 4H3PA 3OXZA 2UZTA 3C4WA 3PSBA 4M66A 4RIYA 4RVMA 2VX0A 4BDHA 4BYJA 3HMOA 5EM8A 2PE2A 2RFSA 1PXOA 4EZ5A 3CEKA 4FT5A 3MB7A 3MJ2A 3M42A 5A4TA 1XKKA 2VNYA 2YM8A 3VRZA 4AW5A 4JBQA 5BVEA 5ANIA 5AADA 4BR3A 3FL4A 4A9SA 1UU3A 4F08A 4A9TA 5ETFA 3GT8A 4FSYA 4YNOA 4NT4A 4KSPA 3ZLSA 3P08A 4GFOA 3FQSA 3PDTA 3R2BA 4YJTA 1ZWSA 2O5KA 4YURA 5CZIA 5J8IA 4FV5A 1JBPE 4BIDA 1ZRZA 2ZV9A 3KULA 3F6XA 4G6LA 2BDFA 2WMQA 3KXMA 2YJSA 5FP6A 1YHWA 2XEZA 3OCTA 3PTGA 3C1XA 4O21A 4PL4A 5DBXA 5K9IA 5CEPA 5E1EA 3LLTA 3QUEA 1UKIA 3PJ1A 5JGBA 3NWWA 2F7XE 4DG2E 3V5WA 3UIMA 2BZHB 5AUXA 4FL1A 2JDVA 3RHKA 1GJOA 4O6LA 4S33A 5FEDA 4A7CA 5BYYA 2R3JA 3NR9A 4I1ZA 3TKHA 3A8XA 1U54B 3EQHA 1OL5A 1SMHA 2QNJA 2GSFA 1AGWA 1GIJA 3OCSA 3R8UA 4AACA 4C62A 3EL7A 5F1ZA 4GIHA 4AX8A 2E9NA 4QOXA 4D28A 4YTHA 4C36A 5FDPA 4DN5A 4IMYA 4FNWA 4F7NA 3ZFXA 2H96A 3WIKA 2HZ4A 2E9OA 2WMVA 1IAJA 4ZSGA 4IX5A 4RZVA 3RAHA 4AZFA 3DKCA 5CVGA 5CX9A 3ZZEA 1M7QA 3HRCA 3QX2A 2I40A 2XKDA 3FC1X 3RWPA 3JUHA 3W18A 4E5AX 3QTWA 3TUCA 3MB6A 4CXAA 2UW6A 4DH3A 2JAMA 5C8MA 4JOAA 4MNEB 4DBNA 1SVEA 3CY3A 4TKSA 2GHMA 2BRHA 5BVOA 3U6IA 3ATTA 3BRBA 4CFVA 3AT4A 2ESMA 3T9IA 4AT4A 5IPJA 4JRVA 1SNUA 4ZLYA 4ZZNA 1PXJA 5E8SA 4PTCA 4AW0A 1KSWA 2PHKA 3KXNA 2VTAA 2YM5A 1X8BA 5DEYA 5AR4A 2VGOA 4I22A 2EXMA 5M4UA 4J52A 4A9UA 1DI9A 4QMXA 3WYXA 3TZ9A 4PMMA 3FI3A 2GTNA 1E9HA 4JI9A 1M7NA 3CD8A 3HV3A 5HBHA 4O83A 1VJYA 4WRSA 4RRVA 4IWPA 2C6KA 4ARKA 2UZUE 5IDPA 4FEXA 3O17A 4J53A 2OW3A 4YJRA 3ETAA 1J7IA 4CSVA 2ITOA 1UKHA 1PHKA 3FC2A 5GHVA 4DFNA 4QPMA 2GS6A 2JDSA 2B52A 2UZOA 3UC4A 5CYIA 4BCOA 3ZEPA 4TPTA 5H8EA 4NIFB 2QVSE 3BQCA 2C0OA 2JKKA 4KAOA 4C61A 2R3NA 5AP5A 2VWXA 4FKUA 4JR7A 2QG5A 4EH4A 3EYGA 2I0EA 4JG7A 5LARA 4IW0A 3R9NA 2UV2A 1Q41A 1REJA 5AAEA 5CF8A 5JN2A 2W5BA 3VIDA 4CT2A 2XCHA 3OOGA 2CCHA 5J5SA 3Q9XA 3QQJA 2OH4A 4FT7A 4DGOA 4XEYA 4XS2A 1OIQA 2XNNA 4EK4A 3AC5A 4HVIA 4FG9A 4MCVA 4XBUA 3HAVA 5EM5A 4ACMA 2CKPA 3VS4A 3PP0A 1F0QA 1AQ1A 2C6EA 2C3LA 3F5XA 4K8AA 4ONAA 4ENYA 4YTFA 2G2FA 4J96A 3VBQA 5E8WA 4FTOA 3C4XA 5EYMA 5D11A 3Q4UA 5HKMA 4LM5A 5A4EA 3COIA 1H0VA 1SZMA 2YA9A 2Z7SA 5HVYA 2VX3A 3PXQA 2WO6A 3Q2JA 2OZOA 2YLEA 2W1CA 5KMJA 2YDJA 2J0MB 3TN8A 4YTIA 5KZ0A 4S32A 4WNKA 2OGVA 4X2GA 1H08A 5CXZA 4ANNA 4EORA 2YCRA 4GG5A 2F9GA 4DTAA 4O27B 4DFZE 4ACHA 3UE4A 1ZYCA 2O8YA 3KXXA 4NK9A 5CEKA 5IZFA 5LMAA 3U55A 3O51A 2R7BA 2PVRA 2BIYA 1UWHA 4RX9A 4FBXA 1SVGA 5HICA 1GAGA 3GP0A 4FKJA 2C3KA 3TNQB 4CMTA 5AA8A 1VZOA 4XLIA 5B2MA 2ZYBA 3FQHA 3F3WA 3WZKA 3TV4A 3R7UA 5CAOA 5JRQA 1WFCA 3NLBA 4GJ2A 4UMQA 3ZRKA 4C35A 5IH6A 4EOPA 3MDYA 3IQ7A 4BDBA 2GDOA 3DCVA 3TZ7A 3V5TA 3DOGA 4GL9A 4U44A 4V0GA 3W32A 3HUBA 3HV7A 2LGCA 3SRVB 1M2PA 4XYFA 4D5KA 2YAKA 3IOPA 3ZRLA 5LVMA 1A48A 2ZMDA 4I6BA 2YAAA 3POZA 5M51A 3UGCA 2W5HA 4P2KA 3L9PA 5EW3A 4FTLA 3QAME 3HDMA 3V6RA 1JLUE 4L8MA 4PL3A 3O0GA 2WMUA 3E8NA 4FTQA 4UN0C 3POOA 2JBOA 4M0ZA 4QP9A 3QD0A 5HG8A 4E6AA 4YZBA 4AU8A 3TTJA 3EFJA 3DK6A 2W4JA 2IZTA 2SRCA 3P79A 5HCZA 1UNHA 1B6CB 5I9VA 1GZOA 2GFSA 3Q2MA 1XWSA 3OD6X 2BMCA 5B0XA 4FIEA 4XOZA 5EW8A 2PVFA 3BEAA 3NUPA 3PXFA 2I0HA 1ZOEA 2BPMA 3O7LD 5DR6A 1FPUA 1F5QA 4GYGA 4LI5A 3P86A 4FIHA 4ALWA 1DM2A 4MKCA 2JITA 1W7HA 3Q53A 1QPJA 4AUAA 4ID7A 1OM1A 5J9LA 3UO6A 4BCMA 1UNLA 4OAVB 1Q24A 2I1MA 5KE0A 4DH8A 3HX4A 4ZTQA 3ATSA 4AZWA 1H27A 4TTHB 4USDA 3SW4A 4RC4A 1ZY5A 4BCJA 3OF0A 4IHPA 4RJ3A 2JIVA 3MVLA 4AE9A 3GU4A 5DH3A 3SG8A 4HGTA 2NRYA 5L6OA 1WBNA 4F63A 1QPEA 3HVCA 5JFSA 5EH0A 2QQ7A 4RPVA 3SX9A 3RZBA 5FXSA 3EKNA 2PUIA 3Q6UA 3F3TA 2F57A 3NEWA 3ZO3A 2XK9A 5AP3A 2C47A 4EOKA 1KOBA 4OBOA 4O2PA 2C30A 4QMLA 4X2FA 4AQCA 2XNPA 3H4JA 2V7AA 3NUSA 2YDKA 2UW7A 3HUCA 1IG1A 3OMVA 3OROA 4O22A 2PUNA 3IPHA 2YCSA 3N51A 3OWPA 4R7IA 4FNYA 4M97A 5CSWA 1SM2A 2ZV7A 3VS7A 4FV0A 2BKZA 3NS9A 3R00A 2FH9A 3D2KA 4FT0A 3LMHA 1FINA 1I09A 4QT1A 1OPLA 2RFDA 3VQHA 2GQGA 3PY1A 3KRLA 5AUTA 3BE2A 5JFXA 1JAMA 4XV2A 3QTZA 3AQVA 2XNGA 3OUKA 4XBRA 4HVHA 3O8TA 4GU6A 5GIOE 5CS6A 2XH5A 4E4MA 3EMGA 2C5XA 4KA3A 4D2VA 3RNIA 3QQLA 5J7BA 5ACKA 4QP8A 3QUDA 4IM2A 1JKSA 2A0CX 1PXIA 2VTLA 5L2QA 3OWJA 3QYZA 2V0DA 4GT5A 3P7BA 5TOZA 1PXLA 5AMNA 3R7EA 4ZEGA 3QKKA 4H3QA 1ATPE 3A2CA 4B7TA 4BKJA 2BKKA 5ANJA 4XRJA 4BDGA 1BKXA 5CEIA 4QRCA 3DAJA 5TKDA 5JT2A 3ZFMA 1J91A 4EBWA 3KMMA 5FQDC 5ANOA 4TYJA 4FIJA 2O65A 4C33A 3Q4ZA 2QO9A 3QCXA 3COMA 3G9NA 1P4OA 4TXCA 4GIIA 5HO6A 3SAYA 1H24A 2UZNA 5D7VA 4OBQA 5TO8A 4NKAA 4U0IA 5M55A 2B9JA 2XEYA 4L3JA 3R8VA 5LMKC 2GQRA 3F66A 4G5JA 3HEGA 3MH2A 5AIKA 4WT6A 3P23A 2Y4PA 1PKDA 3DS6A 3BI6A 1PXMA 2HY81 4C02A 4HOKA 4C4JA 2X9FA 2FUMA 1S9JA 2GTMA 3II5A 3QHWA 3TG1A 3WZDA 1MUOA 2R3LA 3L8SA 5CAVA 3G6GA 4PV0A 3IONA 5KMOA 3LFNA 2PPQA 4PQNA 2ITVA 2WGJA 2WNTA 3ALNA 1IAHA 2X2LA 3MW1A 4RQVA 4OTIA 3GU6A 2ITPA 3H0ZA 3VHKA 2BAKA 3Q60A 2QHNA 3LXKA 1OIRA 2VGPA 3R30A 4HPTE 4BZDA 4FKOA 1IR3A 3FL5A 5BNJA 5J87A 1RW8A 3V8SA 4FGRA 1M2QA 2RFEA 4NTSA 5JQ5A 4XV1A 2BCJA 1JWHA 3BV2A 3R02A 4D0WA 2ITYA 3R9OA 5CF4A 3BQRA 4F7JA 4ZTMA 4YZNA 2W96B 5DI1A 3R1NA 2XK4A 4OTDA 5AR7A 4I5CA 5LWNA 5CANA 3U8WA 3QD3A 5IQCA 3PIZA 4ZLOA 4R1VA 3B2WA 4BDIA 1Y8YA 3A7HA 3QQFA 1PJKA 3ZSIA 4DGMA 3GC7A 5IU2A 2BVAA 3RPRA 4BDEA 1PMEA 2OXDA 4LOPA 4R7BA 3CIKA 1GNGA 3MH3A 3I79A 4GV1A 3D9VA 3REPA 1WZYA 2C4GA 4QPSA 5HX8A 1DS5A 2GCDA 3BBTB 4DLIA 4S30A 2VO7A 4F0GA 4EK8A 5HZNA 5L2IA 2VO3A 1YRPA 3CR0A 2PU8A 2OF4A 3W1FA 3ORIA 3EN4A 2VWWA 2QC6A 2P55A 5DR2A 4H58A 2R9SA 3FPQA 1H1PA 2PUPA 3P5KA 2OG8A 2W1DA 5DA3A 3MFRA 2OLCA 3OTUA 5L2SA 5AWMA 4WG3A 4H1JA 4ZTSA 3CTQA 3BHHA 3FWQA 5L8KA 1NVRA 4ZTRA 3EN9A 3H9OA 3SGCA 3NCZA 3NZ0A 2RF9A 5FLFA 2C6IA 3MFSA 5EK7A 4FV6A 2VTPA 2OO8X 2PZ5A 2YABA 2JBPA 3I6UA 1L8TA 1R1WA 4BICA 4XLVA 3NYNA 4YZCA 1IA8A 4TRLA 4EKLA 1GZ8A 4YO4A 4AW1A 3PWYA 3IDPA 2C68A 2BDWA 3ERKA 3IW7A 4AOJA 2QO2A 5HE3A 1OZ1A 1Z5MA 4FT9A 3A7JA 1XH6A 4S34A 3KMWA 3Q32A 1FOTA 4MXCA 3OUNB 1NVQA 4IZAA 4DFXE 4G3EA 4I6HA 2QOLA 5AP0A 1OKVA 4QYEA 1M17A 4MXZA 2UZEA 5FWKK 4O7ZA 2F7ZE 5H2UA 3PXZA 3MA6A 2VO0A 4W9XA 4MQ1A 5EG3A 4KUJA 5FM2A 4PNKA 4PMPA 3B2TA 2W99B 2Z7RA 4P5ZA 4JVGA 1YWNA 4B4LA 2J0LA 4CYIA 2X7FA 4I6FA 3RPYA 2Z8CA 4LRKA 4K0YA 2FYSA 1XBAA 5DT0A 5BVWA 4ANMA 2XUUA 3JY9A 2W9ZB 4P5QA 3PRFA 4RJ5A 3MY5A 1BUHA 4WD5A 4WNOA 3QA0A 3QRUA 3QU0A 1CDKA 4IX4A 4O38A 3FMJA 4FSUA 3R8MA 4I41A 5KKRC 3I1AA 2IWIA 4YUQA 5EM6A 5HCYA 4QYGA 3KULB 2BTSA 2XCKA 5AM7A 3VS0A 3G2FA 3WE4A 3TV6A 1XR1A 4AGCA 5I4NA 5KX8A 4ZXTA 2QOHA 5IA3A 4HGSA 5IDNA 3LKMA 3R1SA 3MPTA 5L6PA 4YGAA 4CG8A 4OTGA 2BIKB 3PFQA 1YVJA 4Y73A 5HHWA 5AAGA 2ZAZA 5CXHA 1ZXEA 4AA5A 2B1PA 2UZDA 3ORLA 4KS8A 3FKOA 3ORMA 3FLSA 3ALOA 4R3CA 4BGHA 4CLIA 5AR8A 1G3NA 3EL8A 4DH1A 4Q9SA 2W1IA 2CGVA 4BL1A 3VVHA 4FT3A 3PE2A 4I0TA 4DTBA 4B6LA 5BVKA 4NM7A 5A4CA 4EQMA 3S3IA 3QC9A 4WA9A 1LP4A 3I60A 3QX4A 4E4XA 5LMBA 4IBMA 2X6EA 2R2PA 4K6ZA 1M2RA 3RGFA 4ANLA 3UQFA 3NYVA 1SVHA 2QKWB 3TUBA 4YJOA 3DFAA 4I23A 1WBSA 1ZYDA 4FTRA 3NRMA 2YCQA 3PPKA 3PSDA 3H3CA 4GEOA 2W9FB 3DFCB 3DTCA 2WZJA 4IVBA 4YHFA 3UQGA 1XH4A 5FEQA 2F49A 4BCGA 2X2KA 3R1QA 3D0EA 3ET7A 4E6QA 2JD5A 3ORPA 2XIXA 3FKLA 3HP5A 2B0QA 4QMYA 4TNBA 3BIZA 3BV3A 4IE9A 4MX9A 4X3JA 2UZLA 5LJJA 1YXUA 2J5EA 3KN6A 4U3ZA 4LMUA 5GINE 4BTJA 3F2NA 1OUYA 1RQQA 2PVHA 3AOXA 3JY0A 2VWYA 4OTWA 4JR3A 1H26A 3KU2A 4E26A 4F9BA 3UO5A 5LCJA 3MTFA 4GKHA 4X3FC 1UU9A 4WBBB 2I6LA 5JKGA 2OJFE 3T9TA 2YIXA 4XG7A 5LVLA 5KMMA 3KRWA 4FZ6A 4C4EA 2B9HA 1OL1A 4EUTA 2WMSA 4O0YA 3R8PA 5KMKA 3CQEA 5HU9A 2QOQA 2BDJA 3SXSA 1JPAA 4J95A 1AD5A 3FMLA 4GVAA 1U46A 3WIGA 3DTWA 1OECA 4LGHA 4DTKA 1FGKA 5DN3A 3BGQA 3D7TA 3D5WA 4FKGA 4BCKA 3ZHPC 4JNWA 2XBJA 3UC3A 3WZJA 4XP3A 3ZO2A 3DBDA 2HYYA 4LOOA 4YPSA 3PJ8A 3BHVA 2QOFA 2W4OA 2JFLA 3ORNA 2CN5A 5EI6A 4FI1A 2XNMA 5H8GA 3JVSA 4F7SA 3L9LA 5L6WL 5JFVA 2BTRA 2GHGA 3RPOA 4FVRA 3UOJA 4OAUC 4FF8A 2GS7A 4A07A 2ITQA 2JDOA 2VWZA 3PZHA 4OTQA 4UWCA 3FI8A 3DZQA 4ACGA 4BWPA 2EXCX 2JEDA 3ULZA 4MBIA 4QQJA 3EN6A 3R8LA 1YI6A 3DB8A 3QTIA 3ITZA 4KKGA 4O91A 2YM4A 2IVUA 3JXWA 4YSMA 1OKZA 2Z7LA 3D94A 4ZTHA 3R7IA 5BVNA 3GOKA 5E90A 4GH2A 1KUTA 4CG9A 4FNZA 3FY2A 4GS6A 2YWVA 5DT4A 4IANA 2Q0BA 4C2WA 1UU8A 2VNWA 3E8CA 4O7SA 2ZV2A 5LMKA 5EW9A 3S2PA 5KMIA 1Q61A 3F2RA 2R3IA 4TWCA 3ZMMA 4BCNA 3KL8A 4MBJA 3TWJA 3ZC5A 3AG9A 4MF0A 3VWAA 3PVWA 2PL0A 4NEUA 4QMZA 4FKWA 4TY1A 5JQ8A 5IUIA 2PZPA 3A8WA 3LPBA 5KBRA 2IVTA 2WMBA 4MEDA 4XP2A 4ACDA 5LQFA 4DHFA 1WBVA 2PK9A 3H0YA 3COKA 3BGZA 4FX3A 3RK9A 5CT7A 3QTSA 3D14A 3SG9A 3MY1A 3ORKA 1RE8A 4FTAA 4OBPA 4QNYA 2B4SB 2WEIA 4MK0A 5L2WA 4X7QA 5CF5A 4XJ0A 1YXTA 2C0TA 3BU5A 4CFNA 1QPCA 1JSVA 4P7EA 3QTXA 4OTFA 4N4SA 3NSZA 4C4IA 3VUDA 4QQCA 5EFQA 5EQYA 3D5VA 4FKSA 3PJ3A 2NO3A 4LV8A 5JRSA 3VNTA 2YIRA 4BC6A 3CP9A 2OF2A 3PLSA 3EH9A 4KABA 3RTPA 4DC2A 3QZHA 4HZRA 3F5UA 4YHJA 4Z55A 1A06A 4ZAUA 3ROYA 2NRUA 3CTHA 5EOBA 3P0MA 4IX3A 3Q96A 5DRBA 2OSCA 5DGZA 3UVRA 5CASA 4UB7A 1OI9A 3DBEA 3IG7A 4KRDA 5HESA 4EONA 4KIKA 4QMTA 4JT3A 5FBOA 3FBVA 4FEUA 4NW6A 1IA9A 3GU7A 2RG6A 3E93A 2G1TA 3QRIA 2WTKB 4AFJA 4D2PA 5IA0A 3QQKA 4CFUA 5J5TA 3LXPA 2FGIA 4BDFA 2AC3A 5HNBA 4KSQA 3UOHA 3NUUA 4O84A 3Q5IA 4ZSAA 1V1KA 4UYAA 4MF1A 4WG5A 2W7XA 1YXVA 3TEIA 2WTDA 4E5WA 5GZ8A 5HX6A 2R3MA 2BAJA 4X2KA 4D4SA 1UNGA 4YU2A 3QF9A 4RIXA 5ANDA 2OI4X 1TQMA 3EIDA 4NFMA 1NXKA 3UVPA 2UZBA 2QOOA 4NW5A 4WIHA 3MTLA 4FSWA 3ROCA 1O9UA 5BQ0A 1ZYJA 3FZTA 4FTJA 4DAWA 5HGIA 5B2KA 3F5PA 3C0HA 3K3JA 3Q5ZA 4R78A 4IIRA 4X6QC 5IMXA 3SC1A 2CGWA 3AC4A 5EKOA 3UO4A 4CNHA 1BMKA 2IW9A 5CI6A 5CALA 5E4HA 3KF7A 2P4IA 2R5TA 4EOLA 5FTOA 4DINA 4CV8A 1VYWA 5CWZA 3ZLWA 3EQCA 2YISA 1Q3DA 1XO2B 3F7WA 1YXXA 1OBDA 3Q52A 3IW5A 1H25A 2J9MA 4EH9A 2BHHA 4F7LA 4XNEA 3R9DA 3PA5A 3TDVA 1P4FA 3FXXA 4FZFB 5BVFA 3VBWA 3TV7A 3SLSA 1IRKA 3OBJA 1QL6A 4AW2A 4R3PA 3TNWA 2DQ7X 1R0EA 2GNGA 2XJ0A 4QTDA 2VU3A 3BYUA 3JS2A 5HCXA 5KHWA 3F61A 3O8UA 5ANEA 4A4OA 3HL7A 1WBPA 4LQMA 2PZIA 3PPZA 2CJMA 4I94A 3CY2A 4DITA 5FXQA 4I24A 2JLDA 5CU6A 3GCQA 3HMPA 3GQLA 3HYHA 3KCKA 4IJ9A 4ZTNA 2VTQA 3F7ZA 3UJGA 4BKZA 2WXVA 4NTTA 5FDXA 2XS0A 3O71A 3PY0A 3RKBA 4PPAA 1REKA 1W98A 2W4KA 5AM6A 5FBNC 4MXAA 5A4LA 1ZOHA 1FBNA 4FV7A 4TWOA 3D15A 2W05A 5EYKA 3DK3A 4XCUA 1RJBA 3TZ8A 3ZUTA 4BCFA 5CI7A 3DA6A 2J6MA 4FVQA 1XH5A 3KY2A 2OU7A 3F9NA 4GYIA 3RAIA 4H36A 1NT2A 5IEVA 3E92A 4BF2A 5ACBC 4C58A 2O63A 4FV8A 2C5NA 4ZSLA 3BCEA 1IASA 2OKRA 5EHLA 3ENHA 3U4UA 3ZOSA 4AA0A 3NVMB 3B8QA 4NU1A 3KRRA 4EH7A 2QOKA 5KHXA 2X7OA 3LCKA 5IQGA 3MVHA 5M56A 4XG2A 4YP8A 1GY3A 4FZDB 4ZP5A 1PMNA 4F64A 3GFWA 3RK7A 3ORXA 5HE0A 3TJDA 2VD5A 3EKKA 5C1QB 4CZUA 1G5SA 1MQBA 3D5UA 3R0TA 2A19B 1YKRA 4C3RA 1GIHA 3HDNA 3BYVA 4W4XA 4E73A 2UW9A 2R0IA 3PY3A 1FMOE 4QYFA 2BRMA 2WQOA 4JDIA 3HZTA 2XKCA 4EOOA 4RJ4A 1L3RE 1B38A 3U6HA 4OTPA 3FY0A 5I9YA 2R3OA 4IACA 3W16A 3NIEA 2B54A 5FEEA 3FAAA 3E7VA 2NNWB 4UWBA 4F9AA 3TIZA 3NNWA 3TKUA 3V6SA 5DNRA 1KV1A 4KIQA 3VF8A 3VUIA 5AP7A 2QR8A 4CFFA 4DFLA 2FSLX 4E7WA 1I44A 5C4KA 5L4QA 4X3FA 2WB8A 2A1AB 4ZK5A 1Q99A 2Y8OA 3RINA 2XM9A 3VS6A 3DJ7A 3ZFYA 4CRSA 4G34A 4RLKA 1BL7A 4S2ZA 4KS7A 4AZVA 2YM3A 3MGYA 3N4UA 3L9MA 3UOLA 3BU3A 2WKMA 3OXIA 5M06A 1G8SA 3RHXA 1Y8GA 2XF0A 4GJ3A 1BYGA 4L43A 4WNMA 4EOQA 2I7QA 4O7LA 3C50A 1ZARA 3MJ1A 2YDIA 2O0UA 4HJOA 4LOQA 4TWPA 5AUWA 4O7TA 5I9WA 2R7IA 5CAUA 3TXOA 4GRBA 4Y46A 3P4KA 4YJUA 5HORA 5J1VA 4HCUA 1J7LA 2VO6A 5E8XA 3EHAA 2B55A 3EQBA 4MXXA 5LCKA 2YN8A 5FG8A 4U81A 5GIPE 4APCA 2CGUA 5CY3A 4Q5EA 4UMTA 5KMNA 3FMMA 3WARA 1OVEA 3IDCA 3O50A 3RP9A 4AGDA 4XX9A 3UTOA 3LJ0A 4JDJA 5HE2A 3T3VA 3R04A 4B8MA 4I0SA 1ZYLA 3OY1A 2Y4IC 4UYNA 2YIWA 3VN9A 2QLQA 2C6LA 4CFXA 4FIGA 3LFFA 4QNAA 1W0XC 4ZZMA 3ZDUA 4IC7A 2OJ9A 3HLLA 4U41A 4F6UA 2Z7QA 4HYIA 4QTCA 4O6EA 5AR2A 2Y7JA 5K4JA 2P0CA 4I6QA 4DF3A 3SOAA 4J7BA 2HK5A 4FOCA 5CAQA 1NA7A 5IG1A 1UA2A 4IEBA 4MWIA 3TUDA 5IQFA 3LVPA 4RVKA 5CSHA 5IKWA 4RA5A 4IAFA 1Z9XA 4BY9E 3LCOA 1U54A 4A9RA 2R3QA 5GJDA 4E6DA 3KREA 4CZTA 3LMIA 3PXRA 2VAGA 3AMBA 5KCVA 5EDRA 2P33A 2XJ2A 4E5BA 4QTBA 3OW4A 4L00A 4RFZA 1OIUA 5K3YA 1YDRE 4LRJA 4RWLA 1OL7A 2LAVA 1E1XA 4KIPA 2WMXA 4GUEA 3ZO4A 3W2QA 2CSNA 2YFXA 3CC6A 2C6TA 5FP5A 4HVGA 2VWUA 2WFYA 3ODYX 2QHMA 5C03A 3ID6C 1SNXA 2R0UA 1OITA 3GFEA 2ZV8A 1JKTA 3QWKA 4ZSEA 4E4LA 3NAYA 5E92A 4E20A 4F0FA 4D4RA 5L8LA 1HCLA 5LVNA 4JG6A 4BTMA 4G9RA 4KD1A 2HZ0A 2F7EE 4UWYA 3FYKX 3PVUA 1JOWB 4MNEA 1WBTA 2DUVA 1H0WA 4RBLA 4EWHA 3S00A 4FYOA 4FSZA 4GK2A 4PUZA 4KIOA 4IH8A 4S31A 4UBAA 3DQXA 3AT2A 4HCTA 4QP1A 2GHLA 3I7CA 4ZMEA 3EN7A 4Z3VA 3ULIA 4D1ZA 3QFVA 5E91A 3SQQA 3K3IA 4QP2A 1HCKA 2XIYA 1UV5A 1YDTE 2PMIA 3MH1A 4IFGA 4MD8E 3S1HA 1QCFA 4FV1A 4PDYA 3IDBA 1KE6A 4YLKA 5JEBA 1P5EA 4P4CA 3OOMA 1K3AA 3ZSGA 2BFYA 2ZB0A 2O3PA 4AZSA 2X39A 4JBPA 4FNXA 4L6QA 3NPCA 2PY3A 3DBQA 3GVUA 2YEXA 5ICPA 4CT1A 1WBWA 3BWJA 3NW7A 4WNPA 4U97A 1PMVA 3K5VA 3F3UA 4U5JA 3ZONA 2I0VA 2XZSA 3BU6A 3QRKA 3Q9ZA 4KBKA 3OWKA 2Y0AA 5A14A 4TW9A 4N70A 4TYHA 4USEA 4AA4A 1H1QA 2F2UA 3HMNA 3DDQA 5C8NA 1KE8A 4HW7A 3I0OA 3OW3A 4IJPA 4Z16A 4F99A 4TNDA 3AC2A 4LRMA 5F20A 5TT7A 4BFMA 2ERKA 4I93A 3S95A 1HOWA 2B7AA 4XV3A 3D83A 4DEDA 4IZYA 3OXTA 2CNUA 4RMZA 1YDSE 3BLRA 3CBLA 4IM0A 3AMAA 1R3CA 5J79A 4KRCA 4CLJA 1GZNA 3RVGA 3OZ6A 4EJ7A 2FA2A 4QMMA 2WTWA 4L3PA 3UPZA 3ZSHA 1V0PA 3P9JA 4L7SA 2CPKE 3ZO1A 2YM7A 4QYHA 4TZRA 3UYSA 4U40A 4M69B 5A3XA 3I81A 1V0OA 3HMIA 3PP1A 5HTIA 3R9RA 4AF3A 3GQIA 3LW0A 5CVHA 1G8AA 4J1RA 3VS1A 2OH0E 3KK8A 5CQUA 3C4EA 4O2ZA 5IUHA 2GNFA 3C4FA 3UVQA 3PZEA 3LCTA 4U42A 5AV0A 3UYTA 4KKHA 4IZ5A 4JDHA 5AX9A 2XNEA 4L53A 4CMUA 5LWMA 2J51A 2WPAA 3RWQA 3A7FA 2YACA 1YQJA 2XNOA 3NYXA 3Q6WA 4D55A 3H10A 3OHTA 4E6CA 5LVOA 5LVPA 2GNJA 1YXSA 4F6WA 4EK3A 2RFNA 2YERA 3BHTA 5C9CA 1WVYA 3H9FA 1J1BA 1OKWA 3UMWA 5FTQA 3LLAA 3WE8A 4O82A 3DNEA 2WHBA 4RC2A 4FODA 4AT3A 4UZDA 4L52A 2WD1A 3OFMA 2VTRA 3VUHA 4NCTC 4EK5A 4U9AA 5LOHA 3DLZA 4RIWB 4M15A 2YIQA 2W0JA 3QYWA 1JSUA 4W9WA 3UZTA 4GFMA 1FVRA 2E9UA 2VV9A 4FKLA 4TN6A 3LQ3A 3U54A 5M4CA 3E7OA 3VW6A 1XH9A 2JFMA 4II5A 4L42A 4O1PA 5AUYA 3WI6A 4ERWA 2QI8A 5ANKA 5CU2A 2VTTA 5HG7A 4IX6A 4O7YA 5EM7A 5DEWA 4EOSA 4RVTA 4BBFA 2XK6A 4F9CA 1ZMWA 3FI2A 5I3OA 4FV2A 2WAJA 3DXQA 2CNQA 1QMZA 1XH8A 2WTCA 2YITA 2WTVA 3F3ZA 1CSNA 3MN3A 3OBGA 4K18A 4RT7A 4ZS4A 5HIDA 2HW7A 3I7BA 3KQ7A 3QKLA 4D4YA 1PXKA 3ZM4A 4B99A 3WZEA 5DPVA 3VO3A 4IDVA 3AMYA 4CEGA 3GCPA 3IW8A 2CLQA 4ITIA 1H07A 1XBCA 4OLIA 4Y8DA 3VBTA 5IQEA 1BX6A 2XYNA 1WAKA 4M7IA 2QR7A 3DZOA 4JAJA 3UG2A 2YZLA 4MHAA 2H34A 1F3MC 1KE5A 4K2RA 5AX3A 4NM3A 3DV3A 3WBLA 5AUUA 1YI3A 5I9ZA 4X2JA 3IOKA 4BN1A 4F6SA 3PG3A 5JGDA 4PP9A 3VW8A 3SVVA 4O0TA 2VTIA 4UMRA 2GFCA 2JDRA 2CLXA 4GT3A 4JQ7A 3LFAA 3RJCA 2W06A 3HV6A 4BBEA 4U43A 3UBDA 4G3GA 4M13A 2VWVA 2JKMA 5FM3A 4DGLC 4R3RA 4IADA 3Q3BA 1U5RA 3ZZWA 5HLWA 1M52A 1FGIA 3W2CA 3F2AA 2VTMA 4MXOA 4LFIA 3GCVA 1BI7A 3IS5A 1S9IA 5KUPA 4RIYB 3VBXA 4C8BA 1Q8ZA 1H1WA 3JVRA 1Z57A 4LV5A 2VN9A 4RA4A 2P2IA 3PXKA 4D1XA 4FTUA 5AIRA 3DU8A 3RMFA 2QU5A 1Q8WA 3PA4A 4ITJA 4C59A 2YJRA 3RALA 5I9UA 3QTQA 1V0BA 4PL5A 4ACCA 2OJJA 3R7GA 3O23A 4JL9A 3ZCLA 4EK6A 4IB3A 1GOLA 4CV9A 4EHEA 4QMQA 5CTPA 2VWBA 3AT3A 5CENA 4WSQA 4UY9A 5H9BA 5I0BA 3FHRA 3Q04A 2UUEA 4C0TA
chains in the Genus database with same CATH superfamily
4C3FA 3UIUA 3GC9A 4AWIA 1O6LA 4L44A 1PXPA 2B53A 3W0MA 4EH6A 5DRDA 5AP4A 2WOUA 3QTUA 2PZRA 2XNBA 4N6YA 4OGRA 4XG6A 4YLJA 4W8EA 2X4FA 4I5HA 1NW1A 4PWNA 3QRTA 2FB8A 4O4BB 3VC4A 5M44A 2J5FA 4XP0A 5A9UA 1J3HA 5FUTA 3NX8A 3QHRA 3UIBA 3MYGA 2QKRA 3CKWA 3R1YA 3SW7A 2QODA 4V05A 3LJ1A 4FICA 4YJNA 3L8XA 4AGUA 5JGAA 2CDZA 3WOWA 1ZYSA 4BI0A 4D2TA 3U9CA 5HBJA 4YBKA 3FXWA 4MUQA 4B8LA 4BVUA 2YIYA 4G16A 4XV9A 2H8HA 2NP8A 4QP3A 4XG9A 4Y83A 2UW8A 3R28A 4WUAA 1Y6AA 1WMKA 2PZYA 4WOVA 3ZH8A 5AV4A 1YHSA 1YHVA 4OTHA 2EVAA 3VS2A 2FSTX 2XP2A 3D4QA 3G5DA 4I3ZA 4K11A 5KNJA 3PUFC 3LJ2A 3U51A 5BYLA 4YO6A 1VR2A 2PUUA 4TL0A 4I4FA 4ZY5A 2VTHA 3ZEWA 2PE0A 5TR6A 3M11A 5I3RA 4R77A 3OG7A 3AC1A 3R21A 2BRBA 2ITZA 2X6DA 3QGWA 3ZUVA 4BDCA 3R6XA 4NL0A 4A4XA 2RIOA 4UMUA 4RJ7A 3VJNA 1Y57A 4X2NA 2G01A 2PMLX 1CKJA 5I5ZA 4FG8A 3UMXA 2ZJWA 2IW8A 4IQ6A 3O8PA 3BYOA 1U4DA 2JKQA 5J1WA 4FC0A 4RX5A 5EQPA 3EB0A 1TKIA 3FJQE 3WILA 4HPUE 5L8JA 1Q5KA 2OXXA 4IB5A 5DWRA 2GNIA 3T8OA 4DYMA 2X8EA 3IGGA 5EOLA 3VUMA 3A99A 3UIXA 5IQIA 4LG4A 2C69A 3M1SA 3NNUA 3PE1A 3SDJA 2XARA 5M09A 3QL8A 5DLSA 3G51A 2C5OA 3EFWA 3FMNA 2WOTA 3NNXA 4L46A 1XBBA 3V8TA 3N4VA 5E1SA 4I20A 5CAPA 3L9NA 4MVFA 3QXPA 4A4LA 2ZOQA 1U5QA 2R3PA 3EZVA 5IQBA 4QQ5A 1YOJA 4AAAA 3QQGA 4BCQA 3A4OX 3EQDA 3EQFA 4XOYA 4PMSA 4H1MA 4B9DA 3MVJA 5HLPA 4EH5A 4BZOA 3KK9A 2V55A 5IA2A 3E88A 3HAMA 4J97A 4E1ZA 4EH2A 3RAWA 2I0YA 4IAIA 4K9YA 4MBLA 5HIEA 2VTNA 1VEBA 2HAKA 4ITHA 3DNDA 3OCGA 4OR5A 4BZNA 3EZRA 2Q0NA 3W8QA 3UDZA 2Y6MA 2PULA 3FMKA 3CKXA 4DDGA 1YWRA 1PY5A 3NUXA 1OKYA 3GUBA 4L45A 4PX6A 5DIAA 4ASEA 3P5JC 2DWBA 3PRIA 4O7NA 3CSVA 4CTBA 3DBCA 3E8EA 1OMWA 3VS5A 5IF1A 2XMYA 3Q9YA 3COHA 1URCA 5HBEA 3VBVA 3AD5A 4PTGA 4E93A 4DEAA 1XJDA 2H9VA 2BRGA 3FPMA 4EOJA 4BKYA 2ZVAA 4CKJA 4FKTA 4KINA 3IO7A 2IVSA 4U3YA 3V8WA 2PVKA 2X2MA 3UNZA 5F9EA 2CGXA 4XUFA 3V51A 4UXLA 4FSQA 4V04A 4QP7A 4W4YA 4Y72A 4JG8A 2WTJA 4BWKA 5DYJA 1ZZ2A 3D2IA 1Q4LA 3KB7A 5DT3A 4XMOA 5IA1A 2BROA 2PTKA 3BYMA 1FQ1B 5E9EA 2WTKC 2QLUA 4ZTLA 4WO5A 4EZ7A 1P2AA 3HP2A 5G1XA 2WEVA 3R7OA 2WQMA 5K0KA 3IKAA 1JKKA 2OBJA 4MWHA 3TIYA 2NYAA 5A6OA 4PDOA 5HOAA 3NNVA 4GKIA 4LGGA 3MWUA 2FVDA 1IEPA 3NVKI 4PF4A 3AD4A 4X21A 1H1SA 3D7ZA 5IEYA 4FK3A 3CGFA 3TJCA 2XJ1A 3ZTXA 1M14A 1WBOA 3R7YA 1CKPA 4MH7A 4EI4A 3NAXA 2HXQA 4DBXA 1JKLA 3PIXA 4H05A 2HZIA 2WMAA 2IO6A 4QP6A 4NJ3A 3CJFA 3SA0A 3UPXA 3G0EA 1LEZA 3F82A 4FE2A 4LDTA 2WELA 5CLPA 5TF9A 4L01A 3C0GA 3FXZA 3RK5A 4U6RA 2A2AA 3G0FA 4FSMA 1JNKA 2RSVA 2ETKA 4ZZOA 3PA3A 3GOPA 3QA8A 4X3FB 2J0IA 3O5AA 4NZWB 2YLFA 3A7GA 2QCSA 4JRNA 4OTRA 3W10A 4V0GB 3KXGA 4QP4A 3G90X 3DY7A 1H4LA 1T45A 3WF5A 4BCPA 2CCIA 1Q8UA 3MA3A 3P7AA 4D1SA 5AEPA 2VUWA 4G3DA 3ZS5A 4DEHA 3NDMA 4NWMA 4JQ8A 4Z7GA 4FSTA 2VX1A 5HTCA 3UP7A 4Y85A 5DFPA 2QD9A 5D12A 2WMTA 3E3BX 1R0PA 4NCTA 1BLXA 3K2LA 4BI2A 4ANOA 1YI4A 4GW8A 3VBYA 1APME 3QZIA 5M4FA 4EH3A 2IZUA 1O6YA 3G33A 2PYWA 3C51A 3WF9A 2PVNA 2BFXA 2Y9QA 3UDSA 3RBWA 3DGKA 4XG3A 4UXQA 2JIUA 1DAYA 4ENXA 1ND4A 4BBMA 3QZFA 3DJ5A 3GCSA 5FRIA 5AJQA 1DI8A 1OUKA 1OL6A 1JSTA 3QLGA 3VHEA 1XQZA 3A7IA 3QQHA 4I5PA 3ZLXA 1RDQE 2EUFB 5H8BA 4ASXA 2W17A 3MPMA 1H28A 5M4IA 3CGOA 4IDTA 4D58A 4F1OA 5AA9A 4JMQA 3PSCA 4O7RA 4FTMA 3UZPA 4UMPA 5ANGA 5BPYA 2OWBA 3DXNA 5JZJA 3UQCA 2W1HA 4Y95A 1CTPE 3W0OA 2XIRA 4HVDA 2ZM3A 2R3FA 1YW2A 4RWKA 1MP8A 2P2HA 3FMEA 1ZMUA 4Y5HA 5JSMA 4CGAA 1K9AA 4ASZA 5CZHA 2XAOA 3C4CA 2XBAA 4Y5QA 4AQKA 2BZIB 2DYLA 3R63A 5JZNA 2ERZE 4HNIA 1ZLTA 2XK7A 4YHTA 5EYCA 1R78A 4DEIA 2JDTA 2A4LA 3F3VA 3KGAA 3WYYA 2XA4A 5JH6A 4NFNA 2FSOX 2QURA 4G3CA 4LUEA 3B8RA 4YJVA 4YZMA 3AGLA 3TT0A 4QMNA 4M0YA 2R3HA 3U4WA 4BHZA 4WUNA 3W33A 3LXNA 2ITUA 4EKKA 2Y6OA 4KKEA 3EQGA 4FV9A 1H00A 4USFA 3MBLA 5E7RA 2PVYA 5F4NA 5AR5A 3BLHA 4EH8A 4ORKA 3LFDA 4PP7A 2YM6A 2ITWA 2PE1A 2YZAA 5JK3A 1TVOA 4BI1A 2OZAA 2OIBA 1YWVA 4KB8A 4CCBA 1KWPA 2ITXA 2Z2WA 4G2FA 4D4VA 4AN3A 5AAFA 5KZIA 2YCFA 4QTAA 3LXLA 4RWJA 3WF7A 3TI1A 2QOCA 4MYGA 1Q3WA 4L67A 2CN8A 5HG9A 2C0IA 3FLNC 3MFUA 2F2CB 3OWLA 3FLZA 2XRWA 3DT1A 4K33A 1Y6BA 4FZ7A 4BIBA 4EHGA 4EEVA 4PPBA 4L3LA 5IQDA 2G15A 4WG4A 3LM5A 5C4LA 2AYPA 3K5UA 4RVLA 3ZLYA 4F09A 3R01A 3CXWA 4QD6A 2RL5A 5DVRA 1Y91A 4C37A 2IN6A 3GXLA 4BB4A 4ZMFA 5ETAA 4YSJA 3HA6A 1P14A 2IZRA 4GU9A 4AOIA 4UX9A 2X8DA 5K5XA 3QWJA 3OCBA 5J95A 3FI4A 4ZY6A 3FLYA 3KEXA 1PYXA 4YJSA 2C3IB 4ZJJA 2E2BA 4W8DA 4TYHB 5CEQA 4JJRA 5HU3A 4FZAB 4HZSA 4GVJA 3CS9A 1MRYA 3C4ZA 3CD3A 3UOKA 2QOIA 4O0WA 4G31A 2C1BA 4YC3A 3P78A 4NJDA 4BDDA 4Z9LA 4GG7A 2FSMX 5C26A 5L2TA 4O7VA 2XK3A 5M57A 3VQUA 3TL8A 4FIFA 3HV5A 3FEGA 4EBVA 4DGNA 3GC8A 3PPJA 2BUJA 3GC0A 1PRYA 3UNKA 1ZMVA 2KTYA 4YZ9A 5TE0A 4CKIA 4R6VA 2YHVA 3NYOA 5AFVA 5M07A 3MH0A 1TQIA 3LOKA 4XG4A 4AFEA 3S0OA 5BMMA 2XAMA 3F5GA 4O1OA 2H6DA 3FV8A 4Q2AA 4RJ6A 5A6NA 5BUIA 1LUFA 2Z60A 3SV0A 5D9HA 1H1RA 3LAUA 2O64A 4U79A 2QG7A 3BLQA 1W2FA 4FV4A 5H3QA 1PYEA 2AUHA 2ZB1A 4IFCA 4ANBA 2UVYA 3OY3A 4TYEA 1KE7A 3MY0A 4KNBA 2ZM4A 3V01A 4ASDA 3QZGA 4JQEA 4IVDA 4PRJA 4WKQA 4MD7E 3RCDA 2A98A 3GU5A 4AGWA 4R8QA 3KVXA 3I6WA 3L8VA 2XKEA 2WIPA 4QMWA 2HZNA 3QKMA 3V5QA 4GUBA 5HVKA 3F69A 5IQAA 3DKFA 1E1VA 5HTBA 3AC3A 2VTSA 4DCAA 3ANRA 3EN5A 1ERKA 4OUCA 4CCUA 4D2WA 2WQBA 4OT5A 2BALA 3LHJA 3BL9A 5J9ZA 3IGOA 4FSRA 4BHNA 1J7UA 3R7VA 3WF8A 4DHJA 3ACJA 1FVTA 3K54A 4M68A 4F9WA 4CQGA 3DQWA 3QQUA 2GS2A 2IVVA 2WQNA 3MIYA 4IC8A 3ORTA 5AP1A 5EHYA 3W8LA 4ALVA 3KF4A 5IA5A 2XKFA 5HO7A 2WMWA 2UW0A 3VF9A 5DHJA 2Z02A 4QMVA 3RNYA 3RM7A 1FVVA 3CE3A 1MRVA 3CQWA 4DFYA 1W83A 3D5XA 4QPAA 3SHEA 4DH7A 4I21A 5GZ9A 2ETRA 3NW6A 4RIOA 1MQ4A 4I4EA 4C2VA 3ZXZA 4I5MA 2XIKA 3BZ3A 3CPCA 4ZY4A 4PTEA 5ETCA 5F94A 4HYSA 4NKSA 4BWXA 4PDSA 3N9XA 3R83A 4DG3E 3IW6A 3UNJA 2J50A 2IG7A 2Q83A 3PJCA 4RGJA 2X81A 5CSVA 5E8TA 2X7GA 3FHIA 3O96A 1KOAA 3OP5A 3HRFA 4L9IA 4F1TA 4CZYB 3MVMA 4QYYA 5E8VA 4FOBA 4AE6A 5BX0A 4XRLA 4BGGA 5IEXA 3R2YA 2G9XA 1FMKA 3AGMA 4DLJA 2FO0A 5AR3A 4C4GA 5E8YA 5J7HA 2EU9A 2B9IA 2PMNX 2OFUA 3FLWA 4G9CA 4IAAA 2WIHA 3CLYA 3GB2A 3R8ZA 3QCSA 4C57A 3BL7A 1VYZA 3VJOA 4AN2A 3CCNA 3PLAE 2XVDA 5DG5A 4F0IA 5EKNA 3PG1A 4FUYA 5DMZA 4XH6A 3NUNA 4FKQA 4YBJA 4BCHA 1W2DA 4O0VA 4XHKB 4L68A 3E3PA 4C7TA 3CPBA 4EC8A 2ZM1A 4AN9A 5CEMA 4J98A 3ZU7A 4DCEA 4ZOGA 5DR9A 4YR8A 4EOIA 3IECA 2J2IB 2WU6A 3E8DA 2XRUA 4QMPA 1W84A 3VULA 2GU8A 4N0SA 2CKOA 4QO9A 3L8PA 1NVSA 3NCGA 4RX8A 4EUUA 4JLCA 1OB3A 3R22A 3ZRMA 2QO7A 3QGYA 3DXPA 2RG5A 3TTIA 4D0XA 3FYJX 4NM5A 4DG0E 4EOMA 1G8JA 1ZY4A 5AP6A 5KO1A 5E8UA 3TM0A 2PWLA 3G6HA 3QALE 3VUKA 3EJ1A 2OIDA 4IAKA 4QMUA 2BHEA 3KVWA 5EQEA 4ANSA 4FK6A 4YNEA 2PVLA 5CF6A 4FV3A 3G9LX 4D9TA 3W2SA 3LMGA 1K2PA 3KCFA 2HIWA 3LFSA 2XB7A 5DOSA 4BTFA 3QD4A 1JVPP 4AZTA 1ZAOA 5CSXA 5BYZA 5K4IA 2X0QA 3MV5A 5CSPA 3DJ6A 4HYUA 5AV2A 3BHUA 4HGLA 4MQ2A 3SD0A 1BI8A 1NY3A 4R1YA 4E3CA 3W0SA 3TNHA 3RM6A 3N4TA 2C6DA 4O81A 2GQSA 4AP7A 3DAEA 4FVPA 3QLFA 4EL9A 1LR4A 5BUJA 3LQ8A 4ZSJA 2GMXA 2UZVA 4R5YA 4WSYA 3BWFA 1SYKA 4H39A 4IB0A 3V5LA 4MD9E 4L7FA 4FR4A 3UDBA 4BDKA 2Y4IB 4YJQA 2CNVA 2X4ZA 3ELJA 3V5PA 4GCJA 2GNLA 2HY0A 2XIZA 4NIFA 3H30A 2VZ6A 4W4VA 3W2OA 5D10A 3OTVA 3EQRA 3BPRA 2GPHA 3NMUF 4BTKA 3ZYAA 4YJPA 3PYYA 3ZM9A 4MNFA 3V04A 3BHYA 3BKBA 3ACKA 2J4ZA 3FLQA 2F4JA 3CQUA 3P7CA 2DS1A 5A4QA 5J9YA 2REIA 1PXNA 2V7OA 4WHZA 1PKGA 3UG1A 2W5AA 4O7WA 1GZKA 4O96A 3A4PA 3FZRA 4NM0A 2X9EA 4G1WA 4FTIA 3ZC6A 3HRBA 4EYMA 2PVMA 3C5IA 4CTCA 4GFGA 1XHAA 2UW5A 4A9YA 4MTAA 3T3UA 4BCIA 2QONA 4U7ZA 3CTJA 4F9YA 3DKOA 4WBOA 2J0JA 3BYSA 4JBOA 5AUZA 2IW6A 4JBVA 4JX7A 5GJFA 5HG5A 3MS9A 3THBA 4J8NA 4M3QA 4RLLA 5CQWA 5EDQA 5IUGA 2W1ZA 3MESA 5G6VA 4IAZA 3FSFA 3FZSA 4HNFA 4AXAA 3A60A 4F65A 4HVSA 2ONLC 3LE6A 4N57A 3NUAA 4QMSA 1Q97A 4XG8A 3EQPA 5B7VA 3WZUA 4FEQA 4RJ8A 5BVDA 5IQHA 4X0MA 2VWIA 5GJGA 3SOCA 5GZAA 5FD2A 4FSNA 3OEZA 4R7HA 5HEZA 2O2UA 3FZ1A 1W8CA 5HE1A 4K77A 1G8KA 1QPDA 3BE9A 5F95A 4APPA 4KBAA 4ZIMA 5IH4A 4FTTA 2X1NA 2UW3A 3D7TB 4YC6A 3IK3A 4FTNA 3EFKA 5HD4A 3C7QA 4RQKA 3NW5A 1A9UA 4O0UA 5T6KA 2R3KA 2UVXA 3OC1A 4FMQA 4FEVA 3Q4TA 3LFBA 2B9FA 4F78A 2R4BA 3UODA 5AV3A 3SRVA 3KC3A 3FMDA 4CYJA 1W82A 4IB1A 5A54A 2OIQA 2IZSA 1ZOGA 2CMWA 3MFTA 3WF6A 4FL3A 5C8KA 3RPSA 3I4BA 5CU3A 1OPJA 3FZOA 2ACXA 3KKVA 4IAYA 4MAOA 2BILB 2ITNA 2P3GX 4G17A 5B2LA 3L1SA 5C01A 3LFQA 3KFAA 3QD2B 2C6OA 4TWNA 1XH7A 1URWA 4EHVA 3ODZX 4ZS0A 3KMUA 2V22A 5M53A 2HWOA 5M08A 4CVAA 3KXZA 4BRXA 2XM8A 3ZXTA 4ZJVA 3BEGA 1W2CA 5CNOA 4W4WA 4JXFA 3VRYA 3EQIA 4UV0A 4GK3A 4AT5A 2PVJA 2X0GA 4JIAA 4OW8A 2OXYA 3RCJA 4TYGA 5T3QA 4DEEA 5GNKA 4LV7A 4J71A 4D5HA 4ALUA 2JAVA 4IVCA 5EI8A 4O0XA 3EOCA 4FTKA 3QTRA 3EYHA 3EFLA 4JIKA 3FKNA 5FXRA 2PSQA 4G6OA 4CFWA 4AG8A 1CKIA 2JGZA 5IH5A 3E5AA 3LZBA 2C5VA 2CHLA 4LUDA 5BMSA 3C5UA 3VAPA 2VRXA 1PW2A 5HNIX 2HENA 1EH4A 2RKUA 4JX3A 2V5QA 5CNNA 5ETIA 3KRXA 3KA0A 3MI9A 4F70A 4ZJIA 2KULA 4RZWA 4AS0A 2AC5A 3UP2A 4CFMA 2YWPA 4QDEA 4O0SA 4IZ7A 4D9UA 3FMHA 4U45A 4HCVA 5HNGA 2WQEA 5CVFA 3FZPA 2XK8A 4BDAA 3ANQA 4EYJA 3QRJA 3GENA 4NSTA 1TQPA 4CD0A 3BBWA 3TACA 3GI3A 4LMNA 3JR1A 3RAKA 4J8MA 3PXYA 4EQUA 3KRJA 1Q8TA 1WVWA 4KBCA 5BUEA 4O86A 4G5PA 3HGKA 5K5NA 3RI1A 3OT8A 2WU7A 3HV4A 5HO8A 3W2PA 4CKRA 4DGGA 4CRLA 2IPXA 4IWOA 4M12A 3ZUUA 2OK1A 3PJ2A 2BRNA 4LL5A 4EZ3A 3G15A 2J7TA 3I5NA 5JFWA 2ZMCA 4DE4A 1YOLA 1OBGA 5IMEA 4FYNA 3QBNA 4M84A 4KIKB 4FL2A 4G6NA 2OFVA 2BZKB 4C4FA 1YOMA 1MRUA 3DB6A 3BGPA 4R5SA 4AOTA 1B39A 3V3VA 4RSSA 5A46A 3LQ5A 1WCCA 4E4NA 3TZMA 2X8IA 4D2SA 4UALA 4ZLZA 4NYEA 4HGEA 3FDNA 2C1AA 2A27A 2W1GA 4RFYA 3HKOA 5FGKA 2C5YA 2W1FA 3C0IA 3HECA 5T68A 3W2RA 3DBFA 4QTEA 4RG0A 2ETMA 2NPQA 2G2HA 3GCUA 2JKOA 4HYHA 5HI2A 3U9NA 4BIEA 2J0KA 2UZWE 4RIXB 1PMUA 3KN5A 4O4EA 2IJMA 4B0GA 3MPAA 4C4HA 1KE9A 3SXRA 3TCPA 4CQEA 1JQHA 4DFBA 3DKGA 4YPDA 3U87A 4GMYA 5E8ZA 3JYAA 3H9RA 5CT0A 5EDPA 3R9HA 2EB2A 1OIYA 2BZJA 1CM8A 5D41A 4JDKA 1J1CA 3ZDIA 5IISA 4DT9A 4YLLA 1KV2A 1OGUA 2VTOA 2J90A 5JMSA 4BJJA 2BR1A 4GSBA 3S4QA 5EHOA 2HOGA 3C13A 3FUPA 4P90A 4BDJA 3EWHA 4E8AA 4C34A 2V62A 5D1JA 4GK4A 4RC3A 5CEOA 5HLNA 3UZRA 3ORZA 5LXMA 2VTJA 2R64A 1DAWA 5ITAA 4ERKA 1OPKA 2OICA 2E9PA 5EYDA 2HELA 2R3GA 4A06A 5CU4A 2QOBA 2OZAB 2UW4A 4FKRA 4IWQA 4WRGA 5EI2A 3QC4A 4FTCA 4Q5HA 4FKIA 3VUGA 4TT7A 3E63A 3OT3A 3I0QA 2OJIA 3MSSA 2ZDTA 2G2IA 4M69A 3QUPA 4U80A 3W55A 1PF8A 4Q9ZA 3DAKA 3JPVA 1LPUA 2GNHA 2WTIA 3LCSA 4V01A 3I5ZA 1LEWA 4FKPA 4AZEA 4KWPA 2HXLA 3E64A 5KKRB 2OJGA 3PWDA 4MXYA 3GGFA 2UVZA 3ZBXA 2RGPA 3DLSA 1O6KA 4LYNA 3V5JA 3VS3A 5KMLA 4FEWA 5DE2A 5C27A 3RPVA 3LFCA 3NGAA 3ZBFA 2HCKA 5FTGA 4PDPA 3AXWA 4RWIA 4M67A 3ENMA 4QQTA 4YC8A 1H8FA 2PMOX 3IW4A 1OGYA 3NFFB 4DA5A 4H3BA 1T46A 3HNGA 4BYIA 4CMOA 2CKEA 2JIIA 3FQEA 4IM3A 3PIYA 4NUSA 4FGBA 3CJGA 1R39A 2R3RA 4TYIA 3RZFA 2ITTA 4NH1A 3FE3A 4RIWA 4M14A 3DK7A 3OS3A 3VUTA 5CU0A 1Q8YA 3PVBA 4LGDA 3R71A 4RX7A 3O2MA 3Q4CA 3E62A 3QCQA 4EC9A 3U6JA 5HVJA 4G3FA 4YZDA 4DEGA 2CKQA 2E9VA 3LIJA 4GT4A 1ZZLA 3Q9WA 3TNIA 4FA2A 4PMTA 1WVXA 4O0RA 4DEBA 2C3JA 4UZHA 5KBQA 2BAQA 5AUVA 4ANQA 4QMOA 3OVVA 4F4PA 3TDWA 3TKIA 3M2WA 1U59A 2HWPA 3QCYA 4PY1A 4DFUA 3GEQA 2ZDUA 3BELA 4DT8A 4UEUA 3GNIB 4PNIA 5HIBA 3TNPC 3KXHA 1GIIA 4J99A 5IA4A 2EXEA 3GBZA 3AD6A 3PUPA 4N6ZA 2WMRA 4FJVA 3O7LB 4FUXA 3QXOA 2W1EA 3NUYA 4LL0A 3LCDA 3P1AA 3AC8A 4C3PA 4YMJA 1OL2A 2QU6A 1CMKE 3LM0A 4OT6A 2EB3A 3MIAA 3GU8A 4F1MA 3PVGA 4M8TA 4IVAA 4RFMA 2EWAA 2C6MA 3SXFA 2XYUA 3FSKA 1UVRA 4Z7HA 1UU7A 5HQ0A 4PPCA 4IXPA 4I92A 4IWDA 4I0RA 4BGQA 3DPKA 4C38A 3SKCA 4JS8A 1STCE 4EWQA 2ONLA 3BX5A 5K0XA 3F88A 4D2RA 3OEFX 3A61A 1Q62A 1H01A 4EJNA 2HW6A 3NIZA 4U8ZA 5HD7A 4DH5A 3HA8A 1UWJA 4YTCA 2JC6A 4FG7A 4JAIA 5L3AA 3C9WA 5AP2A 4FKVA 3LFEA 3R73A 3A62A 5D7AA 4K1BA 4X6RA 5AV1A 4EQCA 4EHZA 3DDPA 3HMMA 4FIIA 5I9XA 1BL6A 3E87A 4H3PA 3OXZA 2UZTA 3C4WA 3PSBA 4M66A 4RIYA 4RVMA 2VX0A 4BDHA 4BYJA 3HMOA 5EM8A 2PE2A 2RFSA 1PXOA 4EZ5A 3CEKA 4FT5A 3MB7A 3MJ2A 3M42A 5A4TA 3ML1A 1XKKA 2VNYA 2YM8A 3VRZA 4AW5A 4JBQA 5BVEA 5ANIA 5AADA 4BR3A 3FL4A 4A9SA 1UU3A 4F08A 4A9TA 5ETFA 3GT8A 4FSYA 4YNOA 4NT4A 4KSPA 3ZLSA 3P08A 4GFOA 3FQSA 3PDTA 3R2BA 4YJTA 1ZWSA 2O5KA 4YURA 5CZIA 5J8IA 4FV5A 1JBPE 4BIDA 1ZRZA 2ZV9A 3KULA 3F6XA 4G6LA 2BDFA 2WMQA 3KXMA 2YJSA 5FP6A 1YHWA 2XEZA 3OCTA 3PTGA 3C1XA 4O21A 4PL4A 5DBXA 5K9IA 5CEPA 5E1EA 3LLTA 3QUEA 1UKIA 3PJ1A 5JGBA 3NWWA 2F7XE 4DG2E 3V5WA 3UIMA 2BZHB 5AUXA 4FL1A 2JDVA 3RHKA 1GJOA 4O6LA 4S33A 5FEDA 4A7CA 5BYYA 2R3JA 3NR9A 4I1ZA 3TKHA 3A8XA 1U54B 3EQHA 1OL5A 1SMHA 2QNJA 2GSFA 1AGWA 1GIJA 3OCSA 3R8UA 4AACA 4C62A 3EL7A 5F1ZA 4GIHA 4AX8A 2E9NA 4QOXA 4D28A 4YTHA 4C36A 5FDPA 4DN5A 4IMYA 4FNWA 4F7NA 3ZFXA 2H96A 3WIKA 2HZ4A 2E9OA 2WMVA 1IAJA 4ZSGA 4IX5A 4RZVA 3RAHA 4AZFA 3DKCA 5CVGA 5CX9A 3ZZEA 1M7QA 3HRCA 3QX2A 2I40A 2XKDA 3FC1X 3RWPA 3JUHA 3W18A 4E5AX 3QTWA 3TUCA 3MB6A 4CXAA 2UW6A 4DH3A 2JAMA 5C8MA 4JOAA 4MNEB 4DBNA 1SVEA 3CY3A 4TKSA 2GHMA 2BRHA 5BVOA 3U6IA 3ATTA 3BRBA 4CFVA 3AT4A 2ESMA 3T9IA 4AT4A 5IPJA 4JRVA 1SNUA 4ZLYA 4ZZNA 1PXJA 5E8SA 4PTCA 4AW0A 1KSWA 2PHKA 3KXNA 2VTAA 2YM5A 1X8BA 5DEYA 5AR4A 2VGOA 4I22A 2EXMA 5M4UA 4J52A 4A9UA 4FRFA 1DI9A 4QMXA 3WYXA 3TZ9A 4PMMA 3FI3A 2GTNA 1E9HA 4JI9A 1M7NA 3CD8A 3HV3A 5HBHA 4O83A 1VJYA 4WRSA 4RRVA 4IWPA 2C6KA 4ARKA 2UZUE 5IDPA 4FEXA 3O17A 4J53A 2OW3A 4YJRA 3ETAA 1J7IA 4CSVA 2ITOA 1UKHA 1PHKA 3FC2A 5GHVA 4DFNA 1VLRA 4QPMA 2GS6A 2JDSA 2B52A 2UZOA 3UC4A 5CYIA 4BCOA 3ZEPA 4TPTA 5H8EA 4NIFB 2QVSE 3BQCA 2C0OA 2JKKA 4KAOA 4C61A 2R3NA 5AP5A 2VWXA 4FKUA 4JR7A 2QG5A 4EH4A 3EYGA 2I0EA 4JG7A 5LARA 4IW0A 3R9NA 2UV2A 1Q41A 1REJA 5AAEA 5CF8A 5JN2A 2W5BA 3VIDA 4CT2A 2XCHA 3OOGA 2CCHA 5J5SA 3Q9XA 3QQJA 2OH4A 4FT7A 4DGOA 4XEYA 4XS2A 1OIQA 2XNNA 4EK4A 3AC5A 4HVIA 4FG9A 4MCVA 4XBUA 3HAVA 5EM5A 4ACMA 2CKPA 3VS4A 3PP0A 4AXDA 1F0QA 1AQ1A 2C6EA 2C3LA 3F5XA 4K8AA 4ONAA 4ENYA 4YTFA 2G2FA 4J96A 3VBQA 5E8WA 4FTOA