4PTEA

Structure of a carvoxamide compound (15) (n-[4-(isoquinolin-7-yl)pyridin-2-yl]cyclopropanecarboxamide) to gsk3b
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
341
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDFKNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of new acylaminopyridines as GSK-3 inhibitors by a structure guided in-depth exploration of chemical space around a pyrrolopyridinone core.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 341
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pteA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pteA01
1J7LA 4GFOA 3BQRA 3MTLA 4I94A 3ERKA 1XH5A 4OBPA 3ORTA 5J5SA 4DEGA 2WFYA 3VRYA 4KRCA 4GIHA 4BCHA 3OCSA 2RFDA 1GNGA 2HWOA 1YDSE 3C51A 3R22A 1B6CB 2YCSA 3DT1A 4HPTE 4LUEA 4RFMA 2PE1A 5A3XA 2J9MA 3SX9A 3IKAA 3P23A 3QX4A 4ZS0A 5HEZA 3QKKA 3LCTA 1APME 4FL3A 4X2NA 2VTAA 3SOAA 4CT1A 4K9YA 5DR6A 5KNJA 2GQGA 1BUHA 2IVUA 3BU5A 4DC2A 1UV5A 2JDSA 3MSSA 3FMKA 2C0OA 1BI7A 3OP5A 4L67A 2WTCA 3P1AA 4H1JA 3TUCA 1CMKE 1YHVA 4II5A 4FGBA 3BLHA 4GJ3A 1WBOA 4N0SA 5CEOA 1Y57A 5AV2A 4BDHA 3LIJA 4RJ4A 4XOYA 2HW6A 1XH6A 3KXGA 5FEEA 5L2TA 4YJRA 2RF9A 3RPYA 2BAJA 2QOQA 5GIPE 4QNYA 4Q9ZA 2I7QA 4EOLA 2W7XA 1WZYA 4YZNA 4IE9A 3ZO4A 4AGDA 5BMSA 2R3LA 4DFBA 1ZYCA 5CQUA 3C7QA 2CJMA 4YJQA 4DH1A 3KKVA 3NNXA 1PMUA 4O2ZA 2ITVA 2QO9A 3KN6A 1GZOA 3ZS5A 2JKOA 4AF3A 4IZAA 5AUXA 3PJ8A 2R7BA 4GT5A 3TZMA 4FV6A 4R8QA 4L45A 4QPAA 4ANQA 3TJCA 1W8CA 4ZMFA 2BRNA 2JIVA 4BI1A 5H8EA 1OI9A 2CKQA 5KZIA 4I21A 5E8YA 1BMKA 4IQ6A 3O7LD 3FZOA 2IWIA 4N6ZA 4XOZA 4JBVA 4AACA 4JG6A 1XWSA 4QYYA 3L1SA 3HV3A 4YJPA 2QLUA 3HMIA 2XIZA 3DAKA 4LL5A 2GTMA 2J5FA 4P7EA 3WZJA 5T6KA 2E9OA 4TYIA 1UNHA 1U4DA 3DNEA 2WNTA 3JUHA 5BVKA 3U54A 2WMBA 4G5JA 1JKSA 3ZRMA 3FEGA 4Y5QA 2PMLX 4WSQA 2RG6A 3NPCA 5C9CA 4DGGA 4QP6A 2YITA 2UVZA 4D58A 4O83A 4I6BA 4DG3E 3H30A 3BWJA 3VUKA 4NKSA 1SZMA 2BRMA 3EQHA 3LFAA 5IUHA 5LCJA 3SW7A 4F9YA 3VVHA 5IH4A 4GKHA 3FL5A 3GOKA 3TG1A 1BYGA 3P08A 3QGWA 5IA1A 4KIKB 4BHZA 4DFZE 4EK8A 3NW7A 3QQFA 2FH9A 5GNKA 3L9MA 3P9JA 3VJOA 2CGUA 3RPOA 3OZ6A 3E7VA 4U44A 3II5A 5DPVA 3P78A 2HZNA 4OTHA 1AD5A 5AR3A 3KMMA 4ZY5A 2JBOA 3A99A 3QTUA 4LOQA 3E64A 4J99A 4IB3A 2AYPA 5DH3A 3PXFA 3E92A 2WTVA 5D7VA 2RG5A 1PRYA 2B9HA 4D2PA 5IA3A 4WOVA 4F9BA 4HNFA 4OBQA 5L2WA 4UYAA 3Q52A 4B7TA 4LG4A 4LQMA 3PSDA 5D12A 4DE4A 3H3CA 4QMUA 2WB8A 1YXSA 3EHAA 4LL0A 4GVAA 4Q5EA 4FV7A 4QP9A 3EYHA 3F5PA 5JGAA 3PA5A 3JY9A 3DK6A 4ANOA 5BUIA 5LWNA 4CV9A 4D4RA 4BWPA 4HVSA 5AX9A 4XCUA 3AD5A 3ET7A 4K0YA 4MXZA 4FSWA 4BZOA 5IUIA 5BQ0A 4IEBA 3KULA 3R28A 2OFUA 4YC3A 3ZCLA 5M55A 5EKOA 4TYHA 3IQ7A 4BI0A 4O0UA 1R39A 4ZTQA 3BYSA 4FIFA 1H28A 2QG5A 3R8MA 5CAPA 3FMEA 3I79A 2KTYA 5F4NA 1XH8A 4HVIA 5AR8A 3NS9A 5L8JA 4FT9A 4DT8A 1TQMA 5HD7A 2YABA 5C8MA 2FUMA 2OXXA 4ALUA 4DITA 3ORIA 5AV1A 2X1NA 2VGPA 1UU8A 4O7LA 2CDZA 4BBMA 3C5IA 2O2UA 2OG8A 1JQHA 2VU3A 1SVGA 4GYGA 3SVVA 2QOOA 3C4ZA 2QOFA 4U3ZA 3F5GA 4RJ5A 3TV4A 5EM5A 1P4FA 3ZSGA 4OW8A 3IW7A 3ITZA 3AC3A 4W4WA 4GFGA 5CVGA 4EOSA 5CSXA 2XEYA 5HLPA 3I81A 4AXAA 3PFQA 1GIIA 1V1KA 5ETCA 5LMAA 4ASZA 4OBOA 3HUBA 2BVAA 3BLQA 3EWHA 4QP7A 4UMPA 1NY3A 2BAKA 1G3NA 4IZ5A 4X0MA 3NYXA 4Y73A 3Q4UA 2BPMA 3LFBA 3R63A 3VF8A 3GCQA 3NIZA 3CP9A 3OMVA 3CE3A 4EH5A 4FTTA 4EZ5A 5LVNA 3QCYA 4ERKA 3KL8A 5LVPA 3JVRA 2PVMA 3ULZA 5GIOE 3DGKA 3H9RA 2GNJA 5T3QA 4JS8A 4GKIA 4UXLA 3Q9XA 4HZRA 2HZ4A 3CTHA 4DFXE 4D4SA 3VW6A 4RT7A 4MK0A 5J8IA 2WMWA 2J7TA 3BGQA 3DBDA 4AZVA 5IMXA 2SRCA 4FIGA 4DLJA 1JSVA 4BB4A 4WHZA 4OTFA 3VS7A 3PA3A 3BELA 3RVGA 4BZDA 3FJQE 3K3JA 4BDKA 2O63A 3ORZA 2WMVA 4K11A 1Q99A 4R7HA 4FV2A 4PF4A 5FG8A 1NVQA 2ACXA 3HP2A 2B9IA 3Q4ZA 4CTBA 4FSMA 4FOBA 3UO5A 1OIRA 2WQOA 2EXCX 5DR2A 3V6RA 3V5WA 3PYYA 3FHIA 3QQKA 2CKPA 5J7HA 2VAGA 2XZSA 3O71A 4CV8A 4M13A 3ALNA 4YLKA 3MVHA 3POOA 5KCVA 4NW6A 4FV5A 4AA5A 3R1NA 4RWIA 2X4ZA 2UW8A 2VTNA 3LCDA 1UU7A 3WZEA 5HLNA 4M15A 1Z5MA 2QI8A 3G90X 5AJQA 4F0IA 1OKZA 5EI2A 4OTWA 4RC4A 5I3OA 4ACMA 4BDDA 2LGCA 4UYNA 1R0EA 1U54B 3CSVA 4LOOA 1W98A 4DFYA 4IW0A 3VBWA 4YZCA 2B9JA 4ITIA 3MN3A 5F94A 4JG7A 2XB7A 3BV2A 2G01A 3HMOA 4NM0A 4M69B 5F1ZA 4LM5A 2CSNA 2W0JA 3G6GA 4GIIA 4QYGA 2HENA 2PK9A 4YHFA 3EN5A 5J79A 4ZZNA 4EKLA 4ZZOA 4JDKA 4FTCA 2PY3A 5KBQA 5HIDA 2DQ7X 2QD9A 4FSUA 1L8TA 5BYLA 1P2AA 3QALE 4ENXA 4USFA 5CEKA 2JC6A 3GFWA 5JFVA 4FC0A 4FTLA 2W1IA 4IX5A 4FNWA 1WBPA 3GC0A 3AGLA 3GU7A 4FSRA 4DTKA 3RPVA 2O3PA 4YC8A 3OXIA 4C36A 4ZY6A 3HV6A 3MY5A 3WF6A 3ZLYA 3FKOA 4BCGA 5JRSA 4QD6A 5CAVA 4Y83A 2R3MA 3KB7A 3AC8A 4FEVA 1FBNA 2JDRA 2PZIA 5CEMA 3KCKA 4BGHA 1WBTA 4YTHA 3PJ3A 4DGLC 2F2CB 1DI8A 5FXSA 3RK5A 2WMAA 4IVBA 1YKRA 3WE8A 1LEZA 5JSMA 3A4OX 3BGZA 4TNDA 2UZUE 4U80A 2CGVA 2GSFA 3SV0A 2Z60A 1V0BA 4RIYA 3SXFA 4IIRA 3UBDA 5ITAA 4FSNA 4O0XA 2R0IA 3W33A 2XK6A 2W9FB 4XYFA 1KUTA 2ETMA 4OGRA 3RNYA 2PHKA 4C02A 2NO3A 4NJ3A 1OUYA 2IZSA 3NZ0A 5AUZA 5IISA 4M84A 2JAMA 4BGQA 4MEDA 3LFCA 2VO3A 4FI1A 4BDEA 3BX5A 4KSQA 2QC6A 3G9LX 1M52A 3LM5A 5IQDA 4YSJA 3TI1A 2ITOA 5HORA 3HMNA 4JQEA 3UC3A 2I40A 2CN5A 3MJ2A 2OJFE 2X9EA 4FKOA 4NM3A 1H24A 4RZWA 4JAIA 4O22A 5FXQA 4LGHA 3R8LA 2FYSA 3EL7A 2I1MA 3D15A 2W1GA 3WYXA 2Q83A 4LYNA 5H8BA 3RINA 2BR1A 4IADA 4AW0A 4ZSEA 5CF8A 3ANRA 2YA9A 3PE2A 5M56A 2CKEA 2GFSA 5HKMA 5CI6A 4QMNA 3LFFA 4FBXA 4V01A 3VUMA 4RX8A 1IA8A 4I93A 5J5TA 3VN9A 3EFKA 2HCKA 3ZLXA 3FZ1A 1KE8A 3BI6A 2XBJA 3G6HA 4DEHA 3QC4A 4GYIA 4LRMA 3BHTA 5HBJA 4XG7A 4WRGA 4A4LA 3PY3A 2ZYBA 1OL1A 4C4JA 2AUHA 3PRIA 3MTFA 3A8WA 5HLWA 5K5NA 4R78A 2W9ZB 4ZS4A 4QQ5A 4BDIA 4QQCA 4EOOA 2JKQA 3QQGA 4RG0A 3UZPA 2X8DA 3AXWA 3KRWA 4BYJA 2X39A 3L8XA 4I5PA 4YLLA 4YMJA 3LXKA 2OJ9A 4HVDA 4E4NA 5M44A 3SG8A 2W4KA 5ANEA 1YOLA 3FV8A 2ESMA 1DAWA 4NM7A 2C4GA 3Q6WA 4H3BA 2J51A 2C6KA 5FD2A 3N4UA 5AM6A 4S30A 5IMEA 4IX4A 5DEWA 4YO4A 1CM8A 2UW3A 3A4PA 3IDBA 5TF9A 4BDGA 2R7IA 2V7OA 2WOTA 4X6RA 1H0VA 5KZ0A 3DA6A 3QC9A 4A7CA 5I4NA 5A14A 3F3WA 4X2FA 3GU8A 3GCPA 4PY1A 4AUAA 4D5HA 3HVCA 4I22A 2ZVAA 1ZY4A 2WOUA 2BMCA 2VZ6A 1RQQA 2QCSA 2ZM3A 4I5HA 4WUAA 5ACKA 3WZUA 1LPUA 3L8PA 2PVJA 3EZRA 3NR9A 5KMLA 2QOHA 2C5OA 4FZDB 1ZY5A 4R3PA 3CCNA 3AC2A 3D0EA 4UMRA 4KBAA 2YACA 4I4FA 5CXZA 2YIQA 4HYIA 4O0TA 3DLSA 2V62A 3C4CA 4BKYA 4O0RA 3OY1A 5GJDA 4IB5A 4LGGA 1OECA 4EC9A 2XYNA 5EHYA 4I5MA 1OKVA 2FSTX 2VX1A 1PXPA 2G2FA 2YZAA 3BEGA 3DKGA 5CU6A 5AR2A 4JG8A 1E1XA 2PYWA 2EU9A 3VF9A 1P4OA 2I0VA 4QTAA 3SRVB 4HVHA 3C1XA 2ONLC 5HNBA 5A4TA 4KD1A 5CVFA 1XH7A 1YDTE 2YAKA 2ZOQA 4I5CA 2ETKA 2EB2A 2ZB0A 3A2CA 2REIA 1Q24A 3DB8A 2WMRA 3GVUA 2BRBA 5BVFA 1QL6A 2XH5A 4FG9A 3QYZA 4IX3A 4TWNA 4XP0A 3E8DA 2UZOA 4WUNA 3T3UA 4GCJA 3ZUUA 3DK7A 2R4BA 3G15A 1EH4A 5CEQA 2QU5A 3EQPA 2WQEA 4G2FA 4XMOA 4A4OA 4C61A 3RP9A 3VAPA 1CKIA 4H05A 2W1ZA 1IAHA 3G9NA 3UVQA 2JFMA 4LI5A 4S2ZA 3R7GA 2A1AB 3RAIA 4NK9A 4F1MA 2HY0A 4RQVA 4AU8A 4AN9A 4J1RA 4GT4A 4DEAA 3VBXA 3NRMA 4RFYA 4AA4A 2B7AA 2F7ZE 3F7WA 3MFRA 2C6TA 3GOPA 5J87A 1S9IA 3UVPA 1O6YA 2X2KA 4L8MA 2BZHB 1CKPA 4QP1A 5ACBC 2JLDA 4YBJA 4CFWA 1H1PA 5CZHA 3MY0A 4X3FB 5TT7A 5A6OA 4IDVA 5IQCA 4XRLA 1SVHA 3Q4CA 4BICA 4OLIA 5GHVA 5GZ9A 3DK3A 1WAKA 3H10A 4AE9A 1OMWA 3VJNA 4IWDA 3UZTA 5E1SA 3EN9A 3TKIA 3ZH8A 3BHUA 1PMVA 4WNPA 4DFNA 5CU0A 3K5UA 3R1QA 3EN7A 1OKYA 4MXYA 1K3AA 5I9ZA 5BPYA 5CLPA 3UG1A 4BCNA 3L9LA 5AAGA 3KXHA 5E8TA 4ACGA 3IDCA 3EKKA 4FOCA 5BVWA 3W10A 5HD4A 5AP1A 5KMNA 4D4VA 2BRHA 4WNMA 3FMLA 4AT5A 4BCKA 2VWUA 2XK7A 3M42A 4TYJA 4ARKA 4IACA 2WKMA 1GY3A 2F57A 3WARA 3ATSA 1TVOA 3VRZA 3NUUA 1CSNA 3G51A 3W16A 4UALA 2PPQA 4X2GA 1I09A 4CCUA 5AM7A 5TO8A 3MVMA 4Y5HA 4O7YA 2BIYA 4HGTA 2FSOX 4EOJA 4QP3A 3VBQA 4IAZA 5L2SA 3LJ2A 3Q3BA 4ACDA 4G6LA 2EWAA 1FVVA 4PDSA 3FXXA 4MD9E 4R1VA 4AZEA 1O6KA 3ENMA 1XR1A 3UYSA 5IQFA 3A7FA 4D28A 4XP3A 2JD5A 3CJGA 3EMGA 3HNGA 3AT3A 3L8SA 3QAME 4FZAB 5D10A 2PUPA 1KWPA 1GJOA 3UO4A 4C4IA 4EKKA 2XIYA 3QTWA 4EBWA 1XHAA 2C5YA 2B9FA 3ZC5A 3NAYA 4NUSA 1Q8UA 4HW7A 1XH9A 2HXQA 3OY3A 5HIBA 4NIFA 2G2HA 2Z8CA 4PV0A 4N57A 4CG9A 4HCVA 5CALA 5HE0A 4IM0A 3CY3A 3AD4A 4UWCA 4QQJA 4D55A 4O27B 2CN8A 3BCEA 2P4IA 3W55A 3C50A 5ANKA 3HLLA 2WMQA 4K1BA 3LHJA 4GUEA 4CMUA 2GNGA 2ITPA 3S00A 4DA5A 3QZIA 4TY1A 2PU8A 1Y91A 4OTIA 5IA2A 2PE2A 4L46A 2GQRA 3GI3A 4DYMA 3OWKA 3QBNA 5A54A 4LRJA 2X6DA 4C2WA 2C3IB 3JVSA 3RGFA 5BYZA 1U46A 3VBYA 4WD5A 4XG3A 2PZYA 3E63A 3I6WA 4GUBA 3GFEA 4BDJA 5I9YA 4TYHB 3RK9A 3HMMA 4TYEA 3P7AA 4RC3A 3R9NA 4UMUA 3KF7A 2B54A 3FKLA 3OXZA 3FYJX 3PTGA 4ZLYA 2WTJA 4X3FC 4D9UA 5EHOA 5GJGA 4FTUA 3QCSA 3HAVA 1Q61A 4R7BA 3DFCB 4L3LA 3Q4TA 1PJKA 5HVKA 1YI4A 2XIRA 4Q2AA 3WZKA 4E4LA 5CAUA 4HPUE 1FMKA 4YJUA 5FTOA 3UJGA 5KMOA 2J0KA 3COKA 1KE5A 2C6DA 2PZPA 3ZFXA 4AA0A 3TDWA 5HE3A 3DNDA 1BLXA 5L4QA 3UNKA 1FPUA 4U45A 3SHEA 1ZOEA 5EYMA 3E8EA 3DKFA 2C3JA 2Z7QA 4IJPA 3PPJA 3NYVA 4UN0C 4BCIA 2WQNA 2UZLA 2R3FA 2QU6A 2OZAA 1ZYJA 4G16A 3E62A 4D0XA 4L7FA 3C0HA 3RHXA 4DH7A 3L8VA 3ZO3A 3QGYA 3QUDA 3UMXA 4QMOA 5HE1A 3VNTA 4BI2A 4F64A 5ANDA 4F6SA 3TXOA 4CKRA 3UIBA 3VS6A 4ZEGA 4G17A 4O7SA 1PXKA 3UIMA 3GGFA 3PPZA 4KUJA 1G5SA 3NYNA 5CQWA 2C47A 4RJ7A 4W4VA 5AR5A 2WMSA 3KRJA 2WU6A 5D41A 3R83A 3GU6A 1VJYA 3SD0A 3EJ1A 3HV4A 2XCHA 4K77A 4MXAA 4O7WA 2GFCA 3D2KA 3MIYA 4WBBB 2ZDUA 4D2RA 5HO7A 2BKKA 1IA9A 2GMXA 1YDRE 3ORNA 4RLLA 5EW9A 5IH5A 2PUUA 5DYJA 4EUUA 5HTBA 5F95A 5L8LA 3R2YA 3F7ZA 2YCFA 3FZSA 4LMUA 4XV9A 5CNNA 3ZZWA 5AMNA 4EYJA 4J97A 5L2QA 4BDBA 5CF6A 2C69A 4D1XA 4RX9A 4C62A 2EXEA 4YP8A 4R5SA 5JQ5A 4FV4A 1YOMA 3OHTA 3QF9A 5D7AA 4EK5A 3HP5A 3G2FA 4L3JA 2C6MA 5FM3A 3TDVA 4ENYA 1ND4A 4D1SA 3SKCA 3Q5ZA 4MTAA 3MB7A 1W84A 4TPTA 4D2SA 5BUEA 3NUAA 5CSVA 5AUTA 1OBGA 4RJ6A 2VTRA 3ZRKA 3LMGA 4DHFA 2CLQA 5LMKC 1OIUA 2IZTA 3PLSA 4IVAA 3ZM4A 3W2RA 3S0OA 4YJVA 2OI4X 4QTCA 5C26A 3NX8A 3FC2A 4XG2A 2WD1A 5HGIA 2F7EE 2ERKA 4DH8A 1AQ1A 3ID6C 4M67A 3AG9A 2BUJA 2XNEA 3PDTA 2ITXA 4O82A 4FV0A 4BVUA 4C3RA 4ANNA 4DG2E 5AP7A 3LCOA 5EM8A 4GV1A 2VTTA 2YM8A 4FTKA 2XJ0A 3NDMA 4U43A 3SW4A 4E5WA 4YZDA 5KO1A 4QQTA 4QMZA 1T46A 2IVTA 3OCTA 2Y0AA 4H36A 2YIWA 3O8UA 3E7OA 3LJ1A 5DFPA 4G3DA 5EYDA 1ZMWA 3LLTA 4E20A 5IF1A 3E88A 3V5QA 3QQLA 3ZLWA 4AGUA 3QD4A 5LWMA 4W4YA 4DEIA 4Q5HA 4CTCA 3ZBFA 4FICA 2CKOA 3RZBA 5FQDC 1YXVA 3DZOA 3FY2A 4FR4A 4WT6A 3S2PA 3ACKA 4O21A 1PMEA 4NJDA 1PXNA 4QMSA 4HZSA 4PMMA 4BDAA 4FL2A 5HX8A 2YLEA 1YXUA 4L44A 2XF0A 1URCA 2W5BA 4FUXA 4IZ7A 2XIXA 4XP2A 4FE2A 4JI9A 4Z3VA 3PA4A 1M2QA 4L01A 2IW9A 2Q0NA 4PRJA 3CS9A 3CQWA 4CQEA 2Z2WA 3MBLA 4GL9A 4PNIA 1M14A 5IDPA 3VQHA 4E8AA 4EOMA 5IKWA 4QMYA 4N6YA 1F3MC 2G15A 2BRGA 2OSCA 3EKNA 1CTPE 4HGLA 3FLZA 4MF0A 2LAVA 2HOGA 4FKVA 2WQBA 4ASDA 5FP6A 3DXQA 3QD2B 3P4KA 1FVTA 3OUKA 3DQWA 3E93A 3R00A 5CANA 2OK1A 4BC6A 2PE0A 4O91A 3P79A 3QZHA 4FSQA 2FO0A 1JKKA 2ZV7A 3O7LB 4G34A 3W2OA 4E6DA 4DFUA 4PNKA 2WQMA 3FAAA 4O7VA 3OTUA 2GHMA 1P5EA 4DEBA 1G8SA 3TACA 4RVTA 3PVGA 4XRJA 1Q3WA 1WBNA 4JBPA 1PXOA 5BX0A 2VO7A 5JZJA 2C1AA 4IXPA 3OOMA 4RIXB 1ZAOA 2WHBA 5A4CA 4PPAA 4RJ8A 4O38A 3TUDA 3PY1A 4KS8A 1PMNA 2C5NA 4FKJA 2VO6A 2Z7RA 3DBEA 3O2MA 5B0XA 3HRCA 4TZRA 3SQQA 4B99A 4IHPA 4MNEB 5CZIA 2GS2A 2PVKA 3FXZA 4F7NA 1TQPA 4KS7A 5I9VA 5AEPA 2QQ7A 4NSTA 1QPCA 3WZDA 4F4PA 5CXHA 3WF8A 2OIDA 4O0YA 2B1PA 3PZEA 3MH2A 4D2VA 5EM6A 3GC7A 3MVLA 5TKDA 3PPKA 3LMHA 4CFXA 3AGMA 3KQ7A 2VD5A 1M17A 1VYWA 4BTFA 4EH8A 4IAKA 4X2JA 4DG0E 2BTRA 2YERA 4NKAA 4P5ZA 3QUEA 3LW0A 4ITHA 3RWQA 2C30A 3KXXA 2QOCA 2WXVA 4ZIMA 5C27A 5HZNA 1PXMA 1SNUA 2CMWA 3NIEA 5D9HA 3L9NA 4YNEA 2UUEA 2YWPA 1WBWA 1U5QA 4BIEA 3K3IA 4AOIA 2UZEA 3CC6A 3IS5A 1PXJA 3U9CA 4C4EA 4ZTRA 4EH2A 4ZTSA 4F6UA 4I6HA 1M2PA 3VC4A 3BYMA 5M06A 4EH4A 4MF1A 3RWPA 1UA2A 4FZ7A 3SXSA 4HOKA 3P5KA 4Y72A 2OF2A 3IW4A 5CF4A 3C4WA 4TW9A 3O8PA 4USEA 5HVYA 2DYLA 2C68A 3NGAA 5FDPA 3K2LA 2A0CX 3IDPA 5AIKA 4EJNA 3Q53A 3V04A 3OCBA 4EL9A 4G31A 1H26A 4J8NA 4WA9A 3D14A 2VWIA 4CD0A 5HNGA 5DE2A 3ORLA 4ASXA 4H3PA 5CYIA 3FMJA 3WILA 1MP8A 4XBUA 3HYHA 2C5XA 3RI1A 1IRKA 4X3JA 2PSQA 4N70A 3FDNA 3DOGA 5FEDA 1JKTA 1L3RE 5I0BA 3W2SA 5BVOA 4I0TA 4L68A 1PYEA 2IZRA 4S32A 4FTAA 2X81A 1OUKA 2GPHA 3CXWA 5ETIA 3TZ9A 3I4BA 1JAMA 4FKPA 3RAHA 1A9UA 5DRDA 1HCKA 1FQ1B 2HW7A 4WBOA 3R7IA 2HK5A 2QKWB 3W2QA 1OKWA 1T45A 3AT2A 3EYGA 1PYXA 1WCCA 3I0OA 3OW4A 5GZAA 1H1SA 5IA5A 4PL4A 4FODA 2QODA 3UO6A 2W96B 2W1HA 5KMMA 3PXQA 5EYKA 3MWUA 5FXRA 2C0TA 4IWPA 4OUCA 3PVWA 5G1XA 2CGXA 1Y8YA 4IB0A 3ZU7A 1H8FA 4FT5A 4IBMA 2YHVA 4H39A 4R6VA 3T9TA 3VBTA 5CF5A 3AMAA 5TR6A 4EHEA 5EW8A 4BYIA 3Q9YA 1H25A 3EN4A 4O6EA 5L6PA 2PMNX 4JLCA 3KVWA 5M4FA 3PP0A 4FYOA 2F4JA 4AAAA 1I44A 4EH7A 1BL6A 3M2WA 2X6EA 4GW8A 3A7HA 3Q04A 4EORA 4OAUC 3B8QA 2JBPA 3UPXA 3U6JA 3ZOSA 3RNIA 5J1VA 4YJSA 4CMOA 2WMTA 1QCFA 2JITA 3BBWA 3E8CA 4ZLZA 4GK3A 2UVXA 2JIUA 3W1FA 4PMTA 2YM7A 4I6QA 3VULA 3C9WA 5I9UA 3TTJA 3VWAA 3GB2A 4CYJA 2X0GA 4AN3A 3SLSA 2R3JA 3CPBA 1B38A 1YXTA 1Q8YA 2BALA 4YLJA 4F08A 5IDNA 4ALWA 5JK3A 4YZ9A 2JKMA 1W83A 3VS0A 2OH0E 4ZMEA 4IAIA 4OTQA 4WG4A 2RFSA 4U5JA 4PDYA 4RGJA 1OGUA 5K5XA 4CG8A 4XLVA 3S3IA 4DGOA 4FG8A 4QRCA 3FUPA 1OB3A 2VWXA 3MH0A 3AC4A 4LUDA 5CI7A 4FEQA 4XNEA 5E92A 4DTBA 3F61A 3KRXA 3MB6A 3OEZA 4ERWA 4ANMA 4FKRA 4YC6A 4KSPA 5JKGA 5K0XA 3M1SA 2IPXA 2ITQA 3PY0A 3EQDA 4UZHA 2XVDA 1JOWB 1YW2A 5IUGA 5M07A 5JFXA 4BBEA 3ORMA 4NEUA 5EQYA 5B7VA 3TNIA 4KKHA 2AC5A 4RIOA 4YHTA 3DBCA 4RIWA 4C34A 2VTLA 2W1DA 3UODA 4DEDA 3A7JA 3RM6A 5DBXA 4J52A 3DS6A 4YZMA 4DFLA 5CSPA 4UMQA 2YZLA 2XNPA 1JBPE 4YNOA 1YWNA 2YDKA 4AG8A 1UVRA 2J0JA 3ACJA 3GNIB 4TWOA 3OS3A 5FDXA 3D7TA 3TNPC 4AN2A 4EWHA 5AFVA 3QTSA 3PWYA 4JQ8A 5AV4A 1ZWSA 3OEFX 4L6QA 3I0QA 4CFVA 3OWLA 4FUYA 1RDQE 4JAJA 5KE0A 2GU8A 5LQFA 3VQUA 3RKBA 2VGOA 3KF4A 2WTKB 4DCEA 4AGWA 3UYTA 4J53A 4JNWA 3OTVA 1GOLA 2J4ZA 3NVMB 2XRWA 4TWPA 4DAWA 4FTRA 4V0GA 3WOWA 2QHMA 3D4QA 4TT7A 3HECA 4TRLA 2VWBA 4IWOA 3AOXA 2JIIA 3ZM9A 1G8AA 1R0PA 4GH2A 2XK4A 4FIEA 4NIFB 3V8TA 4CKJA 4A06A 4O84A 1YVJA 5E8VA 4ZK5A 3UOKA 5AP4A 3DTCA 4O7TA 1QMZA 4PDPA 4ACHA 4EHZA 4YU2A 2QONA 4APCA 4NZWB 2XNOA 4DEEA 1SMHA 3DZQA 1H07A 3DCVA 4BIDA 4HNIA 3D5WA 5H3QA 3DU8A 3NNVA 4DTAA 1Q97A 3OBGA 4TYGA 2BIKB 3KMUA 4EBVA 3TTIA 3I6UA 3QTXA 4FIJA 4K2RA 4QTEA 3CQUA 3QHRA 4IAFA 4YJOA 3GCSA 3NAXA 4DH3A 4QPMA 3UTOA 4F09A 4RA4A 3MS9A 3I60A 5EM7A 4F7JA 3PP1A 2JDVA 4MWHA 3BKBA 4F70A 4EONA 1M7QA 2PVYA 2QOIA 4ZP5A 3RAKA 5EQEA 5TE0A 3H4JA 4JX7A 2B0QA 3C0GA 5IH6A 4ZTHA 3UQGA 3CPCA 3HDMA 4X6QC 4DT9A 4BCPA 4UX9A 4JT3A 1ZOHA 3ZHPC 2O65A 3V3VA 4BN1A 4OT6A 3NMUF 1RJBA 2BFYA 5C1QB 4G9RA 5HU9A 3DAJA 4FVQA 4RQKA 3WE4A 3QA8A 3RMFA 2GCDA 2JFLA 3MFUA 4YTIA 4OTGA 3T9IA 5AIRA 1OIYA 3TV6A 4WNOA 1GAGA 3QTZA 3C13A 4DCAA 1A06A 5A46A 4UY9A 3HGKA 3LXPA 4QMMA 4J96A 2UW9A 2CCHA 3DJ7A 4FX3A 5J95A 3O23A 2YM3A 3VBVA 2OZAB 4GVJA 1JKLA 1UKHA 4U81A 4NTSA 4AOTA 3N4VA 2VNYA 5CVHA 2OIBA 2C6OA 4EQUA 3R7EA 1FGKA 1U59A 3FLSA 4QP4A 2YCRA 1M2RA 3QKLA 4GMYA 4UB7A 4W8DA 4J71A 4PMSA 5LCKA 4BBFA 3MVJA 3KK8A 4A9SA 4F0FA 2YM5A 5IQBA 4GU9A 3G0EA 2JAVA 3UVRA 4QPSA 2RGPA 3BLRA 4C3FA 3OROA 2WTKC 5CTPA 4YTCA 4NFMA 1O9UA 5HO6A 4BIBA 2PVNA 5AADA 4ZZMA 3VO3A 5HICA 1H01A 2QOLA 3EQIA 5IEXA 4MBIA 3IO7A 2IO6A 3QD0A 3U51A 3THBA 2J0LA 4PTEA 4FSZA 3R71A 4E7WA 4EEVA 2VN9A 4LV8A 4F1TA 2Z7SA 5AV0A 4BY9E 2HY81 4U7ZA 3S1HA 1KV2A 5B2MA 2X8IA 4OAVB 3SG9A 4H3QA 4I24A 4FKUA 4GT3A 3TZ7A 4BWKA 2VX0A 4MKCA 4OR5A 5L3AA 2R3HA 4C35A 3NSZA 2VTOA 4DGMA 4E5AX 2UW0A 2PVFA 5LMBA 4FG7A 3WIKA 3ULIA 4BL1A 1J1BA 2BAQA 3BZ3A 4JRVA 5E8WA 3ZEWA 1J7IA 4E4XA 1KE9A 2DS1A 3CBLA 3TIYA 4IVCA 2P3GX 3ZFYA 5AP3A 4M66A 5I9WA 2CCIA 5DN3A 5EG3A 2B55A 2JKKA 2WEIA 5JRQA 3LQ8A 4EH3A 2GNLA 4NL0A 3D5VA 4ZTNA 2R3NA 3MW1A 4L52A 3UQFA 4HGEA 3RALA 4C33A 5FBOA 5AWMA 2JDTA 2YFXA 1XH4A 3GXLA 4PQNA 3ZXZA 4BGGA 3UIUA 3VW8A 3A8XA 5K0KA 1XBCA 2NRUA 4PX6A 4CXAA 4ZJIA 3CGFA 2WEVA 2P2HA 4FKLA 3FSKA 4MHAA 2C1BA 5C4KA 2JDOA 2VTJA 4I41A 4NW5A 1OL7A 5ANOA 1V0OA 4AZSA 3KCFA 2HZ0A 3FHRA 2YIXA 2R3QA 2C6LA 4M0ZA 4Z7GA 3IW5A 1XBBA 3CLYA 3R73A 3R8PA 2YISA 3QA0A 2B52A 1UNLA 4XX9A 3QFVA 5E8SA 5HCYA 3U6HA 1ATPE 3QKMA 4NU1A 3DQXA 4RZVA 1PW2A 3VHKA 5AR7A 4AZTA 2DUVA 2H8HA 3KY2A 3BIZA 5LVOA 2QG7A 2X7OA 5FRIA 1WMKA 1RW8A 2HZIA 4M69A 3QCQA 4C4HA 4Z7HA 3P7CA 4CVAA 5DGZA 2ZJWA 1NXKA 5CAQA 1SYKA 3C4XA 1BX6A 3TKHA 3NW6A 4A9YA 3U9NA 1NW1A 2H9VA 4BWXA 1QPJA 4AE6A 3ELJA 4RLKA 4EZ3A 4QNAA 2VTQA 2IW6A 2XIKA 3QHWA 3FZPA 5KBRA 4JL9A 4QMLA 4EK4A 1H00A 4Z16A 3VS2A 3U55A 3BEAA 4F99A 4L7SA 3QUPA 2IN6A 2V0DA 4ZTLA 2I6LA 5L6OA 3RAWA 4GG5A 2YDJA 4AWIA 4TTHB 4I6FA 2XA4A 3WIGA 4O7NA 5EI8A 2BZKB 3QZGA 3Q9ZA 3F5UA 4LV5A 5CU4A 2Y6OA 3FL4A 3EQBA 3MFSA 4XBRA 3DV3A 3PUPA 4IJ9A 4PL3A 4Y95A 4Y46A 5AA9A 5JEBA 4FKSA 3LFDA 3GCUA 4BCFA 4YGAA 4IAAA 1HCLA 3RK7A 4S34A 4HJOA 2RKUA 5LVLA 3AC5A 2PZ5A 4QYHA 3CKXA 3C4EA 3TWJA 2CNVA 2FB8A 3LCKA 4R7IA 3HRFA 3COMA 4NCTA 3NNWA 4QP2A 5DWRA 1J7UA 4BCQA 2VRXA 4XH6A 1M7NA 3T8OA 4FTOA 3FKNA 5HESA 3P7BA 3ZUVA 2BZIB 2JEDA 1R78A 1LP4A 1UWHA 4ALVA 4O7ZA 4HYUA 2NP8A 3RBWA 2Y4IC 4M14A 1STCE 4CQGA 3OWPA 4NT4A 5J1WA 3T3VA 4QMQA 1Q5KA 3LKMA 3RPRA 2H6DA 2HXLA 5DOSA 2ZAZA 4JX3A 3KULB 2PVRA 3FMHA 4MQ2A 4BDFA 2WTDA 4D5KA 1KV1A 3HA8A 4FNZA 4HCUA 5DT3A 5IQHA 3BV3A 3LLAA 5HG7A 4JIKA 3TIZA 4OT5A 2X2MA 3VS3A 2XUUA 2ZDTA 2BDFA 5DHJA 3DXNA 3U4WA 3G33A 5DMZA 2XRUA 1SM2A 1IG1A 3ANQA 4O96A 4BCJA 3F2AA 3QU0A 5EOLA 4C7TA 3FI8A 3LQ3A 2UV2A 3BGPA 3NWWA 1IASA 4MVFA 5AP6A 5K4IA 2XK3A 5EH0A 1Q8ZA 1IR3A 2XKDA 4B8MA 1ZMVA 4GJ2A 5HX6A 1KSWA 1FMOE 4TNBA 4BR3A 3R7OA 2UW6A 4P5QA 4CZYB 3PJ2A 4KNBA 4RWLA 3KC3A 5BUJA 3ODZX 2C3KA 2OLCA 1ZZLA 3O51A 3R02A 3EN6A 4AFEA 1FGIA 4CT2A 3UZRA 4U97A 4MQ1A 4O0SA 4IAYA 2E9PA 2OGVA 1H1QA 3ODYX 2XMYA 1U5RA 2PMIA 2RL5A 3ALOA 1CDKA 3NCGA 5E1EA 3VUTA 2YN8A 3F3TA 4E93A 2UW5A 4PDOA 1DS5A 2FVDA 4LOPA 3VUIA 5IG1A 5AUVA 3EIDA 2P2IA 4MBLA 4WG3A 3DB6A 5DA3A 2A27A 4JDJA 1B39A 3VUDA 4M68A 4ANLA 1SVEA 3REPA 1MRUA 2P0CA 5IQAA 2IZUA 4WRSA 2R3RA 3FPMA 2Q0BA 2F49A 2OF4A 3UC4A 1OL2A 2H96A 3IONA 4X21A 4HVGA 1NVSA 3N9XA 4XG6A 2G1TA 2WELA 1DM2A 5EDRA 5FTQA 2WMXA 4U6RA 2J90A 1P14A 2OWBA 2VTIA 5HE2A 3TEIA 3O8TA 2R9SA 4EC8A 4MYGA 3LFQA 2O64A 3LVPA 4FIIA 2BTSA 5E8UA 3UGCA 4F7LA 4YURA 2AC3A 3W2PA 3LFNA 5A9UA 2FGIA 2GNFA 3BE2A 3SRVA 3UMWA 2F7XE 2X4FA 2E9NA 3EFJA 3N51A 3RJCA 3U4UA 3TL8A 5HVJA 4PPCA 4TXCA 5EK7A 4C0TA 3UIXA 3PVUA 3CY2A 3MJ1A 5IU2A 4ZJJA 5CAOA 4EJ7A 1Q8TA 1J91A 5E8XA 1NT2A 2W1FA 2J5EA 3MH3A 5F20A 2IVSA 3QYWA 1YWVA 5C03A 3IW6A 4DINA 3LFSA 4IFCA 4F65A 2OICA 1WBSA 4RRVA 4RVKA 2A19B 2ITZA 4JOAA 2G2IA 3B8RA 2IJMA 3HAMA 4G6NA 4B4LA 3QLFA 3MGYA 2R3GA 4FSTA 5HCXA 5BVNA 2XM9A 5A6NA 5HI2A 3C0IA 3LM0A 5IZFA 4TN6A 3HEGA 4JXFA 2BDWA 3TNHA 4XV3A 3VS4A 3ETAA 4FKQA 2HIWA 2VTSA 4QMVA 4XLIA 5EW3A 3TNWA 3Q6UA 2XKCA 5H9BA 3ZZEA 4EOKA 3UNJA 4L9IA 4X3FA 1E9HA 5TOZA 3R9DA 4L42A 3NUPA 5IA4A 4RIWB 2UZDA 3MA3A 5DR9A 5JH6A 4GU6A 3HV5A 4MXXA 3R8ZA 3CTQA 3K54A 2UW4A 3QLGA 3AT4A 4KB8A 1QPEA 3FI3A 3JR1A 5EFQA 3D7TB 3V01A 2YLFA 4H1MA 4FT7A 4DGNA 3DKCA 4RFZA 2P55A 4ZLOA 3PLAE 4RIYB 5G6VA 5B2KA 3MPAA 5AX3A 4DLIA 2VO0A 1W7HA 4IC7A 4ZTMA 5E4HA 4AQCA 4FEXA 3RM7A 3EQFA 4XS2A 3LQ5A 2UZBA 4O7RA 5M4CA 1IAJA 5HNIX 5HQ0A 4BKZA 5JZNA 2UZVA 4XG4A 2WZJA 2XP2A 4A9RA 3ZTXA 4HYSA 4R3CA 2YJSA 3UP2A 4F9AA 3DBFA 3BYUA 3NW5A 5D1JA 1O6LA 4ZSJA 3R1YA 4V0GB 4ANBA 5AAFA 3UP7A 5KX8A 4JDIA 4QYFA 2HWPA 4P2KA 4R3RA 4WG5A 4BHNA 5I3RA 3TNQB 1PHKA 3HRBA 3FY0A 3QZFA 4JBQA 4QTBA 3V5JA 1K2PA 3KU2A 2OIQA 5JFWA 3R7YA 4YO6A 1E1VA 1FVRA 4JIAA 3R1SA 3TZ8A 2VTMA 4RC2A 5JN2A 1J3HA 2ZB1A 2OO8X 4CGAA 2BZJA 3DJ6A 1DI9A 4CRLA 3WBLA 1A48A 2WMUA 5AP0A 2OXDA 3ROCA 3HDNA 4FZ6A 4IZYA 4FMQA 4O0VA 4FA2A 3F69A 3NEWA 3ZRLA 3F6XA 3IK3A 2QVSE 2QURA 1Q62A 3BHYA 3WF5A 2OKRA 3R2BA 4AP7A 2OXYA 4KIQA 2WGJA 2QOKA 3KXMA 3QRIA 3R30A 1UKIA 3OF0A 1YI3A 3AC1A 3IGOA 1KE6A 4K8AA 5HG9A 4AW1A 5J9YA 2I0YA 2XJ2A 3QRJA 4C59A 4EWQA 4FT0A 4G9CA 4FTIA 3FYKX 3EQCA 4QP8A 4UWYA 5HG8A 3R8VA 3ZO2A 3PIZA 3AD6A 4RSSA 4ZXTA 4GFMA 1WFCA 4M7IA 4E5BA 4AGCA 3KREA 4KBCA 3VS5A 2GHLA 5LMKA 3NUXA 4BF2A 4KA3A 5ETFA 2W4JA 4FV8A 5ANGA 4XV1A 5CU2A 4Y8DA 1NA7A 3A7IA 3CKWA 2OFVA 2XM8A 3F88A 3FSFA 3TV7A 3FQEA 2B4SB 3G5DA 4DN5A 5E9EA 2WTIA 4NYEA 4GK2A 3JPVA 4KRDA 5M53A 4CLJA 4G3FA 3RPSA 3TCPA 3Q2MA 4ZY4A 5EQPA 3JS2A 1QPDA 2PUIA 2DWBA 5HG5A 2GS7A 2W05A 4Z55A 5FBNC 1GZKA 3V6SA 4C3PA 4PUZA 5FTGA 3KXZA 3UDBA 4B8LA 3HKOA 3V5PA 1KOBA 1H0WA 1IEPA 3B2WA 4BDCA 5M08A 5M4IA 4JQ7A 1GIJA 3EZVA 4F7SA 2ITTA 3EQGA 3F66A 5FLFA 2F9GA 5DRBA 2PZRA 2OJIA 3BWFA 4LFIA 4D1ZA 5CSHA 4NTTA 4W9XA 4CLIA 2F2UA 4O2PA 4J8MA 4EI4A 3LXLA 1PXLA 3O0GA 1OIQA 2O8YA 2B53A 2W1CA 4L43A 2PVLA 2J0MB 2HELA 3DTWA 4DF3A 4AZWA 3EL8A 4BZNA 3JYAA 2BCJA 2Y4PA 3IECA 2X7FA 3FLWA 2YDIA 3PSBA 4JR7A 1HOWA 5DT4A 3TJDA 4MXOA 2OJGA 4ZAUA 4MBJA 3PSCA 5FUTA 4U41A 2CPKE 1ZYDA 5E90A 1OL5A 3COHA 2YM4A 3E5AA 3DBQA 2BILB 4EHGA 4IMYA 3H9FA 5BNJA 5LARA 3KMWA 3EFLA 3OT8A 4IDTA 2XNGA 1FOTA 4UEUA 1AGWA 4Y85A 1Y8GA 2VWWA 3OVVA 4FVRA 2WTWA 4FTJA 3AQVA 4XG9A 5D11A 5ANJA 3W18A 4I20A 2W17A 2ITNA 3UNZA 3UOJA 4YHJA 4G3GA 2ZV9A 3PJ1A 1MUOA 4JJRA 4FK3A 4W9WA 3RHKA 4AW2A 3OG7A 3BHVA 3KVXA 2A2AA 4O1PA 4AT3A 2GDOA 4ORKA 4U40A 3GUBA 4UWBA 5CT7A 3F82A 3QTQA 3R04A 5CEIA 4FGRA 4FV3A 1KOAA 3ORKA 3SOCA 4HCTA 1TKIA 2JGZA 2QHNA 3A60A 2XS0A 3F3VA 4GEOA 4EUTA 2PULA 3QD3A 4LGDA 3F3UA 4FEUA 4A4XA 4E3CA 3R6XA 3QQUA 5IQIA 4EH9A 2GTNA 4PPBA 3QRKA 5BVEA 5IQEA 4BKJA 2ITYA 4PL5A 1XKKA 4TKSA 3R7UA 2IW8A 2OH4A 4A07A 3AMYA 1Q3DA 3P0MA 4S31A 1R3CA 3ZONA 4J7BA 5T68A 3R7VA 4FEWA 3O50A 2YIRA 2XK8A 2R3KA 4U3YA 2XNMA 4WKQA 3GQIA 5ANIA 3UOHA 1YRPA 5GJFA 3R8UA 2YM6A 4WIHA 5K3YA 3VUHA 2O5KA 3DDPA 1WVWA 2QNJA 3LZBA 2Y8OA 3MA6A 5L8KA 3AMBA 3QWKA 4CEGA 1YI6A 4WSYA 4BTMA 4FNYA 4PTGA 1UU9A 3E8NA 3LOKA 5HTCA 4FV1A 4M0YA 2YCQA 1Y6BA 1GIHA 2IVVA 3MDYA 4A9UA 3NVKI 5M57A 1BI8A 1MRVA 1LR4A 1JSUA 2OU7A 3R9RA 3ATTA 4F1OA 4UV0A 2R64A 4EQMA 4L3PA 5L6WL 4E6QA 3Q32A 5CASA 3ORXA 3W2CA 3D7ZA 1UNGA 4QTDA 2Y9QA 5DVRA 2WIHA 4CZUA 3Q9WA 4L00A 4X7QA 4USDA 5AP2A 1PF8A 2I0HA 2C3LA 4AX8A 1JSTA 3KFAA 4K33A 2CLXA 2RFEA 4BTKA 4D9TA 5K9IA 3QTRA 3EQRA 4UXQA 3BQCA 4TWCA 5CNOA 2VX3A 4N4SA 5M51A 3F3ZA 2XNNA 2ZV8A 1OM1A 5KHXA 1VZOA 3BYVA 2ZM4A 3EH9A 4IH8A 3V8WA 4C58A 1VR2A 2UZNA 4EK6A 3OXTA 4FKIA 3F9NA 1H27A 2HYYA 2WPAA 4EOPA 3I7BA 5KMIA 1YXXA 2X7GA 3GENA 3HV7A 4KKEA 4BCOA 2BROA 2J6MA 4I1ZA 3H0YA 2ITWA 5HO8A 5KMJA 1YWRA 1VYZA 4O86A 2OW3A 2UZWE 3EFWA 1ZRZA 5CU3A 4EHVA 1NVRA 3Q96A 2H34A 3CIKA 4IFGA 1XBAA 3H0ZA 3V5LA 5F9EA 2YWVA 4U79A 1YOJA 3MFTA 3K5VA 2A4LA 4GS6A 5DLSA 3BPRA 2J50A 4G6OA 5E91A 5AR4A 2UZTA 3IGGA 2ERZE 5AUYA 4PWNA 2FSMX 4FZFB 3SAYA 2R3OA 4RX5A 2C6EA 5EI6A 3VIDA 4RJ3A 2IG7A 1PKGA 4ACCA 4KIOA 2WU7A 3FMNA 3OC1A 5C01A 4KIKA 3GC9A 1Q41A 3R9OA 4EYMA 1K9AA 1LUFA 3DKOA 1UWJA 4RIXA 4IVDA 3NNUA 3ZYAA 2ITUA 5DNRA 1OVEA 5DIAA 5EOBA 3ENHA 3D94A 4XJ0A 4U9AA 4L53A 5CT0A 3OW3A 5AAEA 5KUPA 2VTPA 3B2TA 4KABA 4D0WA 5I5ZA 3HUCA 1JWHA 2YIYA 5GINE 4MNEA 3MESA 3QQJA 3FZRA 3TUBA 2P33A 4PTCA 3MPMA 2V7AA 4E6CA 3PZHA 1YHSA 3KRLA 1KE7A 4RVMA 3LMIA 4GK4A 3CTJA 3KA0A 5EDQA 3DXPA 3W32A 5FWKK 3OT3A 4YUQA 4ANSA 2NRYA 3IG7A 4MH7A 3ZDIA 4D2TA 5HIEA 3GP0A 4ID7A 1Q4LA 1ERKA 1WVXA 3KEXA 3DLZA 3IPHA 3KN5A 3FMDA 3LCSA 4IANA 3PWDA 2X2LA 4IM2A 3TT0A 4C37A 3PXYA 2XK9A 3GEQA 5CWZA 4AW5A 4YTFA 4YPDA 3MI9A 3CQEA 4RWJA 4YZBA 4ZOGA 3QCXA 4OTDA 4OTRA 2V22A 3F2NA 3PG1A 4RVLA 3U8WA 3FC1X 5FP5A 3SGCA 4HGSA 3OBJA 1V0PA 3KRRA 2E9VA 3F5XA 5HBEA 1JVPP 4D2WA 4M8TA 4IC8A 1ZXEA 3UQCA 2XYUA 4TL0A 5ICPA 2EXMA 3IOKA 4YPSA 3BRBA 3QTIA 3OOGA 4U42A 4I92A 2EB3A 1WBVA 2UVYA 3NUYA 4EQCA 1F0QA 3I7CA 3FWQA 5H8GA 4RWKA 5EYCA 2QR7A 2R5TA 3SXRA 2GS6A 5L2IA 5C8KA 2XNBA 3RTPA 5DI1A 4CKIA 1JPAA 5AUWA 4RPVA 5KHWA 4O6LA 3MV5A 2BFXA 4FL1A 3DY7A 2ETRA 3ZFMA 4CYIA 3LXNA 2XKEA 4LMNA 3RZFA 5LVMA 5EKNA 4K6ZA 4ONAA 2W5AA 2KULA 4O1OA 4MD8E 4XHKB 4BRXA 2C6IA 4CSVA 1OZ1A 4ZJVA 2X9FA 3WF9A 4C2VA 2X8EA 4I0SA 3V5TA 4CFMA 1X8BA 4FV9A 1VEBA 3MIAA 3JXWA 5JMSA 4CMTA 2E2BA 2PL0A 2WAJA 4XEYA 1PKDA 4P90A 3S95A 5LXMA 2CHLA 3QWJA 2OJJA 1H4LA 3R01A 5E8ZA 4F9WA 4FTQA 5EDPA 5CX9A 3N4TA 4BCMA 3LPBA 5HCZA 4BFMA 4NCTC 4M97A 5FGKA 4AT4A 2J0IA 4QT1A 3FMMA 4ASEA 3QL8A 5HBHA 3FQHA 2R2PA 5CENA 5HU3A 4NH1A 2Z02A 2NPQA 2ZMCA 3ZDUA 2HAKA 2Y4IB 2V55A 5KKRB 4KINA 2WO6A 3FZTA 4FT3A 4DBXA 4GRBA 4MAOA 2BKZA 4QMPA 5HTIA 3FBVA 4FTNA 3COIA 3C5UA 3DFAA 3LFEA 4MX9A 4S33A 5C4LA 3GU5A 4IX6A 5CS6A 5GZ8A 3PRFA 5A4QA 4KKGA 3Q2JA 3O96A 4JRNA 4Q9SA 5JFSA 3S4QA 3D83A 5AP5A 2PTKA 4JDHA 2QKRA 2XJ1A 4EH6A 4PMPA 2W99B 3V51A 4C4FA 4RX7A 1GZNA 1Q8WA 3PXZA 3CGOA 4IM3A 3DAEA 4KIPA 2ZV2A 4UZDA 1OITA 3EOCA 3OD6X 3CJFA 2O0UA 3GT8A 1FINA 5EHLA 5AV3A 4J95A 3VHEA 4YJTA 1BKXA 3BU3A 5DEYA 3ZC6A 4AS0A 3LJ0A 4DH5A 5I9XA 5AA8A 3OFMA 3VUGA 1U54A 3BE9A 5JGBA 1W82A 2I0EA 2R3PA 3GU4A 4KWPA 2WIPA 3GBZA 3CD8A 4FNXA 4EOIA 4ZSGA 4KAOA 4AZFA 4V05A 4CRSA 2QO7A 1YQJA 3R0TA 4F6WA 2FA2A 2VNWA 2Y6MA 3LE6A 5DT0A 3ZSIA 4CFFA 1Z57A 3L9PA 4R77A 2QO2A 3D9VA 3Q60A 3DJ5A 1Y6AA 3OCGA 4FF8A 4UMTA 4WNKA 5FEQA 3F2RA 5M4UA 3CD3A 3FLYA 5IEYA 1REKA 4I4EA 5HOAA 1OPJA 1DAYA 3FQSA 4EK3A 2YEXA 3HX4A 3NCZA 3PVBA 2V5QA 4ITJA 4QMWA 2VTHA 4U0IA 3HMPA 4MWIA 1ZOGA 5CSWA 4CFUA 4MD7E 1OBDA 3VS1A 3A62A 3IOPA 3PG3A 4HYHA 1OL6A 4FK6A 4YJNA 3ZUTA 4F9CA 3MH1A 4G3EA 4WO5A 2J2IB 3QXPA 4FIHA 4FKGA 3GC8A 4FYNA 3DPKA 4I23A 4QMTA 2OBJA 5JT2A 5LJJA 3SC1A 4B9DA 5JQ8A 2VV9A 1PY5A 5K4JA 3I5NA 1CKJA 4B0GA 5M09A 1UU3A 5AUUA 1URWA 3NUNA 2QLQA 5H2UA 4YR8A 3WI6A 3TKUA 2GNIA 3ORPA 3Q5IA 4W8EA 5IEVA 3GQLA 1WVYA 5IQGA 3FXWA 1W0XC 2EUFB 3U87A 4Z9LA 3NYOA 5B2LA 3JY0A 3UOLA 3ZLSA 3RCJA 3FI4A 2XBAA 3GCVA 1ZZ2A 1J1CA 2W5HA 1OPLA 3HZTA 3SDJA 3UPZA 3E3PA 3UG2A 5A4LA 2PWLA 2CGWA 2ONLA 2VWZA 3A7GA 1TQIA 3FI2A 2GHGA 2XKFA 3QRTA 4I0RA 4C38A 4XG8A 3IW8A 3NUSA 1MRYA 4AOJA 4MXCA 4O0WA 3PE1A 4OTPA 2RIOA 4M12A 4R1YA 3O17A 3MPTA 4K18A 1XQZA 4PP9A 2FSLX 4FKWA 3PXRA 5KKRC 2BHHA 2W06A 1ZARA 3D5XA 3HA6A 4YSMA 5BVDA 4J98A 3RCDA 1S9JA 1JNKA 3I1AA 4IWQA 2CNUA 2E9UA 4G3CA 2VWVA 4XUFA 5J9LA 4QYEA 4PP7A 4E73A 3H9OA 5IPJA 4FTMA 4GSBA 4MNFA 5LOHA 2VWYA 4RBLA 4YBKA 4R5YA 1MQBA 1ZMUA 4E26A 5ETAA 1PXIA 1R1WA 2QR8A 2QOBA 1XJDA 5BMMA 3PXKA 3I5ZA 3ZBXA 2ZMDA 1SNXA 4U8ZA 4G1WA 4DBNA 5J9ZA 4LRKA 5KMKA 1Z9XA 3PIXA 3POZA 3MY1A 4UBAA 3E3BX 3EB0A 4I3ZA 3FPQA 1RE8A 3BU6A 3ZMMA 1ZLTA 5HHWA 1F5QA 2W4OA 3OWJA 4EZ7A 2EVAA 2Z7LA 2Y7JA 1XO2B 4NM5A 5J7BA 3G0FA 3LAUA 4V04A 2NNWB 4X2KA 1OPKA 2R3IA 4FVPA 2YJRA 2XCKA 5FM2A 3D2IA 3CR0A 5CEPA 3A61A 4QO9A 3R21A 3W8LA 4G5PA 4XV2A 3UE4A 3ZEPA 2UW7A 2ZM1A 4F63A 3OUNB 1H08A 2YAAA 4AFJA 3QRUA 3NLBA 4D4YA 4KBKA 4NWMA 1LEWA 4H58A 1YHWA 3V8SA 3QX2A 3TN8A 3HL7A 4F0GA 3FLQA 4CZTA 1MQ4A 3FE3A 4C8BA 4CCBA 4JBOA 4E4MA 5BYYA 5DG5A 3ZO1A 2GNHA 2R0UA 4M3QA 4FSYA 2OZOA 3MYGA 2PVHA 2CNQA 3PIYA 3DDQA 4A9TA 2PMOX 2G9XA 5E7RA 4EOQA 2C5VA 3M11A 4P4CA 2PUNA 2RSVA 3BYOA 3CEKA 4JVGA 4CNHA 3BBTB 3PJCA 3U6IA 2W1EA 3ZSHA 4APPA 2XEZA 3FLNC 3ZXTA 4E1ZA 4FKTA 3WYYA 3ROYA 2RFNA 3SA0A 4W4XA 1ZYLA 4ZSAA 4GG7A 3WF7A 1REJA 4NFNA 3P86A 3C4FA 1ZYSA 3KK9A 4QOXA 3R9HA 3BHHA 2BDJA 5JGDA 4IB1A 3KGAA 5C8NA 3QXOA 4RA5A 4RMZA 4E6AA 3D5UA 2GQSA 1JLUE 1H1RA 3E87A 2C0IA 4JR3A 5CY3A 3TM0A 4CFNA 4QMXA 5IA0A 1GZ8A 3KXNA 4B6LA 1H1WA 2VUWA 4O81A 2BHEA 4C4GA 5A4EA 4C57A 3QQHA 4MCVA 4ZSLA 3W8QA 4BTJA 1BL7A
chains in the Genus database with same CATH superfamily
1J7LA 4GFOA 3BQRA 3MTLA 4I94A 3ERKA 1XH5A 4OBPA 3ORTA 5J5SA 4DEGA 2WFYA 3VRYA 4KRCA 4GIHA 4BCHA 3OCSA 2RFDA 1GNGA 2HWOA 1YDSE 3C51A 3R22A 1B6CB 2YCSA 3DT1A 4HPTE 4LUEA 4RFMA 2PE1A 5A3XA 2J9MA 3SX9A 3IKAA 3P23A 4AXEA 3QX4A 4ZS0A 5HEZA 3QKKA 3LCTA 1APME 4FL3A 4X2NA 2VTAA 3SOAA 4CT1A 4K9YA 5DR6A 5KNJA 2GQGA 1BUHA 2IVUA 3UDSA 3BU5A 4DC2A 1UV5A 2JDSA 3MSSA 3FMKA 2C0OA 1BI7A 3OP5A 4L67A 2WTCA 3P1AA 4H1JA 3TUCA 1CMKE 1YHVA 4II5A 4FGBA 3BLHA 4GJ3A 1WBOA 4N0SA 5CEOA 1Y57A 5AV2A 4BDHA 3LIJA 4RJ4A 4XOYA 2HW6A 1XH6A 3KXGA 5FEEA 5L2TA 4YJRA 2RF9A 3RPYA 2BAJA 2QOQA 5GIPE 4QNYA 4Q9ZA 2I7QA 4EOLA 2W7XA 1WZYA 4YZNA 4IE9A 3ZO4A 4AGDA 5BMSA 2R3LA 4DFBA 1ZYCA 5CQUA 3C7QA 2CJMA 4YJQA 4DH1A 3KKVA 3NNXA 1PMUA 4O2ZA 2ITVA 2QO9A 3KN6A 1GZOA 3ZS5A 2JKOA 4AF3A 4IZAA 5AUXA 3PJ8A 2R7BA 4GT5A 3TZMA 4FV6A 4R8QA 4L45A 4QPAA 4ANQA 3TJCA 1W8CA 4ZMFA 2BRNA 2JIVA 4BI1A 5H8EA 1OI9A 2CKQA 5KZIA 4I21A 5E8YA 1BMKA 4IQ6A 3O7LD 3FZOA 2IWIA 4N6ZA 4XOZA 4JBVA 4AACA 4JG6A 1XWSA 4QYYA 3L1SA 3HV3A 4YJPA 2QLUA 3HMIA 2XIZA 4AXCA 3DAKA 4LL5A 2GTMA 2J5FA 4P7EA 3WZJA 5T6KA 2E9OA 4TYIA 1UNHA 1U4DA 3DNEA 3AKJA 2WNTA 3JUHA 5BVKA 3U54A 2WMBA 4G5JA 1JKSA 3ZRMA 3FEGA 4Y5QA 2PMLX 4WSQA 2RG6A 3NPCA 5C9CA 4DGGA 4QP6A 2YITA 2UVZA 4D58A 4O83A 4I6BA 4DG3E 3H30A 3BWJA 3VUKA 4NKSA 1SZMA 2BRMA 3EQHA 3LFAA 5IUHA 5LCJA 3SW7A 4F9YA 3VVHA 5IH4A 4GKHA 3FL5A 3GOKA 3TG1A 1BYGA 3P08A 3QGWA 3UDTA 5IA1A 4KIKB 4BHZA 4DFZE 4EK8A 3NW7A 3QQFA 2FH9A 5GNKA 3L9MA 3P9JA 3VJOA 2CGUA 3RPOA 3OZ6A 3E7VA 4U44A 3II5A 5DPVA 3P78A 2HZNA 4OTHA 1AD5A 5AR3A 3KMMA 4ZY5A 2JBOA 3A99A 3QTUA 4LOQA 3E64A 4J99A 4IB3A 2AYPA 5DH3A 3BL7A 3PXFA 3E92A 2WTVA 5D7VA 2RG5A 1PRYA 2B9HA 4D2PA 5IA3A 4WOVA 4F9BA 4BJJB 4HNFA 4OBQA 5L2WA 4UYAA 3Q52A 4B7TA 4LG4A 4LQMA 3PSDA 5D12A 4DE4A 3H3CA 4QMUA 2WB8A 1YXSA 3EHAA 4LL0A 4GVAA 4Q5EA 4FV7A 4QP9A 3EYHA 3F5PA 5JGAA 3PA5A 3JY9A 3DK6A 4ANOA 5BUIA 3TMOA 5LWNA 4CV9A 4D4RA 4BWPA 4HVSA 5AX9A 4XCUA 3AD5A 3ET7A 4K0YA 4MXZA 4FSWA 4BZOA 5IUIA 5BQ0A 4IEBA 3KULA 3R28A 2OFUA 4YC3A 3ZCLA 5M55A 5EKOA 4TYHA 3IQ7A 4BI0A 4O0UA 1R39A 4ZTQA 3BYSA 4FIFA 1H28A 2QG5A 3R8MA 5CAPA 3FMEA 3I79A 2KTYA 5F4NA 1XH8A 4HVIA 5AR8A 3NS9A 5L8JA 4FT9A 4QEBA 4DT8A 1TQMA 5HD7A 2YABA 5C8MA 2FUMA 2OXXA 4ALUA 4DITA 3ORIA 5AV1A 2X1NA 2VGPA 1UU8A 4O7LA 2CDZA 4BBMA 3C5IA 2O2UA 2OG8A 1JQHA 2VU3A 1SVGA 4GYGA 3SVVA 2QOOA 3C4ZA 2QOFA 4U3ZA 3F5GA 4RJ5A 3TV4A 5EM5A 1P4FA 3ZSGA 4OW8A 3IW7A 3ITZA 3AC3A 4W4WA 4GFGA 5CVGA 4EOSA 5CSXA 2XEYA 5HLPA 3I81A 4AXAA 3PFQA 1GIIA 1V1KA 5ETCA 5LMAA 4ASZA 4OBOA 3HUBA 2BVAA 3BLQA 3EWHA 4QP7A 4UMPA 1NY3A 2BAKA 1G3NA 4IZ5A 4X0MA 3NYXA 4Y73A 3Q4UA 2BPMA 3LFBA 3R63A 3VF8A 3GCQA 3NIZA 3CP9A 3OMVA 3CE3A 4EH5A 4FTTA 4EZ5A 5LVNA 3QCYA 4ERKA 3KL8A 5LVPA 3JVRA 2PVMA 3ULZA 5GIOE 3DGKA 3H9RA 2GNJA 5T3QA 4JS8A 4GKIA 4UXLA 3Q9XA 4HZRA 2HZ4A 3CTHA 4DFXE 4D4SA 3VW6A 4RT7A 4MK0A 5J8IA 2WMWA 2J7TA 3BGQA 3DBDA 4AZVA 5IMXA 2SRCA 4FIGA 4DLJA 1JSVA 4BB4A 4WHZA 4OTFA 3VS7A 3PA3A 3BELA 3RVGA 4BZDA 3FJQE 3K3JA 4BDKA 2O63A 3ORZA 2WMVA 4K11A 1Q99A 4R7HA 4FV2A 4PF4A 5FG8A 1NVQA 2X0QA 2ACXA 3HP2A 2B9IA 3Q4ZA 4CTBA 4FSMA 4FOBA 3UO5A 1OIRA 2WQOA 2EXCX 5DR2A 3V6RA 3V5WA 3PYYA 3FHIA 3QQKA 2CKPA 5J7HA 2VAGA 2XZSA 3O71A 4CV8A 4M13A 3ALNA 4YLKA 3MVHA 3POOA 5KCVA 4NW6A 4FV5A 4AA5A 3R1NA 4RWIA 5BV3A 2X4ZA 2UW8A 2VTNA 3LCDA 1UU7A 3WZEA 2ZFYA 5HLNA 4M15A 1Z5MA 2QI8A 3G90X 5AJQA 4F0IA 1OKZA 5EI2A 4OTWA 4RC4A 5I3OA 4ACMA 4BDDA 2LGCA 4UYNA 1R0EA 1U54B 3CSVA 4LOOA 1W98A 4DFYA 4IW0A 3VBWA 4YZCA 3UDZA 2B9JA 4ITIA 3MN3A 5F94A 4JG7A 2XB7A 3BV2A 2G01A 3HMOA 4NM0A 4M69B 5F1ZA 4LM5A 2CSNA 2W0JA 3G6GA 4GIIA 4QYGA 2HENA 2PK9A 4YHFA 3EN5A 5J79A 4ZZNA 4EKLA 4ZZOA 4JDKA 4FTCA 2PY3A 5KBQA 4FRFA 5HIDA 2DQ7X 2QD9A 4FSUA 1L8TA 5BYLA 1P2AA 2X0OA 3QALE 4ENXA 5CEKA 2JC6A 3GFWA 4USFA 4FC0A 4FTLA 2W1IA 4IX5A 5JFVA 4FNWA 1WBPA 3GC0A 3AGLA 3GU7A 4FSRA 4DTKA 3RPVA 2O3PA 4YC8A 3OXIA 4C36A 4ZY6A 3HV6A 3MY5A 3WF6A 3ZLYA 3FKOA 1TFFA 4BCGA 5JRSA 4QD6A 5CAVA 4Y83A 2R3MA 3KB7A 3AC8A 4FEVA 1FBNA 2JDRA 2PZIA 5CEMA 3KCKA 4BGHA 1WBTA 4YTHA 3PJ3A 4DGLC 2F2CB 1DI8A 5FXSA 3RK5A 2WMAA 4IVBA 1YKRA 3WE8A 1LEZA 5JSMA 3A4OX 3BGZA 4TNDA 2UZUE 4U80A 2CGVA 2GSFA 3SV0A 2Z60A 1V0BA 4RIYA 3SXFA 4IIRA 3UBDA 5ITAA 4FSNA 4O0XA 2R0IA 3W33A 2XK6A 2W9FB 4XYFA 1KUTA 2ETMA 4OGRA 3RNYA 2PHKA 4C02A 2NO3A 4NJ3A 1OUYA 2IZSA 3NZ0A 5AUZA 5IISA 4M84A 2JAMA 4BGQA 4MEDA 3LFCA 2VO3A 4FI1A 4BDEA 3BX5A 4KSQA 2QC6A 3G9LX 1M52A 3LM5A 5IQDA 4YSJA 3TI1A 2ITOA 5HORA 3HMNA 4JQEA 3UC3A 2I40A 2CN5A 3MJ2A 2OJFE 2X9EA 4FKOA 4NM3A 1H24A 4RZWA 4JAIA 4O22A 5FXQA 4LGHA 3R8LA 2FYSA 4DHZA 3EL7A 2I1MA 3D15A 2W1GA 3WYXA 2Q83A 4LYNA 5H8BA 3RINA 2BR1A 4IADA 4AW0A 4ZSEA 2XAOA 5CF8A 3ANRA 2YA9A 3PE2A 5M56A 2CKEA 2GFSA 5HKMA 5CI6A 4QMNA 3LFFA 4FBXA 4V01A 3VUMA 4RX8A 2IF8A 1IA8A 4I93A 5J5TA 3VN9A 3EFKA 2HCKA 3ZLXA 3FZ1A 1KE8A 3BI6A 2XBJA 3G6HA 4DEHA 3QC4A 4GYIA 4LRMA 3BHTA 5HBJA 4XG7A 4WRGA 4A4LA 3PY3A 2ZYBA 1OL1A 4C4JA 2AUHA 3PRIA 3MTFA 3A8WA 5HLWA 5K5NA 4R78A 2W9ZB 4ZS4A 4QQ5A 4BDIA 1TZDA 4QQCA 4EOOA 2JKQA 3QQGA 4RG0A 3UZPA 2X8DA 3AXWA 3KRWA 4BYJA 2X39A 3L8XA 4I5PA 4YLLA 4YMJA 3LXKA 2OJ9A 4HVDA 4E4NA 5M44A 3SG8A 2W4KA 5ANEA 1YOLA 3FV8A 2ESMA 1DAWA 4NM7A 2C4GA 3Q6WA 4H3BA 2J51A 2C6KA 5FD2A 3N4UA 5AM6A 4S30A 5IMEA 4IX4A 5DEWA 4YO4A 1CM8A 2UW3A 3A4PA 3IDBA 5TF9A 4BDGA 2R7IA 2V7OA 2WOTA 4X6RA 1H0VA 5KZ0A 3DA6A 3QC9A 4A7CA 5I4NA 5A14A 3F3WA 4X2FA 3GU8A 3GCPA 4PY1A 4AUAA 4D5HA 3HVCA 4I22A 2ZVAA 1ZY4A 2WOUA 2BMCA 2VZ6A 1RQQA 2QCSA 2ZM3A 4I5HA 4WUAA 5ACKA 3WZUA 1LPUA 3L8PA 2PVJA 3EZRA 3NR9A 5KMLA 2QOHA 2C5OA 4FZDB 1ZY5A 4R3PA 3CCNA 3AC2A 3D0EA 4UMRA 4KBAA 2YACA 4I4FA 5CXZA 2YIQA 4HYIA 4O0TA 3DLSA 2V62A 3C4CA 4BKYA 4O0RA 3OY1A 5GJDA 4IB5A 4LGGA 1OECA 4EC9A 2XYNA 5EHYA 4I5MA 1OKVA 2FSTX 2VX1A 1PXPA 2G2FA 2YZAA 3BEGA 3DKGA 5CU6A 5AR2A 4JG8A 1E1XA 2PYWA 3W0NA 2EU9A 3VF9A 1P4OA 2I0VA 4QTAA 3SRVB 4HVHA 3C1XA 2ONLC 5HNBA 5A4TA 4KD1A 5CVFA 4DDGA 1XH7A 1YDTE 2YAKA 2ZOQA 4I5CA 2ETKA 2EB2A 2ZB0A 3A2CA 2REIA 1Q24A 3DB8A 2WMRA 3GVUA 2BRBA 5BVFA 1QL6A 2XH5A 4FG9A 3QYZA 4IX3A 4TWNA 4XP0A 3E8DA 2UZOA 4WUNA 3T3UA 4GCJA 3ZUUA 3DK7A 2R4BA 3G15A 1EH4A 5CEQA 2QU5A 3EQPA 2WQEA 4G2FA 4XMOA 4A4OA 4C61A 3RP9A 3VAPA 1CKIA 4H05A 2W1ZA 1IAHA 3G9NA 3UVQA 2JFMA 4LI5A 4S2ZA 3R7GA 2A1AB 3RAIA 4NK9A 4F1MA 2HY0A 4RQVA 4AU8A 4AN9A 4J1RA 4GT4A 4DEAA 3VBXA 3NRMA 4RFYA 4AA4A 2B7AA 2F7ZE 3F7WA 3MFRA 2C6TA 3GOPA 5J87A 1S9IA 3UVPA 1O6YA 2X2KA 4L8MA 2BZHB 1CKPA 4QP1A 5ACBC 2JLDA 4YBJA 4CFWA 1H1PA 5CZHA 3MY0A 4X3FB 5TT7A 5A6OA 4IDVA 5IQCA 4XRLA 1SVHA 3Q4CA 4BICA 4OLIA 5GHVA 5GZ9A 3DK3A 1WAKA 3H10A 4AE9A 1OMWA 3VJNA 4IWDA 3UZTA 5E1SA 3EN9A 3TKIA 3ZH8A 3BHUA 1PMVA 4WNPA 4DFNA 5CU0A 3K5UA 3R1QA 3EN7A 1OKYA 4MXYA 1K3AA 5I9ZA 5BPYA 5CLPA 3UG1A 4BCNA 3L9LA 5AAGA 3KXHA 5E8TA 4ACGA 3IDCA 3EKKA 4FOCA 5BVWA 3W10A 5HD4A 5AP1A 3P5JC 5KMNA 4D4VA 2BRHA 4WNMA 3FMLA 4AT5A 4BCKA 2VWUA 2XK7A 3M42A 4TYJA 4ARKA 4IACA 2WKMA 1GY3A 2F57A 3WARA 3ATSA 1TVOA 3VRZA 3NUUA 1CSNA 3G51A 3W16A 4UALA 2PPQA 4X2GA 1I09A 4CCUA 5AM7A 5TO8A 3MVMA 4Y5HA 4O7YA 2BIYA 4HGTA 2FSOX 4EOJA 4QP3A 3VBQA 4IAZA 5L2SA 3LJ2A 3Q3BA 4ACDA 4G6LA 2EWAA 1FVVA 4PDSA 3FXXA 4MD9E 4R1VA 4AZEA 1O6KA 3ENMA 1XR1A 3UYSA 5IQFA 3A7FA 4D28A 4XP3A 2JD5A 3CJGA 3EMGA 3HNGA 3AT3A 3L8SA 3QAME 4FZAB 5D10A 2PUPA 1KWPA 1GJOA 3UO4A 4C4IA 4EKKA 2XIYA 3QTWA 4EBWA 1VLRA 1XHAA 2C5YA 2B9FA 3ZC5A 3NAYA 4NUSA 1Q8UA 4HW7A 1XH9A 2HXQA 3OY3A 5HIBA 4NIFA 2G2HA 2Z8CA 4PV0A 4N57A 4CG9A 4HCVA 5CALA 5HE0A 4IM0A 3CY3A 3AD4A 4UWCA 4QQJA 4D55A 4O27B 2CN8A 3BCEA 2P4IA 3W55A 3C50A 5ANKA 3HLLA 2WMQA 4K1BA 3LHJA 4GUEA 4CMUA 2GNGA 2ITPA 3S00A 4DHJA 4DA5A 3QZIA 4TY1A 2PU8A 1Y91A 4OTIA 5IA2A 2PE2A 4L46A 2GQRA 3GI3A 4DYMA 3OWKA 3QBNA 5A54A 4LRJA 2X6DA 4C2WA 2C3IB 3JVSA 3RGFA 5BYZA 1U46A 3VBYA 4WD5A 4XG3A 2PZYA 3E63A 3I6WA 4GUBA 3GFEA 4BDJA 5I9YA 4TYHB 3RK9A 3HMMA 4TYEA 3P7AA 4RC3A 3R9NA 4UMUA 3KF7A 2B54A 3FKLA 3OXZA 3FYJX 3PTGA 4ZLYA 2WTJA 4X3FC 4D9UA 5EHOA 5GJGA 4FTUA 3QCSA 3HAVA 1Q61A 4R7BA 3DFCB 4L3LA 3Q4TA 1PJKA 5HVKA 1YI4A 2XIRA 4Q2AA 3WZKA 4E4LA 5CAUA 4HPUE 1FMKA 4YJUA 5FTOA 3UJGA 5KMOA 2J0KA 3COKA 1KE5A 2C6DA 2PZPA 3ZFXA 4AA0A 3TDWA 5HE3A 3DNDA 1BLXA 5L4QA 3UNKA 1FPUA 4U45A 3SHEA 1ZOEA 5EYMA 3E8EA 3DKFA 2C3JA 2Z7QA 4IJPA 3PPJA 3NYVA 4UN0C 3VONA 4BCIA 2WQNA 2UZLA 2R3FA 2QU6A 2OZAA 1ZYJA 4G16A 3E62A 4D0XA 4L7FA 3C0HA 3RHXA 4DH7A 3L8VA 3ZO3A 3QGYA 3QUDA 3UMXA 4QMOA 5HE1A 3VNTA 4BI2A 4F64A 5ANDA 4F6SA 3TXOA 4CKRA 3UIBA 3VS6A 2IEWA 4ZEGA 4G17A 4O7SA 1PXKA 3UIMA 3GGFA 3PPZA 4KUJA 1G5SA 3NYNA 5CQWA 2C47A 4RJ7A 4W4VA 5AR5A 2WMSA 3KRJA 2WU6A 3PUFC 5D41A 3R83A 3GU6A 1VJYA 3SD0A 3EJ1A 3HV4A 2XCHA 4K77A 4MXAA 4O7WA 2GFCA 3D2KA 3MIYA 4WBBB 2ZDUA 4D2RA 5HO7A 2BKKA 1IA9A 2GMXA 1YDRE 3ORNA 4RLLA 5EW9A 5IH5A 2PUUA 5DYJA 4EUUA 5HTBA 5F95A 5L8LA 3R2YA 3F7ZA 2YCFA 3FZSA 4LMUA 4XV9A 5CNNA 4MUQA 3ZZWA 5AMNA 4EYJA 4J97A 5L2QA 4BDBA 5CF6A 2C69A 4D1XA 4RX9A 4C62A 2EXEA 4YP8A 4R5SA 5JQ5A 4FV4A 4O4CA 1YOMA 3OHTA 3QF9A 5D7AA 4EK5A 3HP5A 3G2FA 4L3JA 2C6MA 5FM3A 3TDVA 4ENYA 1ND4A 4D1SA 3SKCA 3Q5ZA 4MTAA 3MB7A 1W84A 4TPTA 4D2SA 5BUEA 3NUAA 5CSVA 5AUTA 1OBGA 4RJ6A 2VTRA 3ZRKA 3LMGA 4DHFA 2CLQA 5LMKC 1OIUA 2IZTA 3PLSA 4IVAA 3ZM4A 3W2RA 3S0OA 4YJVA 2OI4X 4QTCA 5C26A 3NX8A 3FC2A 4XG2A 2WD1A 5HGIA 2F7EE 2ERKA 4DH8A 1AQ1A 3ID6C 4M67A 3AG9A 2BUJA 2XNEA 3PDTA 2ITXA 4O82A 4FV0A 4BVUA 4C3RA 4ANNA 4DG2E 5AP7A 3LCOA 5EM8A 4GV1A 2VTTA 2YM8A 4FTKA 2XJ0A 3NDMA 4U43A 3SW4A 4E5WA 4YZDA 5KO1A 4QQTA 4QMZA 1T46A 2IVTA 3OCTA 2Y0AA 4H36A 2YIWA 3O8UA 3E7OA 3LJ1A 5DFPA 4G3DA 5EYDA 1ZMWA 3LLTA 4E20A 5IF1A 3E88A 3V5QA 3QQLA 3ZLWA 4AGUA 3QD4A 5LWMA 4W4YA 4DEIA 4Q5HA 4CTCA 3ZBFA 4FICA 2CKOA 3RZBA 5FQDC 1YXVA 3DZOA 3FY2A 4FR4A 4WT6A 3S2PA 3ACKA 4O21A 1PMEA 4NJDA 1PXNA 4QMSA 4HZSA 4PMMA 4BDAA 4FL2A 5HX8A 2YLEA 1YXUA 4L44A 2XF0A 1URCA 2W5BA 4FUXA 4IZ7A 2XIXA 4XP2A 4FE2A 4JI9A 4Z3VA 3PA4A 1M2QA 4L01A 2IW9A 2Q0NA 4PRJA 3CS9A 3CQWA 4CQEA 2Z2WA 3MBLA 4GL9A 4PNIA 1M14A 5IDPA 3VQHA 4E8AA 4EOMA 5IKWA 4QMYA 4N6YA 1F3MC 2G15A 2BRGA 2OSCA 3EKNA 1CTPE 4HGLA 3FLZA 4MF0A 2LAVA 2HOGA 4FKVA 2WQBA 4ASDA 5FP6A 3DXQA 3QD2B 3P4KA 1FVTA 3OUKA 3DQWA 3E93A 3R00A 5CANA 2OK1A 4BC6A 2PE0A 4O4EA 4O91A 3P79A 3QZHA 4FSQA 2FO0A 1JKKA 2ZV7A 3O7LB 4G34A 3W2OA 4E6DA 4DFUA 4PNKA 2WQMA 3FAAA 4O7VA 3OTUA 2GHMA 1P5EA 4DEBA 1G8SA 3TACA 4RVTA 3PVGA 4XRJA 1Q3WA 1WBNA 4JBPA 1PXOA 5BX0A 2VO7A 5JZJA 2C1AA 4IXPA 3OOMA 4RIXB 1ZAOA 2WHBA 5A4CA 4PPAA 4RJ8A 4O38A 2AQXA 3TUDA 3PY1A 4KS8A 1PMNA 2C5NA 4FKJA 2VO6A 2Z7RA 3DBEA 3O2MA 5B0XA 3HRCA 4TZRA 3SQQA 4B99A 4IHPA 4MNEB 5CZIA 2GS2A 2PVKA 3FXZA 4F7NA 1TQPA 4KS7A 5I9VA 5AEPA 2QQ7A 4NSTA 1QPCA 3WZDA 4F4PA 5CXHA 3WF8A 2OIDA 4O0YA 2B1PA 3PZEA 3MH2A 4D2VA 5EM6A 3GC7A 3MVLA 5TKDA 3PPKA 3LMHA 4CFXA 3AGMA 3KQ7A 2VD5A 1M17A 1VYWA 4BTFA 4EH8A 4IAKA 4X2JA 4DG0E 1XMLA 2BTRA 2YERA 4NKAA 4P5ZA 3QUEA 3LW0A 4ITHA 3RWQA 2C30A 3KXXA 2QOCA 2WXVA 4ZIMA 5C27A 5HZNA 1PXMA 1SNUA 2CMWA 3NIEA 5D9HA 3L9NA 4YNEA 2UUEA 2YWPA 3PFYA 1WBWA 1U5QA 4BIEA 3K3IA 4AOIA 2UZEA 3CC6A 3IS5A 1PXJA 3U9CA 4C4EA 4ZTRA 4EH2A 4ZTSA 4F6UA 4I6HA 1M2PA 3VC4A 3BYMA 5M06A 4EH4A 4MF1A 3RWPA 1UA2A 4FZ7A 3SXSA 4HOKA 3P5KA 4Y72A 2OF2A 3IW4A 5CF4A 3C4WA 4TW9A 3O8PA 4USEA 5HVYA 2DYLA 2C68A 3NGAA 5FDPA 3K2LA 2A0CX 3IDPA 5AIKA 4EJNA 3Q53A 3V04A 3OCBA 4EL9A 4G31A 1H26A 4J8NA 4WA9A 3D14A 2VWIA 4CD0A 5HNGA 5DE2A 3ORLA 4ASXA 3AKKA 4H3PA 5CYIA 3FMJA 3WILA 1MP8A 4XBUA 3HYHA 2C5XA 3RI1A 3W0SA 1IRKA 4X3JA 2PSQA 4N70A 3FDNA 3DOGA 5FEDA 1JKTA 1L3RE 5I0BA 3W2SA 5BVOA 4I0TA 4L68A 1PYEA 2IZRA 4S32A 4FTAA 2X81A 1OUKA 2GPHA 3CXWA 5ETIA 3TZ9A 3I4BA 1JAMA 4FKPA 3RAHA 3W0QA 1A9UA 5DRDA 1HCKA 1FQ1B 2HW7A 4WBOA 5DT4A 3R7IA 2HK5A 2QKWB 3W2QA 1OKWA 1T45A 3AT2A 3EYGA 1PYXA 1WCCA 3I0OA 3OW4A 5GZAA 1H1SA 5IA5A 4PL4A 4FODA 2QODA 3UO6A 2W96B 2W1HA 5KMMA 3PXQA 5EYKA 3MWUA 5FXRA 2C0TA 4IWPA 4OUCA 3PVWA 5G1XA 2CGXA 1Y8YA 4IB0A 3ZU7A 1H8FA 4FT5A 4IBMA 2YHVA 4H39A 4R6VA 3T9TA 3VBTA 5CF5A 3AMAA 5TR6A 4EHEA 5EW8A 4BYIA 3Q9YA 1H25A 3EN4A 4O6EA 5L6PA 4LV7A 2PMNX 4JLCA 3KVWA 5M4FA 3PP0A 4FYOA 2F4JA 4AAAA 1I44A 4EH7A 1BL6A 3M2WA 2X6EA 4GW8A 3A7HA 3Q04A 4EORA 4OAUC 3B8QA 3W0PA 2JBPA 3UPXA 3U6JA 3ZOSA 3RNIA 5J1VA 4YJSA 4CMOA 2WMTA 1QCFA 2JITA 3BBWA 3E8CA 4ZLZA 4GK3A 2UVXA 2JIUA 3W1FA 4PMTA 2YM7A 4I6QA 3VULA 3C9WA 5I9UA 3TTJA 3VWAA 3GB2A 4CYJA 2X0GA 4AN3A 3SLSA 2R3JA 3CPBA 1B38A 1YXTA 1Q8YA 2BALA 4YLJA 4F08A 5IDNA 4ALWA 5JK3A 4YZ9A 2JKMA 1W83A 3VS0A 2OH0E 4ZMEA 4IAIA 4OTQA 4WG4A 2RFSA 4U5JA 4PDYA 4RGJA 4QDVA 1OGUA 5K5XA 4CG8A 4XLVA 3S3IA 4DGOA 4FG8A 4DDIA 4QRCA 3FUPA 1OB3A 2VWXA 3MH0A 3AC4A 4LUDA 5CI7A 4FEQA 4XNEA 5E92A 4DTBA 3F61A 3KRXA 3MB6A 3OEZA 4ERWA 4ANMA 4FKRA 4YC6A 4KSPA 5JKGA 5K0XA 2AEGA 3M1SA 2IPXA 2ITQA 3PY0A 3EQDA 4UZHA 2XVDA 1JOWB 1YW2A 5IUGA 5M07A 5JFXA 4BBEA 3ORMA 4NEUA 5EQYA 5B7VA 3TNIA 4KKHA 2AC5A 4RIOA 4YHTA 3DBCA 4RIWA 4C34A 2VTLA 2W1DA 3UODA 4DEDA 3A7JA 3RM6A 5DBXA 4J52A 3DS6A 4YZMA 4DFLA 5CSPA 4UMQA 2YZLA 2XNPA 1JBPE 4YNOA 1YWNA 2YDKA 4AG8A 1UVRA 2J0JA 3ACJA 3GNIB 4TWOA 3OS3A 5FDXA 3D7TA 3TNPC 4AN2A 4EWHA 5AFVA 3QTSA 3PWYA 4JQ8A 5AV4A 1ZWSA 3OEFX 4L6QA 3I0QA 4CFVA 3KIOC 3OWLA 4FUYA 1RDQE 4JAJA 5KE0A 2GU8A 5LQFA 3VQUA 3RKBA 2VGOA 3KF4A 2WTKB 4DCEA 4AGWA 3UYTA 4J53A 3W0MA 4JNWA 3OTVA 1GOLA 2J4ZA 3NVMB 2XRWA 4TWPA 1W2CA 4DAWA 4FTRA 4V0GA 3WOWA 2QHMA 3D4QA 4TT7A 3HECA 4TRLA 2VWBA 4IWOA 3AOXA 2JIIA 3ZM9A 1G8AA 1R0PA 4GH2A 2XK4A 4FIEA 4NIFB 3V8TA 4CKJA 4A06A 4O84A 1YVJA 5E8VA 4ZK5A 3UOKA 5AP4A 3DTCA 4O7TA 1QMZA 4PDPA 4ACHA 3O5AA 4EHZA 4YU2A 2QONA 4APCA 4NZWB 2XNOA 4DEEA 1SMHA 3DZQA 1H07A 3DCVA 4BIDA 4HNIA 3D5WA 5H3QA 3DU8A 3NNVA 4DTAA 1Q97A 3OBGA 4TYGA 2BIKB 3KMUA 4EBVA 3TTIA 3I6UA 3QTXA 4FIJ<