5FXSA

Igfr-1r complex with a pyrimidine inhibitor.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
SYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRAIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEEPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
publication title Discovery of a Potent, Selective, Orally Bioavailable, and Efficacious Novel 2-(Pyrazol-4-ylamino)-pyrimidine Inhibitor of the Insulin-like Growth Factor-1 Receptor (IGF-1R).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fxsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fxsA01
4ZTLA 2YAAA 2WMWA 3LJ1A 3U6JA 4NU1A 4MWIA 4J98A 3ELJA 2AC5A 4F0IA 3QUEA 3CC6A 2W4OA 2PUNA 4FOCA 4JAIA 3BHVA 2UW8A 2ZB1A 3I5ZA 4F9BA 2R3OA 5LMKC 2YACA 4IB1A 4A4XA 3HP5A 3LPBA 3PJCA 3TKIA 4B8LA 3OROA 5L8LA 4BWXA 4YLLA 4BIBA 5G6VA 5AR4A 4IX5A 3KXNA 4OT6A 3GC9A 3UOJA 2XNEA 4NIFB 4PMPA 3BU6A 1YOMA 2XIXA 3GC0A 3DBFA 2CGWA 4A07A 4IX3A 3TTJA 2HK5A 3UIBA 3DXQA 4FEWA 3N4VA 1JNKA 3IDBA 4FR4A 1QPCA 4U79A 4AS0A 5BQ0A 3EL8A 4FKRA 4D2VA 3UJGA 3ZM9A 2PZ5A 3Q9ZA 4W4WA 3VS0A 2NRUA 2UW0A 3KMUA 4YJQA 5H3QA 4FNYA 3K5VA 3KRWA 5HNGA 4N0SA 1Q5KA 3VVHA 2C68A 4DEGA 4EQUA 1URWA 3ENHA 4L3LA 2ITNA 4B0GA 5L4QA 2F49A 2VZ6A 5ETIA 4C57A 3OVVA 4YURA 4PV0A 1OPJA 3TZ8A 1OBGA 4N6ZA 4K77A 3KFAA 2QOKA 2V0DA 1BUHA 3DXNA 4BDFA 5AUUA 3ZO1A 3FMJA 4FT3A 5CEQA 2BIKB 1YKRA 2HZIA 3TIZA 1TQPA 5M08A 3JPVA 2UVYA 3CEKA 4AX8A 3LMIA 3QCSA 3QQJA 2PMIA 3W8QA 2C5YA 1NVRA 4CYIA 4EH9A 4HCVA 5CVFA 5M4UA 2GQRA 3D7ZA 3EN5A 3BYUA 3LIJA 4KINA 4MXOA 5L8JA 4CKJA 2FSOX 4DEAA 5KKRB 3HMOA 3A99A 4FZFB 4O0WA 3WF9A 2HW7A 2WELA 3FBVA 4M0YA 4TL0A 3QU0A 4LUDA 4OUCA 3ZFYA 4KBKA 4FG8A 2O5KA 2PSQA 4LFIA 2XJ1A 2YHVA 4IM0A 2CCHA 4Y72A 2EU9A 1Q61A 4S30A 4YO6A 4ACDA 3OT3A 3QTZA 3CCNA 3G0FA 3QUPA 3HMPA 3ZU7A 1PXKA 2QG7A 3Q2MA 4IB3A 2P3GX 3FUPA 4AA4A 4CT1A 1YXTA 4E4LA 5E90A 5EM6A 3M11A 4BICA 4U0IA 3GNIB 1PF8A 3DLZA 3R7YA 3GFEA 4L9IA 1LEWA 4S32A 5HE0A 3V01A 3KF4A 4E73A 2QONA 4LRKA 2QOOA 4APPA 4MHAA 2PTKA 4ANSA 1MUOA 4DHFA 3R63A 3KMWA 2RL5A 3QRTA 4YMJA 4OTPA 3G9LX 3OUKA 2WAJA 1OITA 3B8RA 4JX7A 3IW5A 4FNZA 2CHLA 5F1ZA 3EFKA 4DH8A 3CD3A 1TVOA 1NVQA 3C0GA 1R39A 1I09A 3BHTA 4E1ZA 2E9VA 1G5SA 3OXTA 2E2BA 2P33A 3R8VA 1U4DA 4D2TA 4W9WA 1OUKA 5KX8A 3V51A 2BZKB 5DHJA 3WF7A 1JQHA 1JOWB 3VBWA 4FEVA 4KSQA 3T8OA 5LJJA 5E8UA 3R83A 2CN5A 4I6QA 2FH9A 3H9OA 4H39A 4EC9A 2W5BA 3ZXZA 5BUJA 5L2WA 4IHPA 5CAOA 1BI7A 2BKZA 3D4QA 3QQGA 4YJSA 4G6LA 3ZBFA 4FV1A 4F08A 1ZY5A 3UBDA 4G9CA 5C26A 3HEGA 3Q2JA 3Q52A 3C7QA 2UZWE 4K33A 4CMUA 3LCTA 3Q32A 4FTLA 3MB6A 3ZRKA 3D7TB 3I81A 1RQQA 1XBAA 1XBBA 1YI6A 5HCXA 3ZLYA 4EWQA 2BAKA 4FTUA 5FXRA 2VX3A 5IA4A 4WNKA 2XKFA 4BCOA 5C8MA 5DYJA 4FKTA 2A19B 4BIDA 1QPEA 4OTQA 5EK7A 3HRBA 3QX4A 4E93A 5HLNA 5M09A 2XIZA 3LCSA 4I4FA 4KS8A 5IUIA 1P2AA 4DGMA 5BVDA 1UVRA 2BZJA 3FPQA 4CFWA 3TEIA 1Q24A 4CCUA 1UU3A 3KN6A 4BDBA 2QR7A 4RJ8A 4ERWA 3TXOA 4OW8A 2WTKB 3R28A 4Q5EA 5JQ8A 2XP2A 1KV2A 3DLSA 4O22A 5AUTA 2R7IA 3HECA 5F9EA 3LFNA 4W4VA 3MH0A 4FV4A 4IDTA 5HCYA 1WZYA 4O83A 2VTMA 5C1QB 4FKWA 3PPKA 2VWBA 3OY3A 3EQFA 1JLUE 3UP2A 4E4NA 1QPDA 5HVJA 4ZSGA 5AX9A 1BL6A 3WI6A 3U6IA 1Q62A 1JBPE 5M44A 4CFUA 5D12A 2XS0A 4XG6A 5H8EA 3LCDA 1H0VA 4AFJA 3F3TA 1PXPA 4P5ZA 3RZBA 5CF6A 4YTIA 4DFZE 1H1RA 1PXOA 3F6XA 2HYYA 2YIXA 3GC8A 4FKIA 5CQWA 3ZDUA 3TT0A 4TTHB 3TI1A 1HOWA 4XOZA 4H1MA 3JXWA 3Q4CA 2CKQA 3LMHA 4IANA 4F0FA 2PU8A 3FZTA 3MYGA 1BMKA 2GNLA 2I1MA 2HOGA 3R04A 5IA0A 2G9XA 2JDRA 4ZXTA 5BYYA 5K0KA 4RSSA 5IA5A 1YXXA 4ASEA 4CFNA 3ZBXA 4CYJA 4EH3A 2Q0BA 5ANIA 3KRRA 3C4XA 4EC8A 3DDQA 2B9HA 3GCUA 4M0ZA 4UYNA 2PL0A 4IDVA 4WNPA 3W2SA 3AT2A 3BLQA 4GS6A 2JD5A 5AFVA 4O7NA 2XKEA 5DN3A 2WIHA 2XK6A 4ORKA 2E9UA 4ITJA 5M55A 3WF5A 1BL7A 3P7CA 3RZFA 3PVWA 4ANBA 5IISA 5FTGA 3COMA 4HGLA 2XK8A 1R1WA 4C2WA 5EW9A 1Z57A 4ZJJA 3IW8A 3ZOSA 1KOAA 1ND4A 4QPSA 3EMGA 4TW9A 4L43A 3DK6A 5J5TA 4DTBA 4MKCA 3ZSHA 3QX2A 3UTOA 3ORMA 4NSTA 4KIOA 3UNZA 4C4IA 3SAYA 5IEXA 3PSCA 1Q3WA 2E9PA 3UYSA 3QRIA 3PG3A 3UC4A 4EJ7A 3KXZA 3ZYAA 2W5HA 2R3RA 5I9ZA 5EQEA 4X6RA 3ZFMA 2WTDA 4ZIMA 3QTXA 4ASXA 5CEKA 5K5NA 3IPHA 2ETMA 3LFFA 4HNIA 4QYYA 4UWYA 5AP4A 4DGOA 4EOOA 5J7BA 3FQEA 3IOPA 3N9XA 5DT4A 4C37A 4N57A 5AUXA 1GIJA 1H27A 2GPHA 3PVBA 2GNGA 2WMQA 4I5PA 1ZAOA 3R02A 4Y85A 5JQ5A 2O64A 2W96B 3P86A 3PTGA 4L44A 3UDBA 5A4CA 5A4EA 4UZDA 3MTFA 1SZMA 2XIRA 3R9NA 4HPUE 5LXMA 4FV8A 4GUBA 4QYFA 4A4OA 4YSJA 3TDVA 1H1WA 1NXKA 2UZOA 2WHBA 4YJRA 4CZYB 4EYJA 1DI9A 1M52A 4YJOA 3G2FA 5AP0A 3ZZWA 4UXQA 1OI9A 1IG1A 1MP8A 5CAVA 4AT5A 3AC3A 3G9NA 4F63A 3HAVA 4FK6A 4JDIA 4OTHA 4F6UA 4M13A 4XS2A 3UMWA 3P7AA 4NYEA 3CIKA 5AR3A 4U97A 3PFQA 3M42A 3E93A 3ROCA 2OIDA 1Q3DA 1MRYA 1PXNA 4YC3A 3UIMA 4ALVA 2OXXA 1J1BA 5L2SA 4ZS0A 3W2OA 3CBLA 4PDPA 3C4CA 4D0WA 4OTDA 4IACA 4RLKA 2YWPA 5EM5A 4L45A 3ZO4A 3LOKA 2OF2A 2WTIA 2ZMCA 3CJFA 3HZTA 4WIHA 3TZ7A 4A06A 1UV5A 2WQOA 4I6BA 5C01A 5HBJA 3EYHA 2XJ2A 4CLJA 4IM3A 4DA5A 4BBEA 4J53A 1ZYJA 3LM0A 3QL8A 2UW4A 3EQRA 3LXPA 3OD6X 1PKGA 4R3PA 4WRSA 1J7LA 3CY3A 4L3PA 3BBTB 4QQTA 2CMWA 1ZYLA 3QZIA 4I5CA 3C4EA 2OBJA 1OIQA 2W1IA 4HNFA 5CLPA 5GJGA 4EUUA 4BZDA 4E8AA 5GZAA 3ZM4A 3SLSA 2QOFA 4L46A 3U87A 4O7ZA 3KCFA 5M53A 3QA8A 3QRKA 3AMBA 5CS6A 1Q8YA 4NCTC 3OG7A 3EIDA 3O50A 5T68A 4RRVA 4AN3A 5AR8A 2CGUA 3OP5A 4JQ7A 5J7HA 4YC8A 4EQMA 1ZMWA 1KE9A 4XLVA 2BZHB 3I60A 3HV4A 5IPJA 3JR1A 4C02A 4A4LA 3PZHA 4GCJA 4AOIA 3MI9A 2RFDA 3GT8A 4D9UA 3FLNC 3NCGA 5B2KA 4KKEA 4OGRA 4BDGA 2B4SB 1H01A 4FIEA 3MBLA 3W32A 2JLDA 3KREA 1BI8A 3FLYA 4R1YA 3CKXA 3F3VA 4LL0A 3RINA 2RF9A 5IQEA 3C1XA 3RHXA 4HZRA 3F7ZA 3SW7A 1OIUA 2REIA 3VBQA 2GS6A 3OW3A 4BCJA 2F57A 5LVMA 3D5UA 5I3OA 3R7GA 5CQUA 3W18A 2GNIA 3PVUA 2BUJA 1QMZA 3GQLA 3NDMA 1H00A 4O7RA 3PY1A 4O6EA 2XK9A 4RVTA 3UODA 3V5PA 3ZDIA 4DEBA 4FTNA 1XWSA 3KVXA 5HKMA 4YUQA 2BDFA 2JIVA 3LMGA 3QQFA 3U9NA 1PRYA 4X6QC 4B8MA 2ITYA 1OPKA 2V7AA 1W7HA 3HV6A 5BVKA 3RVGA 4O84A 4AZEA 3I1AA 4AT3A 1OKZA 1VYZA 4H3PA 3O71A 5BMSA 2HXLA 5I5ZA 3ZMMA 3W16A 4CG8A 3OTUA 4IB0A 3V5LA 2WMXA 1GY3A 5CSHA 3R8MA 1ZOEA 1YI4A 1O6LA 4QT1A 4JDHA 3QQUA 4FZ6A 3O0GA 4PTEA 2CDZA 4PP7A 5IA3A 5J9LA 3RPYA 1RJBA 2ZJWA 3F9NA 2WKMA 4R7BA 2JBPA 2CPKE 3RHKA 2X6DA 3VQUA 2BCJA 2OIQA 4QP4A 3TUDA 5IQDA 2Q0NA 2C6OA 2WNTA 4G3EA 3PP1A 3FEGA 5IZFA 4YZBA 4I6FA 4YPSA 5JKGA 3N4TA 3FI3A 3H0YA 4I0RA 4M66A 2YCFA 3ZC6A 4CKIA 2XNPA 5J1VA 3TKUA 2ZMDA 1WVWA 3FMKA 3QD2B 3QTQA 4X2KA 4ANMA 3WF8A 3WYYA 4RC4A 3P23A 4AGDA 5DLSA 1K3AA 4V04A 5AV3A 4FKSA 1XH9A 2VTOA 4NM7A 4CFXA 4X2NA 1W98A 2P2IA 2BDJA 2HWOA 4E5AX 5IMXA 1GZNA 1WBOA 5AV1A 2YM4A 4QTDA 2X2LA 2FVDA 3R8PA 3TZ9A 3ZUVA 4Q9ZA 3F7WA 4EK8A 5AV4A 2J0IA 4BHNA 3UQFA 1W82A 4F7SA 1PYEA 2UZVA 5D9HA 4ZLZA 2W17A 5CANA 2YJRA 3NUPA 4FTRA 5E8WA 2X0GA 2YM7A 4FE2A 4AN2A 2R4BA 4NFNA 4AZTA 5HICA 4UALA 3AD5A 4O7WA 4IVCA 2X8IA 3QTUA 4MNEA 4Z7GA 2XEZA 4IBMA 1BLXA 5A46A 1IASA 4R8QA 2C30A 3QXOA 4BDCA 2BRMA 1CSNA 2IVSA 3I5NA 4BTJA 3DNEA 3A7FA 5F94A 3DZOA 2QOQA 3TIYA 3ROYA 4TT7A 5JT2A 2V55A 2PVYA 3ODYX 3QWJA 4QMPA 1YDTE 5AAFA 3WZEA 2XIKA 4WUAA 4YJUA 1OUYA 4PPBA 2Y0AA 4G17A 3NW5A 1O6YA 4G9RA 5HVKA 3GP0A 3EQGA 5KHXA 2BKKA 2V5QA 4O1PA 3JY9A 2XNOA 4II5A 4XCUA 2BDWA 1U54B 4EUTA 5IH6A 2OJIA 3NAYA 3NYXA 3RKBA 3COIA 4XBRA 3GB2A 5E8XA 5IG1A 3KMMA 3OWPA 5HIEA 4AZWA 5JFSA 1XH7A 3NPCA 4MNEB 5CI6A 4Y46A 4C36A 3I0OA 4BZOA 4QTEA 3FKNA 3OS3A 1OBDA 4JBPA 4IAAA 4NTSA 3V8TA 4RX5A 3NUAA 3UZPA 2IZSA 1REKA 5IH5A 4BTFA 5BNJA 2FSTX 1H08A 3RPOA 1XQZA 3PA4A 4HCUA 3SX9A 4AOJA 4L53A 2PVMA 3UP7A 2A0CX 2BRHA 4DITA 4X2JA 4MX9A 4I5HA 4D4SA 1SM2A 2OJFE 3DKFA 3MV5A 5DEYA 4RJ7A 3UO6A 4BDEA 1Y6BA 1YDRE 2OF4A 2HZ4A 3DJ6A 2Z7LA 4AFEA 3MFRA 3N4UA 3C5UA 4FSRA 4LM5A 2PVLA 4G3CA 3JUHA 3W55A 3AMYA 4ZK5A 4YHFA 3O23A 2XVDA 2YIYA 3BEAA 4XV9A 3AC1A 5CU3A 4D2RA 1H26A 3VUTA 1XO2B 4BDKA 5L6PA 4WG4A 2VGOA 4QYEA 4CGAA 3TDWA 4I41A 3AQVA 4AZSA 1YI3A 4HVHA 3RCDA 3DOGA 5HNIX 3KB7A 2OO8X 3WBLA 3NVMB 3PXFA 4ZY6A 2YZAA 3HX4A 5JFVA 2Y4IC 1CKPA 3NNWA 2RG6A 5EM8A 4ZZMA 3RWPA 2IJMA 5ANJA 2IZUA 4LOQA 4O1OA 4UN0C 4DFUA 2GFCA 1XH8A 3KKVA 4J99A 4O21A 4DLIA 2VWWA 4KBAA 4K0YA 2GMXA 4L42A 2VO0A 2G2IA 2VWVA 2PZPA 1OL2A 3OY1A 4FIJA 5JSMA 3VHEA 1ZARA 3ZLSA 3I7BA 1KSWA 3U6HA 2R3GA 5JK3A 3MESA 1UU8A 2UW7A 3JY0A 2PVKA 4XEYA 4CSVA 5M4IA 4PMMA 2F2UA 3KXMA 5E1EA 3VS4A 3DFAA 1UKHA 3F3ZA 3KRLA 5TT7A 4CRSA 4WD5A 4TWNA 4J7BA 4TWOA 1AGWA 5FLFA 3ORTA 4EOPA 3QF9A 5K5XA 3DK3A 2BIYA 2FO0A 3SXRA 2CN8A 4CRLA 2PPQA 3FSKA 4ZS4A 3GCVA 3RP9A 4DFNA 2OGVA 3PRFA 3C51A 2BTRA 4F1TA 4ANNA 1FBNA 3F3WA 4HJOA 3RPRA 3EZVA 5CU2A 4QMQA 2XBAA 4M12A 4GYIA 2X4ZA 4KIQA 4JQ8A 4F65A 4BVUA 5BVOA 2R3QA 2GQSA 3IW4A 2C6KA 2C0TA 4MAOA 1APME 3MSSA 3PY3A 2HY81 4IQ6A 3ORIA 3DFCB 5LVLA 1IAHA 4G3FA 2JFLA 4IADA 1SNXA 4BTKA 3QTSA 5K4IA 3IDCA 3QCYA 3LQ8A 4RA4A 1YDSE 3W1FA 2I40A 1O9UA 4L68A 5EW3A 5BYZA 4EEVA 3T3UA 5J9ZA 4FGRA 2R3MA 4C35A 2WXVA 3F2NA 4XHKB 3VIDA 3QZHA 3E8DA 4TYHA 3DBDA 1DAWA 2VTSA 5CYIA 5DEWA 4D2WA 3QKMA 2XMYA 4WT6A 2NO3A 4ZTQA 1NT2A 4X2GA 2Y4PA 4EHGA 2CSNA 2EXCX 2XB7A 1HCKA 3L9MA 2X81A 4IB5A 3V8SA 2PK9A 3QHWA 3DNDA 3EN6A 5JEBA 3FV8A 1HCLA 2QKWB 4JX3A 5GHVA 2ERZE 4E4XA 3KGAA 4WOVA 3TUCA 4O0XA 4HYIA 4RX7A 2C69A 5FDPA 3QYWA 4RLLA 3L8VA 3UZRA 4EZ7A 2Y6MA 3F82A 5FDXA 3VC4A 1OPLA 3LQ3A 4H3BA 5EKNA 3BPRA 3DGKA 1PY5A 1P14A 1P4FA 5E9EA 4QD6A 4I23A 3SHEA 4BWKA 3PJ1A 5DMZA 3L9PA 3OXZA 5KMOA 4GSBA 4TYHB 4X3FC 1NA7A 4YC6A 4EHEA 4XV3A 2RFEA 4AGWA 2ZM4A 3FMHA 3IGGA 3NIZA 4UWCA 4FOBA 4RWJA 3V6RA 4EHVA 3GU5A 3ZO3A 1CMKE 2IWIA 3NX8A 3M1SA 3PSDA 4XV2A 2JDSA 1YQJA 4ANQA 4NH1A 4YJPA 3LFDA 3RALA 4ZOGA 4EKKA 5FRIA 4DH5A 3FL4A 5AR7A 3ATSA 2ONLA 4Q5HA 2I7QA 2OW3A 5D7VA 3FYJX 3PE2A 5CSPA 4DH3A 3HVCA 4MXYA 3CXWA 3OCSA 3TZMA 5JGAA 2PE1A 3U51A 4FTJA 2YM5A 3TNIA 4C38A 2XH5A 4ZY4A 3L8PA 1Q4LA 1M7NA 3ATTA 4ID7A 4FIIA 3VF8A 1V1KA 2C0IA 4FSUA 4XG8A 3AOXA 2A2AA 3VRYA 4O0SA 4K9YA 5M57A 3E92A 4FSNA 3GOKA 5I9WA 3E8NA 3QTWA 2R7BA 4ZSEA 4OTGA 2DS1A 4MXZA 3FZSA 1B39A 3AT4A 3G6GA 4FKGA 4XP2A 4ZY5A 3OT8A 1U5QA 4E6DA 1X8BA 2X2KA 5DR2A 3RAWA 4GV1A 3EKKA 2DQ7X 5JFXA 4KB8A 3VHKA 4HVDA 2UVXA 4ALWA 3UNKA 5CENA 4D1ZA 4DFYA 2YLEA 5AR5A 1GIHA 4MF1A 1ZYDA 1JSTA 4H58A 4FEXA 3NUUA 4O96A 2Q83A 3UG2A 1H28A 3FWQA 4FTCA 4ENYA 5LVPA 2DWBA 2XBJA 3NYVA 4IZYA 3FXXA 3IDPA 3A8WA 3FZRA 2VTHA 1YHVA 5CY3A 4EH7A 1OIYA 3OCTA 4OLIA 4DTKA 4DGNA 3WILA 4BI2A 4NT4A 2X1NA 1Q8WA 3ZSIA 3A2CA 4CNHA 2C3JA 2W99B 5AP1A 4U43A 4GT4A 3UYTA 1KUTA 4OBQA 2VWUA 3QAME 4DF3A 2P0CA 2BTSA 4U45A 4YJTA 1PYXA 2ITXA 4YLJA 3D7TA 4GU9A 2OLCA 3ZLXA 3VAPA 1KE7A 3RWQA 1CDKA 5IKWA 2GFSA 3NUNA 5JH6A 4QQ5A 4USFA 4C3PA 1O6KA 4ACMA 3SG8A 4GKIA 4FIHA 5A6NA 3U4UA 4GH2A 4YBKA 5L3AA 3E7OA 1IA9A 4WNMA 2YZLA 4MK0A 2PE2A 3HMIA 2C6MA 3QC9A 4FV9A 4UY9A 3KC3A 4W9XA 4X0MA 4ZTSA 5KE0A 3ETAA 1VEBA 3FKLA 2R3IA 4FC0A 2QLQA 2WIPA 5H8GA 3UQGA 4ZSLA 2GTMA 3FXZA 3WE4A 3BCEA 4ENXA 3CGFA 3L8SA 4KKHA 3QZFA 4NKSA 3BHYA 3PPZA 4J96A 5HO6A 2E9NA 2H8HA 4GU6A 4YP8A 1PMNA 4B6LA 2PUUA 1FVTA 4IWQA 5JRSA 2XNNA 4FL3A 5BVWA 1MQ4A 3ZHPC 4RA5A 2BHEA 4MD7E 4GFOA 5TE0A 3UIUA 4U80A 2QODA 4DCAA 1I44A 4C8BA 2YDJA 3U54A 3LJ0A 4BIEA 2UZUE 3POZA 4D5KA 4DYMA 5AP2A 4R3CA 4TWPA 1U59A 3F5PA 2IO6A 3A4OX 5CNNA 5J8IA 3VN9A 5C03A 4BKZA 2JC6A 4QYHA 2JKMA 3C0HA 5ACBC 3FI8A 4BHZA 4AUAA 4XYFA 3D5VA 3DTCA 3QQLA 4I1ZA 2UZBA 3LFAA 4H3QA 4J8MA 4J95A 4QMTA 4WHZA 5DFPA 3VW6A 3EQIA 3P4KA 4XV1A 5HLPA 1WBSA 1J7UA 3KCKA 4BCFA 1M7QA 2BZIB 3FLWA 4XG2A 4MD9E 5HTIA 2QHNA 3FQHA 4F7NA 2W1EA 2O3PA 3DB8A 2RIOA 3F5GA 4IAKA 3QGWA 4DEEA 4IJPA 1LEZA 3PXZA 2JKOA 4JT3A 3R9DA 3MPMA 4RQVA 4NKAA 2VX1A 2E9OA 2XA4A 3PXRA 4MCVA 4FK3A 4EORA 1K9AA 1YWRA 3PSBA 4WNOA 3ZLWA 1LUFA 4A9UA 4EHZA 4FTOA 3KXGA 3MIAA 4AN9A 4DGGA 2R9SA 2ZDUA 3MB7A 4FL1A 5DG5A 2YCQA 3KU2A 3OWKA 1QPJA 2BRNA 5CAPA 1W83A 4CLIA 4FVPA 2JAMA 2RFNA 1H4LA 4QP7A 1ZRZA 2JDVA 4GJ3A 1SNUA 4U44A 5CF4A 4AWIA 4EKLA 2ZV8A 4E6QA 2RFSA 5A9UA 5H8BA 1FOTA 2Y4IB 2G2FA 3BV3A 3NNXA 4QTAA 3LLTA 3PIYA 3PXQA 5M56A 5JRQA 3D14A 3SOAA 2G01A 2QU6A 4D58A 4TWCA 2RSVA 3OEFX 5CZIA 3R1SA 5DRBA 2WB8A 4CD0A 4UZHA 4R7HA 1H0WA 4QYGA 4FMQA 4QP3A 2WD1A 4X7QA 2ZV7A 4NM0A 4PL3A 4QPMA 3BWFA 4J1RA 4M67A 4EK6A 3UZTA 4RVLA 3BKBA 2VWXA 5M51A 2I6LA 4KRDA 4BC6A 4K18A 4QMMA 4LRMA 4WG5A 4GK2A 3DS6A 3EOCA 2ITVA 3TACA 3A62A 3PZEA 4FKOA 4V0GA 4RX9A 3F5UA 4D2SA 4DBNA 3TN8A 2IVTA 4AE9A 5AUWA 5LWMA 2DYLA 2EXMA 4HGEA 5FP6A 5EQYA 4DH1A 2QHMA 5HBHA 5FP5A 4O2PA 4Z9LA 4ZZNA 3IS5A 4IWPA 1MRUA 4XG4A 1G3NA 4FSTA 4I94A 3DAKA 1LR4A 4V05A 3ZZEA 2F7EE 3FY0A 4L52A 5KBQA 4JIAA 5EOLA 3C50A 2JIUA 5AIRA 5AP7A 4QMLA 5CU0A 4G5JA 1OGUA 2XKCA 2C6DA 3MH3A 2XUUA 4LI5A 4OR5A 3Q4UA 4DC2A 1OL6A 4QP8A 2QQ7A 5E7RA 3QRUA 1OB3A 4C0TA 4F9CA 4CEGA 3ALNA 5LMKA 3R7UA 4Y5HA 2EVAA 4NFMA 3R73A 4AAAA 2XNBA 4NJDA 2R3PA 1WVYA 4FNWA 4RZWA 5IEVA 2XNGA 2QOLA 2W4KA 4MXXA 5D1JA 4V0GB 5J95A 4C4EA 1VZOA 2XRUA 3DU8A 4O82A 1JKLA 5LWNA 4PUZA 3EL7A 3QZGA 4E5BA 2IVUA 4M3QA 1ZZLA 3CP9A 4YLKA 2JBOA 2GS2A 4IVAA 3VS2A 2I0YA 2YEXA 4ZJVA 4KIKB 2GS7A 3UO5A 1IA8A 4PPAA 4QQJA 5I9UA 4FKPA 4A9SA 2OFUA 3ZONA 2CNUA 4CMTA 4FV7A 4I92A 5BUEA 2IW8A 5HX6A 5CWZA 4WBOA 1JSVA 2BAQA 2ZV2A 4YPDA 3O8UA 4ASZA 1REJA 2W1DA 2GNFA 3SD0A 3GEQA 3SDJA 3PUPA 2EXEA 4L67A 5D7AA 2NRYA 5T6KA 1JSUA 2QO2A 3O96A 4FG9A 3EH9A 3OOMA 3GCSA 4C33A 4BRXA 5CTPA 5AUZA 2GTNA 5E91A 3UQCA 2PZYA 4MBLA 4GKHA 3O8TA 3P9JA 4FSZA 3RJCA 1Q8ZA 3BBWA 4PQNA 2IN6A 5FG8A 4D28A 5CXHA 4BY9E 4MXAA 5D41A 3B2WA 4YZDA 2A1AB 4C62A 4FV0A 1FVVA 2UUEA 4ZLOA 4DEHA 4EJNA 2PYWA 3PWDA 2JDOA 5DR9A 2B7AA 4BDIA 4QNAA 3VWAA 4FKLA 2EB2A 5DIAA 1ZYCA 4HW7A 1FQ1B 3MVJA 4TNDA 5B0XA 1PXIA 3AC4A 2VU3A 4O0TA 4UBAA 2XM8A 4O0VA 4O7LA 3SA0A 2C6EA 1CTPE 3QLGA 4PNKA 1VR2A 5KMLA 2WMAA 1M2RA 1E9HA 3LCOA 3S95A 4O81A 4E6AA 2PZIA 4FTKA 3PJ8A 1E1VA 3HV3A 2BRBA 1YVJA 4R3RA 4BF2A 2UZNA 3JVSA 2OH0E 3EB0A 4FX3A 1AD5A 4Y5QA 2W1ZA 3E8EA 3MJ2A 3EFLA 3DJ7A 4IAFA 4BDDA 3ID6C 2H96A 3UG1A 1TQIA 5K3YA 5HZNA 4HYSA 5AEPA 4O7TA 4I5MA 3BGQA 1U46A 3H30A 3Q9WA 2ETKA 2YLFA 5KMJA 4IWDA 3LHJA 2FSLX 2HZNA 3TKHA 3EWHA 3PJ2A 3Q9YA 5EDPA 4CZTA 4TZRA 3GBZA 3EQDA 3SG9A 2OJJA 5HBEA 3G33A 3R22A 2R2PA 3C4FA 3ZCLA 4ANLA 3LAUA 4OTRA 3MH2A 3UE4A 2HW6A 4M7IA 5HE2A 3MFTA 4IW0A 4RMZA 4ITHA 3S1HA 2NNWB 5JFWA 3VBXA 2B55A 4C7TA 5KMKA 3EKNA 4G31A 3IONA 4BTMA 1E1XA 4RC3A 3BRBA 4XJ0A 5D10A 4JG8A 3FZPA 2YITA 3E88A 4EOMA 1WBPA 2VWIA 2YN8A 4OTFA 3ERKA 4EH6A 3CGOA 3EQBA 4UB7A 5FXQA 2ZM1A 3DTWA 3OCGA 3VUDA 4HPTE 1H1SA 4HVGA 3F2AA 5C27A 1R0EA 3V5WA 4FZ7A 2PMOX 2VX0A 4P4CA 2X8DA 3PY0A 3Q9XA 4IZ5A 2WQEA 4EOIA 3W2PA 1JWHA 2Y6OA 4NEUA 5EHLA 4CQEA 3AD6A 5AADA 1XH6A 5ACKA 3RBWA 3ZUUA 4EOKA 3NRMA 4PTGA 4DTAA 5CT0A 4PY1A 1DS5A 4GFMA 2J7TA 2XK7A 2VTPA 5ETCA 3ZTXA 2XJ0A 4I93A 3QBNA 4QQCA 3R7VA 4OTWA 5HIBA 3IGOA 4W4XA 4D9TA 4G34A 4R1VA 1UNGA 3VUIA 1ZMUA 1YW2A 2VRXA 3KY2A 4XBUA 4ACHA 5KNJA 4HCTA 2J5EA 4FV2A 3FC1X 4O6LA 3OEZA 4B4LA 1YXSA 2X7GA 4FKVA 2VTAA 4MTAA 2AUHA 3L9LA 3PXYA 3DV3A 4FYOA 5FGKA 5FWKK 4C58A 5HU9A 2WZJA 1RW8A 4RIXA 4MBJA 4P90A 4AXAA 2JITA 5K4JA 2WTWA 5CX9A 3RI1A 5EI8A 5BVFA 4JIKA 4IE9A 4X3JA 2BAJA 3AT3A 3I6WA 4BKYA 4O7SA 2BPMA 3UC3A 3UOHA 2Y8OA 5D11A 3UPXA 2O65A 5EYMA 5M4CA 5KKRC 3VUMA 1S9JA 1T45A 2ERKA 2QO7A 1CKIA 2C5OA 3MPAA 4QPAA 4F0GA 4FKJA 2W9ZB 1OMWA 2QOBA 3G5DA 3MJ1A 2QOCA 3QLFA 2WPAA 2B54A 4C3FA 5T3QA 4C61A 5JZNA 1U54A 2WTJA 5CSXA 3C5IA 3DDPA 3EFJA 1SVEA 3FLSA 4LOOA 3MN3A 2IW9A 4DG0E 3FDNA 3FE3A 4EK3A 5L2IA 2VNWA 5FXSA 4AT4A 2Z7QA 4IIRA 5EDQA 3DB6A 4CFMA 3UOLA 2VO3A 1PMUA 4JBOA 5DGZA 5FD2A 4AOTA 4DFBA 5LVOA 5GINE 3BGZA 4JR3A 5AP6A 4O7VA 2J0LA 3P5KA 3R7IA 3POOA 2OJ9A 3GU7A 3HYHA 4RIXB 5BMMA 5IA2A 4RFZA 2B0QA 3DXPA 1OL5A 4DLJA 2ITWA 5AX3A 5GIOE 1L3RE 2UW9A 2WGJA 3OCBA 3TNWA 4RFYA 4FGBA 3Q3BA 4O0UA 2C3KA 5ICPA 5A6OA 5B7VA 3NS9A 4MH7A 1MRVA 2V62A 3OWLA 4LL5A 4XUFA 4TRLA 3WZJA 1GIIA 5DRDA 2BMCA 4M14A 4K6ZA 5AMNA 2CKEA 3ORLA 2YDKA 2OU7A 1P4OA 3QWKA 3R7OA 2VTRA 2VUWA 3R01A 5LCJA 2R3LA 4NK9A 4I20A 4X21A 3CS9A 1NW1A 5E8ZA 1PXLA 3I7CA 2GQGA 3F2RA 3GQIA 3PIXA 5HG9A 1ATPE 2LGCA 4EOQA 2ZOQA 3BU3A 5M07A 2XCKA 4KAOA 3ZO2A 5F20A 4QMWA 4S33A 1SMHA 1YXUA 3L8XA 3PWYA 1P5EA 4ZJIA 2X7FA 2PVNA 2CGXA 4O86A 2C0OA 5EYKA 3TCPA 4P7EA 1OKWA 2YERA 4AACA 4IZ7A 3ALOA 4IAZA 4LV5A 4Y8DA 4GFGA 1STCE 1T46A 3BYVA 5A4LA 4YJNA 2A4LA 2PVJA 3KXHA 3QXPA 3ZC5A 2RKUA 4DN5A 2R0IA 3UIXA 3LXNA 3CQWA 3E87A 4R5YA 4CFFA 3SVVA 5CT7A 4LGGA 5HGIA 5KO1A 4H36A 4GG5A 4LGHA 3BZ3A 3VBYA 4UXLA 4FKQA 3GUBA 1F5QA 3QQHA 4BR3A 5ANGA 3MGYA 2WOTA 2AYPA 1BKXA 4KS7A 2XRWA 4EONA 3CQEA 2C4GA 3FQSA 2HIWA 2EUFB 2YM8A 2WMSA 3KN5A 1M17A 2BHHA 3QKKA 1XJDA 3CPCA 5IQBA 3FMEA 3QALE 3PYYA 2V7OA 1PXJA 3KXXA 2B9IA 1EH4A 2WTKC 1J1CA 4TYJA 3DZQA 4CZUA 3D94A 3RM6A 4RT7A 2CKOA 1XHAA 1WBNA 4KBCA 1UU9A 4OAUC 3DBQA 3VJNA 3UVRA 1RE8A 5AM6A 2C5NA 3LW0A 2KULA 2XF0A 3PLSA 3I4BA 3Q4TA 4FEQA 4RJ5A 5DI1A 1SVGA 2Z8CA 3RK9A 4EWHA 4MYGA 3FHIA 3RM7A 4FKUA 1L8TA 3O17A 4E4MA 1FMKA 4YZMA 5DVRA 4RQKA 4YTFA 5EHYA 4B99A 2YCSA 2YWVA 4D0XA 3M2WA 5HG5A 3VF9A 3FYKX 2XK3A 4JL9A 4LQMA 4YGAA 3LLAA 1R0PA 1PXMA 3EN7A 3GENA 3MVHA 4M69B 3SQQA 1G8AA 2VNYA 4D5HA 4JI9A 3HDMA 5BYLA 4FTAA 4M97A 2BVAA 2J51A 4BCPA 1Y6AA 5AA8A 4R6VA 3QKLA 4BI0A 3IKAA 4F1OA 4BCMA 2BRGA 4DGLC 4WA9A 4HVIA 3VUGA 4RC2A 3HGKA 3DA6A 2ACXA 3ACJA 5HTCA 3MPTA 2W7XA 4MNFA 5EM7A 4AE6A 4E5WA 1H1QA 3O2MA 5B2LA 1ZWSA 1A06A 2JGZA 3PVGA 2OG8A 4F9AA 2WU7A 4EH5A 4PMSA 3FHRA 3HL7A 3NLBA 4NCTA 3WARA 4NWMA 3RNIA 2VWZA 3NYOA 3S3IA 5HVYA 3VNTA 3WYXA 2QLUA 3BI6A 3G90X 3BLRA 2GNHA 3GXLA 1JPAA 2VO7A 1GNGA 5AA9A 4FT0A 1ERKA 1JVPP 2QC6A 2ITQA 2YDIA 2F7XE 4QTBA 2RG5A 3JVRA 4TYEA 4HOKA 3RPSA 5KCVA 2GHMA 2VTNA 5IQAA 4ZMEA 3Q60A 2XNMA 4I0SA 2Z60A 3HKOA 3RAIA 4UEUA 4XG3A 4XMOA 3FXWA 4PL5A 5IQFA 3TG1A 4PP9A 3II5A 2QURA 3HRCA 3MA6A 3U4WA 3VULA 1OM1A 1IAJA 3IG7A 2X9FA 3T3VA 4BFMA 3BWJA 4CQGA 1FGIA 1UU7A 4HVSA 2R3JA 4ZTNA 5HOAA 3H9FA 5KMIA 3R21A 3O51A 2J0MB 3N51A 4FZAB 4M8TA 4BGGA 4D4RA 5BPYA 4USEA 3DBEA 3S00A 4NUSA 4TPTA 2OZOA 3OMVA 2EB3A 2V22A 3JS2A 4EZ5A 3C13A 5IA1A 2I0VA 4OT5A 1ZZ2A 4BCNA 3EN9A 3VS3A 2J9MA 3DT1A 4Y95A 5J9YA 4F09A 4QMSA 2BR1A 3TTIA 5HX8A 1ZMVA 5HE1A 4D4YA 3P0MA 3ORXA 3G6HA 3MY1A 4ZSJA 5EW8A 2O8YA 5AWMA 5KBRA 1G8SA 2VTTA 3RMFA 4PDOA 3HUCA 2J6MA 2B1PA 3LFSA 3WIGA 3P08A 5A4TA 4KA3A 4GIHA 4IM2A 3KA0A 5EYDA 2YIQA 4FTQA 5HQ0A 3MS9A 1IR3A 3FI2A 2GCDA 4PF4A 5CNOA 4PDSA 4V01A 3RNYA 3EQHA 4RIOA 2B52A 2C3LA 5HG8A 3E62A 3HUBA 2R3HA 5CEIA 4YBJA 4BZNA 1SVHA 4RBLA 4L8MA 3FAAA 3MY0A 5AV2A 4IZAA 3JYAA 3SRVA 1PMVA 3ET7A 2CCIA 3THBA 2B9FA 2ITPA 2UZLA 2WU6A 4GYGA 3R1QA 2I0HA 3R71A 4BBMA 4JG7A 1CKJA 4NW5A 3COHA 4DT8A 3PLAE 3AMAA 4LGDA 5TOZA 4BGHA 5IDNA 3IO7A 4AW1A 3SGCA 4ZLYA 4D4VA 2JIIA 3R30A 1YXVA 3T9IA 3HV5A 3MH1A 3RAHA 2PVHA 5ETAA 4FF8A 3R1YA 4QMVA 2HXQA 3EQCA 2R3KA 3VW8A 2YA9A 1Q8UA 5JGDA 3PP0A 3W2QA 4TKSA 4NW6A 4JOAA 2OJGA 4JNWA 3ZXTA 4AGCA 5HLWA 4U3YA 3QUDA 2FB8A 2OKRA 1BYGA 4I4EA 2YIWA 4MVFA 4BDJA 2PMLX 3UPZA 1OECA 2X6EA 3TV6A 1LPUA 3SC1A 4YTCA 4J52A 5ANOA 3CJGA 2IZTA 3NSZA 4JJRA 3WOWA 4DCEA 3R8ZA 5HU3A 5L2TA 4F7JA 4BWPA 4FUXA 2WMVA 4R7IA 3SRVB 4UYAA 3FMMA 4BGQA 4N6YA 4CV9A 1PJKA 1YWNA 4IXPA 4FODA 5HO7A 2I0EA 4ANOA 4CFVA 5IMEA 5IH4A 3NW6A 2CGVA 4P5QA 3VRZA 5E4HA 3C4ZA 3OZ6A 3UMXA 3DKCA 4BDAA 4ASDA 1WBTA 4TYIA 2YM6A 2Z7SA 4BL1A 3GFWA 5TR6A 4JR7A 4LV8A 3HV7A 5CAUA 5CXZA 5CU6A 3CE3A 5DOSA 4EYMA 3ORZA 2ZV9A 4DT9A 5A4QA 5AUVA 4DAWA 4EI4A 2HELA 4O7YA 2H34A 4U42A 5DH3A 5ANDA 2J2IB 4WO5A 2J50A 4PNIA 4CXAA 1ZXEA 4ZTMA 4JQEA 2W06A 4ACGA 4CKRA 2ITTA 1VYWA 1KE8A 4UMTA 3BU5A 3CPBA 4QMNA 3IQ7A 3NUXA 2W1GA 5ETFA 5BVEA 3AD4A 3ORNA 2W0JA 3UGCA 4EZ3A 3IW7A 3HP2A 4N4SA 4PTCA 5HIDA 3V04A 3K2LA 3ZRLA 4MQ1A 2IZRA 2OK1A 1KE5A 2QG5A 1KE6A 4C4GA 3EZRA 1JAMA 3TJCA 3G15A 3MVLA 4DG3E 2QCSA 3ULZA 2GNJA 4DBXA 1XBCA 4O0YA 2XEYA 3FL5A 4AA0A 3B2TA 3WZKA 3VO3A 2O63A 1OL7A 3GCQA 2HENA 4GT5A 4HZSA 4BCKA 3CR0A 4IAIA 4MBIA 1BX6A 3A60A 3W2RA 4DINA 4EK5A 5IEYA 3A7JA 1M2PA 2CLXA 3DAJA 3VQHA 3DQWA 4J71A 4U9AA 5AP5A 3KRJA 3WZUA 4E3CA 4FVQA 4O91A 5HD4A 2VD5A 2J0JA 4ONAA 1TQMA 3D83A 4TY1A 3WE8A 4JG6A 4E6CA 3E3BX 1FGKA 5FTOA 1ZY4A 3P78A 2VAGA 3OWJA 4FVRA 4Q2AA 3FLQA 4YTHA 4R77A 3UOKA 4LMNA 3SKCA 3UNJA 1B38A 4W8EA 5HD7A 2YABA 5IU2A 4NM5A 5A54A 3MVMA 3QTIA 2W1CA 3W33A 3L9NA 4P2KA 1Q8TA 3TNPC 3R0TA 4EL9A 5H9BA 3EQPA 4JLCA 5I9XA 3TV7A 4K11A 5DA3A 1DI8A 3FMLA 4FV3A 1V0PA 1KOBA 2UW6A 3F5XA 2XM9A 5C9CA 1U5RA 1FINA 3A7GA 4FL2A 3ITZA 3KK9A 4EOSA 1ZOGA 3PXKA 2W9FB 2J5FA 3E64A 5TKDA 5ANEA 4S2ZA 5AAGA 4FEUA 3PPJA 4A9YA 5JZJA 4FBXA 4ZTRA 4E7WA 2SRCA 3AG9A 2FA2A 4LG4A 3LFEA 3EFWA 3KVWA 5CZHA 3BHUA 4UV0A 5AP3A 1SYKA 3D5XA 4BCHA 2G1TA 3KRXA 5GIPE 1LP4A 2B9JA 2J90A 3MFUA 3HMMA 4B9DA 3C9WA 5I4NA 3BYMA 5LVNA 2PVRA 3OXIA 4PDYA 4H05A 3MFSA 4F70A 3QGYA 3BLHA 2ZYBA 5JN2A 5HG7A 3V5JA 3EN4A 1R78A 3IK3A 4IH8A 2VTIA 4WRGA 4ZP5A 5K0XA 4GMYA 3D5WA 5HCZA 2VTLA 4H1JA 4EH4A 5DBXA 3Q96A 2HY0A 1URCA 2XYNA 4USDA 5CF8A 2C3IB 4FA2A 1S9IA 3R6XA 4WBBB 4BDHA 2XYUA 2VGPA 3FKOA 5CSWA 3C4WA 4U41A 4TN6A 3OHTA 1KWPA 4K8AA 3QQKA 3VBVA 3BV2A 4JDKA 4BB4A 4JXFA 2W4JA 5EHOA 3R8LA 4QO9A 4ZSAA 4M84A 2ZM3A 1M2QA 3KULA 4MXCA 4WSYA 1W0XC 5EQPA 1F0QA 4BKJA 2VO6A 4YNEA 5AJQA 4EBWA 2XK4A 5AUYA 3F61A 4FSYA 4JRVA 5E92A 2WMBA 4AW0A 1FMOE 1WBVA 2CNVA 1FPUA 4FT9A 4QMUA 5EFQA 1M14A 3Q53A 1PMEA 3S4QA 4DFXE 5CEMA 3OF0A 3LJ2A 4XG7A 4QP1A 4TYGA 1W84A 5DE2A 5I9YA 2C6IA 2CJMA 3TJDA 4XOYA 2F4JA 5LCKA 4AQCA 4OAVB 5HNBA 3VJOA 3D2IA 5KZIA 3TNHA 2W1FA 3BGPA 5CVGA 1OL1A 4IWOA 5AR2A 2ITZA 1W8CA 3FLZA 4KIKA 5FEQA 1YOJA 2PMNX 3FMDA 1VJYA 2P2HA 3E5AA 3PE1A 5E8TA 5HORA 4TNBA 3CSVA 4FG7A 1Y8YA 3I6UA 4ZAUA 3CTHA 4M68A 4F9WA 2FGIA 3KULB 5H2UA 3TV4A 5DWRA 4EQCA 3ORPA 2UZDA 4YNOA 3E8CA 5LMAA 4QMYA 2QO9A 3W8LA 3MY5A 1OKVA 4C59A 4EOLA 1GZ8A 4JS8A 1XKKA 2QNJA 4ZTHA 4LRJA 1F3MC 3CQUA 3MA3A 4AU8A 4G6OA 3EYGA 3GOPA 4Z16A 1GOLA 2OI4X 4I6HA 4WG3A 4RJ4A 4ITIA 1XH5A 3ENMA 4G2FA 5C8NA 4BCIA 5FBOA 1J91A 2C6LA 2FYSA 4RFMA 3NNUA 2PUPA 3BX5A 4QP9A 4RWKA 4QOXA 4X3FA 2ZDTA 3O7LB 4A7CA 5JGBA 3BE2A 1Y91A 5LOHA 2XZSA 2GSFA 2JAVA 2WEVA 3A61A 3FPMA 3GGFA 3PRIA 2B53A 3QD0A 4MEDA 4Q9SA 4QMZA 3SXFA 2F9GA 2G15A 1JKSA 4XRLA 4B7TA 2ETRA 3CTJA 4GK3A 4HGTA 3GVUA 3A8XA 3P79A 3LVPA 5E1SA 3ZSGA 5HEZA 3ANQA 4YHJA 4R5SA 3TNQB 3NVKI 5B2MA 2JKKA 1Q41A 2ZAZA 5HESA 3Q4ZA 5AAEA 1IRKA 3LE6A 3TL8A 5KMMA 3AC5A 1QL6A 1Z5MA 3ANRA 4JDJA 3ODZX 2BROA 2H6DA 2PVFA 5GZ9A 2R3NA 4GVJA 3NEWA 3O7LD 3QA0A 4GVAA 5K9IA 3FZOA 3I0QA 4GJ2A 3A7IA 4FIFA 4JBQA 3U9CA 4AF3A 4CMOA 1WMKA 4IFCA 4X3FB 3V6SA 3KF7A 2GHGA 1UWJA 3RCJA 5AM7A 1H07A 3FC2A 3R00A 4HYUA 1R3CA 4AGUA 3OTVA 2FUMA 2F7ZE 5EH0A 2WMRA 2QI8A 2C47A 3BYOA 2UVZA 3OBGA 1JKKA 4WSQA 4AG8A 5FEDA 4LUEA 4RGJA 3H3CA 5J79A 5EI2A 2UW5A 2VV9A 2XKDA 2JFMA 2FSMX 2P55A 4QP2A 4IC8A 5E8SA 3C0IA 3REPA 1OIRA 2WOUA 4I24A 2HWPA 2VTJA 1JKTA 3CY2A 4CT2A 2ZVAA 4G16A 5E8VA 1A48A 5I0BA 4FT5A 2J4ZA 2WFYA 4XX9A 3RGFA 5IDPA 4L00A 5C8KA 3H4JA 3LFCA 4HGSA 4AZVA 1DM2A 5IQIA 2BILB 3HLLA 2WQNA 3NGAA 4OBPA 3WIKA 5KUPA 2GU8A 4C2VA 2X8EA 3K5UA 3R7EA 4JRNA 3RPVA 4S31A 5HHWA 4GG7A 4C34A 4O0RA 2BFYA 3COKA 4KKGA 4KUJA 1MQBA 3FZ1A 4XP0A 5L6OA 3NR9A 2AC3A 4ZEGA 3VS1A 3D0EA 3U55A 4QMXA 2XCHA 4IX6A 2PY3A 3NIEA 2GHLA 2O2UA 3ZH8A 4CTBA 3QCQA 4M15A 4U7ZA 4D1XA 1UKIA 5EOBA 4RWIA 3RK5A 1OVEA 4ARKA 4UMPA 2UW3A 4FTIA 4GK4A 4EBVA 4NM3A 3K54A 3GC7A 4U6RA 3NWWA 4IX4A 4K2RA 5FUTA 4Y83A 4IVDA 3NMUF 4QNYA 3CD8A 4UX9A 1Y8GA 3SOCA 5M06A 1NVSA 4QTCA 4R78A 3OBJA 2OICA 5DNRA 4CTCA 3BELA 3V8WA 5CALA 3DKGA 2YJSA 5IQCA 4PL4A 4IAYA 4FICA 4UMRA 3CLYA 3QD4A 2C1BA 5LQFA 4YO4A 2OFVA 5EG3A 3D2KA 3PIZA 1H8FA 3ORKA 4HYHA 3AC2A 4BCQA 4X2FA 3D9VA 3K3IA 2WMUA 5DR6A 5F95A 1CM8A 2OXYA 5LARA 1WCCA 2PWLA 4LOPA 4EK4A 2R3FA 1H25A 3BIZA 4PPCA 5FQDC 4IMYA 1OKYA 2OH4A 2IG7A 1Q97A 3P1AA 1V0BA 3F69A 3FY2A 5I9VA 2C5XA 4PRJA 4RJ3A 3V5TA 3TUBA 3G0EA 3WF6A 2WO6A 2QD9A 3NUSA 3VS7A 1B6CB 4W8DA 3RTPA 3T9TA 3ZRMA 5J1WA 4ZMFA 1Z9XA 5CEOA 3ZS5A 5EDRA 5L6WL 5FM2A 3KEXA 2OXDA 4YZCA 3LFBA 5HI2A 4WUNA 1RDQE 4G6NA 4GW8A 4QMOA 3SV0A 3ULIA 4ERKA 2X9EA 4DG2E 3SXSA 4KRCA 4BCGA 3A7HA 3V5QA 2NP8A 4F64A 3CKWA 5A14A 4N70A 4YZNA 3PA5A 3BHHA 5CF5A 4IFGA 2QR8A 2VN9A 3CTQA 4FYNA 4LMUA 4RG0A 4UMUA 4NL0A 4I0TA 4EOJA 3D15A 2PHKA 3MW1A 3R2BA 3DY7A 2RGPA 3NAXA 5BVNA 5C4LA 3R9HA 2BALA 1ZOHA 2ONLC 4KSPA 4BBFA 1V0OA 2OZAA 4AA5A 2W1HA 3F66A 5EI6A 4BYIA 4D1SA 2YAKA 5IUHA 2ZB0A 3NNVA 3KL8A 5CSVA 4RJ6A 4DH7A 3R1NA 3LXLA 4O38A 3HA6A 1Q99A 4AW5A 4DFLA 4ZZOA 4MWHA 4MD8E 4F6SA 2F2CB 4PMTA 5G1XA 3MTLA 4F9YA 3FSFA 2LAVA 4EH8A 3DAEA 3NZ0A 4D55A 3DK7A 1WBWA 2QOHA 1WFCA 1XR1A 2Z2WA 1YWVA 3QC4A 4RVKA 4U40A 4KNBA 4UMQA 4ALUA 2IW6A 3HMNA 3NW7A 3QFVA 5CAQA 5ITAA 4IVBA 3PDTA 3BYSA 4W4YA 3OW4A 3AGMA 2CNQA 1J3HA 3AXWA 3Q5ZA 4Z55A 5HTBA 4XH6A 1UWHA 3ZEWA 1PKDA 2OIBA 3R9OA 3ZEPA 4LYNA 4YR8A 5TO8A 3R8UA 1PHKA 5CEPA 5L8KA 2Z7RA 2CLQA 1GAGA 4L6QA 1A9UA 4U8ZA 4BYJA 3HAMA 4L7FA 1H1PA 2HCKA 3BQRA 2QVSE 3Q5IA 4I21A 4RIYA 1Y57A 2OZAB 2QKRA 3AC8A 3LZBA 5F4NA 1NY3A 3MDYA 4G5PA 4UWBA 3GU8A 1YOLA 2C5VA 3B8QA 4GIIA 3SW4A 3H0ZA 4RPVA 3WZDA 2C1AA 2ESMA 4F6WA 2DUVA 4U3ZA 4U5JA 2R0UA 5A3XA 3NUYA 3R2YA 4G3GA 4NTTA 5AV0A 3DCVA 4A9RA 5CASA 3BQCA 1DAYA 2UZTA 4FI1A 3HRFA 2YFXA 3IW6A 3OUNB 3Q04A 4AZFA 4F7LA 4QP6A 2Z02A 2Y7JA 3MWUA 4XNEA 3K3JA 1YHWA 2WMTA 2JDTA 3FJQE 4FTMA 5DT3A 3U8WA 4DEDA 4IC7A 5IF1A 4KIPA 2OSCA 2PUIA 4Z3VA 1WVXA 2YCRA 1KV1A 3EJ1A 3P7BA 3F3UA 1IEPA 4GRBA 4M69A 4DEIA 4EH2A 1J7IA 1UA2A 3GU6A 2PULA 4RIYB 4FSWA 3F88A 2NPQA 3LQ5A 3NCZA 5J87A 3GCPA 4YJVA 4BI1A 3OOGA 3I79A 4KABA 5DT0A 3R9RA 5LMBA 3QTRA 2WTVA 4CVAA 3DPKA 2X39A 3UVPA 2EWAA 4I3ZA 3HDNA 5IUGA 3HNGA 4KWPA 3OFMA 4TXCA 3NYNA 4MQ2A 3IOKA 4APCA 5BX0A 1K2PA 3E3PA 4NZWB 4YSMA 3HA8A 3ACKA 1UNHA 5HO8A 2Y9QA 2J0KA 5GZ8A 3KK8A 3BEGA 3DQXA 4FT7A 4GEOA 4XP3A 4AW2A 2A27A 2W5AA 3FMNA 3G51A 4RX8A 3BE9A 4RIWA 5FM3A 4E26A 2X7OA 4F1MA 2WQBA 1PW2A 5J5SA 2QU5A 2HAKA 4GUEA 3E7VA 3A4PA 4JVGA 5GJDA 3W10A 4FV6A 1YRPA 4G1WA 4J97A 2QOIA 4Z7HA 4FIGA 2O0UA 5EYCA 3S0OA 4NJ3A 5KHWA 2IPXA 2UZEA 4L3JA 4PWNA 5E8YA 4RVMA 4CCBA 2PE0A 3H10A 5L2QA 3QHRA 4K1BA 5BUIA 3ZUTA 4IEBA 3DKOA 2ITUA 5ANKA 3VUKA 4FV5A 1UNLA 2X2MA 2YISA 3L1SA 2WQMA 4G3DA 4O2ZA 2UV2A 3DBCA 3Q6UA 5AIKA 3QCXA 1H24A 3EHAA 4FNXA 4C4HA 4C4FA 2JKQA 3GU4A 3PJ3A 4E20A 4DE4A 4A9TA 2CKPA 1FVRA 3O8PA 3LKMA 2OWBA 3RK7A 4BN1A 3GI3A 4FSQA 5DPVA 5M4FA 2P4IA 2X4FA 3QD3A 1GZKA 4L7SA 3S2PA 3V3VA 2GDOA 1QCFA 3ZFXA 5JMSA 2WTCA 2G2HA 4Y73A 1GZOA 4L01A 4C4JA 4JBVA 3Q6WA 4RIWB 4C3RA 4YU2A 2PZRA 4O27B 2C6TA 2HZ0A 4J8NA 1TKIA 5EKOA 3W2CA 3FI4A 4MF0A 4ACCA 2YIRA 4F99A 5GJFA 1ZYSA 3H9RA 3QYZA 4OBOA 5FEEA 1YHSA 2XIYA 4FZDB 5GNKA 1WAKA 2JEDA 5CU4A 2YM3A 5CI7A 1OZ1A 3VS6A 4PX6A 3UO4A 4D2PA 3MIYA 4RZVA 3QRJA 4FUYA 3PA3A 4XG9A 4JAJA 4AP7A 5FTQA 4XRJA 3DJ5A 4QRCA 4GT3A 4IJ9A 4XLIA 2ITOA 3KQ7A 5CVHA 3AGLA 3PG1A 2IVVA 4I22A 4YHTA 2WEIA 4F4PA 2BFXA 4S34A 4KD1A 3UVQA 1ZLTA 4NIFA 3VUHA 4CV8A 2R64A 5IQGA 2VWYA 3IECA 3TM0A 4WKQA 3LFQA 3VBTA 5KZ0A 2KTYA 3LCKA 1GJOA 5KMNA 2H9VA 3E63A 2R5TA 4FSMA 4CG9A 4GL9A 4U81A 5HE3A 3LM5A 4YZ9A 3VS5A 2VTQA 5FBNC 2W05A 1AQ1A 3LXKA 4OTIA 5I3RA 5IQHA 1XH4A 3OC1A 3TWJA 5C4KA 3RAKA 4FTTA 4RWLA 5TF9A
chains in the Genus database with same CATH superfamily
4ZTLA 2YAAA 2WMWA 3LJ1A 3U6JA 4NU1A 4MWIA 4J98A 3ELJA 2AC5A 4F0IA 3QUEA 3CC6A 2W4OA 4DHIB 2PUNA 4FOCA 4JAIA 3BHVA 2UW8A 2ZB1A 3I5ZA 4F9BA 2R3OA 5LMKC 2YACA 4IB1A 4A4XA 3HP5A 3LPBA 3PJCA 3TKIA 4B8LA 3OROA 5L8LA 3BL9A 4BWXA 4YLLA 4BIBA 5G6VA 5AR4A 4IX5A 3KXNA 4OT6A 3GC9A 3UOJA 2XNEA 4NIFB 4PMPA 3BU6A 1YOMA 2XIXA 3GC0A 3DBFA 2CGWA 4A07A 4IX3A 3TTJA 2HK5A 3UIBA 3DXQA 4FEWA 3N4VA 1JNKA 3IDBA 4FR4A 1QPCA 4U79A 4AS0A 5BQ0A 3EL8A 4FKRA 4D2VA 3UJGA 1VLRA 3ZM9A 2PZ5A 3Q9ZA 4W4WA 3VS0A 2NRUA 2UW0A 3KMUA 4YJQA 5H3QA 4FNYA 3K5VA 3KRWA 5HNGA 4N0SA 1Q5KA 3VVHA 2C68A 4DEGA 4EQUA 1URWA 3ENHA 4L3LA 2ITNA 4B0GA 5L4QA 2F49A 2VZ6A 5ETIA 4C57A 3OVVA 4YURA 4PV0A 1OPJA 3TZ8A 1OBGA 4N6ZA 4K77A 3KFAA 2QOKA 2V0DA 1BUHA 3DXNA 4BDFA 5AUUA 3ZO1A 3FMJA 4FT3A 5CEQA 2BIKB 1YKRA 2HZIA 3TIZA 1TQPA 5M08A 3JPVA 2UVYA 3CEKA 4AX8A 3LMIA 3QCSA 3QQJA 2PMIA 3W8QA 2C5YA 1NVRA 4CYIA 4EH9A 4HCVA 5CVFA 5M4UA 2GQRA 3D7ZA 3EN5A 3BYUA 3LIJA 4KINA 4MXOA 5L8JA 4CKJA 2FSOX 4DEAA 5KKRB 3HMOA 3A99A 4FZFB 4O0WA 3WF9A 2HW7A 2WELA 3FBVA 4DDGA 4M0YA 4TL0A 3QU0A 4LUDA 4OUCA 3ZFYA 4KBKA 4FG8A 2O5KA 2PSQA 4LFIA 2XJ1A 2YHVA 4IM0A 2CCHA 4Y72A 2EU9A 1Q61A 4S30A 4YO6A 4ACDA 3OT3A 3QTZA 3CCNA 3G0FA 3QUPA 3HMPA 3ZU7A 1PXKA 2QG7A 3Q2MA 4IB3A 2P3GX 3FUPA 4AA4A 4CT1A 1YXTA 4E4LA 5E90A 5EM6A 3M11A 4BICA 4U0IA 3GNIB 1PF8A 3DLZA 3R7YA 3GFEA 4L9IA 1LEWA 4S32A 5HE0A 3V01A 3KF4A 4E73A 2QONA 4LRKA 2QOOA 4APPA 4MHAA 2PTKA 4ANSA 1MUOA 4DHFA 3R63A 3KMWA 2RL5A 3QRTA 4YMJA 4OTPA 3G9LX 3OUKA 2WAJA 1OITA 3B8RA 4JX7A 3IW5A 4FNZA 2CHLA 5F1ZA 3EFKA 4DH8A 3CD3A 1TVOA 1NVQA 3C0GA 1R39A 1I09A 3BHTA 4E1ZA 2E9VA 1G5SA 3OXTA 2E2BA 2P33A 3R8VA 1U4DA 4D2TA 4W9WA 1OUKA 5KX8A 3V51A 2BZKB 5DHJA 3WF7A 1JQHA 1JOWB 3VBWA 4FEVA 4KSQA 3T8OA 5LJJA 5E8UA 3R83A 2CN5A 4AXDA 4I6QA 2FH9A 3H9OA 4H39A 4EC9A 2W5BA 3ZXZA 5BUJA 2A98A 5L2WA 4IHPA 5CAOA 1BI7A 2BKZA 3D4QA 3QQGA 4YJSA 4G6LA 2X0OA 4FV1A 3ZBFA 1ZY5A 3UBDA 4G9CA 5C26A 3HEGA 3Q2JA 3Q52A 3C7QA 2UZWE 4K33A 4CMUA 3LCTA 3Q32A 4FTLA 3MB6A 3ZRKA 3D7TB 3I81A 1RQQA 1XBAA 1XBBA 1YI6A 5HCXA 3ZLYA 4EWQA 2BAKA 4FTUA 5FXRA 2VX3A 1W2FA 4WNKA 5IA4A 2XKFA 4BCOA 4AQKA 5C8MA 5DYJA 4FKTA 2IEWA 2A19B 4BIDA 1QPEA 4OTQA 5EK7A 3HRBA 3QX4A 4E93A 5HLNA 5M09A 2XIZA 3LCSA 4I4FA 4KS8A 5IUIA 1P2AA 4DGMA 5BVDA 1UVRA 2BZJA 3FPQA 4CFWA 3TEIA 1Q24A 4CCUA 1UU3A 3KN6A 4BDBA 2QR7A 4RJ8A 4ERWA 3TXOA 4OW8A 2WTKB 3R28A 4Q5EA 5JQ8A 2XP2A 1KV2A 3DLSA 4O22A 5AUTA 2R7IA 3HECA 5F9EA 3LFNA 4W4VA 3MH0A 4FV4A 4IDTA 5HCYA 1WZYA 4O83A 2VTMA 5C1QB 4FKWA 3PPKA 2VWBA 3OY3A 3EQFA 1JLUE 3UP2A 4E4NA 1QPDA 5HVJA 4ZSGA 5AX9A 1BL6A 1G8JA 3WI6A 3U6IA 1Q62A 1JBPE 5M44A 4CFUA 5D12A 2XS0A 4XG6A 5H8EA 3LCDA 1H0VA 4AFJA 3F3TA 1PXPA 4P5ZA 3RZBA 5CF6A 4YTIA 4DFZE 3AKLA 1H1RA 1PXOA 3F6XA 2HYYA 2YIXA 3GC8A 4FKIA 5CQWA 3ZDUA 3TT0A 4TTHB 3TI1A 1HOWA 4XOZA 4H1MA 3JXWA 3Q4CA 2CKQA 3LMHA 4IANA 4F0FA 2PU8A 3FZTA 3MYGA 1BMKA 2GNLA 2I1MA 2HOGA 3R04A 5IA0A 2G9XA 2JDRA 4ZXTA 5BYYA 5K0KA 4RSSA 5IA5A 1YXXA 4ASEA 4CFNA 3ZBXA 4CYJA 4EH3A 2Q0BA 5ANIA 3KRRA 3C4XA 4EC8A 3DDQA 2B9HA 3GCUA 4M0ZA 4UYNA 2PL0A 4IDVA 4WNPA 3W2SA 3AT2A 3BLQA 4GS6A 2JD5A 5AFVA 4O7NA 2XKEA 5DN3A 2WIHA 2XK6A 4ORKA 2E9UA 4ITJA 5M55A 3WF5A 1BL7A 3P7CA 3RZFA 3PVWA 4ANBA 5IISA 5FTGA 3COMA 4HGLA 1G8KA 2XK8A 1R1WA 4C2WA 5EW9A 3W0MA 1Z57A 4ZJJA 4O4BB 3IW8A 3ZOSA 1KOAA 1ND4A 4QPSA 3EMGA 4TW9A 4L43A 3DK6A 5J5TA 4DTBA 4MKCA 3ZSHA 3QX2A 3UTOA 3ORMA 4NSTA 4KIOA 3UNZA 4C4IA 3SAYA 5IEXA 3PSCA 1Q3WA 2E9PA 3UYSA 3QRIA 3PG3A 3UC4A 4EJ7A 3KXZA 3ZYAA 2W5HA 2R3RA 5I9ZA 5EQEA 4X6RA 3ZFMA 2WTDA 4ZIMA 3QTXA 4ASXA 5CEKA 5K5NA 3IPHA 2ETMA 3LFFA 4HNIA 4QYYA 4UWYA 5AP4A 4DGOA 4EOOA 5J7BA 3FQEA 3IOPA 3N9XA 5DT4A 4C37A 4N57A 5AUXA 1GIJA 1H27A 2GPHA 3PVBA 2GNGA 2WMQA 4I5PA 1ZAOA 3R02A 4Y85A 5JQ5A 2O64A 2W96B 3P86A 3PTGA 4L44A 3UDBA 5A4CA 1OGYA 5A4EA 4UZDA 3MTFA 1SZMA 2XIRA 3R9NA 4HPUE 5LXMA 4FV8A 4GUBA 4QYFA 4A4OA 4YSJA 3TDVA 1H1WA 1NXKA 2UZOA 2WHBA 4YJRA 4CZYB 4EYJA 1DI9A 1M52A 4YJOA 3G2FA 5AP0A 3ZZWA 4UXQA 1OI9A 1IG1A 1MP8A 5CAVA 4AT5A 3AC3A 3G9NA 4F63A 3HAVA 4FK6A 4JDIA 4OTHA 4F6UA 4M13A 4XS2A 3UMWA 1XMMA 3P7AA 4NYEA 3CIKA 5AR3A 4U97A 3PFQA 3M42A 3E93A 3ROCA 5BV3A 2OIDA 1Q3DA 1MRYA 1PXNA 4YC3A 3UIMA 4ALVA 2OXXA 1J1BA 5L2SA 4ZS0A 3W2OA 3CBLA 4PDPA 3C4CA 4D0WA 4OTDA 4IACA 4RLKA 2YWPA 5EM5A 4L45A 3ZO4A 3LOKA 2OF2A 2WTIA 2ZMCA 3CJFA 3HZTA 4WIHA 3TZ7A 4A06A 1UV5A 2WQOA 4I6BA 5C01A 5HBJA 3EYHA 2XJ2A 4CLJA 4IM3A 4DA5A 4BBEA 4J53A 1ZYJA 3LM0A 3QL8A 2UW4A 3EQRA 3LXPA 3OD6X 1PKGA 4R3PA 4WRSA 1J7LA 3CY3A 4L3PA 3BBTB 4QQTA 2CMWA 1ZYLA 3QZIA 4I5CA 3C4EA 2OBJA 1OIQA 2W1IA 4HNFA 5CLPA 5GJGA 4EUUA 4BZDA 4E8AA 5GZAA 2AEGA 3ZM4A 3SLSA 2QOFA 4L46A 3U87A 4O7ZA 3KCFA 5M53A 3QA8A 3QRKA 3AMBA 5CS6A 1Q8YA 4NCTC 3OG7A 3EIDA 3O50A 5T68A 4RRVA 4AN3A 5AR8A 2CGUA 3OP5A 4JQ7A 5J7HA 4YC8A 4EQMA 1ZMWA 1KE9A 4XLVA 2BZHB 3I60A 3HV4A 5IPJA 3JR1A 3W0OA 4C02A 4A4LA 3PZHA 4GCJA 4AOIA 3MI9A 2RFDA 3GT8A 4D9UA 3FLNC 3NCGA 5B2KA 4KKEA 4OGRA 4BDGA 2B4SB 1H01A 4FIEA 3MBLA 3W32A 2JLDA 3KREA 1BI8A 3FLYA 4R1YA 3CKXA 3F3VA 4LL0A 3RINA 2RF9A 5IQEA 3C1XA 3RHXA 4HZRA 3F7ZA 3SW7A 1OIUA 2REIA 3VBQA 2GS6A 3OW3A 4BCJA 2F57A 5LVMA 3D5UA 5I3OA 3R7GA 5CQUA 3W18A 2GNIA 3PVUA 2BUJA 1QMZA 3GQLA 3NDMA 1H00A 4O7RA 3PY1A 4O6EA 2XK9A 4RVTA 3UODA 3V5PA 3ZDIA 4DEBA 4FTNA 1XWSA 3KVXA 5HKMA 4YUQA 2BDFA 2JIVA 3LMGA 3QQFA 3U9NA 1PRYA 4X6QC 4B8MA 2ITYA 1OPKA 2V7AA 1W7HA 3HV6A 5BVKA 3RVGA 3O5AA 4O84A 4AZEA 3I1AA 4AT3A 1OKZA 1VYZA 4H3PA 3O71A 5BMSA 2HXLA 5I5ZA 3ZMMA 3W16A 4CG8A 3OTUA 4IB0A 3V5LA 2WMXA 1GY3A 5CSHA 3R8MA 4F78A 1ZOEA 1YI4A 1O6LA 4QT1A 4JDHA 3QQUA 4FZ6A 3O0GA 4PTEA 2CDZA 4PP7A 5IA3A 5J9LA 3RPYA 1RJBA 2ZJWA 3F9NA 2WKMA 4R7BA 2JBPA 2CPKE 3RHKA 2X6DA 3VQUA 2BCJA 2OIQA 4QP4A 3TUDA 5IQDA 2Q0NA 2C6OA 2WNTA 4G3EA 3PP1A 3FEGA 5IZFA 4YZBA 4I6FA 4YPSA 5JKGA 3N4TA 3FI3A 3H0YA 4I0RA 4M66A 2YCFA 3ZC6A 4CKIA 2XNPA 5J1VA 3TKUA 2ZMDA 1WVWA 4AAYA 3FMKA 3QD2B 3QTQA 4X2KA 4ANMA 3WF8A 3WYYA 4RC4A 3P23A 4AGDA 5DLSA 1K3AA 4V04A 5AV3A 4FKSA 1XH9A 2ZFYA 2VTOA 4NM7A 4CFXA 4X2NA 1W98A 2P2IA 2BDJA 2HWOA 4E5AX 5IMXA 1GZNA 1WBOA 5AV1A 2YM4A 4QTDA 2X2LA 2FVDA 3R8PA 3TZ9A 3ZUVA 4Q9ZA 3F7WA 4EK8A 5AV4A 2J0IA 4BHNA 3UQFA 1W82A 4F7SA 1PYEA 2UZVA 5D9HA 4ZLZA 2W17A 5CANA 2YJRA 3NUPA 4FTRA 5E8WA 2X0GA 2YM7A 4FE2A 4AN2A 2R4BA 4NFNA 4AZTA 3W0SA 5HICA 4UALA 3AD5A 4O7WA 4DDIA 4IVCA 2X8IA 3QTUA 4MNEA 4Z7GA 2XAMA 2XEZA 4DHZA 4IBMA 1BLXA 5A46A 1IASA 4R8QA 2C30A 3QXOA 4BDCA 2BRMA 1CSNA 2IVSA 3I5NA 4BTJA 3DNEA 3A7FA 5F94A 3DZOA 2QOQA 3TIYA 4QDEA 3ROYA 4TT7A 5JT2A 2V55A 2PVYA 3ODYX 3QWJA 4QMPA 1YDTE 5AAFA 3WZEA 2XIKA 4WUAA 4YJUA 1OUYA 4PPBA 2Y0AA 4G17A 3NW5A 1O6YA 4G9RA 5HVKA 3GP0A 3EQGA 5KHXA 2BKKA 2V5QA 4O1PA 3JY9A 2XNOA 4II5A 4XCUA 2BDWA 1U54B 4EUTA 5IH6A 2OJIA 3NAYA 3NYXA 3RKBA 3COIA 4XBRA 3GB2A 5E8XA 5IG1A 3KMMA 3OWPA 5HIEA 4AZWA 5JFSA 1XH7A 3NPCA 4MNEB 5CI6A 4Y46A 4C36A 3I0OA 4BZOA 4QTEA 3FKNA 3OS3A 1OBDA 4JBPA 4IAAA 4NTSA 3V8TA 4RX5A 3NUAA 3UZPA 2IZSA 1REKA 5IH5A 4BTFA 5BNJA 2FSTX 1H08A 3RPOA 1XQZA 3PA4A 4HCUA 3SX9A 4AOJA 3TMOA 4L53A 2PVMA 3UP7A 2A0CX 2BRHA 4DITA 4X2JA 4MX9A 4I5HA 4D4SA 1SM2A 2OJFE 3DKFA 3MV5A 5DEYA 4RJ7A 3UO6A 4BDEA 2XANA 1Y6BA 1YDRE 2OF4A 2HZ4A 3DJ6A 2Z7LA 4AFEA 3MFRA 3N4UA 3C5UA 4FSRA 4LM5A 2PVLA 4G3CA 3JUHA 3W55A 3AMYA 4ZK5A 4YHFA 3O23A 2XVDA 2YIYA 3BEAA 4XV9A 3AC1A 5CU3A 4D2RA 1H26A 3VUTA 1XO2B 4BDKA 5L6PA 4WG4A 2VGOA 4QYEA 4CGAA 3TDWA 4I41A 3AQVA 4AZSA 1YI3A 4HVHA 3RCDA 3DOGA 5HNIX 3KB7A 2OO8X 3WBLA 3NVMB 3PXFA 4ZY6A 2YZAA 3HX4A 5JFVA 2Y4IC 1CKPA 3NNWA 2RG6A 5EM8A 4ZZMA 3RWPA 2IJMA 5ANJA 2IZUA 4LOQA 4O1OA 4UN0C 4DFUA 2GFCA 1XH8A 3KKVA 4J99A 4O21A 4DLIA 2VWWA 4KBAA 4K0YA 4MUQA 2GMXA 4L42A 2VO0A 2G2IA 2VWVA 2PZPA 1OL2A 3OY1A 4FIJA 5JSMA 3VHEA 1ZARA 3ZLSA 2XAOA 3I7BA 1KSWA 3U6HA 2R3GA 5JK3A 3MESA 1UU8A 2UW7A 3JY0A 4F08A 2PVKA 4XEYA 4CSVA 5M4IA 4PMMA 2F2UA 3KXMA 5E1EA 3VS4A 3DFAA 3NFGB 1UKHA 3F3ZA 3KRLA 5TT7A 4CRSA 4WD5A 4TWNA 4J7BA 4TWOA 1AGWA 5FLFA 3ORTA 4EOPA 3QF9A 5K5XA 3DK3A 2BIYA 2FO0A 3SXRA 2CN8A 4CRLA 2PPQA 3FSKA 4ZS4A 3GCVA 3RP9A 4DFNA 2OGVA 3PRFA 3C51A 2BTRA 4F1TA 4ANNA 1FBNA 3F3WA 4HJOA 3RPRA 3EZVA 5CU2A 4QMQA 2XBAA 4M12A 4GYIA 2X4ZA 4KIQA 4JQ8A 4F65A 4BVUA 5BVOA 2R3QA 2GQSA 3IW4A 2C6KA 2C0TA 4MAOA 1APME 3MSSA 3PY3A 2HY81 4IQ6A 3ORIA 3DFCB 5LVLA 1IAHA 4G3FA 2JFLA 4IADA 1SNXA 4BTKA 3QTSA 5K4IA 3W0NA 3IDCA 3QCYA 3LQ8A 4RA4A 1YDSE 3W1FA 2I40A 1O9UA 4L68A 5EW3A 5BYZA 4EEVA 3T3UA 5J9ZA 4FGRA 2R3MA 4C35A 2WXVA 3F2NA 4XHKB 3VIDA 3QZHA 3E8DA 4TYHA 3DBDA 1DAWA 2VTSA 5CYIA 5DEWA 4D2WA 3QKMA 2XMYA 4WT6A 2NO3A 4ZTQA 1NT2A 4X2GA 2Y4PA 4EHGA 2CSNA 2EXCX 2XB7A 1HCKA 3L9MA 2X81A 4IB5A 3V8SA 2PK9A 3QHWA 3DNDA 3EN6A 5JEBA 3FV8A 1HCLA 2QKWB 4JX3A 5GHVA 2ERZE 4E4XA 3KGAA 4WOVA 3TUCA 4O0XA 4HYIA 4RX7A 2C69A 5FDPA 3QYWA 4RLLA 3L8VA 3UZRA 4EZ7A 2Y6MA 3F82A 5FDXA 3VC4A 1OPLA 3LQ3A 4H3BA 5EKNA 3BPRA 3DGKA 3NFFB 1PY5A 1P14A 1P4FA 5E9EA 4QD6A 4I23A 3SHEA 4BWKA 3PJ1A 5DMZA 3L9PA 3OXZA 5KMOA 3W0QA 4GSBA 4TYHB 4X3FC 1NA7A 4YC6A 4EHEA 4XV3A 2RFEA 4AGWA 2ZM4A 3FMHA 3IGGA 3NIZA 4UWCA 4FOBA 4RWJA 3V6RA 4EHVA 3GU5A 3ZO3A 1CMKE 2IWIA 3NX8A 3M1SA 3PSDA 4XV2A 2JDSA 1YQJA 2AQXA 4ANQA 4NH1A 4YJPA 3LFDA 3RALA 4ZOGA 4EKKA 5FRIA 4DH5A 3FL4A 5AR7A 3ATSA 2ONLA 4Q5HA 2I7QA 2OW3A 5D7VA 3FYJX 4LV7A 3PE2A 5CSPA 4DH3A 3HVCA 4MXYA 3CXWA 3OCSA 3TZMA 5JGAA 2PE1A 3U51A 4FTJA 2YM5A 3TNIA 4C38A 2XH5A 4ZY4A 3L8PA 1Q4LA 1M7NA 3ATTA 4ID7A 4FIIA 3VF8A 1V1KA 2C0IA 4FSUA 4XG8A 3AOXA 2A2AA 3VRYA 4O0SA 4K9YA 5M57A 3E92A 4FSNA 3GOKA 5I9WA 3E8NA 3QTWA 2R7BA 4ZSEA 4OTGA 2DS1A 4MXZA 3FZSA 1B39A 3AT4A 3G6GA 4FKGA 4XP2A 4ZY5A 3OT8A 1U5QA 4E6DA 1X8BA 2X2KA 5DR2A 3RAWA 3W0RA 4GV1A 3EKKA 2DQ7X 5JFXA 4KB8A 3VHKA 4HVDA 2UVXA 4ALWA 3UNKA 5CENA 4D1ZA 4DFYA 2YLEA 5AR5A 1GIHA 4MF1A 1ZYDA 1JSTA 4H58A 4FEXA 3NUUA 4O96A 2Q83A 3UG2A 1H28A 3FWQA 4FTCA 4ENYA 5LVPA 2DWBA 2XBJA 3NYVA 4IZYA 3FXXA 3IDPA 3A8WA 3FZRA 2VTHA 1YHVA 5CY3A 4EH7A 1OIYA 3OCTA 4OLIA 4DTKA 4DGNA 3WILA 4BI2A 4NT4A 2X1NA 1Q8WA 3ZSIA 3A2CA 4CNHA 2C3JA 2W99B 5AP1A 4U43A 4GT4A 3UYTA 1KUTA 4OBQA 2VWUA 3QAME 4DF3A 2P0CA 2BTSA 4U45A 4YJTA 1PYXA 2ITXA 4YLJA 3D7TA 4GU9A 2OLCA 3ZLXA 3VAPA 1KE7A 3RWQA 1CDKA 5IKWA 2GFSA 3NUNA 5JH6A 4QQ5A 4USFA 4C3PA 1O6KA 4ACMA 3SG8A 4GKIA 4FIHA 5A6NA 3U4UA 4GH2A 4YBKA 5L3AA 3E7OA 1IA9A 4WNMA 2YZLA 4MK0A 2PE2A 3HMIA 2C6MA 3QC9A 4FV9A 4UY9A 3KC3A 4W9XA 4X0MA 4ZTSA 5KE0A 3ETAA 1VEBA 3FKLA 2R3IA 4FC0A 2QLQA 2WIPA 5H8GA 3UQGA 4ZSLA 2GTMA 3FXZA 3WE4A 3BCEA 4ENXA 3CGFA 3L8SA 4KKHA 3QZFA 4NKSA 3BHYA 3PPZA 4J96A 5HO6A 2E9NA 2H8HA 4GU6A 2PULA 4YP8A 1PMNA 4B6LA 2PUUA 1FVTA 4IWQA 5JRSA 2XNNA 4FL3A 5BVWA 1MQ4A 3ZHPC 4RA5A 2BHEA 4MD7E 4GFOA 5TE0A 3UIUA 4U80A 2QODA 4DCAA 1I44A 4C8BA 2YDJA 3U54A 3LJ0A 4BIEA 2UZUE 3POZA 4D5KA 4DYMA 5AP2A 4R3CA 4TWPA 1U59A 3F5PA 2IO6A 3A4OX 5CNNA 5J8IA 3VN9A 5C03A 4BKZA 2JC6A 4QYHA 2JKMA 3C0HA 5ACBC 3FI8A 4BHZA 4AUAA 4XYFA 3D5VA 3DTCA 3QQLA 4I1ZA 2UZBA 3LFAA 4H3QA 4J8MA 4J95A 4QMTA 4WHZA 5DFPA 3VW6A 3EQIA 3P4KA 4XV1A 5HLPA 1WBSA 1J7UA 3KCKA 4BCFA 1M7QA 2BZIB 3FLWA 4XG2A 4MD9E 5HTIA 2QHNA 3FQHA 4F7NA 3KIOC 2W1EA 2O3PA 3DB8A 2RIOA 3F5GA 4IAKA 3QGWA 4DEEA 4IJPA 1LEZA 3PXZA 2JKOA 4JT3A 3R9DA 3MPMA 4RQVA 4NKAA 2VX1A 2E9OA 2XA4A 3PXRA 4MCVA 4FK3A 4EORA 1K9AA 1YWRA 3PSBA 4WNOA 3ZLWA 1LUFA 3TYKA 4A9UA 4EHZA 4FTOA 3KXGA 3MIAA 4AN9A 4DGGA 2R9SA 2ZDUA 3MB7A 4FL1A 5DG5A 2YCQA 3KU2A 3OWKA 1QPJA 2BRNA 5CAPA 1W83A 4CLIA 4FVPA 2JAMA 2RFNA 1H4LA 4QP7A 1ZRZA 2JDVA 4GJ3A 1SNUA 4U44A 5CF4A 4AWIA 4EKLA 2ZV8A 4E6QA 2RFSA 5A9UA 5H8BA 1FOTA 2Y4IB 2G2FA 1ST0A 3BV3A 3NNXA 4QTAA 3LLTA 3PIYA 3PXQA 5M56A 5JRQA 3D14A 3SOAA 2G01A 2QU6A 4D58A 4TWCA 2RSVA 3OEFX 5CZIA 3R1SA 5DRBA 2WB8A 1TZDA 4CD0A 4UZHA 4R7HA 1H0WA 4QYGA 4FMQA 4QP3A 2WD1A 4X7QA 2ZV7A 4QDVA 4NM0A 4PL3A 4QPMA 3BWFA 4J1RA 4M67A 4EK6A 3UZTA 4RVLA 3BKBA 4O4EA 2VWXA 3UDSA 5M51A 2I6LA 4KRDA 4BC6A 4K18A 4QMMA 4LRMA 4WG5A 4GK2A 3DS6A 3EOCA 2ITVA 3TACA 3A62A 3PZEA 4FKOA 4V0GA 4RX9A 3F5UA 4D2SA 4DBNA 3TN8A 2IVTA 4AE9A 5AUWA 5LWMA 2DYLA 2EXMA 4HGEA 5FP6A 5EQYA 4DH1A 2QHMA 5HBHA 5FP5A 4O2PA 4Z9LA 4ZZNA 3IS5A 4IWPA 1MRUA 4XG4A 1G3NA 4FSTA 4I94A 3DAKA 1LR4A 4V05A 3ZZEA 2F7EE 3FY0A 4L52A 5KBQA 4JIAA 5EOLA 3C50A 2JIUA 5AIRA 5AP7A 4QMLA 5CU0A 4G5JA 1OGUA 4BJJA 2XKCA 2C6DA 3MH3A 2XUUA 4LI5A 4OR5A 3Q4UA 4DC2A 1OL6A 4QP8A 2QQ7A 5E7RA 3QRUA 1OB3A 4C0TA 4F9CA 4CEGA 3ALNA 5LMKA 3R7UA 4Y5HA 2EVAA 4NFMA 3R73A 4AAAA 2XNBA 4NJDA 2R3PA 1WVYA 4FNWA 4RZWA 5IEVA 2XNGA 2QOLA 2W4KA 4MXXA 5D1JA 4V0GB 5J95A 4C4EA 1VZOA 2XRUA 3DU8A 4O82A 1JKLA 5LWNA 4PUZA 3EL7A 3QZGA 4E5BA 2IVUA 4M3QA 1ZZLA 3CP9A 4YLKA 2JBOA 2GS2A 4IVAA 3VS2A 2I0YA 2YEXA 4ZJVA 4KIKB 2GS7A 3UO5A 1IA8A 4PPAA 4QQJA 5I9UA 4FKPA 4A9SA 2OFUA 3ZONA 2CNUA 4CMTA 4FV7A 4I92A 5BUEA 2IW8A 5HX6A 5CWZA 4WBOA 1JSVA 2BAQA 2ZV2A 4YPDA 3O8UA 4ASZA 1REJA 2W1DA 2GNFA 3SD0A 3GEQA 3SDJA 3PUPA 2EXEA 4L67A 4BJJB 5D7AA 2NRYA 5T6KA 1JSUA 2QO2A 3O96A 4FG9A 3EH9A 3OOMA 3GCSA 4C33A 4BRXA 5CTPA 5AUZA 2GTNA 5E91A 3UQCA 2PZYA 4MBLA 4GKHA 3O8TA 3P9JA 4FSZA 3RJCA 1Q8ZA 3BBWA 4PQNA 2IN6A 5FG8A 4D28A 5CXHA 4BY9E 4MXAA 5D41A 3B2WA 4YZDA 2A1AB 4C62A 4FV0A 1FVVA 2UUEA 4ZLOA 4DEHA 4EJNA 2PYWA 3PWDA 2JDOA 5DR9A 2B7AA 4BDIA 4QNAA 3VWAA 4LDTA 4FKLA 2EB2A 5DIAA 1ZYCA 4HW7A 1FQ1B 3MVJA 4TNDA 5B0XA 1PXIA 3AC4A 2VU3A 4O0TA 4UBAA 2XM8A 4O0VA 4O7LA 3SA0A 2C6EA 1CTPE 3QLGA 4PNKA 1VR2A 5KMLA 2WMAA 1M2RA 1E9HA 3LCOA 3S95A 4O81A 4E6AA 2PZIA 4FTKA 3PJ8A 1E1VA 3HV3A 2BRBA 1YVJA 4R3RA 4BF2A 2UZNA 3JVSA 2OH0E 3EB0A 4FX3A 1AD5A 4Y5QA 2W1ZA 3E8EA 3MJ2A 3EFLA 3DJ7A 4IAFA 4BDDA 3ID6C 2H96A 3UG1A 1TQIA 5K3YA 5HZNA 4HYSA 5AEPA 4O7TA 4I5MA 3BGQA 1U46A 3H30A 3Q9WA 2ETKA 2YLFA 5KMJA 4IWDA 3LHJA 2FSLX 2HZNA 3TKHA 3EWHA 3PJ2A 3Q9YA 5EDPA 4CZTA 4TZRA 3GBZA 3EQDA 3SG9A 2OJJA 5HBEA 3G33A 3R22A 2R2PA 3C4FA 3ZCLA 4ANLA 3LAUA 4OTR