5FXSA

Igfr-1r complex with a pyrimidine inhibitor.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
SYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRAIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEEPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
publication title Discovery of a Potent, Selective, Orally Bioavailable, and Efficacious Novel 2-(Pyrazol-4-ylamino)-pyrimidine Inhibitor of the Insulin-like Growth Factor-1 Receptor (IGF-1R).
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fxsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fxsA01
4I4FA 1M2QA 2QOIA 4X3JA 2UZEA 4IAYA 2J9MA 4DFLA 4ZLOA 2PZRA 3ZRMA 4QMMA 3V5JA 3VF8A 3ZMMA 2YWVA 2R3QA 3R63A 4QP4A 4W4YA 3DK7A 3UQFA 4HGLA 4GYGA 3ZLSA 3RMFA 5IQGA 2C69A 3UIUA 4YZDA 1UVRA 3NX8A 4TZRA 4BWXA 2UW4A 3O51A 2CGXA 3IONA 3LFFA 4ALWA 4MBLA 2IN6A 2WEVA 4QTCA 4RJ6A 5FQDC 3QGYA 4BCJA 4C59A 4NUSA 1XQZA 1J1CA 2XK3A 5AUVA 2V7AA 1QPCA 2C68A 3F2NA 4FV1A 4CLJA 2CLQA 4M7IA 2WMVA 3A7GA 1Y8YA 3A60A 1YWRA 2WMWA 3FZRA 4W9WA 2HW7A 2NO3A 4FI1A 4RWLA 2C1BA 4NTTA 4JAIA 3V8SA 3N4UA 2XZSA 3UQCA 4O96A 2GNLA 5LMKC 2VTLA 5CASA 3I5NA 3BYOA 3MY5A 4FV7A 4IMYA 4LGGA 5E92A 3VRZA 3ZXZA 3VUKA 4RIXA 2PYWA 4A4OA 3H0ZA 3D7TB 5EKOA 1PKDA 4XV2A 2VTNA 5JFXA 3FHRA 5JQ8A 4PP9A 4CMUA 3ZYAA 4JAJA 5EDPA 4MWHA 4GJ3A 1NT2A 4CRSA 3E8NA 3LLAA 4CFWA 2BRBA 1UNGA 4D2RA 5LMBA 4L7FA 4KB8A 3JS2A 3LFNA 4FTAA 4R5YA 3U8WA 4CQGA 4S34A 3LM5A 4WSQA 1PYXA 2JD5A 3FHIA 3V01A 4IWQA 4MK0A 2UZOA 3UJGA 4J1RA 4R6VA 5JRQA 3DLZA 3E8CA 4EOSA 4LYNA 5EDQA 4Y46A 2BRMA 4O6LA 5DWRA 3NIEA 4PPCA 1KV1A 2OFUA 2PE0A 3FMJA 3LFQA 4NKSA 3NLBA 5HNGA 5C8MA 1G3NA 1R3CA 1KWPA 2QKRA 2WMSA 4PDOA 3P86A 5CSHA 5IUIA 4F1OA 4YJOA 1MQBA 3SA0A 4X6QC 4NH1A 1PXLA 4PDPA 1B38A 4RIWA 5BMMA 2YWPA 5JQ5A 3AQVA 1XBBA 2YM4A 2R0UA 3AD4A 4ZSAA 5JK3A 4J8NA 3PLSA 4NYEA 2YCRA 3HMNA 4F99A 3LFEA 1PYEA 4HVGA 1KV2A 5CSVA 4MVFA 2VNWA 2O3PA 1L8TA 2P3GX 3K2LA 4M0ZA 4QYGA 3GQIA 4IXPA 4WA9A 1YW2A 2CJMA 3ZSIA 4J96A 4S2ZA 3V8TA 2ITWA 4AZWA 5DRBA 4RVKA 4ZP5A 4QMNA 2YIYA 3MFSA 2ERKA 3Q3BA 5KCVA 2A2AA 4QP6A 2W1FA 3R00A 2RFDA 5IQCA 4EH9A 4GMYA 3DZQA 3UOLA 1OECA 1PMNA 2IVSA 4PX6A 3R8LA 3NUSA 3NDMA 2WMBA 3ZS5A 1Q3WA 1K2PA 3CKXA 2FA2A 2REIA 4FNYA 5LWMA 3R9RA 3B2WA 3LFBA 2HXLA 2WMXA 4FODA 3TI1A 3QF9A 2ITUA 2J7TA 2R3HA 5EW9A 3SXFA 4CKRA 3MPMA 4E4MA 2PPQA 3I0QA 4IM0A 4FV0A 5E1SA 4IVDA 4QMQA 1AQ1A 2R3FA 2XK8A 5DG5A 3C13A 2BDWA 2H6DA 2VX3A 5GHVA 4D4RA 3ZFYA 2GFSA 4Z16A 3PY1A 5CX9A 3H9FA 4AA4A 4J53A 4RLKA 3FY0A 3BELA 3HV7A 3E93A 3QKMA 4YZ9A 4O0WA 4JIAA 2E2BA 4BTKA 4H39A 4U9AA 3VBQA 5A4TA 2HZ4A 4IWPA 4BL1A 2OJIA 3CPCA 2CKPA 2CNVA 2QQ7A 4L3JA 2UW7A 3AC8A 4IE9A 1H07A 1ZMWA 4IZ7A 2YITA 3VBWA 3C0GA 4BIEA 3VN9A 2ZM4A 4PY1A 3GCVA 1H4LA 3KXXA 3W2SA 4AWIA 3OWKA 2JDRA 4IC7A 2W4JA 3RAKA 5K0XA 3LMHA 5CEQA 2ERZE 3BHHA 2PMIA 5JFWA 1FMOE 2OK1A 4F63A 3I4BA 3ZUTA 2XK4A 1MQ4A 1Q97A 3UMXA 3EH9A 3F69A 3MJ1A 4YTHA 4O84A 1FGIA 4NFNA 2I7QA 2YEXA 4F6UA 5FWKK 2C5XA 3TIYA 4FSRA 4O7SA 2JBPA 3QD4A 4FSNA 4TN6A 4F6WA 1P5EA 4BDFA 4XG6A 4ACHA 4OTPA 4EQCA 4L53A 1PY5A 3UG2A 4QQJA 3OXTA 4GUEA 2DQ7X 3G6GA 4EH7A 5JH6A 2X7GA 2C3KA 3TXOA 4UBAA 4FTJA 3GGFA 3I7BA 2UVZA 3F2AA 4QQ5A 3PXYA 4XG2A 5IQFA 5LVOA 4LMUA 3TWJA 2JIVA 4KIKB 4J8MA 3EN7A 3OTUA 4LV5A 3LCKA 3EFKA 3KMMA 4I6HA 4JDIA 4TL0A 2B1PA 3TTIA 4PV0A 1ATPE 4GW8A 4K2RA 3UQGA 3WIKA 4FV5A 3L8XA 3LE6A 3MTFA 2WTKB 2VTOA 3MH1A 3IGGA 2XJ0A 4AA0A 5E8ZA 4FYOA 2F7EE 3EN6A 3SC1A 2BHHA 4M8TA 4DTAA 2OJGA 3R8PA 5M4CA 3OWLA 3M1SA 4RVLA 4C35A 5HD7A 4R7IA 2RFNA 1W8CA 3ETAA 5CEIA 3Q2JA 1V0OA 5IPJA 3OBGA 2BFXA 3UNJA 3U6IA 4ZSLA 3VS0A 4ZTSA 2PUPA 3I7CA 3NGAA 3S4QA 3LFAA 3V5TA 5HIBA 3FC1X 3LFSA 4ZAUA 3G90X 2O64A 3U87A 2YIWA 5CEMA 2IZSA 3EQGA 3KQ7A 4X7QA 3ZUUA 1PRYA 1Y6AA 3TNIA 3OG7A 3FI2A 3LLTA 1OKYA 4F6SA 4R7BA 1WVWA 5CANA 4N6ZA 4G6OA 2VN9A 3S0OA 2DUVA 2PHKA 3EN5A 3FKOA 3FZ1A 3H3CA 3E5AA 4KAOA 4L67A 2YM7A 4QRCA 4ZTNA 4QTBA 4D55A 3DOGA 4KINA 1OUKA 4LUDA 4RX7A 1PXJA 2VO0A 2X9FA 4Y85A 3BQCA 5TKDA 1ZYLA 3OS3A 1OIUA 2WMTA 3PYYA 3IPHA 4K1BA 4P90A 3SOAA 3MFRA 2QOQA 4HJOA 4CQEA 3ORKA 1WMKA 4CZUA 2XYNA 5CVFA 1KOBA 2X2KA 1KE6A 2YM3A 3F6XA 1DAYA 3F5GA 3Q52A 2PUUA 5M53A 3D7ZA 5ANOA 4ZXTA 2XKFA 3CGOA 2XJ1A 4FEVA 1H0WA 1R78A 1H26A 4JDKA 3QCQA 3R04A 1RQQA 2EB2A 3OUNB 4L44A 4RJ4A 4XV1A 5B0XA 4DYMA 2W1EA 4EHEA 4USEA 2C5VA 3TUCA 4YSMA 5HVKA 3NNVA 3JR1A 1DM2A 3F3ZA 3SRVA 3RP9A 2YN8A 3E87A 1YI3A 4OTGA 1SVEA 3UOHA 2HENA 3E3PA 3I79A 2ZV2A 3QD0A 4I0TA 2FVDA 4FEQA 1OPKA 4E4LA 3OWPA 3ZDUA 4N57A 5DMZA 5FXRA 1U5RA 4KWPA 4HNFA 3JXWA 1A06A 3KVWA 2ZV8A 2XVDA 3FL4A 3SAYA 4D28A 5K4JA 4BIBA 3CQWA 4Y5QA 4BI0A 1VYWA 4FKGA 4E93A 4PPBA 1OVEA 3GC9A 2H96A 4I94A 4G5JA 4IACA 4D0WA 4XLVA 1OMWA 1SVGA 5CEKA 1FVRA 3MV5A 4FMQA 5LCKA 3EMGA 3DFAA 4I24A 2CKOA 4FC0A 3ZXTA 3ZOSA 4EK6A 4DEDA 4EOJA 2VGOA 2WXVA 4A9UA 4EORA 4FZDB 4DFUA 1H28A 5A4QA 5M4IA 4B99A 5LVLA 3R7OA 2Y4IB 5HTBA 3C50A 5BYZA 4WUNA 4X2GA 1M2PA 1FGKA 2ZV9A 2OICA 5HESA 4EOOA 5B2LA 1PMUA 1YOMA 2QLQA 3HP5A 2A0CX 5CQWA 4LRMA 1YDRE 2XS0A 2YM8A 1SZMA 5J95A 1GIHA 3QL8A 5HZNA 3FZTA 3LQ5A 5CZHA 3BEAA 4DCEA 2BILB 5HLWA 3GB2A 2OBJA 5AP1A 2XH5A 5F94A 4WT6A 3TZ9A 3QXPA 2HAKA 2H34A 4L68A 4QMVA 4UZHA 1I44A 5CAUA 2BUJA 2C6LA 4BDAA 1JBPE 3VJNA 5IA3A 2F57A 4LMNA 4W4WA 2OKRA 5J1VA 4FKRA 4CV8A 4ANQA 4ID7A 5JKGA 2V0DA 3R7GA 4HYUA 2G2FA 2PVNA 4DINA 2YCSA 2JKMA 3AMYA 4N0SA 3WF7A 4RC3A 3FMMA 3NUUA 1ZOGA 2EB3A 4APPA 1YXSA 2YLFA 3IDBA 3QRTA 2LAVA 3UP2A 3LQ8A 4R3PA 4RFZA 3R30A 4AFJA 3BLRA 4BCNA 2YISA 2BRGA 4DFBA 3EHAA 1H8FA 2G9XA 4IVCA 4MQ1A 5D7AA 4AW5A 4U41A 3R83A 4UMPA 4EWQA 5CAPA 5FM3A 2GHMA 2GHLA 2EXCX 4N70A 3C5UA 4TY1A 2DS1A 3NUAA 4DLJA 1XKKA 2HOGA 4DT9A 4DCAA 4FOCA 2IJMA 3PP0A 4DGMA 4O2PA 3FXZA 4U40A 4DT8A 2CNQA 3DTWA 1XWSA 3QTZA 5AIRA 4RG0A 2JKQA 2YHVA 3CIKA 2X8DA 4E6CA 1HCLA 4J98A 4BDJA 3LOKA 4CMOA 5GJFA 3PPJA 4XBRA 4O0YA 2OO8X 4YP8A 5L3AA 5CU0A 3HV4A 2RSVA 3DBCA 4BWPA 5GZ8A 1KOAA 3QTSA 2YJRA 2CNUA 3RNYA 2CPKE 3DBDA 3VBYA 4OAVB 4FSMA 3PY0A 2GQSA 3F66A 3FMNA 4C4GA 3FI3A 2XIZA 4E20A 3MS9A 4U97A 3VUIA 5IQEA 4D9TA 1W7HA 4GYIA 5K3YA 4HCUA 4D9UA 3UIXA 4NWMA 3QALE 5KBRA 2C0OA 4O7TA 4BI2A 1K9AA 1Q8TA 1VZOA 3OW3A 5EHLA 1PJKA 4IW0A 2OXYA 4V01A 1OIQA 2WGJA 2XIRA 5ANKA 3UP7A 4C2VA 3NNWA 2BAKA 3BBWA 5GIOE 3DAKA 3POZA 3R9NA 5E7RA 1YWNA 3K3JA 5CVHA 4IBMA 4E26A 1SVHA 4RWKA 4DHFA 4F70A 2I0YA 1T45A 5CLPA 4YHTA 4C37A 4WNMA 3MPAA 5AR7A 3DKCA 4IVAA 4ZLZA 4ERWA 1H25A 5L6PA 3TNHA 2R7IA 5C8KA 4UMQA 3K54A 2O0UA 2VTQA 2XNOA 4WIHA 3COHA 4QMUA 1P4FA 2YDIA 2XYUA 3AD6A 4O0XA 4DGGA 2R3OA 5BUIA 2QR8A 3UMWA 3BLQA 3CS9A 4FVPA 3ANRA 4C4IA 3ODYX 2BR1A 2C6DA 4I93A 3HKOA 2JGZA 3VUGA 1UV5A 3EL8A 1JNKA 2DWBA 3WF5A 1BUHA 4ACMA 1ZYDA 4XNEA 5AMNA 2RFEA 5I9WA 4EHZA 4Y83A 2F9GA 2FYSA 3E92A 3A2CA 4QMLA 4KRDA 3ZM4A 3NUPA 5IA0A 4X6RA 3CSVA 2JDVA 3VW6A 3F5PA 3II5A 3AOXA 2ETRA 5AM6A 5M57A 4AFEA 2WMAA 4DEHA 4BR3A 3PXKA 3KRRA 3UPXA 1KE8A 4MXOA 4FSUA 2IZTA 1IR3A 3KRJA 1Q62A 3Q4UA 2EXEA 4W8DA 3GP0A 2VWVA 4AT4A 3KA0A 3RAHA 3AGMA 4JQEA 3FKLA 5HCZA 3RPSA 3P7CA 4ZTLA 3UGCA 2ONLA 5CI7A 1SM2A 2BTRA 4F08A 4EWHA 5KNJA 4C0TA 1S9JA 3BE9A 3ELJA 4AXAA 4B9DA 2YIQA 3MA3A 4RIYB 2UZBA 4M14A 4X2KA 4PNIA 4ZTHA 4QP9A 2QOKA 3FXXA 1URWA 2XBJA 1FVVA 3LMGA 4BF2A 3PFQA 4YMJA 2PMNX 5HVYA 2XK6A 3EFJA 3REPA 4FEWA 2QO2A 2PMLX 2P0CA 5TF9A 2RKUA 4R3CA 2BCJA 3I0OA 3QHRA 3QLFA 4DGOA 3F88A 4OTWA 4YLLA 3BU6A 2Z8CA 3C4ZA 4FTRA 5BVDA 4RZWA 4QYFA 4U80A 2UUEA 1ZYSA 2BMCA 4O1PA 2X8EA 2WTJA 4EOIA 3HEGA 4RZVA 4W8EA 1U4DA 1S9IA 1JQHA 1Z9XA 3Q9XA 2QO9A 5HTCA 5I9XA 4OBPA 4IZAA 1UU3A 4FOBA 3MYGA 5J9YA 4HGSA 3NNXA 3GU6A 3DT1A 3G0FA 3MVLA 4XX9A 3Q04A 4MKCA 3HDNA 2YERA 5HIDA 5H3QA 1LEZA 1WBPA 2QG5A 3UIBA 5EM7A 5FGKA 4O7ZA 4L9IA 3BWJA 2NPQA 5JT2A 3IDPA 1VEBA 3WZDA 5LMKA 4K0YA 3FI8A 2P33A 3ACJA 4HPTE 2ETMA 1MP8A 3TKUA 5E8YA 3RBWA 2VWZA 1H1RA 5CXZA 4I0SA 3CC6A 4FGBA 2R3NA 4XH6A 4YGAA 4YLJA 4AZSA 5LVNA 4XOZA 3BU5A 4C3RA 2ACXA 4II5A 1M17A 4C02A 3EQHA 5FXQA 4JRVA 1OB3A 1O6YA 3PP1A 1H08A 4EKKA 3QRJA 5EOBA 3R7EA 3RPOA 2XKEA 3V04A 3ORNA 3RAIA 3TTJA 5IZFA 2F4JA 3R71A 4G6NA 2HELA 3GCQA 4UY9A 3WZUA 5IH6A 3RKBA 4IB3A 3WF9A 4PL3A 2R7BA 3Q9YA 1TQIA 3BWFA 3QQUA 4GK3A 4OTFA 2J4ZA 2Z7QA 3QC4A 4IDVA 2X81A 3TV4A 1J3HA 1PF8A 3L9LA 3QA8A 5AM7A 4NL0A 4HOKA 4RC4A 1NY3A 4QYHA 5FTOA 3LMIA 1LR4A 2OXDA 2HY0A 3H10A 2OIBA 4QP7A 4BDHA 3LXLA 5D9HA 4O7NA 2VWIA 1PXNA 3HV6A 3ZO2A 5CZIA 4M66A 4BZNA 3D5UA 3I5ZA 3LJ0A 4C2WA 4FKIA 4XG4A 4EYJA 4HVDA 3G15A 4GKIA 2W05A 2XBAA 1JSVA 5EFQA 4E6QA 2GHGA 2ITPA 4MNFA 4NEUA 4EK3A 1WVXA 1YI4A 3OD6X 1STCE 3AMAA 2I40A 4E6DA 3QAME 3GXLA 3R7UA 4IM3A 1Q8UA 3ROYA 5KO1A 5HNIX 4FV8A 4QPAA 5C27A 2UW3A 4UXLA 5FEEA 5M4FA 4RJ3A 2R3KA 2C6IA 5L2SA 4HGEA 4TYGA 5E1EA 1OL6A 4BWKA 5EYKA 4G17A 1PXKA 4O0UA 4OW8A 4YO6A 4IHPA 1B6CB 2W7XA 2BALA 2OZAB 1YRPA 1WBTA 4YC3A 4KIQA 3HA8A 2W96B 1W0XC 4NW5A 2G01A 2X2MA 2GCDA 3NNUA 4N4SA 5HNBA 2BIYA 3EQPA 3LM0A 1XR1A 3ROCA 2GNIA 4LI5A 1YI6A 4JDJA 3BV2A 3EWHA 4M69A 4KS7A 4CG8A 4BDCA 4BDKA 2VO7A 5EDRA 3ENMA 3DXNA 4UMTA 3FDNA 4QP1A 4TYIA 3DJ6A 3NW5A 3Q96A 3QQJA 4M68A 3RI1A 4J95A 5J9LA 3PJ3A 2ONLC 3QQFA 3QZFA 4RFMA 2NRYA 4MX9A 4FL1A 3MH2A 4X2JA 3QTIA 4DLIA 1VR2A 1J1BA 4OR5A 4FA2A 4FYNA 4GIHA 4I41A 4HZSA 4KSQA 4X3FC 4A4XA 4NIFB 4CZYB 2WQOA 3QTUA 3AC2A 3MJ2A 4FT5A 4GH2A 2WAJA 5AUYA 3TKIA 3AD5A 4V0GB 5GINE 4RBLA 3ZHPC 3HGKA 4JNWA 3FYKX 1FOTA 2JC6A 1BL6A 4DAWA 3KL8A 1A48A 1PXOA 5AWMA 4PRJA 3A62A 2ITOA 4W4VA 3VWAA 1JPAA 4BRXA 5BPYA 4EK8A 3UNKA 3Q5IA 5HG7A 2YA9A 2ITTA 3O0GA 3MH3A 4DGLC 5FXSA 4HYSA 5AP7A 3VUDA 4IC8A 3UZPA 2VTRA 4GJ2A 3ZO4A 4FT0A 1H01A 3R9OA 4AAAA 4DFXE 2C5YA 2VV9A 3QRKA 2Z60A 4GRBA 3PZHA 5FM2A 5D12A 1JWHA 3R1NA 3T9TA 4BTJA 1FQ1B 3SQQA 5HTIA 3U51A 4V05A 2VWYA 2XP2A 5GNKA 2B0QA 4I92A 2ESMA 4ZY4A 1OGUA 3IDCA 4QPMA 2KTYA 1H1QA 4IEBA 2XNPA 4AGDA 1IA8A 4ERKA 4M3QA 2CGUA 1QL6A 2BKZA 4WRGA 1BLXA 3ORPA 4PMTA 5AV0A 4FE2A 2UW6A 3P7AA 4UMUA 1OPLA 2WD1A 4RRVA 2XK9A 4X2FA 2C0TA 4C8BA 4IFGA 3DDPA 3D5VA 3EYHA 4U3YA 3RZFA 4AN9A 5L8KA 4BY9E 4QP3A 4YNEA 1WVYA 2AYPA 3CY3A 3EZVA 5DN3A 3MA6A 2PMOX 2PVJA 3IW8A 4ZTQA 4FK3A 3SW4A 5EM6A 2QNJA 1YHVA 5KHXA 3COIA 3CLYA 5BQ0A 5DOSA 5E8TA 4FKPA 4RJ5A 3QRIA 4XP3A 2UZWE 4J97A 2WTVA 3COMA 5GZ9A 4IAKA 3ATSA 4BI1A 3HMIA 2YM6A 2UZDA 5ACBC 5J8IA 3DGKA 3TUBA 4JR7A 1ZZLA 3L8SA 3OMVA 3EQBA 3FV8A 4CT1A 2XRUA 2PULA 3IQ7A 3MH0A 1ZMVA 5AV1A 4P2KA 5DR2A 3EL7A 3PXZA 3OXZA 3GQLA 1U59A 4RPVA 2FH9A 3DAEA 5FBNC 3QKLA 4E73A 2H8HA 2VTMA 2WTDA 1M14A 4F9BA 4CYJA 1WBSA 1UWJA 3W32A 4B4LA 2F7ZE 3KF4A 2UZVA 1DI8A 4OT6A 4WNKA 3V5WA 3VS5A 1WFCA 2ITXA 2UZUE 3AXWA 4GK2A 4FIEA 4V04A 2B54A 2WTWA 4WBOA 4YTIA 3R1QA 4MF0A 2OI4X 4AZEA 3IW6A 5IEVA 4P5ZA 3PY3A 4W4XA 3DXQA 3TJDA 4ZSEA 4AN2A 1UKIA 3UODA 3R28A 5CEOA 4O81A 3S2PA 5KMJA 4AOJA 2Z02A 4BZOA 4AU8A 2ZMDA 5E9EA 3D14A 1XBCA 4MXZA 2IVUA 5HD4A 5IUGA 4RJ7A 5ANEA 3ZTXA 5IKWA 2GQGA 2XKDA 3QRUA 2B9FA 5E8WA 4ZY6A 1XBAA 3TNPC 2XRWA 4KBCA 4JQ7A 5AR3A 4KS8A 4MQ2A 4KIOA 2GS7A 4QT1A 5L8JA 4FEUA 4ANBA 2E9VA 3RCDA 5HLNA 1Y57A 3ACKA 3E62A 3HUCA 4IX3A 5JRSA 4EOQA 5IDNA 4FEXA 4GEOA 2C3LA 2JBOA 2X39A 2YAAA 3FMHA 5DIAA 1R39A 5JN2A 3TUDA 4MXAA 1Q24A 3FQSA 3HMPA 4I5MA 1WCCA 1QPJA 4MNEA 4QYYA 4RMZA 2W9ZB 3RWPA 3T3UA 3W2QA 4D4VA 3UPZA 4O7LA 1NXKA 3DCVA 4JL9A 1H1PA 1Z57A 4XYFA 2R3MA 4JG6A 5JFVA 4MBIA 3C5IA 5DVRA 4FUXA 3IW7A 4F9AA 5HEZA 4MF1A 3FMKA 4ASZA 1WBNA 2W5AA 4IZ5A 3NWWA 4PQNA 4WD5A 4AW1A 4LGHA 2QU6A 3TIZA 5IQIA 5E90A 3BIZA 3WOWA 3ORZA 1SNUA 5DI1A 2RGPA 4TWPA 4RA4A 2QOLA 4QMYA 4B0GA 4I20A 3MFUA 3VS6A 4EHVA 1GZ8A 2E9OA 4QD6A 2EVAA 3R1SA 3GU8A 4L8MA 4H3PA 2C4GA 5IU2A 5H2UA 1YHSA 3NVKI 3OW4A 2XNGA 3MVHA 4MD9E 5EI2A 1E9HA 4UZDA 2OSCA 1JVPP 2IWIA 3QZGA 3RAWA 3UOJA 2UZTA 2B53A 4Q9ZA 2FO0A 4RIXB 3H0YA 2F49A 5AR2A 4XV3A 3EN9A 5IA5A 5CF5A 3U6JA 4DE4A 5A3XA 2W4OA 2GFCA 3HL7A 4A06A 4D2WA 3UO4A 3O17A 3DKFA 2O5KA 4NM7A 3Q9ZA 3DU8A 4ITHA 4JBVA 4IJ9A 3RWQA 3EQCA 3ZBXA 5AUUA 5F9EA 3TACA 2OLCA 1IASA 2OIDA 4JS8A 1XH5A 5TOZA 4E5AX 2HZNA 2JLDA 4NCTA 3RM6A 3JPVA 2Q83A 1FBNA 1QMZA 2RF9A 3LZBA 5CEPA 5IA2A 4ZSJA 3MWUA 4O1OA 3ZO3A 2QVSE 3D4QA 3CD8A 4D1XA 1ZZ2A 3LHJA 1J7UA 4F09A 1YOJA 4OBQA 5D10A 3OY3A 4L42A 4Q5HA 5BNJA 3F3WA 2CKEA 4CFVA 3TNWA 3BE2A 1GIJA 5JMSA 1U5QA 3PLAE 4A07A 4RIWB 1DAWA 4HYIA 4H3QA 3TV6A 5K4IA 2PU8A 2CGVA 3EYGA 4CVAA 3BLHA 1CSNA 4RFYA 2W17A 2ZMCA 5IA4A 3PUPA 1OL1A 4O22A 4FKTA 3SV0A 3DFCB 1REKA 3FMLA 3TNQB 4BN1A 2QC6A 2ITYA 3GEQA 4E5BA 2CCIA 4Y5HA 3TZ7A 2E9PA 2JFLA 4G3FA 3FLNC 5E4HA 2RIOA 2HXQA 4R5SA 1OI9A 2W4KA 3WZEA 4UYNA 5EKNA 3R73A 4FV4A 4K9YA 3R8VA 3W8QA 3EQFA 4D5KA 4A9YA 3OWJA 2VO3A 2LGCA 3F61A 3W2CA 4AW2A 4F1MA 2FSOX 3AGLA 4B6LA 3P78A 4DH7A 1OM1A 4DH1A 2A19B 2VGPA 4XCUA 3WYXA 4C61A 3P08A 3PE1A 3VBTA 1XO2B 2CDZA 4I22A 1LP4A 5IQBA 4XG8A 5CSWA 5KMIA 1KSWA 4ZZMA 3WARA 5CI6A 2UW5A 5ANIA 2Y8OA 5DT0A 1Q8YA 5DPVA 3DXPA 4R78A 2PE2A 3UVQA 4FKVA 4ZTRA 4D58A 4F7NA 5CTPA 5HVJA 3ZRKA 3D5XA 3ANQA 4XV9A 4JQ8A 2QOBA 5HHWA 3WIGA 5AA8A 2E9UA 3MFTA 5AX3A 2HWPA 4I6QA 5EHYA 2XCKA 3QD2B 3R7IA 3DA6A 5HO7A 2GPHA 1Q61A 4ZJJA 4ANLA 3QXOA 4FBXA 5BMSA 4BDIA 4EEVA 3MESA 4FKSA 5K9IA 4GL9A 4CFNA 2WPAA 5CY3A 3R9DA 5CQUA 3WILA 4IWOA 3Q9WA 4Z7GA 2HIWA 2ITNA 4TYHA 1TVOA 3DKGA 4QQCA 5KKRB 4O7YA 5IEYA 4MAOA 4AZTA 1IAHA 3FLWA 3U55A 4B8MA 4BHNA 3E7OA 3SD0A 4FR4A 1B39A 3HZTA 1OBGA 3GU7A 3ALNA 3L8VA 3MPTA 2J5EA 3RPRA 3FLQA 4ZOGA 4NTSA 1Y8GA 2B7AA 3JVRA 3W1FA 4E8AA 3TT0A 4QTEA 5JZJA 1ZOHA 3F9NA 3O50A 4CKIA 3F5XA 4JX3A 2PZYA 5G1XA 5J9ZA 5FTQA 5C4KA 3PVBA 2XCHA 1UNLA 1GZNA 5AX9A 2WO6A 3RHKA 2CKQA 3K5VA 1NVRA 3FYJX 4EH8A 1T46A 3ORMA 1TQPA 4M15A 3SOCA 1WBWA 4FT9A 4A9SA 4LOPA 5HBJA 1H00A 4MHAA 3C51A 4QMWA 3ZZWA 3PIXA 2WMRA 5FRIA 3QD3A 5FEDA 4PP7A 3KEXA 1HOWA 4G5PA 3UO6A 4AS0A 2J0MB 1OL7A 4BCMA 2W06A 3KF7A 4KNBA 4P7EA 4ACCA 5F20A 4YTFA 3FI4A 2Q0BA 1DS5A 4BGGA 2VAGA 3WBLA 2XNMA 3UZTA 2C5NA 2PZPA 3OCBA 1WAKA 5BX0A 3VW8A 3I6UA 4S33A 5I3OA 3WZKA 2R3PA 4NKAA 2QODA 1MRUA 4TWNA 3T3VA 3WE4A 4GU6A 4KKHA 4HVHA 1QCFA 2QOHA 4JBQA 4JX7A 4F7JA 1CKPA 4FT7A 1O6LA 4NCTC 3I1AA 4L01A 4PMMA 4RJ8A 3R1YA 1RJBA 4CMTA 5IQAA 5A14A 2C6TA 2J2IB 3DPKA 4MD8E 3B8QA 4EZ3A 2JIUA 4O0RA 1JAMA 2X4ZA 3VUMA 3BCEA 3ZU7A 4EH6A 4HW7A 3ZLWA 4ASEA 2OWBA 4ASXA 3C4CA 4GG7A 2OJFE 4KKEA 4G3EA 3WI6A 4JDHA 4U43A 1IEPA 4BKZA 1CTPE 1XJDA 3IGOA 4CRLA 2WKMA 1H27A 3WF8A 1PKGA 4ZEGA 2NP8A 3VRYA 3MTLA 2QG7A 2OF2A 5CNNA 4DEIA 4O2ZA 2C3IB 2E9NA 4FX3A 4QO9A 2YZLA 3POOA 5C01A 4FUYA 4N6YA 4KD1A 2W9FB 2J5FA 4IANA 4KIPA 4BHZA 4S30A 4FZFB 3ZM9A 3PIYA 2FSMX 4ITIA 5CT0A 3RJCA 4AOTA 3ATTA 5FG8A 3LXKA 1U54B 3LJ2A 4FTQA 5HX6A 5TT7A 5IH5A 5KBQA 5HQ0A 4D1ZA 2QO7A 3ZUVA 2ITVA 3V51A 5AAGA 5H8EA 2VX0A 3LVPA 4FTKA 2PVMA 2QI8A 4JT3A 4FVQA 2B52A 4TRLA 3OCGA 3VHEA 5I9ZA 4ANOA 2IVVA 1J7LA 1ZY4A 5T68A 2QURA 1UKHA 3KFAA 2VWUA 3DBEA 3QZHA 4R3RA 1QPEA 5KZ0A 4RIOA 4NM3A 5DA3A 3P4KA 3VF9A 4F9YA 4XS2A 4IADA 4IQ6A 3B2TA 4BDEA 2BZJA 2V7OA 2VTJA 3LW0A 5EK7A 4D2TA 5I5ZA 4G16A 3NYNA 2YLEA 2IPXA 4IDTA 5KE0A 2I1MA 1JKLA 2R9SA 2XNNA 4IB5A 3QBNA 5EYMA 3R7YA 4C38A 2GNJA 4FG7A 3HRCA 4USDA 3S95A 4DG2E 4D2PA 3KMWA 3L9NA 4G1WA 4L3PA 5CF6A 3KGAA 4FV2A 3C7QA 3V5QA 3VS4A 4MXYA 3AC4A 3MY0A 5HU9A 3AT4A 3EQDA 4CFFA 3RVGA 4F1TA 4CFXA 4NU1A 4LGDA 3PE2A 2J0LA 3UO5A 3O8UA 3FUPA 4FTTA 3RZBA 1GNGA 4FV6A 1JLUE 3SVVA 3NVMB 4C58A 5DR9A 4PTEA 4RWJA 3LFDA 4FKLA 4YURA 5BVWA 5J5SA 4FIGA 2Q0NA 5EH0A 4FTOA 3IO7A 1RDQE 4XG7A 3NPCA 3TZMA 3C4EA 2J51A 3KXNA 5FTGA 4CSVA 1F5QA 3KK8A 4YO4A 4U42A 3OC1A 4CNHA 5CU2A 3ZC5A 4BICA 5D1JA 5KMLA 4H1JA 1XH7A 5AP3A 2VTAA 5LARA 4EOLA 1XHAA 3VS3A 1AGWA 3F7WA 4XLIA 4IAIA 3KKVA 4GU9A 4IIRA 3GUBA 3OVVA 1LUFA 4RWIA 3FZOA 4G9RA 2IW6A 3Q6WA 1SYKA 5D41A 3PSDA 2Y7JA 5JGDA 3FBVA 4QMOA 3PWYA 1Q41A 2YIRA 3HRBA 3KULA 2X2LA 4FZAB 3PIZA 5HCYA 3N4TA 1JKSA 5LVPA 2JAVA 3HV3A 3PG3A 4BGQA 2R3RA 3GNIB 1PW2A 1OKVA 3VBVA 3A7FA 3A61A 2YFXA 3QUEA 3R01A 2J0KA 1IRKA 3SXSA 5JFSA 4XHKB 4I4EA 4M12A 2X9EA 5F4NA 3DY7A 4X3FA 4PTGA 3VHKA 5EI6A 4WUAA 1IG1A 3KB7A 3VIDA 5A4CA 3NIZA 3PVWA 3KK9A 4C4JA 1MRYA 2VTTA 4NSTA 3PJ2A 3ZO1A 4DN5A 4F0FA 3LKMA 3W2OA 3UTOA 4K6ZA 1GJOA 2DYLA 5ETCA 5HE3A 1ZYJA 3LCTA 1Q8WA 4PDSA 1E1XA 5I9YA 4FSTA 4U7ZA 5AUWA 4OLIA 3KXHA 2YDKA 1AD5A 3HDMA 4UWYA 3AT3A 3CR0A 4F0IA 4YUQA 2JEDA 5DHJA 3BX5A 3U9CA 3TV7A 2XJ2A 3CD3A 5M09A 4MD7E 2GTMA 4O38A 3DQXA 2GNGA 1I09A 2QHNA 3TDWA 1BYGA 3I60A 4GUBA 1BMKA 4U79A 3ITZA 3E88A 2Z2WA 3FJQE 4PUZA 3VBXA 4ZTMA 2P4IA 4AGWA 2BKKA 3VC4A 3JYAA 2I0VA 3W2RA 5CU4A 2I0HA 4GFOA 4V0GA 5FDXA 2BIKB 3IOPA 5AP6A 3FPQA 5DLSA 4NW6A 3BGPA 4Y95A 3W18A 3IK3A 2UV2A 3UZRA 3R8ZA 4B8LA 4I6FA 2AC3A 2VU3A 4MCVA 4D4SA 2FSTX 2J6MA 4YC8A 5M06A 2PVYA 3CTJA 1Y6BA 4L7SA 5CXHA 3OTVA 5HO8A 4ZK5A 3TJCA 3OF0A 3RALA 4FSQA 4IX6A 4CYIA 3W33A 3D5WA 4FTMA 5HE1A 2VO6A 1M52A 2A27A 4HYHA 3D15A 1F0QA 2WU7A 2H9VA 4FTUA 3ZFMA 4KABA 1REJA 4I5CA 2EUFB 5EM8A 4O7VA 4S32A 2QOOA 1P4OA 5IMEA 2PUIA 3QTXA 3NZ0A 4QMZA 4CEGA 4EBVA 3TN8A 3V6SA 4S31A 2CMWA 1FVTA 4DBXA 4FTIA 4FKQA 1OL2A 3D7TA 4J99A 4Y72A 5EOLA 4EK4A 5M4UA 4IZYA 2HZ0A 3S3IA 4EONA 3DKOA 3DLSA 3O8TA 4GFGA 2XIKA 1E1VA 3R9HA 2P55A 4XRLA 2C5OA 2PY3A 4FKOA 4JIKA 3HNGA 3OBJA 3AC5A 4DH3A 3R2YA 3FZPA 4AX8A 4QMXA 4C3FA 1UU7A 1O6KA 4BZDA 4EJNA 3OUKA 4EJ7A 5LOHA 2V62A 5E8SA 4XP0A 4PNKA 3LXPA 4C36A 4H58A 3KREA 3I6WA 2SRCA 4J71A 4PL4A 4L46A 4CCBA 4JG7A 3F3UA 2R5TA 3A99A 5FDPA 4D2SA 5KUPA 5DGZA 1NW1A 2VWBA 3GC8A 5EG3A 5AP4A 2GS2A 3QHWA 2G2IA 4ZIMA 2PE1A 4XG3A 2BZKB 4O91A 1M7QA 3U9NA 4CFMA 4U6RA 4L43A 3N4VA 3C0HA 2HYYA 5CAVA 3MIYA 2BRNA 3FSFA 2KULA 2F2UA 2RL5A 4QYEA 2J0JA 2GQRA 3MB6A 3Q60A 4JJRA 5C9CA 4HNIA 3GOKA 3GCSA 3VS1A 1X8BA 1Y91A 2CN5A 3RK5A 5M56A 3NR9A 3NS9A 3VQHA 3BYVA 4UXQA 4DEBA 1BI8A 2ZJWA 1G8AA 4KUJA 4OTIA 3EIDA 4WG5A 4CFUA 1PMVA 5CU3A 4GT4A 2PVKA 3NW6A 5I9UA 3PG1A 4ZS4A 4NT4A 3DQWA 4AZVA 3SG9A 3P23A 2G1TA 3GOPA 2V22A 2QHMA 3D2IA 3L9MA 3R2BA 5CS6A 3DZOA 1H1WA 2F2CB 3JY0A 2W0JA 2WTCA 3DB8A 3O7LB 4RX8A 5E8UA 4CCUA 4Z7HA 2VD5A 4F65A 2VRXA 3FLZA 4XBUA 4ZJIA 4UYAA 4E5WA 1OUYA 2FSLX 5HLPA 4Y73A 5TE0A 3QCXA 5FLFA 4BBMA 1DI9A 2Z7SA 4FSZA 3KRWA 4G31A 3NYOA 3CKWA 3MY1A 3ZEPA 3QC9A 4F7SA 3O7LD 4YTCA 5CSPA 5AP0A 2BTSA 3KMUA 1OL5A 3PA3A 4BCGA 3CP9A 4J52A 4OBOA 2GU8A 2B9JA 2OW3A 5F95A 3FY2A 3H4JA 5J87A 4FSYA 2J50A 3KU2A 4Z55A 3SXRA 3ZDIA 3OCTA 5DFPA 4C34A 4ZS0A 2C6MA 2J90A 4M97A 4BKYA 5A6NA 1XH9A 3F82A 4FIFA 5C03A 4YJRA 3GBZA 4XMOA 5HE2A 1YQJA 2W1IA 2VX1A 1PHKA 3N9XA 1ZOEA 2YDJA 3HP2A 5M07A 3D9VA 4BCPA 4EZ5A 2JDTA 2NRUA 2ZAZA 4IAZA 4WBBB 2QLUA 2WIPA 3ERKA 5M55A 4FTCA 4O83A 3HVCA 2XM8A 4GK4A 4OTDA 4BYJA 5AFVA 4FNZA 4DTKA 3IKAA 4Q2AA 4YJQA 2XNBA 4ONAA 4AGUA 5E91A 4F4PA 1UU9A 5TR6A 3R7VA 2V5QA 2C3JA 5IG1A 3LIJA 2B4SB 4YBJA 3EFLA 4UMRA 1YXXA 3HLLA 3LXNA 3MBLA 3RPVA 1TQMA 3P7BA 3FSKA 3QWJA 5IISA 5DNRA 5ANDA 1A9UA 3PPZA 3CBLA 5I9VA 5G6VA 5AJQA 2PZIA 4TT7A 3QQHA 3JVSA 1SNXA 4RX9A 4O7WA 4EBWA 4ZJVA 3OT8A 4L6QA 4QP2A 4X21A 3ORLA 5TO8A 4AW0A 5IF1A 3MGYA 4KIKA 4AQCA 5C1QB 3M42A 4EH3A 1EH4A 4LG4A 4F0GA 4HZRA 3QLGA 5HE0A 2HZIA 1WZYA 4F9CA 3E3BX 3O8PA 3R21A 4G34A 5FP5A 1K3AA 2B9HA 4MYGA 1PMEA 5K5NA 1V0PA 3HUBA 5HG8A 5AA9A 1JKKA 1SMHA 2WB8A 4RQKA 3CGFA 3ZZEA 4IFCA 3SW7A 4JRNA 2OJ9A 4HVSA 2PUNA 4EH2A 1ND4A 2QR7A 3QCSA 1W82A 2R4BA 1Q5KA 3G9LX 3LPBA 2JITA 1YDSE 3BU3A 3OY1A 3C0IA 4ANNA 4DITA 2G2HA 2R3LA 5HG5A 4G2FA 3ZSGA 4GVJA 4KBKA 4XEYA 3BQRA 4EK5A 4K77A 2EXMA 4PPAA 2A1AB 4NZWB 4AZFA 3WYYA 3UNZA 3R22A 2OG8A 4FIHA 5M51A 3GFEA 1GZOA 3BGQA 2QKWB 3E8DA 5HCXA 3W2PA 4M69B 4AT5A 4GV1A 3ZONA 4LL5A 3NAYA 4ASDA 3RM7A 4XG9A 4HPUE 4E4NA 2Z7LA 1R1WA 2C1AA 5LVMA 3IG7A 5BVFA 5C26A 4WSYA 2P2HA 3RCJA 5CAQA 5HG9A 3MN3A 5ETFA 3Q4ZA 4I21A 3V6RA 3NYVA 3CCNA 4QNAA 2ZDUA 3T9IA 5ANGA 5A9UA 1YXTA 3L1SA 3SKCA 1M2RA 3OOMA 4X2NA 4BDGA 3RGFA 4AA5A 4ENXA 4PDYA 3PSCA 2FUMA 3OOGA 3HMOA 3MB7A 1Q8ZA 3T8OA 5M08A 3QU0A 2CLXA 2XIXA 1CKJA 3QTRA 3LJ1A 4NJ3A 5A54A 2GMXA 3D94A 4JR3A 3Q32A 5DRDA 2OF4A 3UIMA 3DK3A 2ZB1A 4AN3A 4DG3E 4HCVA 4I1ZA 3TM0A 5CF8A 2GS6A 4G3DA 3L8PA 2R2PA 4LFIA 4ANMA 2YCQA 4EH4A 3C1XA 2OXXA 4MEDA 2Y0AA 3ID6C 2QOFA 2RG6A 4C62A 4FVRA 3UDBA 2P2IA 3UVPA 1Z5MA 5L2WA 5C4LA 1OZ1A 5L6WL 4QQTA 2XEZA 3UVRA 3LQ3A 4M13A 2OZOA 3BYUA 3V8WA 4OT5A 5DEYA 3EKKA 4O27B 4BCOA 4ZMFA 5HO6A 2ITZA 3FQHA 3UC4A 3VO3A 2AC5A 5AUZA 5IA1A 2X8IA 3CQEA 4FV3A 2PWLA 1ZLTA 2W5HA 4KSPA 3ZH8A 3TKHA 2C6EA 1XH8A 3E7VA 4AE6A 2F7XE 4DH8A 4K18A 4O6EA 4YJNA 2YM5A 4BBEA 3SHEA 4APCA 5BVKA 2RFSA 4WNOA 4BGHA 4O82A 3DK6A 2OU7A 2X1NA 3VUHA 3CPBA 4AF3A 4YU2A 3U4WA 2YABA 4E6AA 5DYJA 2EWAA 3GCUA 5H8BA 2FGIA 1BI7A 2OFVA 2QU5A 2C47A 2GNHA 5FD2A 4Z3VA 1FMKA 4BIDA 5ETIA 4D2VA 4GG5A 5KMKA 5KX8A 4EQMA 4G3CA 4ZMEA 3EQIA 5L2QA 4RA5A 4BB4A 4MBJA 4D1SA 4LQMA 3BI6A 4FSWA 4AGCA 1W84A 2BRHA 4JBPA 1W83A 3C4XA 3FLSA 3QTQA 4XJ0A 2JAMA 2CGWA 4Q9SA 4PL5A 5CSXA 5AV2A 3NAXA 2XIYA 3FE3A 2JKOA 4GKHA 4DFZE 5L2IA 3NSZA 3P79A 2XK7A 3O71A 3IW4A 2BAQA 3H9RA 4IX4A 2W5BA 4CV9A 4D4YA 3QCYA 2XA4A 3BYMA 4HCTA 4IAAA 4LM5A 3VS7A 1V1KA 2AUHA 2BAJA 2WQMA 2IVTA 3WZJA 4YZNA 2W1GA 3A4OX 5J7HA 4O0SA 2XKCA 3Q53A 5K0KA 2JDSA 5AP2A 3BGZA 5GJGA 3P9JA 2OIQA 2PVLA 3QUPA 4WOVA 5AEPA 4ZLYA 3C4FA 4ZZNA 4DG0E 4O21A 3VNTA 2HK5A 5BVNA 2WOUA 2ITQA 3PXFA 4E7WA 2R3JA 3G51A 3NUXA 4MTAA 3S00A 1YOLA 3HA6A 3SG8A 2WTKC 5HBHA 1ZYCA 4X0MA 2X6EA 1OIYA 3JY9A 4CKJA 1YXVA 4TXCA 4CG9A 2WELA 3F3VA 3KY2A 3KC3A 2WNTA 1NVQA 4O7RA 2VNYA 1Q4LA 2C30A 3EFWA 4M67A 2X4FA 5GZAA 3BBTB 1JSUA 1Q3DA 2VWXA 3D0EA 4FNXA 4XOYA 5A4EA 4ACDA 4WO5A 1NVSA 3KVXA 2HY81 3R8UA 2BZHB 1V0BA 2R3GA 5AIKA 2FB8A 5FUTA 3BKBA 3PA4A 4PF4A 1UA2A 4E3CA 4YR8A 1JKTA 3PXRA 5DR6A 4ZY5A 2XF0A 4BBFA 4DFYA 5BUJA 3A7JA 2IO6A 3PA5A 1TKIA 4ITJA 1U54A 4QTDA 1UU8A 3RK9A 1H24A 5E8VA 3O96A 3EOCA 3VUTA 4ANSA 2YCFA 4QMPA 4TWCA 5IQDA 5DT4A 3ZLYA 4MNEB 3NRMA 3AC3A 3H9OA 4K11A 4FZ6A 2CN8A 3DDQA 3PVGA 1APME 1ZXEA 1RE8A 3PPKA 4A9RA 5CAOA 4YSJA 3PXQA 4RQVA 3BHTA 3E64A 3PJCA 2GTNA 3PTGA 5D11A 3KXZA 4IJPA 3ZLXA 5DH3A 3UC3A 3QA0A 3F5UA 3ZEWA 1OBDA 4D0XA 4PMSA 5A4LA 3FMEA 3HRFA 2OH4A 1CDKA 3DJ7A 3PVUA 5KMOA 1J91A 3BPRA 5IDPA 1IA9A 2WMQA 3GT8A 3SDJA 4BTMA 4GIIA 3G2FA 4YJTA 2V55A 2BDJA 4FT3A 4AOIA 3HMMA 1BKXA 3OT3A 5CVGA 2UVXA 5EQEA 4ZSGA 1GAGA 5BUEA 4I5HA 2CSNA 1YKRA 4BDBA 3BV3A 3GU5A 4GFMA 4OUCA 4FV9A 5CU6A 5EW8A 4BVUA 4LUEA 5AADA 4FTLA 4UEUA 5L2TA 3ORIA 4BTFA 4LV8A 1PXIA 3QFVA 4DA5A 5FEQA 5LWNA 2WTIA 4E4XA 2WZJA 5AUXA 2HCKA 3M2WA 4P5QA 1R0PA 4A7CA 1M7NA 5KMNA 1KE5A 3FKNA 2IZRA 3EN4A 3NW7A 4KA3A 4QNYA 3FZSA 4U81A 5H8GA 4CLIA 2WMUA 3TCPA 3CJGA 4H1MA 2W1DA 3AC1A 3I81A 4IH8A 2XUUA 3TG1A 3RNIA 4OAUC 1GOLA 1JOWB 4K33A 1XH6A 5B2KA 3BHYA 5LCJA 2GNFA 4YZBA 4L00A 4BFMA 5KKRC 5AP5A 3QQGA 2YACA 4LL0A 4MXXA 2B55A 3ODZX 3UE4A 2VTSA 5H9BA 2C6KA 3KRLA 2ZOQA 5DBXA 4AG8A 3Q4CA 5EQPA 4FKJA 3UYTA 4R7HA 3ZBFA 2Y4IC 2JDOA 4WHZA 3SX9A 1GIIA 5J1WA 5IQHA 5EM5A 4WG3A 3WE8A 3U4UA 4RX5A 2WHBA 3E8EA 3F7ZA 3HYHA 1P14A 2R64A 4I23A 2HW6A 4JXFA 4TNDA 2YIXA 4FKWA 1G8SA 4UALA 3TEIA 1GY3A 4CTBA 4RGJA 3CE3A 4LRKA 2Y9QA 4FIJA 4OTQA 2UZLA 3G6HA 5J5TA 4EH5A 3GCPA 5BYLA 1ZARA 1R0EA 4NFMA 4I0RA 2PSQA 4YBKA 3NMUF 4UV0A 2W1CA 3FAAA 4ACGA 3DB6A 3OEZA 1QPDA 4RIYA 4FL2A 3M11A 4F64A 3AMBA 3NEWA 1WBVA 2C0IA 4XRJA 3V5LA 4EC9A 3V3VA 3MI9A 4U0IA 2BHEA 5HBEA 3NYXA 1ZY5A 3FC2A 4PTCA 4USFA 5AUTA 4U5JA 3KCFA 2XNEA 1F3MC 3QUDA 1UNHA 4JOAA 4CXAA 3N51A 2W99B 2ZDTA 4TTHB 5ICPA 1OIRA 3TDVA 3R6XA 4QP8A 2Y6OA 1MRVA 2PVRA 3C9WA 3GC0A 4QMTA 4BCHA 5I3RA 3SGCA 4YPSA 3W55A 3THBA 3DBQA 4RVMA 3UOKA 2VWWA 1OKZA 2BZIB 4U44A 4YJVA 3RK7A 4E1ZA 3NUNA 4YZCA 3Q2MA 1G5SA 1IAJA 3S1HA 1ERKA 3A8XA 5L8LA 4WG4A 5KZIA 4R77A 5ITAA 4IWDA 1BX6A 3IECA 4QPSA 4RSSA 4EUUA 5CALA 2Y6MA 3C4WA 3D83A 2Y4PA 5J7BA 5JSMA 3G9NA 3SRVB 1KUTA 4HGTA 3O23A 3OXIA 3BZ3A 4L45A 4GSBA 5AR4A 3W8LA 5M44A 4DTBA 3DNEA 5EW3A 2B9IA 4UX9A 4UN0C 3LCOA 2PZ5A 3P1AA 2WQBA 3AG9A 2VTIA 3CJFA 3GU4A 4O0VA 4C33A 3R02A 4Y8DA 3G5DA 4ZZOA 5A6OA 2IG7A 2JIIA 3AT2A 5BVOA 3F2RA 4H05A 4YJUA 3PJ8A 4IB0A 4AACA 3VULA 1MUOA 5K5XA 4O0TA 1WBOA 3DNDA 3FMDA 5B2MA 3ZSHA 4F7LA 3FLYA 4QOXA 1ZMUA 4TYHB 2BPMA 3PWDA 1KE9A 5F1ZA 5EYCA 5AAFA 3ULIA 3WF6A 3O2MA 4YJSA 4C57A 2YJSA 2ZYBA 3EZRA 4EYMA 4JVGA 5ETAA 5D7VA 3LAUA 4KBAA 4CT2A 2Z7RA 5CF4A 3BRBA 3KXGA 4FGRA 3E63A 3ORXA 3OZ6A 4AUAA 2QOCA 1JSTA 1RW8A 1ZWSA 3RTPA 4A9TA 4C4HA 3GC7A 4CGAA 2W1HA 2WIHA 2X7OA 4C7TA 5KHWA 4LOQA 4BCQA 4I6BA 4YNOA 2UW0A 3QZIA 4Q5EA 3G33A 4TWOA 1YHWA 4NK9A 3PZEA 2ETKA 2UVYA 3G0EA 5JZNA 1O9UA 4EI4A 4NM0A 4LRJA 3ZC6A 1W98A 3QQLA 1UWHA 3OCSA 4Z9LA 1URCA 4C3PA 3HAVA 1FPUA 4WRSA 4EOMA 3Q4TA 2W1ZA 3Q6UA 3CTHA 4I5PA 1PXMA 5HGIA 5BVEA 5CENA 2PL0A 2PTKA 5ACKA 1CM8A 2WFYA 4IX5A 3ENHA 4MWIA 1FINA 2IZUA 5EQYA 2BROA 1P2AA 1ZRZA 2XEYA 3DAJA 4IM2A 4NJDA 3ZRLA 3BHVA 4IVBA 3MDYA 4FICA 4UB7A 4ENYA 3R8MA 4FIIA 3ORTA 2G15A 1PXPA 4GT3A 4YLKA 5CYIA 3IW5A 4H3BA 4EQUA 2QCSA 3DV3A 4FZ7A 5IEXA 3QTWA 4MXCA 2NNWB 5LMAA 5LJJA 3QX4A 2WEIA 5DEWA 2VTPA 2OZAA 3B8RA 2O63A 3FQEA 2BDFA 2WQEA 4I3ZA 4KRCA 1OITA 4TNBA 5EI8A 5J79A 2X7FA 4RLLA 4U3ZA 4JG8A 3MVJA 3F3TA 5DT3A 5HX8A 2ZB0A 1LEWA 5I4NA 3DTCA 2PK9A 3IS5A 3V5PA 3HAMA 2XMYA 3U6HA 1LPUA 2ZM1A 4YZMA 3HX4A 5T6KA 2VUWA 3QKKA 1OPJA 3PSBA 2XM9A 1GZKA 4PWNA 5ANJA 2IW8A 1J7IA 1CMKE 1CKIA 2YZAA 4YC6A 4PMPA 4BCIA 2OH0E 5DE2A 4DEGA 2I6LA 3KCKA 4DEAA 4EC8A 3KRXA 4DH5A 3H30A 4EOPA 3QGWA 4EZ7A 5HICA 4NIFA 3MIAA 5FP6A 3EB0A 4R1YA 5FBOA 2UW8A 3BEGA 4H36A 4GCJA 4ALUA 2PVFA 2IW9A 3P0MA 4K8AA 3UYSA 3EJ1A 3LFCA 4G3GA 3A7IA 3OROA 4YHJA 4B7TA 3UBDA 5L6OA 4EOKA 3MVMA 4FTNA 4D5HA 3IOKA 3OP5A 3FEGA 5AV3A 4RT7A 1ZAOA 5L4QA 4O86A 2PVHA 3HV5A 3QYZA 5HU3A 3OHTA 4HVIA 4DF3A 3ZCLA 4DC2A 4P4CA 1YVJA 3LCSA 4TW9A 4DBNA 4AT3A 4BCKA 5EYDA 4TPTA 2JKKA 1VYZA 4FG9A 1L3RE 2QD9A 5E8XA 4AP7A 3W10A 3RHXA 3SLSA 4U8ZA 4ALVA 3FPMA 4GS6A 2O8YA 5IUHA 3FL5A 2ZV7A 2YAKA 1BL7A 4WNPA 3GI3A 3PJ1A 4QTAA 4CD0A 4UWBA 3VJOA 1NA7A 2EU9A 5AR5A 4FF8A 4OTHA 2OJJA 4WKQA 3A8WA 1H1SA 5IMXA 3KN5A 3U54A 4TYEA 4GVAA 4BCFA 4R8QA 5HOAA 2BFYA 2I0EA 5HI2A 3VS2A 4CTCA 3QWKA 4JLCA 3NCGA 1KE7A 3JUHA 4R1VA 3L9PA 3LCDA 2A4LA 4M0YA 4YPDA 5BYYA 3A4PA 4UWCA 5T3QA 3EQRA 5AAEA 4C4EA 4JBOA 4BDDA 3TL8A 4FG8A 1YWVA 4U45A 5KMMA 3P5KA 4DGNA 4M84A 3NCZA 4GT5A 4BYIA 5B7VA 3MW1A 3CY2A 4EHGA 4NM5A 4JI9A 3GENA 3QYWA 4TYJA 3NUYA 4W9XA 2CHLA 3BYSA 5LQFA 1XH4A 4FKUA 5HIEA 3CEKA 3D2KA 5JGAA 4IAFA 3ZFXA 5HORA 3K3IA 2O2UA 5I0BA 2XB7A 3PDTA 5CWZA 5A46A 4L52A 5LXMA 3DJ5A 4FL3A 4ORKA 1OKWA 4OGRA 4OTRA 2UZNA 3PRIA 2R3IA 4QMSA 3VQUA 2WU6A 3ALOA 4FK6A 3VAPA 1YXUA 3CTQA 3KULB 3RPYA 3BHUA 3FXWA 3KN6A 1HCKA 1Q99A 2J0IA 2X6DA 3CXWA 2O65A 3OFMA 4RC2A 4EKLA 4FNWA 2GDOA 3R0TA 3TZ8A 5IH4A 2CCHA 4L3LA 4BKJA 2QONA 4AE9A 4BC6A 5JGBA 2HWOA 4XUFA 4DEEA 3HECA 2ZVAA 5HKMA 4ARKA 3COKA 3GFWA 3OEFX 4G6LA 3QQKA 5GIPE 3FWQA 2VTHA 4C4FA 4KKGA 3KXMA 3Q5ZA 4X3FB 5CNOA 2ZM3A 2GSFA 2WQNA 4YHFA 2RG5A 3A7HA 3W16A 5EHOA 5JEBA 2C6OA 4LOOA 3DBFA 3CQUA 4G9CA 2UW9A 4F9WA 1U46A 2VZ6A 5CT7A 2R0IA 2BVAA 4XP2A 4TKSA 2OGVA 2WOTA 4CZTA 5AR8A 3VVHA 4DFNA 3PRFA 4J7BA 4RVTA 5C8NA 3GVUA 3DS6A 3ULZA 2JFMA 5AV4A 4IB1A 3MSSA 3K5UA 5GJDA 1H0VA 4EL9A 3UG1A 3ET7A 1VJYA 3RINA 4YJPA 1YDTE 3EKNA 3QX2A 4EUTA 4MH7A 2X0GA 4A4LA
chains in the Genus database with same CATH superfamily
4I4FA 1M2QA 2QOIA 4X3JA 2UZEA 4IAYA 2J9MA 4DFLA 4ZLOA 2PZRA 3ZRMA 4QMMA 3V5JA 3PFYA 3VF8A 2IF8A 3ZMMA 2YWVA 2R3QA 3R63A 4QP4A 4W4YA 3DK7A 3UQFA 4HGLA 2XAMA 4GYGA 3ZLSA 3RMFA 5IQGA 2C69A 3UIUA 4YZDA 1UVRA 3NX8A 4TZRA 4BWXA 2UW4A 3O51A 2CGXA 3IONA 3LFFA 4ALWA 4MBLA 2IN6A 2WEVA 4QTCA 4RJ6A 5FQDC 3QGYA 4BCJA 4C59A 4NUSA 1XQZA 1J1CA 2XK3A 5AUVA 2V7AA 1QPCA 2C68A 3F2NA 4FV1A 4CLJA 2CLQA 4M7IA 2WMVA 3A7GA 1Y8YA 3A60A 1YWRA 2WMWA 3FZRA 4W9WA 2HW7A 2NO3A 4FI1A 4RWLA 2C1BA 4NTTA 4JAIA 3V8SA 3N4UA 2XZSA 3UQCA 4O96A 2GNLA 5LMKC 2VTLA 5CASA 3I5NA 3BYOA 3MY5A 4FV7A 4IMYA 4LGGA 5E92A 3VRZA 3ZXZA 3VUKA 4RIXA 2PYWA 4A4OA 3H0ZA 3D7TB 2IEWA 5EKOA 1PKDA 4XV2A 2VTNA 5JFXA 3FHRA 5JQ8A 4PP9A 4CMUA 3KIOC 3ZYAA 3W0MA 4JAJA 5EDPA 4MWHA 4GJ3A 1NT2A 4CRSA 3E8NA 3LLAA 4CFWA 2BRBA 1UNGA 4D2RA 5LMBA 4L7FA 4KB8A 3JS2A 3LFNA 4FTAA 4R5YA 3U8WA 4CQGA 4S34A 3LM5A 4WSQA 1PYXA 2JD5A 3FHIA 3V01A 4IWQA 4MK0A 2UZOA 3UJGA 4J1RA 4R6VA 5JRQA 3DLZA 3E8CA 4EOSA 4LYNA 5EDQA 4Y46A 2BRMA 4O6LA 5DWRA 3NIEA 4PPCA 1KV1A 2OFUA 2PE0A 3FMJA 3LFQA 4NKSA 3NLBA 5HNGA 5C8MA 1G3NA 1R3CA 1KWPA 2QKRA 2WMSA 4PDOA 3P86A 5CSHA 5IUIA 4F1OA 4YJOA 1MQBA 3SA0A 4X6QC 4NH1A 1PXLA 4PDPA 1B38A 4RIWA 5BMMA 2YWPA 5JQ5A 3AQVA 1XBBA 2YM4A 2R0UA 3AD4A 4ZSAA 5JK3A 4J8NA 3PLSA 4NYEA 2YCRA 3HMNA 4F99A 3LFEA 1PYEA 4HVGA 1KV2A 5CSVA 4MVFA 2VNWA 2O3PA 4DHZA 1L8TA 2P3GX 3K2LA 4M0ZA 4QYGA 3GQIA 4IXPA 4WA9A 1YW2A 2CJMA 3ZSIA 4J96A 4S2ZA 3V8TA 2ITWA 4AZWA 5DRBA 3W0NA 4RVKA 4DDIA 4ZP5A 4QMNA 2YIYA 3MFSA 2ERKA 3Q3BA 5KCVA 2A2AA 4QP6A 3UDZA 2W1FA 3R00A 2RFDA 5IQCA 4EH9A 4GMYA 3DZQA 3UOLA 1OECA 1PMNA 2IVSA 4PX6A 3R8LA 3NUSA 1XMMA 3NDMA 2WMBA 3ZS5A 1Q3WA 1K2PA 3CKXA 2FA2A 2REIA 4FNYA 5LWMA 3R9RA 3B2WA 3LFBA 2HXLA 2WMXA 4FODA 3TI1A 3QF9A 2ITUA 2J7TA 2R3HA 5EW9A 3SXFA 4CKRA 3MPMA 4E4MA 2PPQA 3I0QA 4IM0A 4FV0A 5E1SA 4IVDA 4QMQA 1AQ1A 2R3FA 2XK8A 5DG5A 3C13A 2BDWA 2H6DA 2VX3A 5GHVA 4D4RA 3ZFYA 2GFSA 4Z16A 3PY1A 5CX9A 3H9FA 4AA4A 4J53A 4RLKA 3FY0A 3BELA 3HV7A 3E93A 3QKMA 4YZ9A 4O0WA 4JIAA 2E2BA 4BTKA 4H39A 4U9AA 3VBQA 5A4TA 2HZ4A 4IWPA 4BL1A 2OJIA 3CPCA 2CKPA 2CNVA 2QQ7A 4L3JA 2UW7A 3AC8A 4IE9A 1H07A 1ZMWA 4IZ7A 2YITA 3VBWA 3C0GA 4BIEA 3VN9A 2ZM4A 4PY1A 3GCVA 1H4LA 3KXXA 3W2SA 4AWIA 3OWKA 2JDRA 4IC7A 2W4JA 3RAKA 5K0XA 3LMHA 5CEQA 2ERZE 3BHHA 2PMIA 5JFWA 1FMOE 2OK1A 4F63A 3I4BA 3ZUTA 2XK4A 1MQ4A 1Q97A 3UMXA 3EH9A 3F69A 3MJ1A 4YTHA 4FJVA 4O84A 1FGIA 4NFNA 2I7QA 2YEXA 4F6UA 5FWKK 2C5XA 3TIYA 4FSRA 4O7SA 2JBPA 3QD4A 4FSNA 4TN6A 4F6WA 1P5EA 4BDFA 4XG6A 4ACHA 4OTPA 4EQCA 4L53A 1PY5A 3UG2A 4QQJA 3OXTA 4GUEA 2DQ7X 3G6GA 4EH7A 5JH6A 3BL7A 2X7GA 2C3KA 3TXOA 4UBAA 4FTJA 3GGFA 3I7BA 2UVZA 3F2AA 4QQ5A 3PXYA 4XG2A 5IQFA 5LVOA 4LMUA 3TWJA 2JIVA 4KIKB 4J8MA 3EN7A 3OTUA 4LV5A 3LCKA 3EFKA 3KMMA 4I6HA 4JDIA 4TL0A 2B1PA 3TTIA 4PV0A 1ATPE 4GW8A 4K2RA 3UQGA 3WIKA 4FV5A 3L8XA 3LE6A 3MTFA 2WTKB 2VTOA 3MH1A 3IGGA 2XJ0A 4AA0A 5E8ZA 4FYOA 2F7EE 3EN6A 3SC1A 2BHHA 4M8TA 4AXFA 2OJGA 3R8PA 5M4CA 4DTAA 3OWLA 3M1SA 4RVLA 3UDSA 4C35A 5HD7A 4R7IA 2RFNA 1W8CA 3ETAA 5CEIA 3Q2JA 1V0OA 5IPJA 3OBGA 2BFXA 3UNJA 3U6IA 4ZSLA 3VS0A 4ZTSA 2PUPA 3I7CA 3NGAA 3S4QA 3LFAA 3V5TA 5HIBA 3FC1X 3LFSA 4ZAUA 3G90X 2O64A 3U87A 2YIWA 5CEMA 2IZSA 3EQGA 3KQ7A 4X7QA 3ZUUA 1PRYA 4JMQA 1Y6AA 3TNIA 3OG7A 3FI2A 3LLTA 1OKYA 4F6SA 4R7BA 1WVWA 5CANA 4N6ZA 4G6OA 2VN9A 3S0OA 2DUVA 2PHKA 3EN5A 3FKOA 3FZ1A 3H3CA 3E5AA 4KAOA 4L67A 2YM7A 4QRCA 4ZTNA 4QTBA 4D55A 3DOGA 4KINA 1OUKA 4LUDA 4RX7A 1PXJA 2VO0A 2X9FA 4Y85A 3BQCA 5TKDA 1ZYLA 3OS3A 1OIUA 2WMTA 3PYYA 3IPHA 3PUFC 4K1BA 4P90A 3SOAA 3MFRA 2QOQA 4HJOA 4CQEA 3ORKA 1WMKA 4CZUA 2XYNA 5CVFA 1KOBA 2X2KA 1KE6A 2YM3A 3F6XA 1DAYA 3F5GA 3Q52A 2PUUA 5M53A 3D7ZA 5ANOA 4ZXTA 2XKFA 3CGOA 2XJ1A 4FEVA 1H0WA 1R78A 1H26A 4JDKA 3QCQA 3R04A 1RQQA 2EB2A 3OUNB 4L44A 4RJ4A 4XV1A 5B0XA 4DYMA 2W1EA 4EHEA 4USEA 2C5VA 3TUCA 4YSMA 5HVKA 3NNVA 3JR1A 1DM2A 3F3ZA 3SRVA 3RP9A 2YN8A 3E87A 1YI3A 4OTGA 1SVEA 3UOHA 2HENA 3E3PA 3I79A 2ZV2A 3QD0A 4I0TA 2FVDA 4FEQA 1OPKA 4E4LA 3OWPA 3ZDUA 4N57A 5DMZA 5FXRA 1U5RA 4KWPA 4HNFA 3JXWA 1A06A 3KVWA 2ZV8A 2XVDA 3FL4A 3SAYA 4D28A 5K4JA 4BIBA 3CQWA 4Y5QA 4BI0A 1VYWA 4FKGA 4E93A 4PPBA 1OVEA 3GC9A 2H96A 4I94A 4G5JA 4IACA 4D0WA 4XLVA 1OMWA 1SVGA 5CEKA 1FVRA 3MV5A 4FMQA 5LCKA 3EMGA 3DFAA 4I24A 2CKOA 4FC0A 3ZXTA 3ZOSA 4EK6A 4DEDA 4EOJA 2VGOA 2WXVA 4A9UA 4EORA 4FZDB 4DFUA 1H28A 5A4QA 5M4IA 4B99A 5LVLA 3R7OA 2Y4IB 5HTBA 3C50A 5BYZA 4WUNA 4X2GA 1M2PA 1FGKA 2ZV9A 2OICA 5HESA 4EOOA 5B2LA 1PMUA 1YOMA 2QLQA 3HP5A 2A0CX 5CQWA 4LRMA 1YDRE 2XS0A 2YM8A 1SZMA 5J95A 1GIHA 3QL8A 5HZNA 3FZTA 3LQ5A 5CZHA 3BEAA 4DCEA 2BILB 5HLWA 3GB2A 2OBJA 5AP1A 2XH5A 5F94A 4WT6A 3TZ9A 4AXDA 3QXPA 2HAKA 2H34A 4L68A 4QMVA 4UZHA 1I44A 5CAUA 2BUJA 2C6LA 4BDAA 1JBPE 3VJNA 5IA3A 2F57A 4LMNA 4W4WA 2OKRA 5J1VA 4FKRA 4CV8A 3W0SA 4ANQA 4ID7A 5JKGA 2V0DA 3R7GA 4HYUA 2G2FA 2PVNA 4DINA 2YCSA 2JKMA 3AMYA 4N0SA 3WF7A 4RC3A 3FMMA 3NUUA 1ZOGA 2EB3A 4APPA 1YXSA 2YLFA 3IDBA 3QRTA 2LAVA 3UP2A 3LQ8A 4R3PA 4RFZA 3R30A 4AFJA 3BLRA 4AXCA 4BCNA 2YISA 2BRGA 4DFBA 3EHAA 1H8FA 2G9XA 4IVCA 4MQ1A 5D7AA 4AW5A 4U41A 3R83A 4UMPA 4EWQA 5CAPA 5FM3A 2GHMA 2GHLA 2EXCX 4N70A 3C5UA 4TY1A 2DS1A 3NUAA 4DLJA 1XKKA 2HOGA 4DT9A 4DCAA 4FOCA 2IJMA 3PP0A 4DGMA 4O2PA 3FXZA 4U40A 4DT8A 2CNQA 3DTWA 3NFGB 1XWSA 3QTZA 5AIRA 4RG0A 2JKQA 2YHVA 3CIKA 2X8DA 4E6CA 1HCLA 4J98A 4BDJA 3LOKA 4CMOA 5GJFA 3PPJA 4XBRA 4O0YA 2OO8X 4YP8A 5L3AA 5CU0A 3HV4A 2RSVA 3DBCA 4BWPA 5GZ8A 1KOAA 3QTSA 2YJRA 2CNUA 3RNYA 2CPKE 3DBDA 3VBYA 4OAVB 4FSMA 3PY0A 2GQSA 3F66A 2X0PA 3FMNA 4C4GA 1G8KA 3FI3A 2XIZA 4E20A 3MS9A 4U97A 3VUIA 5IQEA 4D9TA 1W7HA 4GYIA 5K3YA 4HCUA 4D9UA 3UIXA 4NWMA 3QALE 5KBRA 2C0OA 4O7TA 4BI2A 3BL9A 1K9AA 1Q8TA 1VZOA 3OW3A 5EHLA 1PJKA 4IW0A 2OXYA 4V01A 1OIQA 2WGJA 2XIRA 5ANKA 3UP7A 4C2VA 3NNWA 4AXEA 2BAKA 3BBWA 5GIOE 3DAKA 3POZA 3R9NA 5E7RA 1YWNA 3K3JA 5CVHA 4IBMA 4E26A 1SVHA 4RWKA 4DHFA 4F70A 2I0YA 1T45A 5CLPA 4YHTA 4C37A 4WNMA 3MPAA 5AR7A 3DKCA 4IVAA 4ZLZA 4ERWA 1H25A 5L6PA 3TNHA 2R7IA 5C8KA 4UMQA 3K54A 2O0UA 2VTQA 2XNOA 4WIHA 3COHA 4QMUA 1P4FA 2YDIA 2XYUA 3AD6A 4O0XA 4DGGA 2R3OA 5BUIA 2QR8A 3UMWA 3BLQA 3CS9A 4FVPA 3ANRA 4C4IA 3ODYX 2BR1A 2ZFYA 2C6DA 4I93A 3HKOA 2JGZA 3VUGA 1UV5A 3EL8A 4MUQA 1JNKA 2DWBA 3WF5A 1BUHA 4ACMA 1ZYDA 4XNEA 5AMNA 2RFEA 5I9WA 4EHZA 4Y83A 2F9GA 2FYSA 3E92A 3A2CA 4QMLA 4KRDA 3ZM4A 3NUPA 5IA0A 4X6RA 3CSVA 2JDVA 3VW6A 3F5PA 4F78A 3II5A 3AOXA 2ETRA 5AM6A 5M57A 4AFEA 2WMAA 4DEHA 4BR3A 3PXKA 3KRRA 3UPXA 1KE8A 4MXOA 4FSUA 2IZTA 1IR3A 4DDGA 3KRJA 1Q62A 3Q4UA 2EXEA 4W8DA 3GP0A 2VWVA 4AT4A 3KA0A 3RAHA 3AGMA 4JQEA 3FKLA 4O4BB 5HCZA 3RPSA 3P7CA 4ZTLA 3UGCA 2ONLA 5CI7A 1SM2A 2BTRA 4F08A 4EWHA 5KNJA 4C0TA 1TZDA 1S9JA 3BE9A 3ELJA 4AXAA 4B9DA 2YIQA 3MA3A 4RIYB 2UZBA 4M14A 4O4CA 4PNIA 4X2KA 4QP9A 2QOKA 3FXXA 1URWA 2XBJA 1FVVA 3LMGA 4BF2A 3PFQA 4YMJA 2PMNX 5HVYA 2XK6A 3EFJA 3REPA 4FEWA 2QO2A 2PMLX 2P0CA 5TF9A 2RKUA 4R3CA 2BCJA 3I0OA 3QHRA 3QLFA 4DGOA 3F88A 4OTWA 4YLLA 3BU6A 2Z8CA 3C4ZA 4FTRA 5BVDA 4RZWA 4QYFA 1TFFA 4U80A 2UUEA 1ZYSA 2BMCA 4O1PA 2X8EA 2WTJA 4EOIA 3HEGA 4RZVA 4W8EA 1U4DA 1S9IA 1JQHA 1Z9XA 3Q9XA 2QO9A 5HTCA 5I9XA 4OBPA 4IZAA 1UU3A 4FOBA 3MYGA 5J9YA 4HGSA 3NNXA 3GU6A 3DT1A 3G0FA 3MVLA 4XX9A 3Q04A 4MKCA 3HDNA 2YERA 5HIDA 5H3QA 1LEZA 1WBPA 2QG5A 3UIBA 5EM7A 5FGKA 4O7ZA 4L9IA 3BWJA 2NPQA 5JT2A 3IDPA 1VEBA 3WZDA 5LMKA 4K0YA 3FI8A 2P33A 3ACJA 4HPTE 2ETMA 1MP8A 3TKUA 5E8YA 3RBWA 2VWZA 1H1RA 5CXZA 4I0SA 3CC6A 4FGBA 2R3NA 4XH6A 4YGAA 4YLJA 4AZSA 5LVNA 4XOZA 3BU5A 4C3RA 2ACXA 4II5A 1M17A 4C02A 3EQHA 5FXQA 4JRVA 1OB3A 1O6YA 3AKKA 3PP1A 1H08A 4EKKA 3QRJA 5EOBA 3R7EA 3RPOA 2XKEA 3V04A 3ORNA 3RAIA 3TTJA 5IZFA 2F4JA 3R71A 4G6NA 2HELA 3GCQA 4UY9A 3WZUA 5IH6A 3RKBA 4IB3A 3WF9A 4PL3A 2R7BA 3Q9YA 1TQIA 3BWFA 3QQUA 4GK3A 4OTFA 2J4ZA 2Z7QA 3QC4A 4IDVA 2X81A 3TV4A 1J3HA 1PF8A 3L9LA 3QA8A 5AM7A 4NL0A 4HOKA 4RC4A 1NY3A 4QYHA 5FTOA 3LMIA 1LR4A 2OXDA 2HY0A 3H10A 2OIBA 4QP7A 4BDHA 3LXLA 5D9HA 4O7NA 2VWIA 1PXNA 3HV6A 3ZO2A 5CZIA 4M66A 4BZNA 3D5UA 3I5ZA 3LJ0A 4C2WA 4FKIA 4XG4A 4EYJA 4HVDA 3G15A 4GKIA 2W05A 2XBAA 1JSVA 5EFQA 4E6QA 2GHGA 2ITPA 4MNFA 4NEUA 4EK3A 1WVXA 1YI4A 3OD6X 1STCE 3AMAA 2I40A 4E6DA 3QAME 3GXLA 3R7UA 4IM3A 1Q8UA 3ROYA 5KO1A 5HNIX 4FV8A 4QPAA 5C27A 2UW3A 4UXLA 5FEEA 5M4FA 4RJ3A 2R3KA 2C6IA 5L2SA 4HGEA 4TYGA 5E1EA 1OL6A 4BWKA 5EYKA 4G17A 1PXKA 4O0UA 4OW8A 4YO6A 4IHPA 1B6CB 2W7XA 2BALA 2OZAB 1YRPA 1WBTA 4YC3A 4KIQA 3HA8A 2W96B 1W0XC 4NW5A 2G01A 2X2MA 2GCDA 3NNUA 4N4SA 5HNBA 2BIYA 3EQPA 3LM0A 1XR1A 3ROCA 2GNIA 4LI5A 1YI6A 4JDJA 3BV2A 3EWHA 4M69A 4KS7A 4CG8A 2XARA 4BDCA 4BDKA 2VO7A 5EDRA 3ENMA 3DXNA 4UMTA 3FDNA 4QP1A 4TYIA 3DJ6A 3NW5A 3Q96A 3QQJA 4M68A 3RI1A 4J95A 5J9LA 3PJ3A 2ONLC 3QQFA 3QZFA 4RFMA 2NRYA 4MX9A 4FL1A 3MH2A 4X2JA 3QTIA 4DLIA 1VR2A 1J1BA 4OR5A 4FA2A 4FYNA 4GIHA 4I41A 4HZSA 4KSQA 4X3FC 3TMOA 4A4XA 4NIFB 4CZYB 2WQOA 3QTUA 3AC2A 3MJ2A 4FT5A 4GH2A 2WAJA 4ZTHA 5AUYA 3TKIA 3AD5A 4V0GB 5GINE 4RBLA 3ZHPC 3HGKA 4JNWA 3FYKX 1FOTA 2JC6A 1BL6A 4DAWA 3KL8A 1A48A 1PXOA 5AWMA 4PRJA 3TYKA 3A62A 2ITOA 4W4VA 3VWAA 1JPAA 4BRXA 5BPYA 4EK8A 3UNKA 3Q5IA 5HG7A 2YA9A 2ITTA 3O0GA 3MH3A 4DGLC 5FXSA 4HYSA 5AP7A 3VUDA 4IC8A 3UZPA 2VTRA 4GJ2A 3ZO4A 4FT0A 2XALA 1H01A 3R9OA 4AAAA 4DFXE 2C5YA 2VV9A 3QRKA 2Z60A 4GRBA 3PZHA 5FM2A 5D12A 1JWHA 3R1NA 3T9TA 4BTJA 1FQ1B 3SQQA 5HTIA 3U51A 4V05A 2VWYA 2XP2A 5GNKA 2B0QA 4I92A 2ESMA 4ZY4A 1OGUA 3IDCA 4QPMA 2KTYA 1H1QA 4IEBA 2XNPA 4AGDA 1IA8A 4ERKA 4M3QA 2CGUA 1QL6A 2BKZA 4WRGA 1BLXA 3ORPA 4PMTA 5AV0A 4FE2A 2UW6A 3P7AA 4UMUA 1OPLA 2WD1A 4RRVA 2XK9A 4X2FA 2C0TA 1W2DA 4C8BA 4IFGA 3DDPA 3D5VA 3EYHA 4U3YA 3RZFA 4AN9A 5L8KA 4BY9E 4QP3A 4YNEA 1WVYA 2AYPA 3CY3A 3EZVA 5DN3A 3MA6A 2PMOX 2PVJA 3IW8A 4ZTQA 4FK3A 3SW4A 5EM6A 2QNJA 1YHVA 5KHXA 3COIA 3CLYA 5BQ0A 5DOSA 5E8TA 4FKPA 4RJ5A 3QRIA 4XP3A 2UZWE 4J97A 2WTVA 3COMA 5GZ9A 4IAKA 3ATSA 4BI1A 3HMIA 2YM6A 2UZDA 5ACBC 5J8IA 3DGKA 3TUBA 4JR7A 1ZZLA 3L8SA 3OMVA 3EQBA 3FV8A 4CT1A 2XRUA 2PULA 3IQ7A 3MH0A 1ZMVA 5AV1A 4P2KA 5DR2A 3EL7A 3PXZA 3OXZA 3GQLA 1U59A 4RPVA 2FH9A 3DAEA 5FBNC 3QKLA 4E73A 2H8HA 2VTMA 2WTDA 1M14A 4F9BA 4CYJA 1WBSA 1UWJA 3W32A 4B4LA 2F7ZE 3KF4A 2UZVA 1DI8A 4OT6A 4WNKA 2XANA 3V5WA 3VS5A 1WFCA 2ITXA 2UZUE 3AXWA 4GK2A 4FIEA 4V04A 2B54A 2WTWA 4WBOA 4YTIA 3R1QA 4MF0A 2OI4X 4AZEA 3IW6A 5IEVA 4P5ZA 3PY3A 4W4XA 3DXQA 3TJDA 4ZSEA 4AN2A 1UKIA 3UODA 3R28A 5CEOA 4O81A 3S2PA 1ST4A 5KMJA 4AOJA 2Z02A 4BZOA 4AU8A 2ZMDA 5E9EA 3D14A 1XBCA 4MXZA 2IVUA 5HD4A 5IUGA 4RJ7A 5ANEA 3ZTXA 5IKWA 2GQGA 2XKDA 3QRUA 2B9FA 5E8WA 4ZY6A 1XBAA 3TNPC 2XRWA 4KBCA 4JQ7A 5AR3A 4KS8A 4MQ2A 4KIOA 2GS7A 4QT1A 5L8JA 4FEUA 4ANBA 2E9VA 3RCDA 5HLNA 1Y57A 3ACKA 3E62A 3HUCA 4IX3A 5JRSA 4EOQA 5IDNA 4FEXA 4GEOA 2C3LA 2JBOA 2X39A 2YAAA 3FMHA 5DIAA 1R39A 5JN2A 3TUDA 4MXAA 1Q24A 3FQSA 3HMPA 4I5MA 1WCCA 3P5JC 1QPJA 4MNEA 4QYYA 4RMZA 2W9ZB 3RWPA 3T3UA 3W2QA 4D4VA 3UPZA 4O7LA 1NXKA 3DCVA 4JL9A 1H1PA 1Z57A 4XYFA 2R3MA 4JG6A 5JFVA 4MBIA 3C5IA 5DVRA 4FUXA 3IW7A 4F9AA 5HEZA 4MF1A 3FMKA 4ASZA 1WBNA 2W5AA 4IZ5A 3NWWA 4PQNA 4WD5A 4AW1A 4LGHA 2QU6A 3TIZA 5IQIA 5E90A 3BIZA 3WOWA 3ORZA 1SNUA 5DI1A 2RGPA 4TWPA 4RA4A 2QOLA 4QMYA 4B0GA 4I20A 3MFUA 3VS6A 4EHVA 1GZ8A 2E9OA 4QD6A 2EVAA 3R1SA 3GU8A 4L8MA 4H3PA 2C4GA 5IU2A 5H2UA 3W0QA 1YHSA 3NVKI 3OW4A 2XNGA 3MVHA 4MD9E 5EI2A 1E9HA 4UZDA 2OSCA 1JVPP 2IWIA 3QZGA 3RAWA 3UOJA 2UZTA 2B53A 4Q9ZA 2FO0A 4RIXB 3H0YA 2F49A 5AR2A 4XV3A 3EN9A 5IA5A 5CF5A 3U6JA 4DE4A 5A3XA 2W4OA 2GFCA 3HL7A 4A06A 4D2WA 3UO4A 3O17A 3DKFA 2O5KA 4NM7A 3Q9ZA 3DU8A 4ITHA 4JBVA 4IJ9A 3RWQA 3EQCA 3ZBXA 5AUUA 5F9EA 3TACA 2OLCA 1IASA 2OIDA 4JS8A 1XH5A 5TOZA 4E5AX 2HZNA 2JLDA 4NCTA 3RM6A 3JPVA 2Q83A 1FBNA 1QMZA 2RF9A 3LZBA 5CEPA 5IA2A 4ZSJA 3MWUA 4O1OA 3ZO3A 2QVSE 3D4QA 3CD8A 4D1XA 1ZZ2A 3LHJA 1J7UA 4F09A 1YOJA 4OBQA 5D10A 3OY3A 4L42A 4Q5HA 5BNJA 3F3WA 2CKEA 4CFVA 3TNWA 4O4EA 3BE2A 1GIJA 5JMSA 1U5QA 3PLAE 4A07A 4RIWB 3W0RA 1DAWA 4HYIA 4H3QA 3TV6A 5K4IA 2PU8A 2CGVA 3EYGA 4CVAA 3BLHA 1CSNA 4RFYA 2W17A 2ZMCA 5IA4A 3PUPA 1OL1A 4O22A 4FKTA 1W2FA 3SV0A 3DFCB 1REKA 3FMLA 3TNQB 4BN1A 2QC6A 2ITYA 3GEQA 4E5BA 4AAYA 2CCIA 4Y5HA 3TZ7A 2E9PA 2JFLA 4G3FA 3FLNC 5E4HA 2RIOA 2HXQA 4R5SA 1OI9A 2W4KA 3WZEA 4UYNA 5EKNA 3R73A 4FV4A 4K9YA 3R8VA 3W8QA 3EQFA 4D5KA 4A9YA 3OWJA 2VO3A 2LGCA 3F61A 3W2CA 4AW2A 4F1MA 2FSOX 3AGLA 4B6LA 3P78A 4DH7A 1OM1A 4DH1A 2A19B 2VGPA 4XCUA 3WYXA 4C61A 3P08A 3PE1A 3VBTA 1XO2B 2CDZA 4I22A 1LP4A 5IQBA 4XG8A 5CSWA 5KMIA 1KSWA 4ZZMA 3WARA 5CI6A 2UW5A 5ANIA 2Y8OA 5DT0A 1Q8YA 5DPVA 3DXPA 4R78A 2PE2A 3UVQA 4FKVA 4ZTRA 4D58A 4F7NA 5CTPA 5HVJA 3ZRKA 1XMLA 3D5XA 3ANQA 4XV9A 4JQ8A 2QOBA 5HHWA 3WIGA 5AA8A 2E9UA 3MFTA 2NYAA 5AX3A 2HWPA 4I6QA 5EHYA 2XCKA 3QD2B 3R7IA 3DA6A 5HO7A 2GPHA 1Q61A 4ZJJA 4ANLA 3QXOA 4FBXA 5BMSA 4BDIA 4EEVA 3MESA 4FKSA 5K9IA 4GL9A 4CFNA 2WPAA 5CY3A 3R9DA 5CQUA 3WILA 4IWOA 3Q9WA 4Z7GA 2HIWA 2ITNA 4TYHA 1TVOA 3DKGA 4QQCA 5KKRB 4O7YA 5IEYA 4MAOA 4AZTA 1IAHA 3FLWA 3U55A 4B8MA 4BHNA 3E7OA 3SD0A 4FR4A 1B39A 3HZTA 1OBGA 3GU7A 3ALNA 3L8VA 3MPTA 2J5EA 3RPRA 3FLQA 4ZOGA 4NTSA 1Y8GA 2B7AA 3JVRA 3W1FA 4E8AA 3TT0A 4QTEA 5JZJA 1ZOHA 3F9NA 3O50A 4CKIA 3F5XA 4JX3A 2PZYA 5G1XA 5J9ZA 5FTQA 5C4KA 3PVBA 2XCHA 1UNLA 1GZNA 5AX9A 2WO6A 3RHKA 2CKQA 3K5VA 1NVRA 3FYJX 4EH8A 1T46A 3ORMA 1TQPA 4M15A 3SOCA 1WBWA 4FT9A 4A9SA 4LOPA 5HBJA 1H00A 4MHAA 3C51A 4QMWA 3ZZWA 3PIXA 2WMRA 5FRIA 3QD3A 5FEDA 4PP7A 3KEXA 1HOWA 4G5PA 3UO6A 4AS0A 2J0MB 1OL7A 4BCMA 2W06A 3KF7A 4KNBA 4P7EA 4ACCA 5F20A 4YTFA 3FI4A 2Q0BA 1DS5A 4BGGA 2VAGA 3WBLA 2XNMA 3UZTA 2C5NA 2PZPA 3OCBA 1WAKA 5BX0A 3VW8A 3I6UA 4S33A 5I3OA 3WZKA 2R3PA 4DHIB 4NKAA 2QODA 1MRUA 4TWNA 3T3VA 3WE4A 4GU6A 4KKHA 4HVHA 1QCFA 2QOHA 4JBQA 4JX7A 4F7JA 1CKPA 4FT7A 1O6LA 4NCTC 3I1AA 4L01A 4PMMA 4RJ8A 3R1YA 1RJBA 4CMTA 5IQAA 5A14A 2C6TA 2J2IB 3DPKA 4MD8E