5FXSA

Igfr-1r complex with a pyrimidine inhibitor.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
SYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRAIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEEPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
publication title Discovery of a Potent, Selective, Orally Bioavailable, and Efficacious Novel 2-(Pyrazol-4-ylamino)-pyrimidine Inhibitor of the Insulin-like Growth Factor-1 Receptor (IGF-1R).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fxsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fxsA01
2XVDA 4ZLYA 4M97A 4BTJA 4OTWA 5FD2A 4C4FA 5IZFA 4K18A 4M13A 2HY0A 2JAMA 3R1QA 4R3PA 5HBEA 4IX5A 4D5KA 3UQCA 3GENA 5BMMA 4FEXA 2O8YA 2UW0A 2VWYA 4QP9A 4GIHA 2OICA 3FY2A 3HRFA 4XG8A 3BQCA 5A4CA 4BDIA 3DQXA 4LUEA 5EOLA 5KO1A 2A19B 2C5YA 3UYTA 3HRCA 3LCSA 4GYGA 4C34A 4CFWA 4DFXE 3H10A 4O7YA 4X6QC 5FBNC 2QO9A 4QPSA 3CCNA 3HP2A 1WVXA 4FZ7A 4R7IA 1YOJA 4FV6A 2FA2A 5C26A 4WSQA 3V04A 3ZC5A 5C9CA 4EZ3A 3A62A 3LFSA 4DH5A 4S30A 2QG5A 4YSMA 1WBPA 4B4LA 5AIRA 3SRVB 2PZRA 2WMSA 4JBQA 4S33A 2BFYA 3OXZA 3BLHA 5HE3A 4PP9A 4BDAA 4PPAA 1H1PA 3UNJA 3VS2A 2ZM4A 3AC5A 4E5WA 2UVYA 3QQFA 4KSPA 5DEWA 3ZSIA 5AX3A 3BE2A 5ACKA 3F6XA 4RFYA 4UALA 5A6OA 2IN6A 3U54A 4AE9A 4B6LA 4F64A 5HORA 1JPAA 3VVHA 3FXWA 5M06A 2RFNA 1M52A 4X2JA 1OMWA 3ENHA 1WMKA 2J51A 3DK3A 1KOAA 4G2FA 2AUHA 3SDJA 5A4QA 2CLXA 4RSSA 2J5FA 3LE6A 1WBTA 1XO2B 2BVAA 4G3GA 5HLPA 3WI6A 1JLUE 1KOBA 2V0DA 2V55A 3KRRA 4YNEA 3OWLA 3FPMA 4JBOA 4ZTNA 3QUPA 5K4JA 2WZJA 5BVFA 5CWZA 4AG8A 3PJ2A 4C59A 1QPEA 1W0XC 1G8AA 3QXPA 4EC8A 2GQRA 5JMSA 3CS9A 3ZUVA 3OROA 3QTIA 5HEZA 3LFQA 3CQEA 3VW8A 4R3CA 4DCEA 4TWPA 4RIXA 3E8EA 5M51A 2WO6A 4FG8A 3FZOA 1YQJA 3V3VA 3QCXA 4EEVA 5FQDC 2PE1A 3MJ1A 3DAJA 4FTQA 2NRYA 4TXCA 5BVOA 5IA1A 3ZH8A 2OKRA 4FI1A 4MD9E 4A7CA 4YLLA 5HG8A 4L43A 2IZRA 1ZOGA 3VRZA 5KMLA 2OLCA 4O2ZA 3HV7A 2Z8CA 4WNOA 2HENA 3TNWA 4W9WA 3BWFA 4R7BA 4CFUA 3OVVA 3W2QA 1XR1A 2XJ2A 3KRLA 3NUYA 2R3HA 3A4OX 2WQMA 2YIWA 3JY0A 3NUUA 5DA3A 3WF8A 3OCBA 4RVTA 4YC6A 4C7TA 5JGAA 5JFSA 1J7UA 3CSVA 4GFGA 4U7ZA 1FGKA 3E62A 3IGGA 4JL9A 3ZSHA 4AW1A 3E3PA 5AR8A 3I60A 4FNYA 3BLRA 3BRBA 3AQVA 3BYUA 5F1ZA 1YRPA 5EFQA 2FSLX 4D2WA 4FE2A 4FUXA 4LRJA 4Q2AA 3MSSA 4D4SA 3GC9A 1O6LA 4KIKB 4EH7A 2W1HA 2Q0BA 2XIYA 5IF1A 4O7VA 1SYKA 3FQHA 4F9CA 5LMAA 4IBMA 3QZIA 4LM5A 4X2KA 5H2UA 5AR4A 2V22A 1YXXA 3IONA 4BICA 4E7WA 3AC1A 3KXMA 3O71A 3PY3A 4PTEA 3W8LA 2RSVA 4BF2A 2O3PA 2ERKA 5F4NA 2UZDA 4XG7A 5IQAA 4FKLA 3N51A 3EMGA 2CCHA 4RVMA 1ZARA 2GPHA 3VS3A 4ZTMA 3U9CA 3SXFA 5EK7A 3TDVA 4IFCA 3DJ7A 1U46A 2V62A 2OZOA 4HVHA 4YO4A 1KE7A 4X0MA 2Z7RA 4FTJA 4EOMA 4WRGA 1OB3A 4GMYA 1FVTA 1DAYA 4ACGA 3RALA 3QRUA 1PMUA 4QTBA 4TYJA 1QPJA 1KWPA 3E92A 2W5HA 2J0KA 2E2BA 2R3QA 4K1BA 2CGUA 5CVHA 2GHMA 2OJGA 3UVQA 5C8MA 5CS6A 3GC0A 2YLFA 4G3CA 4ALWA 3V5WA 3WYXA 4AGWA 4CT1A 5FTOA 5IEYA 3QLFA 1Y57A 4F0IA 4IJ9A 3RAIA 2FSOX 3FZPA 4FSQA 2YACA 5IEVA 4WNMA 4S2ZA 1UWHA 3UQGA 4FTLA 2REIA 5AP4A 4ZS0A 3HMNA 4C02A 2OFUA 3NNVA 3R21A 4XG2A 3HX4A 1UNHA 4BDBA 5CT0A 4OAVB 4MH7A 2XYNA 3P4KA 5CI7A 3BPRA 3NCGA 4EUUA 4NKSA 1I44A 4DFUA 3I5NA 1XH6A 4WUNA 4J8NA 4WO5A 4F6WA 3MTFA 3HMOA 1FMOE 3IW8A 2XUUA 2Y6OA 4R1YA 3BIZA 4B7TA 3KEXA 2H9VA 2BDJA 5AP7A 4ZSJA 1W7HA 3BV3A 1ZMVA 3F7WA 4FA2A 4L9IA 2XZSA 2VX1A 4XCUA 2EU9A 2WQBA 4EWHA 2BTSA 2ITTA 3NAYA 4BGQA 2UZEA 3R6XA 5E8UA 1TKIA 3ATSA 4NUSA 1QPDA 1H00A 2ZV8A 4FKQA 2QR8A 2NP8A 4ZJIA 1S9IA 2VO0A 2X9EA 5L2WA 5CYIA 2X9FA 4GL9A 3BYOA 2GS6A 4XLVA 1PYEA 4W8DA 4Z16A 2I0VA 5M56A 4O38A 4V01A 4EOLA 4LFIA 2VWZA 2XCKA 3W55A 2OJ9A 4PTGA 4RX7A 4ZMEA 2J0IA 4NM3A 4JLCA 3SD0A 4MHAA 1AD5A 2WQOA 4FTCA 3Q9XA 4O7LA 5CANA 1ZYDA 4FIJA 3RMFA 4DBNA 4YJTA 1SMHA 1OIRA 3SXRA 3AD4A 4DG2E 4A4XA 1E9HA 3ALOA 3SOAA 2F7XE 4IDTA 4JG8A 3UO6A 2PPQA 2OGVA 3MPAA 4AGCA 5L3AA 1IG1A 5CEPA 2B1PA 2XNMA 4AOTA 5KMIA 1OKWA 1Z5MA 3OW4A 5AA9A 3P79A 4OTIA 3FYKX 3QQHA 2V7OA 5AWMA 5HX8A 3IG7A 2PUUA 4WBBB 1YWVA 3E7OA 4CFVA 2G9XA 2W5AA 4E20A 4YURA 4IZ7A 1VEBA 4GW8A 1ZYCA 4DEHA 5KBRA 2WMRA 5IQDA 2A0CX 1MRVA 3LMIA 2R7BA 2Z7SA 5CZHA 4CEGA 3MA3A 1CMKE 4FKJA 4GUBA 3QQJA 4M66A 4CZUA 2CGWA 1UWJA 1FPUA 3GEQA 3PSCA 4YJSA 1FINA 3FZSA 5IH6A 4O0SA 2I0HA 4CVAA 2QKRA 4EOQA 4G5PA 4FZ6A 4DYMA 1ZY4A 2BRMA 3R8LA 5EYDA 3POZA 1SM2A 1BX6A 2FSMX 3CR0A 4GEOA 3F5XA 4H3QA 4RIYA 5EM8A 5CU0A 2YIQA 4LV5A 4ZJJA 5AADA 5KBQA 3K54A 2G1TA 3S2PA 5EYKA 4MXXA 4IAYA 4AZWA 3EWHA 4O22A 2HZ0A 4OGRA 2J50A 2ESMA 3HMPA 3MN3A 4X2FA 4ZSGA 2PU8A 2BAQA 4UMPA 3KXXA 2XNPA 3G90X 3FMDA 4HVGA 2C3IB 4FSRA 4E6DA 2WTKB 2C69A 2PVFA 1U4DA 4R77A 2PK9A 4GG5A 4IVCA 4LUDA 3ZRKA 3E3BX 2VRXA 4FOBA 3F7ZA 5HD4A 2Z02A 3FI8A 2AC5A 3BU3A 4J96A 5HESA 5IA0A 1GAGA 3LFNA 1YXSA 4DH3A 3Q04A 1BUHA 1W84A 4FKOA 2XIKA 5IDPA 3CQWA 4L53A 3EQRA 4LI5A 3K2LA 5CU3A 4A4OA 1UVRA 2C1BA 4GH2A 4DC2A 3TNIA 3TUBA 2PVNA 2R3MA 4YJPA 3PWDA 4O0TA 2QOFA 3HGKA 2PMIA 3RGFA 5ITAA 4ASEA 4K6ZA 3MIAA 3RHKA 4AGUA 4BVUA 3EQPA 4BI0A 4YJRA 2ZMDA 3F3VA 5AAFA 2F2CB 3EHAA 4U81A 3RJCA 3H9FA 2R9SA 3H9OA 4QQCA 3W2CA 4AAAA 4UWYA 4IM0A 3OUNB 4IVAA 3U4WA 4HZRA 4D1XA 4IB1A 3ZBFA 4YZ9A 4XBUA 5DH3A 4V05A 4CMUA 4MCVA 3BGZA 4FZAB 5FBOA 4ZZOA 2F7EE 2B9IA 4UBAA 4A9UA 2WMWA 3OOMA 3D0EA 3FMKA 4ALVA 4ENXA 5IUHA 3D2KA 2BCJA 4G9CA 1J7IA 3DPKA 4RG0A 2J90A 5E8SA 3VBVA 3ZDUA 4CT2A 2I0EA 3DFCB 4YLKA 3ZFXA 5C03A 4BCJA 2VD5A 5J1VA 4MD8E 4O0UA 5I9YA 4TWNA 1RW8A 1AGWA 3FPQA 1A9UA 4O83A 3PE2A 4PL3A 4DT9A 4LMNA 1BMKA 3MIYA 3PG1A 4AE6A 5JN2A 3BKBA 2VV9A 4LL5A 1SVEA 5FEEA 4Y46A 2UW6A 1NY3A 1BLXA 5DT3A 4OAUC 3DY7A 3DKCA 2OJJA 5E4HA 2B4SB 4WG4A 3MFSA 5LVMA 4RFMA 3KF7A 5LMKC 4ZP5A 3W2SA 5HNIX 2WMVA 1Q97A 2C5VA 3IDCA 3CE3A 5BVNA 3AOXA 3F3UA 1W8CA 2X1NA 3LCTA 1FMKA 3ODZX 5LWNA 3R7IA 3P1AA 3TEIA 2W9FB 3QZGA 4XHKB 5G6VA 3C5UA 3V01A 3UZRA 1H01A 1U59A 2PE2A 2WTVA 4OW8A 5CAUA 1WCCA 2XK4A 3EFKA 4BDEA 4UMUA 4NTSA 5L2QA 3TZ9A 2HYYA 1GIJA 4FKRA 3H30A 1OITA 4ACDA 1BKXA 4ZSEA 1IAJA 4DITA 3EQGA 5FXQA 1GZ8A 3OG7A 5TO8A 5CAVA 4X3FB 2YABA 4FTNA 3ZC6A 2VWXA 4HVSA 3TV4A 2ITPA 4FV1A 4DGLC 4EONA 5I9UA 1P4OA 1Q41A 3EKKA 3FMNA 3GGFA 4CLJA 5I3RA 1OECA 3PVWA 1PW2A 1P14A 2JIVA 3SLSA 3VUIA 5KMJA 3AT3A 3DJ6A 2YN8A 3HDMA 3KU2A 3G2FA 3QRJA 3WF5A 5L8JA 3D5WA 2XNOA 3A7IA 3KFAA 3TWJA 2R2PA 5F95A 2F2UA 5AIKA 2PZ5A 3COMA 3EFLA 4IXPA 4KWPA 5KKRB 4CV8A 5LARA 4M0YA 5BYZA 3L9MA 1PXMA 2GQGA 5M08A 2QR7A 1LEZA 1W82A 4YTCA 3EZVA 1XBCA 2F57A 3AGLA 4LGHA 4AFEA 4KNBA 4IWPA 3VF9A 3G15A 3HDNA 5HE2A 3ZO1A 4RX9A 2C6TA 3C4ZA 4Y85A 2DS1A 4H3PA 4W4XA 3OT8A 3KRJA 4QMXA 1WBOA 4BI2A 4J71A 4HJOA 2RG6A 3MWUA 4FYOA 4MYGA 3KMMA 5HU9A 5A46A 2ZDTA 5KMKA 4CKIA 4DLJA 2XYUA 3TUCA 3R01A 2FO0A 5HX6A 5KMMA 4UMRA 1KV1A 3UQFA 5TT7A 3F66A 4NL0A 5ICPA 1Q99A 5C1QB 5CENA 5IQBA 4BKZA 2YCQA 4KRCA 3W8QA 2PSQA 2W0JA 2XRUA 2QO7A 4KAOA 3SXSA 3P9JA 3RAKA 4DFYA 4QTAA 2SRCA 5HVKA 5I9WA 4GK4A 2HXQA 3IK3A 1K3AA 2HIWA 4UWBA 5C8NA 1OI9A 4FTRA 3H0ZA 3LMHA 5I3OA 4FX3A 3FV8A 3EQDA 4I3ZA 2XIZA 3CGFA 1EH4A 2Z7LA 3D15A 5CAPA 2C1AA 4BY9E 1CM8A 2BMCA 3P23A 4XP2A 2R5TA 3OT3A 4HNFA 3DXPA 2PUNA 5B7VA 4O0YA 5D7AA 5E8XA 4CFNA 5L6OA 2HXLA 4QMSA 2VWIA 4UY9A 5BQ0A 1TVOA 1Q8ZA 4F6SA 3DKOA 4HYUA 4RLLA 5AV0A 2UVZA 3RK9A 4ZLOA 4DTBA 3G9LX 3KQ7A 2GFSA 1S9JA 5M4CA 4JG7A 5LWMA 3AC8A 2W06A 3BEGA 2X4ZA 3R83A 4KABA 4IH8A 4R78A 3HV6A 3NUPA 4AU8A 3TTJA 4OTQA 3EYHA 4J98A 5DFPA 4QQTA 3SW4A 4DGOA 4GVAA 1FBNA 4I5MA 3MFRA 1GZNA 1CKJA 5E92A 3EN5A 4J99A 4WHZA 3COKA 4V0GA 3O23A 2CN5A 3NYOA 3BE9A 4FKIA 4C4JA 2YM5A 3GU5A 1Y6AA 4H36A 4YMJA 2I40A 3CD3A 4FV3A 3VUKA 4OUCA 2XM8A 3NR9A 3VUTA 3BBWA 3TZ7A 3A7JA 4IC7A 2EWAA 4RBLA 3QD0A 3ZFMA 3E93A 3B8QA 4MEDA 1E1VA 3DB6A 3UTOA 4RJ8A 2Y8OA 3WE8A 4C3FA 1OBDA 3Q4UA 3C4WA 3VS1A 4ANNA 4LOQA 2C6LA 2UV2A 1OIUA 2ZOQA 5GIOE 4N0SA 3PXRA 4PX6A 5CF8A 4Y73A 3C50A 2W1ZA 3F5UA 4K11A 3GVUA 2X2MA 1MRYA 4XP0A 4XS2A 3LZBA 4O7RA 4BB4A 3PA5A 5E9EA 4FT7A 1HCKA 4J1RA 4FNZA 4A9YA 4FV9A 2JD5A 1PXIA 3FI2A 4J52A 3VAPA 4D9UA 4CG8A 1DM2A 1FVRA 3LXKA 3KRXA 1YOMA 3OUKA 4RIYB 3W32A 4JRNA 3UDBA 2CJMA 4M84A 5B0XA 3DBEA 1O9UA 2BKKA 3O8PA 3SA0A 2JDTA 4I24A 5E8TA 5AR2A 4EH4A 3HAMA 3PP0A 5JK3A 1ZMUA 4RIWA 3UOLA 4ANQA 2P4IA 2Q83A 2QKWB 4FEUA 3E64A 1PYXA 3R04A 1LPUA 1H1QA 2Y4IC 4FKVA 4JVGA 5BUIA 1F5QA 3TT0A 4MX9A 4IEBA 2YERA 3NYNA 4D58A 3P78A 3LQ3A 5CXHA 4AN3A 2UVXA 4JDKA 2FUMA 1DI9A 4QP3A 5HIEA 3KVXA 4L45A 1R3CA 4LYNA 1P2AA 3B8RA 4X2GA 4UXQA 5JSMA 5CEIA 1YI6A 3DLZA 1M2PA 3QC4A 3UOJA 4UN0C 4QQ5A 3N4VA 3DS6A 5GZAA 2ETMA 3BEAA 4QMQA 3R63A 2C47A 2V5QA 2PE0A 2GHLA 5H8BA 4FEVA 3MI9A 1T45A 5DNRA 4EH8A 5IQGA 3EZRA 2PY3A 3CJGA 3FEGA 1STCE 1GJOA 4MQ2A 3F88A 4JJRA 1GIHA 4P2KA 3DOGA 3F2RA 1H07A 4BBFA 2P3GX 4L00A 4OTGA 4ZTRA 1IEPA 3R22A 2VWWA 4RA4A 3I7BA 3ANQA 1FQ1B 5AM6A 4CXAA 1JSTA 2WHBA 3U6IA 3F69A 4FIGA 2GU8A 1NVRA 3BZ3A 3A2CA 4DTAA 1Q3DA 4Y5QA 1JOWB 4BKYA 3NDMA 3ULZA 1F3MC 2YJRA 3LCKA 4LG4A 3GU4A 1PRYA 3LLTA 4EBWA 2F4JA 2PMOX 2PTKA 2P2IA 2VTRA 2NO3A 4E8AA 3CY3A 3R2BA 2Z7QA 5AV4A 4KKGA 4P7EA 5EYCA 4ASDA 3PXQA 4IQ6A 5CF5A 2QCSA 4TZRA 3KC3A 5BX0A 5EM7A 3IOPA 4BZNA 4F7JA 5LVPA 4ITJA 1GOLA 1U5RA 3MY1A 3A8XA 4GK2A 2R3NA 5HHWA 3QKMA 4XX9A 3V5PA 5A4EA 2BRNA 3KVWA 3HAVA 4IWOA 5FUTA 2ITWA 3RTPA 1ZYSA 3PLSA 1A06A 3NZ0A 2IZUA 4I0SA 5HNBA 2WOTA 4AZEA 4BN1A 5K0XA 5HO7A 2YHVA 4PL4A 3HA6A 3W10A 4CV9A 4F99A 5HTCA 2JKOA 3OWJA 2ETRA 2QOQA 4JX7A 2J5EA 4QYFA 3Q9YA 1OPKA 2G01A 2XM9A 1U5QA 1H4LA 4L44A 3FAAA 5ANGA 4G6OA 4C4IA 4XV1A 3GCSA 3AMYA 4IM3A 3FY0A 4M67A 4ZSAA 3LFFA 4BDGA 5HKMA 4PP7A 3FUPA 5JEBA 3H3CA 4TWCA 3GOKA 2PVKA 3I7CA 3IQ7A 5CSPA 4NM7A 4H58A 5I9XA 5HLNA 2W05A 4OTDA 4AFJA 2W17A 4DE4A 4EBVA 2YAKA 4E4MA 3VS7A 2WB8A 4AT4A 4IZAA 4O82A 4FKSA 4JX3A 3ZEWA 4MVFA 2R3RA 3BCEA 4GJ3A 3WF7A 3FDNA 4E93A 3FLQA 5LMKA 2OW3A 4L01A 1OM1A 2UW9A 4RLKA 5TOZA 3A7HA 3U6HA 4B9DA 3VJOA 5I9VA 2QOIA 4AXAA 1YHSA 4O91A 3MPTA 4BR3A 4IDVA 3UNZA 2IW8A 2HW6A 2W9ZB 2VTNA 4IHPA 4C61A 4PWNA 1YKRA 1QL6A 2DYLA 2ITZA 1H0VA 3HUBA 4ZOGA 4XH6A 1YXUA 4IJPA 2YFXA 3KXZA 5ANOA 5KE0A 4GT5A 1RQQA 4QNAA 1OKZA 5CNNA 3REPA 3T9IA 3A4PA 4YJUA 2VTJA 4UB7A 5DR6A 1Y6BA 3MFTA 5HVJA 2YM6A 5BMSA 3JR1A 3OXTA 3FZRA 5FM2A 4X7QA 4ITIA 3C9WA 3OP5A 5A4TA 5JQ8A 5EQEA 4LOOA 4C3RA 1K9AA 2BZIB 4ZZMA 4P5ZA 3FI3A 4O0XA 3FSKA 2YLEA 4OR5A 3ENMA 3P7CA 1Q61A 1WBWA 4H1MA 4EKKA 1FVVA 2BR1A 2F49A 3RCDA 5GINE 3SOCA 5BVWA 4J7BA 4RJ3A 3TV7A 3ORMA 5BNJA 3P08A 4AA5A 4ARKA 2O65A 4FIIA 3ZO3A 2WMQA 4RQKA 4P90A 4MXCA 2W1IA 4B8LA 3FMLA 4O7SA 3QA0A 2UZVA 3PYYA 2R3IA 4ANMA 1REJA 3RHXA 3TJDA 3FMJA 2LAVA 3ZLWA 2E9VA 3FKNA 4ASXA 1JVPP 5DR9A 4MBLA 2BUJA 2J0LA 3DK6A 2WTCA 2Y4PA 3V5TA 4QYYA 5JH6A 2BIKB 4G16A 5AP3A 3PDTA 4U41A 2HZNA 3QLGA 5DEYA 2DQ7X 2VNYA 3FMEA 1XH4A 4DT8A 3WARA 1PMNA 4NW5A 1LUFA 4RWKA 5AUWA 5DPVA 1OL6A 1R0EA 3MS9A 4EOSA 4GV1A 3RM7A 5M53A 4I94A 1XH5A 4FSNA 4G6LA 4XRJA 4ZMFA 5FTQA 3QWKA 2O2UA 3EQIA 2IPXA 3PJ8A 2KULA 4RWLA 2JGZA 2YA9A 3QYWA 5DGZA 2PVHA 5H9BA 3ZU7A 3R9DA 3SAYA 3VWAA 2A2AA 3BYVA 3ZXTA 2CHLA 1V0BA 5EI8A 3GB2A 3UIBA 4MQ1A 5HO6A 4EYJA 2J9MA 3PXFA 2EXEA 4USDA 4C8BA 1KE5A 3CTJA 3ORXA 4OTRA 2YIYA 2VGOA 5KMOA 1OL2A 3TIZA 3ZCLA 5IA2A 1YDRE 5J8IA 5D7VA 2HWOA 5CLPA 4NZWB 5E91A 3V6RA 4GKHA 3OS3A 4FV8A 4EK8A 4LGDA 1BI8A 3A7FA 3O17A 1JSUA 2OBJA 4G6NA 4I4FA 2OK1A 4A9TA 3GC8A 3QHWA 4FOCA 4F7LA 2YAAA 3UP7A 4MTAA 4FT3A 2JDOA 2X7GA 3PIZA 4Z7HA 5EYMA 5CXZA 2WTJA 2ZM1A 3PXKA 4GS6A 4DA5A 3QTQA 3GC7A 1KE8A 2YM3A 3C1XA 3ORLA 3GI3A 4GT4A 4L3JA 3ZEPA 3R9OA 4TW9A 5M55A 4E3CA 5K9IA 3KMUA 1KE6A 3W18A 3SGCA 5AV1A 3WE4A 4AQCA 1SVHA 4HVIA 4YJOA 4CKJA 1ZY5A 2OIBA 5TF9A 2I1MA 3ZO2A 3FBVA 4OBPA 5IH4A 3F61A 2VTLA 4C37A 5GIPE 3QRIA 4F65A 1PF8A 1W83A 4F1OA 3VNTA 2CPKE 2OJIA 3NX8A 3VS5A 4APPA 4JBVA 2WU6A 4LQMA 2OIQA 4YO6A 3GU6A 4DG3E 3RM6A 3JXWA 3RPVA 4M3QA 2QOCA 2VUWA 3AMAA 3PPKA 4C3PA 5IQIA 1YI3A 4I0RA 4FSTA 5CF6A 4FIFA 3LFCA 2B55A 4YZBA 4DEGA 3OC1A 3U8WA 4BC6A 5FEQA 3A61A 4A4LA 3G51A 4D9TA 2YITA 4YJNA 3TKIA 4DH8A 4EK5A 3SV0A 3EQCA 3GCVA 3QGYA 3KCFA 3PE1A 5LVOA 2R3GA 4LGGA 3A99A 5ANJA 2QHMA 1H1WA 1MQ4A 2QURA 4PDSA 4RIWB 4RJ7A 3V51A 2X39A 3R8VA 1Y91A 2RF9A 3PA4A 4I22A 5LCJA 5EDRA 3CQUA 3LXPA 3D7ZA 2E9NA 3OEFX 4FSZA 4OTHA 4RC4A 4XMOA 1TQPA 2UW3A 4LL0A 4N6YA 5ETCA 4JDJA 4NM5A 4TYEA 4M69B 4IM2A 4ZEGA 3DXNA 4YZMA 5K5XA 5L8KA 3R0TA 5CEKA 3CGOA 2QI8A 4JBPA 2C6IA 3R00A 4Q5HA 5AP2A 4YTIA 3MVMA 2YEXA 5AUTA 4FC0A 4BDDA 3I79A 2ZV9A 5KX8A 5FP5A 3L8PA 5ETIA 4QMPA 4DFBA 3NEWA 2B0QA 4CGAA 4IAAA 2WELA 4OBOA 3D9VA 4EC9A 4C35A 4FSWA 1OUKA 2W4KA 4C36A 1YWRA 3O96A 3E8DA 4DEDA 4XBRA 2OG8A 3FWQA 5LJJA 3KXNA 4QT1A 2ERZE 2X2KA 3KKVA 3UIXA 4AZVA 3E87A 1M2RA 2GTMA 5AX9A 3PUPA 4O0WA 2GSFA 3D5UA 4C2VA 4PMPA 5KCVA 5C4LA 1J7LA 3CKXA 5CASA 4ALUA 5GJDA 2QOHA 5AM7A 3WZJA 2VO6A 2WIPA 2ITNA 3DDPA 4ZTQA 1H27A 3KXGA 5CX9A 5DLSA 4EL9A 2BILB 3R1SA 3FLYA 3EJ1A 4F08A 4EK4A 3AD6A 3TZMA 4UXLA 4FK3A 4ANSA 2JEDA 4EHVA 1ZWSA 4U3YA 4C4HA 1G8SA 4GKIA 4DBXA 4TTHB 3HUCA 3TDWA 4AF3A 4G9RA 4MWHA 4I5CA 5AP1A 4CCBA 5E8VA 4BIBA 2XH5A 5KMNA 3BHUA 2PUIA 3AD5A 2VTMA 3PIYA 3TM0A 4QNYA 2GNHA 3LLAA 3ITZA 5CSXA 4AUAA 5AUVA 3UYSA 5DWRA 3C51A 3UC4A 3ZSGA 4IB5A 4CYJA 5L2TA 4QMNA 5EW9A 2VNWA 3EIDA 3D5XA 3JVRA 3FZTA 1XJDA 1I09A 3NCZA 4KUJA 4EH5A 5G1XA 4UMQA 5ANIA 1L8TA 1VZOA 2X8IA 4RC2A 4L42A 3TJCA 3O7LB 4PY1A 1UU9A 4J8MA 4U79A 4EOJA 3DBQA 3LMGA 1PHKA 1QMZA 4IAFA 3CD8A 5IKWA 4MXZA 3IO7A 2IZTA 1WBNA 4JQEA 1ZOEA 2ZYBA 3HRBA 4DEEA 4QTCA 4FV0A 4WG3A 4TWOA 3BQRA 2G2FA 3BWJA 4GU6A 4GJ2A 4WRSA 4NCTC 2YDIA 3QKLA 4IACA 4ACMA 3BYMA 3Q2JA 4FSUA 5TE0A 3P5KA 3BELA 4CCUA 5IQFA 4FKTA 2C6KA 2LGCA 2OZAA 3MGYA 3O8TA 4IMYA 4YTFA 3M42A 4X6RA 3MB7A 2OXDA 4EORA 3C13A 3R7OA 3U87A 2UZLA 1IR3A 2WIHA 2JKQA 3NNWA 4QD6A 5LQFA 3TN8A 2XA4A 5M57A 4BYJA 4I1ZA 5IDNA 4YHFA 2P33A 4W8EA 1BL7A 3VUHA 4DGNA 4RGJA 2ITXA 5HZNA 4TYHA 5IMEA 3HP5A 3GFWA 1XWSA 3VQHA 3AC3A 5AUZA 3EKNA 1RJBA 3WZEA 3NIEA 3C4FA 4N4SA 3KGAA 3QU0A 5D10A 5T6KA 4I5HA 5JGDA 4NM0A 3WF6A 4WIHA 2VTOA 4L67A 4FL2A 2J4ZA 3QA8A 2OH4A 2X6DA 3QQKA 4CFFA 3MPMA 1XHAA 1UNGA 2RGPA 4IX4A 3E8CA 4U0IA 5AP6A 4R3RA 3K3JA 3QXOA 1YOLA 4F4PA 3O50A 3PTGA 1ND4A 3QL8A 5HTBA 4JI9A 2QOOA 4BWXA 4YZDA 4IVBA 2YIRA 3FMMA 2W7XA 3OCTA 3Q60A 3UGCA 3VC4A 3QALE 3S4QA 1OL7A 4E6QA 2IO6A 2ITUA 1XH9A 4QOXA 3NYXA 4RIXB 5AUXA 3HLLA 2WTKC 5IA4A 2WD1A 1Q5KA 4AA0A 4QMUA 3Q6UA 5KHWA 5HICA 2PVJA 5CEMA 3BGPA 4FTUA 3ZRMA 4BZDA 2PUPA 4PMMA 3QD2B 1VYZA 3LHJA 4PPCA 3EN7A 3QTSA 2WTWA 4LRKA 2WMXA 3NUAA 2J6MA 2ONLC 4FT0A 3CP9A 4O1PA 3VBXA 3ZDIA 5HU3A 5DT0A 3ATTA 3RWPA 4GYIA 3GBZA 3OTUA 5F20A 1WFCA 4CQGA 1URWA 1Q3WA 5IU2A 4PNIA 3H9RA 3DLSA 2JFLA 4F9AA 2C6EA 4QRCA 1OZ1A 4IAZA 3IS5A 4BHZA 4JRVA 3LIJA 1LEWA 4H1JA 3AMBA 3LFAA 4YU2A 4L7FA 3LFBA 3HL7A 4JDHA 3DXQA 3V8TA 3C4CA 3QRTA 4EH6A 4O7WA 2O0UA 5L2IA 5AAGA 5J95A 3VUDA 2P0CA 2XKDA 2IW9A 4CFMA 4Z3VA 2XP2A 3JYAA 4H39A 2Y9QA 4MF0A 4ACHA 5JFVA 5E8ZA 3ZFYA 2H6DA 4BRXA 5EQYA 4KIOA 5GJGA 2B9HA 4I0TA 3C5IA 1H08A 1ZZ2A 5JQ5A 5GJFA 5ETAA 3B2WA 2CMWA 4FTMA 4FGRA 4U40A 4NT4A 2R3PA 5DOSA 4QP7A 2JKMA 4JXFA 4AZTA 4BCHA 1YHWA 2BHHA 5I4NA 3FMHA 4K8AA 2CNQA 1ZZLA 2JBPA 1H1SA 4K33A 4E6AA 4MWIA 3R9NA 3DKGA 3VHEA 4FNXA 4G1WA 4UMTA 4NTTA 1GZKA 3M11A 4FT9A 5A6NA 1YXVA 2XKFA 2AC3A 3FHIA 3WF9A 3L9PA 1H25A 3W1FA 3RPYA 4TYIA 4FIHA 2BTRA 5LOHA 4DFNA 4J95A 4EQCA 1XH7A 4KINA 4U97A 3IDPA 4XV3A 1A48A 3S00A 1GNGA 2RL5A 4NEUA 3W2OA 4U43A 4RIOA 2YM4A 3QCSA 3NUNA 2C5OA 2GNJA 4E4NA 3FLSA 2B54A 3THBA 2WKMA 4BGGA 4II5A 4V04A 5M09A 4ACCA 4AN2A 4CRLA 5DMZA 4L3LA 3NMUF 5AAEA 1YDSE 4DINA 4D4VA 4EH2A 3KULA 5DT4A 3UIMA 4X3FC 2ACXA 3HECA 1OGUA 2OF2A 4FSMA 3IKAA 1GY3A 1R39A 4PTCA 4DEAA 3FC1X 3KB7A 1RDQE 1YI4A 4I92A 4O6LA 4IIRA 4FTKA 3PJCA 3RNYA 4O81A 4K77A 4FV5A 5AUUA 2W1GA 3GU7A 2PZYA 5DN3A 3PPZA 4B99A 4HCTA 2R0UA 3LXLA 4J53A 4YBKA 5L6WL 3UG2A 4BCFA 5KUPA 4CRSA 3S1HA 3ZONA 3BYSA 3OBJA 4BDHA 4BGHA 3H0YA 4PQNA 3FZ1A 4QPMA 2WEIA 4B0GA 3R7VA 3ZBXA 2XRWA 2WXVA 3HNGA 5KKRC 1K2PA 2UZBA 3S95A 5JKGA 4L46A 4NYEA 3C4XA 3JS2A 5AV2A 2E9PA 4MBIA 2HCKA 4D2TA 3OD6X 4FGBA 3IPHA 3GCPA 4JR3A 2UW7A 2C0OA 1BI7A 2IVSA 3R7UA 4UX9A 1Q8WA 5IQHA 2Y4IB 1JNKA 1M2QA 2BRGA 2CDZA 2WNTA 4M14A 4RVKA 5H8EA 5J87A 2CKEA 1Y8YA 4U9AA 4FTIA 1DAWA 2ZM3A 2H8HA 1PXJA 2X8EA 4GK3A 1V0OA 5CZIA 3R28A 4C0TA 4ZK5A 1H0WA 4E4XA 3R8UA 1NXKA 3FSFA 2GTNA 5DHJA 4KBCA 3OCSA 3ZUTA 2GHGA 5BYLA 5E8WA 4E26A 3MESA 3EFWA 3VQUA 5JRSA 2QLQA 2XF0A 3FE3A 4PPBA 4TNBA 4ZY6A 2XNNA 3LOKA 3PRFA 3VN9A 4BCPA 5JFXA 4RJ6A 4ONAA 1U54A 4DEIA 1VR2A 4AS0A 4QYHA 1M7QA 3GT8A 4ZTSA 2R3JA 3PSBA 4TT7A 3VUGA 4AZSA 4H3BA 5HCZA 3LM5A 4IB0A 4FK6A 2X7OA 3TZ8A 4YTHA 3W16A 3VF8A 2QC6A 4FV2A 1UU7A 1PXLA 5CEQA 2CNUA 4OBQA 2WTDA 2UZUE 3RVGA 4BCKA 3HA8A 3VBTA 2E9OA 4RMZA 4D1SA 1OBGA 3QQUA 3T9TA 1FOTA 3MVLA 3MV5A 4AP7A 3GNIB 3UMXA 3KK8A 5BVEA 5FG8A 4EK6A 2EXMA 4O96A 1OUYA 1UKIA 1V1KA 3FQEA 4LMUA 4DFZE 2Z60A 3QX2A 4FTOA 4BIEA 1UNLA 5J5SA 4KIQA 3D2IA 3UOHA 4E5AX 1GZOA 2BFXA 3NNXA 4Y5HA 5FXRA 2W96B 4F09A 3A60A 4ID7A 4IZYA 3SVVA 1VYWA 3CLYA 4MXAA 1PY5A 2W1FA 5CY3A 4FTAA 2HY81 3ORZA 4FBXA 4WA9A 3RI1A 1GIIA 2P55A 2OZAB 4IWDA 3RPOA 4BTKA 1SNUA 5K4IA 1URCA 4L8MA 2IVVA 4MNEA 4YHTA 4O1OA 5KZ0A 3Q5ZA 4IANA 2A4LA 2QOKA 4S31A 4HGEA 3PRIA 2XIRA 4EJNA 2VWVA 3RAWA 5JGBA 1NA7A 3EN6A 4BDKA 4R7HA 4XRLA 2QOBA 3F5GA 2JAVA 3NVKI 2GCDA 3ZO4A 4CNHA 3QX4A 4FL1A 1H26A 4UV0A 5K5NA 2BZJA 4Q9SA 2BPMA 3R30A 5E7RA 4TN6A 3W33A 3Q9ZA 3KXHA 4XLIA 5AP0A 4FNWA 3IDBA 3SW7A 4D2VA 4AOIA 5KNJA 4UZHA 2XK6A 3GQLA 3E63A 4NCTA 5D11A 3SKCA 4FF8A 1H1RA 3WZUA 5HLWA 3AGMA 3ALNA 3PVUA 1TQIA 1IAHA 4D4RA 4WUAA 3Q4TA 4BWKA 4CZYB 1LR4A 1YVJA 4KB8A 4YPDA 1YW2A 4E4LA 1IASA 3FL4A 4BHNA 2IWIA 1QPCA 3QC9A 1OL1A 2R3LA 4YPSA 4M0ZA 3MH2A 3RINA 4IX6A 3VHKA 4I21A 3ZLXA 4EYMA 4FSYA 3C0GA 1JWHA 1YXTA 3ZXZA 4NFMA 4B8MA 4C38A 3O51A 4OTPA 3R8MA 3D14A 4NSTA 3N9XA 1JAMA 4I41A 5HIBA 2G2IA 4PL5A 4FEWA 3U55A 4L68A 4OT5A 4RPVA 2NPQA 2QHNA 4XOZA 3I6WA 4QP8A 4YZCA 4BDFA 3MTLA 3PA3A 3DFAA 3VJNA 4RT7A 3BHVA 3F3WA 2FYSA 1ZOHA 2WPAA 3GCUA 3UPXA 4QMMA 4DGMA 3OHTA 4E1ZA 1Q8YA 4AN9A 4HGLA 1JKSA 4YNOA 2FGIA 3CJFA 4RWJA 4YJVA 1RE8A 4YUQA 3NVMB 4JS8A 4KBAA 1WZYA 4W9XA 5EM6A 2PULA 2OWBA 3GQIA 2GDOA 5IMXA 3DK7A 4PDOA 2C6OA 1WVYA 3OTVA 1REKA 3QTRA 4S34A 4X2NA 4XNEA 3V8WA 2WAJA 2OI4X 4YHJA 4D28A 4F0GA 3F9NA 3V6SA 2BKZA 4CZTA 2FB8A 5E1SA 5FDPA 1YDTE 2QQ7A 5CEOA 3QQLA 1ZXEA 3ZRLA 2YJSA 3I1AA 5JZNA 3PY0A 2VWUA 2VAGA 5CU4A 2ITOA 1J1CA 2UW4A 1Q8UA 4IAIA 3QCQA 4F63A 2VTQA 2YDJA 3WILA 3AXWA 3DGKA 4YC3A 4CLIA 3L9NA 4RA5A 3GFEA 4EZ5A 3MYGA 2VTSA 4ANOA 3KRWA 2ZB1A 3Q9WA 4NKAA 5JFWA 4ORKA 4JIAA 3R2YA 3UMWA 3ORKA 4O21A 5DBXA 3DAEA 2XIXA 2XKCA 3HYHA 2ONLA 4G3DA 3ZLSA 4EOKA 3SQQA 3A8WA 3F5PA 3PSDA 2BZHB 3DBDA 1JKKA 4QTDA 1X8BA 4M8TA 4O7ZA 4I6HA 2WU7A 5FP6A 3QUEA 2VGPA 2WQEA 4PRJA 4ZY5A 3UODA 4OTFA 4QP2A 2PL0A 4ZLZA 4O84A 2JKKA 4EOIA 3ORTA 3QBNA 2VN9A 1IA9A 3BHTA 2W1CA 5J9ZA 2XBAA 4JDIA 3R9RA 3KCKA 3Q6WA 4MBJA 4CTCA 4ERWA 4D55A 4I20A 4WG5A 4U44A 4IWQA 3TL8A 2X2LA 1OKYA 3M2WA 1P4FA 3QCYA 4XYFA 5D1JA 2HOGA 4G3FA 2OXYA 3TIYA 2AYPA 5BPYA 4QMOA 2ZV7A 5CQWA 3ERKA 2C0IA 3OMVA 4NWMA 4PF4A 4DAWA 2WFYA 3BHHA 4QYGA 3DU8A 4WSYA 4MXOA 5HE1A 1ZYJA 5M44A 2QU6A 1NW1A 2W99B 5IEXA 3D7TA 3DTWA 3DBFA 3D5VA 2C4GA 4LOPA 3KREA 3N4UA 4BCNA 3KULB 3OWPA 4RX5A 4A9SA 4CD0A 2H96A 3D83A 4YGAA 3UBDA 3OF0A 3U9NA 2IJMA 4ITHA 3MB6A 5J9LA 1E1XA 3SX9A 2OSCA 4BCQA 2PZPA 3RZFA 2QG7A 2B53A 3R9HA 3RWQA 3QZFA 5L2SA 3UNKA 2GNGA 4R5SA 3V5JA 4HGSA 3MH0A 3E5AA 1JKTA 3ZHPC 4AT5A 2J7TA 3IW5A 3NIZA 3P86A 4QMLA 5A54A 4BZOA 4D5HA 3T8OA 3UO4A 1XQZA 3PIXA 4EQUA 4JT3A 1XH8A 5EKNA 4WT6A 3ANRA 2YWPA 3CKWA 3MVHA 3ODYX 2CNVA 2ZAZA 3RK7A 5L8LA 5H8GA 4DEBA 4DLIA 4GU9A 2W5BA 2XEZA 2ITYA 1P5EA 3AT4A 3QKKA 3G5DA 3TACA 5IPJA 2BRBA 2YM8A 4X3FA 2VO3A 4V0GB 4TKSA 2R4BA 4FVQA 5AMNA 4RWIA 2G15A 1OIQA 4A9RA 1H28A 2A1AB 4NFNA 3IW6A 3MVJA 1J1BA 4MKCA 4D2SA 3P7BA 3MDYA 4LV8A 4XUFA 3OEZA 5ETFA 4ZTLA 3SC1A 4A07A 2C3JA 3BV2A 4Z55A 3ZOSA 1WBSA 3P0MA 4ANBA 2PYWA 4Y95A 4IX3A 4ZSLA 1WVWA 5BVKA 3G6GA 1G3NA 3H4JA 4JQ7A 3KF4A 4CYIA 2R3OA 4QO9A 5A9UA 5DIAA 4F9WA 4EJ7A 3ROYA 3OOGA 5HTIA 3FXXA 2JDRA 4C4EA 4GCJA 2HK5A 1ZAOA 2BZKB 4U5JA 3RZBA 3JY9A 5B2LA 3RPSA 5M4IA 1U54B 3LJ2A 2C6DA 4NJDA 1Z9XA 4NIFA 2VTTA 2YISA 3P7AA 2WEVA 3LPBA 3O2MA 3UVRA 5HCYA 4C57A 2RG5A 4GG7A 2XJ1A 3I6UA 4D2RA 2IVUA 3DKFA 4R8QA 4ANLA 4CSVA 1Q62A 1PMEA 4HYSA 1OVEA 4QQJA 5HG5A 3MY0A 4QP1A 3MH1A 3G0EA 2X0GA 4KS7A 1ZYLA 3NGAA 3BI6A 2NRUA 4WKQA 4K2RA 5ANKA 3Q4ZA 3I0QA 4XJ0A 5KZIA 3FL5A 3ZMMA 3RPRA 2DWBA 4P5QA 3UG1A 3DBCA 1FGIA 4M68A 5LMBA 1O6KA 3KA0A 2OU7A 4HYIA 4ZIMA 2KTYA 2QD9A 3FHRA 3GXLA 3LJ1A 3GCQA 3QWJA 2HWPA 4U45A 3KY2A 5HOAA 4YSJA 2WMBA 3GOPA 5I5ZA 2W4JA 3NUSA 4PDYA 4GSBA 3IOKA 1OIYA 2B9JA 3PP1A 4BBEA 3TTIA 5EH0A 2VU3A 4JQ8A 3OFMA 2R64A 2BALA 3CC6A 3OY1A 4FICA 3UC3A 3LFEA 3Q32A 4G5JA 2CKQA 2JLDA 1G5SA 3OY3A 1NVQA 2XJ0A 4W4YA 2CLQA 2WGJA 4UWCA 2PMNX 4HZSA 2GQSA 3ACKA 4MNEB 3ZZEA 3DA6A 2XK8A 4F9BA 4KS8A 4QMYA 4YJQA 3QGWA 5AR3A 4GFOA 2CN8A 3CTQA 1OL5A 2BAKA 2BROA 3K3IA 4F7SA 2B52A 3SG8A 5A4LA 4FYNA 5CT7A 3ZUUA 5J9YA 3A7GA 1KSWA 4MD7E 3LVPA 2GNFA 4M7IA 4CMTA 2PVMA 3M1SA 4KIPA 4OLIA 3I5ZA 2FH9A 3NWWA 3LFDA 4DH1A 2ZVAA 1O6YA 1NVSA 4AA4A 3NSZA 4Z7GA 4W4VA 1XKKA 2JC6A 4I93A 3FJQE 4BCOA 2G2HA 3B2TA 4O2PA 2V7AA 3EB0A 5EI2A 4XV2A 4CMOA 4JAIA 4MF1A 2UZTA 4DHFA 4XOYA 4AT3A 2JBOA 2J2IB 3CXWA 4RJ5A 5AR7A 3ROCA 4JR7A 4Z9LA 2C5NA 2I7QA 3BHYA 4UZDA 1ZLTA 2C3LA 4C62A 3CPBA 3QUDA 4AACA 5J7HA 4BTMA 4D1ZA 5M4FA 4C4GA 4AZFA 5BVDA 2O63A 4KKHA 1UV5A 3LQ8A 3I4BA 4O0RA 5JRQA 1WAKA 3KN6A 3PVBA 3PG3A 1SVGA 2C68A 4N70A 5CU6A 4YZNA 4HPUE 2XNEA 3BBTB 2DUVA 4FG7A 4TY1A 5CSVA 4JAJA 5CI6A 3ELJA 5K0KA 4RFZA 4XP3A 3MY5A 2QO2A 1ZMWA 4NW6A 5EDQA 3UZPA 3TG1A 4F1MA 3ULIA 3HEGA 5LCKA 3OW3A 4HOKA 4XG3A 3LM0A 3BU6A 5BUEA 4TRLA 3LKMA 5H3QA 5IA5A 5CF4A 5IISA 4IADA 5IUIA 2RFSA 3HV3A 2R0IA 4L52A 3K5VA 3PXYA 4LRMA 4PV0A 3EYGA 3QD3A 2FSTX 3COHA 5DVRA 5CTPA 3CIKA 2O5KA 4F9YA 4OT6A 2EXCX 1T46A 4KRDA 5FEDA 2J0MB 2UW8A 3O0GA 4YLJA 1M7NA 3R8ZA 4EH9A 4JNWA 2W1DA 1UU8A 4D0XA 1CDKA 3VS6A 3NLBA 4KBKA 4RQVA 5EG3A 3VULA 4A06A 4UYNA 5EOBA 5HCXA 4U80A 4I6QA 3NW6A 3BX5A 4I5PA 1B39A 3VIDA 5D41A 3DAKA 3EN4A 2OFVA 5HO8A 5FM3A 3IW7A 5DYJA 2WMAA 4PMSA 4ZTHA 1J91A 4HW7A 2VTAA 3UIUA 5CNOA 4AW0A 2HZIA 4UYAA 4HPTE 4EQMA 1KE9A 4F0FA 3R7GA 2PWLA 3R1NA 4JIKA 3E88A 4W4WA 4DH7A 3EN9A 1IRKA 3BGQA 4R1VA 2CCIA 3UP2A 3VBWA 1KUTA 4TNDA 1NT2A 4E5BA 5C8KA 2X81A 3NNUA 3VS0A 1IA8A 4USEA 5IA3A 3IGOA 4USFA 2WQNA 2C0TA 2C3KA 4FL3A 4IE9A 3UE4A 2ZB0A 4QYEA 3V5LA 4QTEA 4O7TA 5DRBA 3MA6A 2XKEA 2RFDA 2Y7JA 1ERKA 3C0IA 2E9UA 5FLFA 1CKPA 5CAQA 2F9GA 2VTPA 3NW7A 2F7ZE 4O0VA 1XBAA 2YZLA 1SZMA 2EUFB 2R3FA 4HCVA 3RKBA 4EHZA 5L4QA 3VO3A 4QMTA 2Q0NA 3BU5A 3FYJX 4MXYA 1PJKA 4HCUA 4PDPA 3BLQA 4NJ3A 1UU3A 2VWBA 3QF9A 5EW8A 4QMWA 3UVPA 5FDXA 4XG9A 2WOUA 4CTBA 4I4EA 4BBMA 4RZWA 3D7TB 2B9FA 5DE2A 3ORPA 5ACBC 2H34A 2QOLA 2IZSA 3W2PA 4X21A 5IQCA 3PXZA 4BKJA 1Z57A 4IFGA 3Q4CA 4BL1A 3R1YA 3E7VA 4DFLA 1WBVA 2UW5A 2NNWB 4FKUA 4BI1A 1QCFA 2GMXA 3F2NA 2HW7A 3T3VA 3QTWA 5IG1A 2C30A 1PXPA 3HV4A 5CALA 4DN5A 5M07A 2R7IA 5AA8A 2CKOA 3QQGA 3TI1A 3R8PA 3LW0A 5CSWA 4EI4A 4TYGA 3TCPA 3FLNC 2VO7A 4HYHA 4O27B 5B2KA 4F7NA 1UKHA 2JITA 4RX8A 2O64A 5CSHA 5FXSA 5HG7A 5E8YA 3HZTA 2R3KA 5EKOA 1KV2A 5AR5A 3DB8A 5GZ9A 3W2RA 3WIGA 5EW3A 2CSNA 2OH0E 3NYVA 2OIDA 5D12A 4WOVA 4DF3A 3Q5IA 3UO5A 4FTTA 3VBYA 2UUEA 3COIA 2X4FA 3KL8A 4XG6A 2GFCA 4KD1A 2J0JA 2CKPA 5CQUA 3ZM4A 3RAHA 3DV3A 5DG5A 4EHEA 2JDSA 4RJ4A 3NS9A 3Q53A 3Q52A 4DCAA 1CSNA 2ZV2A 3CY2A 4P4CA 4PMTA 4Q9ZA 3LXNA 4O7NA 4MK0A 2YZAA 4XEYA 3PZHA 2UZNA 2EB2A 3SG9A 4ZS4A 5J5TA 5CVFA 3LCDA 3POOA 4R5YA 3O8UA 4BWPA 1R78A 3RP9A 2XNBA 5EM5A 3UZTA 1M17A 3EFJA 1Q24A 4C2WA 2XS0A 4O6EA 4WNKA 3QRKA 5AP5A 4FMQA 5C27A 3N4TA 4RVLA 2ITQA 3SRVA 4MNFA 2QONA 5BUJA 5CAOA 1PXKA 5HIDA 1PKGA 5GNKA 3II5A 3RNIA 4EHGA 3QTUA 2FVDA 4PUZA 4XV9A 3EH9A 2YIXA 3OZ6A 4NIFB 4BYIA 4C33A 5A14A 5KHXA 3UPZA 3MJ2A 4AOJA 1TQMA 2WTIA 3FC2A 3RK5A 4CG9A 5AV3A 2Z2WA 4G17A 4AW5A 2JFMA 1OPJA 2W1EA 3PJ3A 3ET7A 4FVRA 2BRHA 3UJGA 3DTCA 2WMTA 3L9LA 4F70A 3F3TA 1PXOA 5E1EA 4L3PA 3OCGA 2A27A 5JZJA 1CKIA 2RIOA 3FKOA 4KA3A 5T68A 4D4YA 3QTZA 4S32A 1PMVA 3IECA 3C7QA 3NRMA 4EKLA 3TNPC 2PVYA 4QMVA 2PMLX 4HVDA 3ZM9A 4QP6A 3JUHA 4X3JA 3ZTXA 4E73A 5C01A 3EQBA 5HBHA 4Y8DA 1JKLA 4NH1A 1PXNA 2HZ4A 3AC4A 3CEKA 5GZ8A 3U6JA 3PVGA 2OXXA 2X6EA 3ZLYA 3Q96A 2XEYA 4U8ZA 5FGKA 3C0HA 3FXZA 2CGXA 2Y0AA 3HKOA 3PWYA 4AW2A 4E6CA 2I0YA 4ENYA 1DS5A 4Q5EA 3R7YA 4TPTA 4YBJA 3L1SA 5AJQA 2X7FA 4JOAA 3PPJA 5M4UA 5AEPA 5L6PA 4FKPA 4GVJA 3SHEA 3WOWA 5HNGA 4C58A 1MUOA 3ZZWA 4YR8A 4R6VA 4KSQA 1HCLA 2YDKA 3F82A 3QHRA 5F94A 3QZHA 2GS7A 1PKDA 2XBJA 3AG9A 1R0PA 3EQFA 2XK9A 3HVCA 5DI1A 4EOPA 5B2MA 3TUDA 4ZZNA 3MBLA 4U6RA 3FKLA 2HELA 2YCRA 4G34A 3CTHA 2YWVA 4IB3A 4CKRA 3OXIA 2UZOA 3ORNA 1LP4A 3TKHA 3K5UA 2QLUA 5D9HA 1MP8A 3WIKA 3HV5A 2EVAA 3NAXA 1YHVA 4JG6A 4FKGA 4I6FA 3R7EA 2UZWE 4EUTA 5E90A 5BYYA 3PLAE 3C4EA 4IW0A 3RCJA 2ETKA 2PHKA 3PY1A 4Y83A 1UA2A 5K3YA 4KIKA 3V8SA 3ZS5A 2C5XA 3OWKA 4G31A 3VS4A 3EL8A 4XG4A 1CTPE 4QPAA 4G3EA 4U42A 2RKUA 4FKWA 3T3UA 4IVDA 2GNLA 3WYYA 2RFEA 4L7SA 4EH3A 3D4QA 4ZJVA 3FI4A 1ATPE 1V0PA 4FZFB 5FWKK 2XK7A 2ITVA 3E8NA 1H8FA 2QU5A 4H05A 2CGVA 3DJ5A 2VZ6A 2XB7A 3CPCA 2BIYA 3GUBA 4ZY4A 1OPLA 3G33A 4FR4A 2PVLA 4ASZA 3R73A 4GUEA 3VBQA 3L8XA 3RBWA 5JT2A 4DTKA 1ZRZA 3PZEA 2PZIA 3S0OA 5HBJA 1JQHA 3PFQA 3DNEA 2YCSA 3HMIA 4HGTA 3ZYAA 1APME 3G6HA 3LCOA 4ZXTA 4I6BA 3DCVA 1MRUA 3ORIA 1W98A 2HAKA 3QTXA 4D2PA 3JVSA 5CVGA 4EK3A 4RRVA 4CQEA 4FZDB 3EQHA 4HNIA 4GRBA 4EWQA 2B7AA 3TNHA 4QP4A 2OF4A 1VJYA 3G9NA 5DRDA 4YP8A 4BCIA 5IUGA 5HQ0A 2BAJA 5LXMA 4F1TA 3OBGA 4M12A 3FLZA 3U4UA 4D0WA 1F0QA 3TKUA 2IG7A 2BDFA 5FTGA 1AQ1A 3VRYA 1JSVA 5IH5A 1OKVA 2VX3A 3VW6A 3WBLA 3ETAA 4BCGA 3ACJA 3U51A 5TR6A 3R02A 3KMWA 1J3HA 2IW6A 3Q3BA 3TNQB 5EHYA 3MW1A 4NK9A 4WNPA 5DR2A 4L6QA 1B6CB 4FT5A 4APCA 1MQBA 2BDWA 4FG9A 5EHLA 5HG9A 2XMYA 5LVNA 5GHVA 5HE0A 5AFVA 3DZOA 3G0FA 3F3ZA 1B38A 1Y8GA 4K0YA 4DGGA 3DT1A 4EZ7A 3F2AA 2VX0A 2VTHA 4M69A 2P2HA 3MH3A 2QODA 3ID6C 3VUMA 3TXOA 4GIIA 5TKDA 2BHEA 3HMMA 3WZDA 1H24A 3NW5A 2OJFE 3GP0A 4BTFA 5FRIA 5HI2A 2JIUA 3EL7A 4WD5A 4TYHB 4FODA 3QFVA 5ANDA 3FLWA 4IAKA 2IVTA 3MFUA 2X8DA 1Q8TA 1DI8A 4RC3A 1YWNA 4UEUA 5HGIA 4N57A 3I81A 4NU1A 2Y6MA 3KN5A 4QMZA 5EHOA 5J79A 4BDCA 3TV6A 3WZKA 1BL6A 5CU2A 5HVYA 4AGDA 3DQWA 4K9YA 2JIIA 5J7BA 4FV4A 2ZMCA 1Q4LA 4ERKA 3LJ0A 3IW4A 1M14A 2YCFA 3DNDA 5T3QA 4ZAUA 2VTIA 3I0OA 4IC8A 4GT3A 4N6ZA 4BFMA 4DG0E 2EB3A 4J97A 2QNJA 2XNGA 4WBOA 4YC8A 5LVLA 3V5QA 3L8SA 5J1WA 2ZJWA 3QYZA 3DDQA 1HOWA 1BYGA 1L3RE 3NPCA 4BIDA 5I0BA 2W4OA 3DZQA 3LAUA 4FV7A 2C6MA 2GNIA 5EQPA 4BDJA 3AC2A 4FIEA 3FQSA 4EOOA 2XCHA 3L8VA 5C4KA 5AUYA 2JDVA 2I6LA 2YM7A 1XBBA 3LQ5A 4U3ZA 4BCMA 3QAME 1R1WA 4FEQA 3D94A 3PJ1A 4I23A 4PNKA 3GU8A 4MAOA 2GS2A 5ANEA 3CBLA 4TL0A 2XK3A 3UOKA 1JBPE 4F6UA 3QD4A 4FUYA 5HD7A 4AX8A 3O7LD 4KKEA 3EOCA 2QVSE 2ZDUA 4M15A 2OO8X 3JPVA 5EI6A 5A3XA 3AT2A 4O86A 3Q2MA 3R71A 4FVPA 4RZVA 4AWIA 3KK9A 3S3IA 4GFMA 2PVRA 2WMUA 4IZ5A 5EDPA 3NUXA 1SNXA 5F9EA 4CFXA 5I9ZA 4Y72A 5IQEA
chains in the Genus database with same CATH superfamily
2XVDA 4ZLYA 4M97A 4BTJA 4OTWA 5FD2A 4C4FA 5IZFA 4K18A 4M13A 2HY0A 2JAMA 3R1QA 4R3PA 5HBEA 4IX5A 4D5KA 3UQCA 3GENA 5BMMA 4FEXA 2O8YA 2UW0A 2VWYA 4QP9A 4GIHA 2XANA 2OICA 3FY2A 3HRFA 4XG8A 3BQCA 5A4CA 4BDIA 3DQXA 4LUEA 5EOLA 5KO1A 2A19B 2C5YA 3UYTA 3HRCA 3LCSA 4GYGA 4C34A 4CFWA 4DFXE 3H10A 4O7YA 4X6QC 5FBNC 2QO9A 4QPSA 3CCNA 3HP2A 1WVXA 4FZ7A 4R7IA 1YOJA 4FV6A 2FA2A 5C26A 4WSQA 3V04A 3ZC5A 5C9CA 4EZ3A 3A62A 3LFSA 4DH5A 4S30A 2QG5A 4YSMA 1WBPA 4B4LA 5AIRA 3SRVB 2PZRA 2WMSA 4JBQA 4S33A 2BFYA 3OXZA 3BLHA 5HE3A 4PP9A 4BDAA 4PPAA 1H1PA 3UNJA 3VS2A 2ZM4A 3AC5A 4E5WA 2UVYA 3QQFA 4KSPA 5DEWA 3ZSIA 4I6LA 5AX3A 3BE2A 5ACKA 3F6XA 4RFYA 4UALA 5A6OA 2IN6A 3U54A 4AE9A 4B6LA 4F64A 5HORA 1JPAA 3VVHA 3FXWA 5M06A 2RFNA 1M52A 4X2JA 1OMWA 3ENHA 1WMKA 2J51A 3DK3A 1KOAA 4G2FA 2AUHA 3SDJA 5A4QA 2CLXA 4RSSA 2J5FA 3LE6A 1WBTA 1XO2B 2BVAA 4G3GA 5HLPA 3WI6A 1JLUE 1KOBA 2V0DA 2V55A 3KRRA 4YNEA 3OWLA 3FPMA 4JBOA 4ZTNA 2NYAA 3QUPA 5K4JA 2WZJA 5BVFA 5CWZA 4AG8A 3PJ2A 4C59A 1QPEA 1W0XC 1G8AA 3QXPA 4EC8A 2GQRA 5JMSA 3CS9A 3ZUVA 3OROA 3QTIA 5HEZA 3LFQA 3CQEA 3VW8A 4R3CA 4DCEA 4TWPA 4RIXA 3E8EA 5M51A 2WO6A 4FG8A 4AQKA 3FZOA 1YQJA 3V3VA 3QCXA 4EEVA 5FQDC 2PE1A 3MJ1A 3DAJA 4FTQA 2NRYA 4TXCA 5BVOA 5IA1A 3ZH8A 2OKRA 4FI1A 4MD9E 4A7CA 4YLLA 5HG8A 4L43A 2IZRA 1ZOGA 3VRZA 5KMLA 2OLCA 4O2ZA 3HV7A 2Z8CA 4WNOA 2HENA 3TNWA 4W9WA 3BWFA 4R7BA 4CFUA 3OVVA 3W2QA 1XR1A 2XJ2A 3KRLA 3NUYA 2R3HA 3A4OX 2WQMA 2YIWA 3JY0A 3NUUA 5DA3A 3WF8A 3OCBA 4RVTA 4YC6A 4C7TA 5JGAA 5JFSA 1J7UA 3CSVA 4GFGA 4U7ZA 1FGKA 3E62A 3IGGA 4JL9A 3ZSHA 4AW1A 3E3PA 5AR8A 3I60A 4FNYA 3BLRA 3BRBA 3AQVA 3BYUA 5F1ZA 1YRPA 5EFQA 2FSLX 4D2WA 4FE2A 4FUXA 4LRJA 4Q2AA 3MSSA 4D4SA 3GC9A 1O6LA 4KIKB 4EH7A 2W1HA 2Q0BA 2XIYA 5IF1A 4O7VA 1SYKA 3FQHA 4F9CA 5LMAA 4IBMA 3QZIA 4LM5A 4X2KA 5H2UA 5AR4A 2V22A 1YXXA 3IONA 4BICA 4E7WA 3AC1A 3KXMA 3O71A 3PY3A 4PTEA 3W8LA 2RSVA 4BF2A 2O3PA 2ERKA 5F4NA 2UZDA 4XG7A 5IQAA 4FKLA 3N51A 3EMGA 2CCHA 4RVMA 1ZARA 2GPHA 3VS3A 4ZTMA 3U9CA 3SXFA 5EK7A 3TDVA 4IFCA 3DJ7A 1U46A 2V62A 2OZOA 4HVHA 4YO4A 1KE7A 4X0MA 2Z7RA 4FTJA 4EOMA 4WRGA 1OB3A 4GMYA 1FVTA 1DAYA 4ACGA 3RALA 3QRUA 1PMUA 4QTBA 4TYJA 1QPJA 1KWPA 3E92A 2W5HA 2J0KA 2E2BA 2R3QA 4K1BA 2CGUA 5CVHA 2GHMA 2OJGA 3UVQA 5C8MA 5CS6A 3GC0A 2YLFA 4G3CA 4ALWA 3V5WA 3WYXA 4AGWA 4CT1A 5FTOA 5IEYA 3QLFA 1Y57A 4F0IA 4IJ9A 3RAIA 2FSOX 3FZPA 4FSQA 2YACA 5IEVA 4WNMA 4S2ZA 1UWHA 3UQGA 4FTLA 2REIA 5AP4A 4ZS0A 3HMNA 4C02A 2OFUA 3NNVA 3R21A 4XG2A 3HX4A 1UNHA 4BDBA 5CT0A 4OAVB 4MH7A 2XYNA 3P4KA 5CI7A 3BPRA 3NCGA 4EUUA 4NKSA 1I44A 4DFUA 3I5NA 1XH6A 4WUNA 4J8NA 4WO5A 4F6WA 3MTFA 3HMOA 1FMOE 3IW8A 2XUUA 2Y6OA 4R1YA 3BIZA 4B7TA 3KEXA 2H9VA 2BDJA 5AP7A 4ZSJA 1W7HA 3BV3A 1ZMVA 3F7WA 4FA2A 4L9IA 2XZSA 2VX1A 4XCUA 2EU9A 2WQBA 4EWHA 2BTSA 2ITTA 3NAYA 4BGQA 2UZEA 3R6XA 5E8UA 1TKIA 3ATSA 4NUSA 1QPDA 1H00A 2ZV8A 4FKQA 2QR8A 2NP8A 4ZJIA 1S9IA 2VO0A 2X9EA 5L2WA 5CYIA 2X9FA 4GL9A 3BYOA 2GS6A 4XLVA 1PYEA 4W8DA 4Z16A 2I0VA 5M56A 4O38A 3W0OA 4V01A 4EOLA 4LFIA 2VWZA 2XCKA 3W55A 2OJ9A 4PTGA 4RX7A 4ZMEA 2J0IA 4NM3A 4JLCA 3SD0A 4MHAA 1AD5A 2WQOA 4FTCA 3Q9XA 4O7LA 5CANA 1ZYDA 4FIJA 3RMFA 4DBNA 4YJTA 1SMHA 1OIRA 3SXRA 3AD4A 4DG2E 4A4XA 1E9HA 3ALOA 3SOAA 2F7XE 3TYKA 4IDTA 4JG8A 3UO6A 2PPQA 2OGVA 3MPAA 4AGCA 5L3AA 1IG1A 5CEPA 2B1PA 2XNMA 4AOTA 4LDTA 5KMIA 1OKWA 1Z5MA 3OW4A 5AA9A 3P79A 4OTIA 3FYKX 3AKKA 3QQHA 2V7OA 5AWMA 5HX8A 3IG7A 2PUUA 4WBBB 1YWVA 3E7OA 4CFVA 2G9XA 2W5AA 4E20A 4YURA 4IZ7A 1VEBA 4GW8A 1ZYCA 4DEHA 5KBRA 2WMRA 5IQDA 2A0CX 1MRVA 3LMIA 2R7BA 2Z7SA 5CZHA 4CEGA 3MA3A 1CMKE 4FKJA 4GUBA 3QQJA 4M66A 4CZUA 2CGWA 1UWJA 1FPUA 3GEQA 3PSCA 4YJSA 1FINA 3FZSA 5IH6A 4O0SA 2I0HA 4CVAA 2QKRA 4EOQA 4G5PA 4FZ6A 4DYMA 1ZY4A 2BRMA 3R8LA 5EYDA 3POZA 1SM2A 1BX6A 2FSMX 3CR0A 4GEOA 3F5XA 4H3QA 4RIYA 5EM8A 5CU0A 2YIQA 4LV5A 4ZJJA 5AADA 5KBQA 4DDIA 3K54A 2G1TA 3S2PA 5EYKA 4MXXA 4IAYA 4AZWA 3EWHA 4O22A 2HZ0A 4OGRA 2J50A 2ESMA 3HMPA 3MN3A 4X2FA 4ZSGA 2PU8A 2ZFYA 2BAQA 4UMPA 3KXXA 2XNPA 3G90X 3FMDA 4HVGA 2C3IB 4FSRA 4E6DA 2WTKB 2C69A 2PVFA 1U4DA 4R77A 2PK9A 4GG5A 4IVCA 4LUDA 3ZRKA 3E3BX 2VRXA 4FOBA 3F7ZA 5HD4A 2Z02A 3FI8A 2AC5A 3BU3A 4J96A 5HESA 5IA0A 1GAGA 3LFNA 1YXSA 4DH3A 3Q04A 1BUHA 1W84A 4FKOA 2XIKA 5IDPA 3CQWA 4L53A 3EQRA 4LI5A 3K2LA 5CU3A 4A4OA 1UVRA 2C1BA 4GH2A 4O4CA 4DC2A 3TNIA 3TUBA 2PVNA 2R3MA 4YJPA 3PWDA 4O0TA 2QOFA 3HGKA 3NFGB 2X0QA 2PMIA 3RGFA 5ITAA 4ASEA 4K6ZA 3MIAA 3RHKA 4AGUA 4BVUA 3EQPA 4BI0A 4YJRA 2ZMDA 3F3VA 5AAFA 2F2CB 3EHAA 4U81A 3RJCA 3H9FA 2R9SA 3H9OA 4QQCA 3W2CA 4AAAA 4UWYA 4IM0A 3OUNB 4IVAA 3U4WA 4HZRA 4D1XA 4IB1A 3ZBFA 4YZ9A 4XBUA 5DH3A 4V05A 4CMUA 4MCVA 3BGZA 4FZAB 5FBOA 4ZZOA 2F7EE 2B9IA 4UBAA 4A9UA 2WMWA 3OOMA 3D0EA 3FMKA 4ALVA 4ENXA 5IUHA 3D2KA 2BCJA 4G9CA 1J7IA 3DPKA 4RG0A 2J90A 5E8SA 3VBVA 3ZDUA 4CT2A 2I0EA 3DFCB 4YLKA 2X0PA 3ZFXA 3AKLA 5C03A 4BCJA 2VD5A 5J1VA 4MD8E 4O0UA 5I9YA 4TWNA 1RW8A 1AGWA 3FPQA 1A9UA 4O83A 3PE2A 4PL3A 4DT9A 4LMNA 1BMKA 3MIYA 3PG1A 4AE6A 5JN2A 1TZDA 3BKBA 2VV9A 4LL5A 1SVEA 5FEEA 4Y46A 2UW6A 1NY3A 1BLXA 5DT3A 4OAUC 3DY7A 3DKCA 2OJJA 5E4HA 2B4SB 4WG4A 3MFSA 5LVMA 4RFMA 3KF7A 5LMKC 4ZP5A 3W2SA 5HNIX 2WMVA 1Q97A 2C5VA 3IDCA 3CE3A 5BVNA 3AOXA 3F3UA 1W8CA 2X1NA 3LCTA 1FMKA 3ODZX 5LWNA 3R7IA 3P1AA 3TEIA 2W9FB 3QZGA 4XHKB 5G6VA 3C5UA 3V01A 3UZRA 1H01A 1U59A 2PE2A 2WTVA 4OW8A 5CAUA 1WCCA 2XK4A 3EFKA 4BDEA 4UMUA 4NTSA 5L2QA 3TZ9A 2HYYA 1GIJA 4FKRA 3H30A 1OITA 4ACDA 1BKXA 4ZSEA 1IAJA 4DITA 3EQGA 5FXQA 1GZ8A 3OG7A 5TO8A 5CAVA 4X3FB 2YABA 4FTNA 3ZC6A 2VWXA 4HVSA 3TV4A 2ITPA 4FV1A 4DGLC 4EONA 5I9UA 1P4OA 1Q41A 3EKKA 3FMNA 3GGFA 4CLJA 5I3RA 1OECA 3PVWA 1PW2A 1P14A 2JIVA 3SLSA 3VUIA 5KMJA 3AT3A 3DJ6A 2YN8A 3HDMA 3KU2A 3G2FA 3QRJA 3WF5A 5L8JA 3D5WA 2XNOA 3A7IA 3KFAA 3TWJA 2R2PA 5F95A 2F2UA 5AIKA 2PZ5A 3COMA 3EFLA 4IXPA 4KWPA 5KKRB 4CV8A 5LARA 4M0YA 5BYZA 3L9MA 1PXMA 2GQGA 5M08A 1G8KA 2QR7A 1LEZA 1W82A 4YTCA 3EZVA 1XBCA 2F57A 3AGLA 4LGHA 4AFEA 4KNBA 4IWPA 3VF9A 3G15A 3HDNA 5HE2A 3ZO1A 4RX9A 2C6TA 3C4ZA 4Y85A 2DS1A 4H3PA 4W4XA 3OT8A 3KRJA 4QMXA 1WBOA 4BI2A 4J71A 4HJOA 2RG6A 3MWUA 4FYOA 3W0MA 4MYGA 3KMMA 5HU9A 5A46A 2ZDTA 5KMKA 4CKIA 4DLJA 2XYUA 3TUCA 3R01A 2FO0A 5HX6A 5KMMA 4UMRA 1KV1A 3UQFA 5TT7A 3F66A 4NL0A 5ICPA 1Q99A 5C1QB 5CENA 5IQBA 4BKZA 2YCQA 4KRCA 3W8QA 2PSQA 2W0JA 2XRUA 2QO7A 4KAOA 3SXSA 3P9JA 3RAKA 4DFYA 4QTAA 2SRCA 5HVKA 5I9WA 4GK4A 2HXQA 3IK3A 1K3AA 2HIWA 4UWBA 5C8NA 1OI9A 4FTRA 3H0ZA 3LMHA 5I3OA 4FX3A 3FV8A 4MUQA 3EQDA 4I3ZA 2XIZA 3CGFA 1EH4A 2Z7LA 3D15A 5CAPA 2C1AA 4BY9E 1CM8A 2BMCA 3P23A 4XP2A 2R5TA 3OT3A 4HNFA 3DXPA 2PUNA 5B7VA 4O0YA 5D7AA 5E8XA 4CFNA 5L6OA 2HXLA 4O4DA 4QMSA 2VWIA 4UY9A 5BQ0A 1TVOA 1Q8ZA 4F6SA 3DKOA 4HYUA 4RLLA 5AV0A 2UVZA 3RK9A 4ZLOA 4DTBA 3G9LX 3KQ7A 2GFSA 1S9JA 5M4CA 4JG7A 5LWMA 3AC8A 2W06A 3BEGA 2X4ZA 3R83A 4KABA 4IH8A 4R78A 3HV6A 3NUPA 4AU8A 3TTJA 4OTQA 3EYHA 4J98A 5DFPA 4QQTA 3SW4A 4DGOA 4GVAA 1FBNA 4I5MA 3MFRA 4DHJA 1GZNA 1CKJA 5E92A 3EN5A 4J99A 4WHZA 3COKA 4V0GA 3O23A 2CN5A 3NYOA 3BE9A 4FKIA 4C4JA 2YM5A 3GU5A 1Y6AA 4H36A 4YMJA 2I40A 3CD3A 4FV3A 3VUKA 4OUCA 2XM8A 3NR9A 3VUTA 3BBWA 3TZ7A 3A7JA 4IC7A 2EWAA 3UDTA 4RBLA 3QD0A 3ZFMA 3E93A 3B8QA 4MEDA 1E1VA 3DB6A 3UTOA 4RJ8A 2Y8OA 3WE8A 4C3FA 1OBDA 3Q4UA 3C4WA 3VS1A 4ANNA 4LOQA 2C6LA 2UV2A 1OIUA 2ZOQA 5GIOE 4N0SA 3PXRA 4PX6A 5CF8A 4Y73A 3C50A 2W1ZA 3F5UA 4K11A 3GVUA 2X2MA 1MRYA 4XP0A 4XS2A 3LZBA 4O7RA 4BB4A 3PA5A 5E9EA 4FT7A 1HCKA 4AXFA 4J1RA 4FNZA 4A9YA 4FV9A 2JD5A 1PXIA 3FI2A 4J52A 3VAPA 4D9UA 4CG8A 1DM2A 1FVRA 3LXKA 3KRXA 1YOMA 3OUKA 4RIYB 3W32A 4JRNA 3UDBA 2CJMA 4M84A 5B0XA 3DBEA 1O9UA 2BKKA 3O8PA 3SA0A 2JDTA 4I24A 5E8TA 5AR2A 4EH4A 3HAMA 3PP0A 5JK3A 1ZMUA 4RIWA 3UOLA 4ANQA 2P4IA 2Q83A 2QKWB 4FEUA 3E64A 1PYXA 3R04A 1LPUA 1H1QA 2Y4IC 4FKVA 4JVGA 5BUIA 1F5QA 3TT0A 4MX9A 4IEBA 2YERA 3NYNA 4D58A 3P78A 3LQ3A 5CXHA 4AN3A 2UVXA 4JDKA 2FUMA 1DI9A 4QP3A 5HIEA 3KVXA 4L45A 3VONA 1R3CA 4LYNA 1P2AA 3B8RA 4X2GA 4UXQA 5JSMA 5CEIA 1YI6A 3DLZA 1M2PA 3QC4A 3UOJA 4UN0C 4QQ5A 3N4VA 3DS6A 3UDSA 5GZAA 2ETMA 3BEAA 4QMQA 3R63A 2C47A 2V5QA 2PE0A 2GHLA 5H8BA 4FEVA 3MI9A 1T45A 5DNRA 4EH8A 5IQGA 3EZRA 2PY3A 3CJGA 3FEGA 1STCE 1GJOA 4MQ2A 3F88A 4JJRA 1GIHA 4P2KA 3DOGA 3F2RA 1H07A 4BBFA 2P3GX 4L00A 4OTGA 4ZTRA 1IEPA 3R22A 2VWWA 4RA4A 3I7BA 3ANQA 1FQ1B 5AM6A 4CXAA 1JSTA 2WHBA 3U6IA 3F69A 4FIGA 2GU8A 1NVRA 3BZ3A 3A2CA 4DTAA 1Q3DA 4Y5QA 1JOWB 4BKYA 3NDMA 3ULZA 1F3MC 2YJRA 3LCKA 4LG4A 3GU4A 1PRYA 3LLTA 4EBWA 2F4JA 2PMOX 2PTKA 2P2IA 2VTRA 2NO3A 4E8AA 3CY3A 3R2BA 2Z7QA 5AV4A 4KKGA 4P7EA 5EYCA 4ASDA 3PXQA 4IQ6A 5CF5A 2QCSA 4TZRA 3KC3A 5BX0A 5EM7A 3IOPA 4BZNA 4F7JA 5LVPA 4ITJA 1GOLA 1U5RA 3MY1A 3A8XA 4GK2A 2R3NA 5HHWA 3QKMA 4XX9A 3V5PA 5A4EA 2BRNA 3KVWA 3HAVA 4IWOA 5FUTA 2ITWA 3RTPA 1ZYSA 3PLSA 1A06A 3NZ0A 2IZUA 4I0SA 5HNBA 2WOTA 4AZEA 4BN1A 5K0XA 3BLAA 5HO7A 2YHVA 4PL4A 3HA6A 3W10A 4CV9A 4F99A 5HTCA 2JKOA 3OWJA 2ETRA 2QOQA 4JX7A 2J5EA 4QYFA 3Q9YA 1OPKA 4DHIB 2G01A 2XM9A 1U5QA 1H4LA 4L44A 3FAAA 5ANGA 4G6OA 4C4IA 4XV1A 3GCSA 3AMYA 4IM3A 3FY0A 4M67A 4ZSAA 3LFFA 4BDGA 5HKMA 4PP7A 3FUPA 5JEBA 3H3CA 4TWCA 3GOKA 2PVKA 3I7CA 3IQ7A 5CSPA 4NM7A 4H58A 5I9XA 5HLNA 2W05A 4OTDA 4AFJA 2W17A 4DE4A 4EBVA 2YAKA 4E4MA 3VS7A 2WB8A 4AT4A 4IZAA 4O82A 4FKSA 4JX3A 3ZEWA 4MVFA 2R3RA 3BL9A 3BCEA 4GJ3A 3WF7A 3FDNA 4E93A 2AQXA 3FLQA 5LMKA 2OW3A 4L01A 1OM1A 2UW9A 4RLKA 5TOZA 3A7HA 3U6HA 3O5AA 4B9DA 3VJOA 5I9VA 2QOIA 4AXAA 1YHSA 4O91A 3MPTA 4BR3A 4IDVA 3UNZA 2IW8A 2HW6A 2W9ZB 2VTNA 4IHPA 4C61A 4PWNA 1YKRA 1QL6A 2DYLA 2ITZA 1H0VA 3HUBA 4ZOGA 4XH6A 1YXUA 4IJPA 2YFXA 3KXZA 5ANOA 5KE0A 4GT5A 1RQQA 4QNAA 1OKZA 5CNNA 3REPA 3T9IA 3A4PA 4YJUA 2VTJA 4UB7A 5DR6A 1Y6BA 3MFTA 5HVJA 2YM6A 5BMSA 3JR1A 3OXTA 3FZRA 5FM2A 4X7QA 4ITIA 3C9WA 3OP5A 5A4TA 5JQ8A 5EQEA 5BV3A 4LOOA 4C3RA 1K9AA 2BZIB 4ZZMA 4P5ZA 3FI3A 4O0XA 3FSKA 2YLEA 4OR5A 3ENMA 3P7CA 1Q61A 1WBWA 4H1MA 4EKKA 1FVVA 2BR1A 2F49A 3RCDA 5GINE 3SOCA 5BVWA 4J7BA 4RJ3A 3TV7A 3ORMA 5BNJA 3P08A 4AA5A 4ARKA 2O65A 4FIIA 3ZO3A 2WMQA 4RQKA 4P90A 4MXCA 2W1IA 4B8LA 3FMLA 4O7SA 3QA0A 2UZVA 3PYYA 2R3IA 4ANMA 1REJA 3RHXA 3TJDA 3FMJA 2LAVA 3ZLWA 2E9VA 3FKNA 4ASXA 1JVPP 5DR9A 4MBLA 2BUJA 2J0LA 3DK6A 2WTCA 2Y4PA 3V5TA 4QYYA 5JH6A 2BIKB 4G16A 5AP3A 3PDTA 4U41A 2HZNA 3QLGA 5DEYA 2DQ7X 2VNYA 3FMEA 1XH4A 4DT8A 3WARA 1PMNA 4NW5A 1LUFA 4RWKA 5AUWA 5DPVA 1OL6A 1R0EA 3MS9A 4EOSA 4GV1A 3RM7A 5M53A 4I94A 1XH5A 4FSNA 4G6LA 4XRJA 4ZMFA 5FTQA 3QWKA 2O2UA 3EQIA 2IPXA 3PJ8A 1XMLA 2KULA 4RWLA 2JGZA 2YA9A 3QYWA 5DGZA 2PVHA 5H9BA 3ZU7A 3R9DA 3SAYA 3VWAA 2A2AA 3BYVA 3ZXTA 2CHLA 1V0BA 5EI8A 3GB2A 3UIBA 4MQ1A 5HO6A 4EYJA 2J9MA 3PXFA 2EXEA 4USDA 4C8BA 1KE5A 3CTJA 3ORXA 4OTRA 2YIYA 2VGOA 5KMOA 1OL2A 3TIZA 3ZCLA 5IA2A 1YDRE 5J8IA 5D7VA 2HWOA 5CLPA 4NZWB 5E91A 3V6RA 4GKHA 3OS3A 4FV8A 4EK8A 4LGDA 1BI8A 3A7FA 3O17A 1JSUA 2OBJA 4G6NA 4I4FA 2OK1A 4A9TA 3GC8A 3QHWA 4FOCA 4F7LA 2YAAA 3UP7A 4MTAA 4FT3A 2JDOA 2X7GA 3PIZA 4Z7HA 5EYMA 5CXZA 2WTJA 2ZM1A 3PXKA 4GS6A 4DA5A 3QTQA 3GC7A 1KE8A 2YM3A 3C1XA 3ORLA 3GI3A 4GT4A 4L3JA 3ZEPA 3R9OA 4TW9A 5M55A 4E3CA 5K9IA 4BJJA 3KMUA 1KE6A 3W18A 3SGCA 5AV1A 3WE4A 4AQCA 1SVHA 4HVIA 4YJOA 4CKJA 1ZY5A 2OIBA 5TF9A 2I1MA 3ZO2A 3FBVA 4OBPA 5IH4A 3F61A 2VTLA 4C37A 5GIPE 3QRIA 4F65A 1PF8A 1W83A 4F1OA 3VNTA 2CPKE 2OJIA 3NX8A 3VS5A 4APPA 4JBVA 2WU6A 4LQMA 2OIQA 4YO6A 3GU6A 4DG3E 3RM6A 3JXWA 3RPVA 4M3QA 2QOCA 2VUWA 3AMAA 3PPKA 4C3PA 5IQIA 1YI3A 4I0RA 4FSTA 5CF6A 4FIFA 3LFCA 2B55A 4YZBA 4DEGA 3OC1A 3U8WA 4BC6A 5FEQA 3A61A 4A4LA 3G51A 4D9TA 2YITA 4YJNA 3TKIA 4DH8A 4EK5A 3SV0A 3EQCA 3GCVA 3QGYA 3KCFA 3PE1A 5LVOA 2R3GA 4LGGA 3A99A 5ANJA 2QHMA 1H1WA 1MQ4A 2QURA 4PDSA 4RIWB 4RJ7A 3V51A 2X39A 3R8VA 1Y91A 2RF9A 3PA4A 4I22A 5LCJA 5EDRA 3CQUA 3LXPA 3D7ZA 2E9NA 3OEFX 4FSZA 4OTHA 4RC4A 4XMOA 1TQPA 2UW3A 4LL0A 4N6YA 5ETCA 4JDJA 4NM5A 4TYEA 4M69B 4IM2A 4ZEGA 3DXNA 4YZMA 5K5XA 5L8KA 3R0TA 5CEKA 3CGOA 2QI8A 4JBPA 2C6IA 3R00A 4Q5HA 5AP2A 4YTIA 3MVMA 2YEXA 5AUTA 4FC0A 4BDDA 3I79A 2ZV9A 5KX8A 5FP5A 3L8PA 5ETIA 4QMPA 4DFBA 3NEWA 2B0QA 4CGAA 4IAAA 2WELA 4OBOA 3D9VA 4EC9A 4C35A 4FSWA 1OUKA 2W4KA 4C36A 1YWRA 3O96A 3E8DA 4DEDA 4XBRA 2OG8A 3FWQA 5LJJA 3KXNA 4QT1A 2ERZE 2X2KA 3KKVA 3UIXA 4AZVA 3E87A 1M2RA 2GTMA 5AX9A 3PUPA 4O0WA 2GSFA 3D5UA 4C2VA 4PMPA 5KCVA 5C4LA 1J7LA 3CKXA 5CASA 4ALUA 5GJDA 2QOHA 5AM7A 3WZJA 2VO6A 2WIPA 2ITNA 3DDPA 4ZTQA 1H27A 3KXGA 5CX9A 5DLSA 4EL9A 2BILB 3R1SA 3FLYA 3EJ1A 4F08A 4EK4A 3AD6A 3TZMA 4UXLA 4FK3A 4ANSA 2JEDA 4EHVA 1ZWSA 4U3YA 4C4HA 1G8SA 4GKIA 4DBXA 4TTHB 3HUCA 3TDWA 4AF3A 4G9RA 4MWHA 4I5CA 5AP1A 4CCBA 5E8VA 4BIBA 2XH5A 5KMNA 3BHUA 2PUIA 3AD5A 2VTMA 3PIYA 3TM0A 4QNYA 2GNHA 3LLAA 3ITZA 5CSXA 4AUAA 5AUVA 3UYSA 5DWRA 3C51A 3UC4A 3ZSGA 4IB5A 4CYJA 5L2TA 4QMNA 5EW9A 2VNWA 3EIDA 3D5XA 3JVRA 3FZTA 1XJDA 1I09A 3NCZA 4KUJA 4FJVA 4EH5A 5G1XA 4UMQA 5ANIA 1L8TA 1VZOA 2X8IA 4RC2A 4L42A 3TJCA 3O7LB 4PY1A 1UU9A 4J8MA 4U79A 4EOJA 3DBQA 3LMGA 1PHKA 1QMZA 4IAFA 3CD8A 5IKWA 4MXZA 3IO7A 2IZTA 1WBNA 4JQEA 1ZOEA 2ZYBA 3HRBA 4DEEA 4QTCA 4FV0A 4WG3A 4TWOA 3BQRA 2G2FA 3BWJA 4GU6A 4GJ2A 4WRSA 4NCTC 2YDIA 3QKLA 4LV7A 4IACA 4ACMA 3BYMA 3Q2JA 4FSUA 5TE0A 3P5KA 3BELA 4CCUA 5IQFA 4FKTA 2C6KA 2LGCA 2OZAA 3MGYA 3O8TA 4IMYA 4YTFA 3M42A 4X6RA 4O4EA 3MB7A 2OXDA 4EORA 3C13A 3R7OA 3U87A 2UZLA 1IR3A 2WIHA 2JKQA 3NNWA 4QD6A 5LQFA 3TN8A 2XA4A 5M57A 4BYJA 4I1ZA 5IDNA 4YHFA 2P33A 4W8EA 1BL7A 3VUHA 4DGNA 4RGJA 2ITXA 5HZNA 4TYHA 5IMEA 3HP5A 3GFWA 1XWSA 3VQHA 3AC3A 5AUZA 3EKNA 1RJBA 3WZEA 3NIEA 3C4FA 4N4SA 3KGAA 3QU0A 5D10A 5T6KA 4I5HA 5JGDA 4NM0A 3WF6A 4WIHA 2VTOA 4L67A 4FL2A 2J4ZA 3QA8A 2OH4A 2X6DA 3QQKA 4CFFA 3MPMA 1XHAA 1UNGA 2RGPA 4IX4A 3E8CA 4U0IA 5AP6A 4R3RA 3K3JA 3QXOA 1YOLA 4F4PA 3O50A 3PTGA 1ND4A 3QL8A 5HTBA 4JI9A 2QOOA 4BWXA 4YZDA 4IVBA 2YIRA 3FMMA 2W7XA 3OCTA 3Q60A 3UGCA 3VC4A 3QALE 3S4QA 1OL7A 4E6QA 2IO6A 2ITUA 1XH9