4U3ZA

Apo map4k4 t181e phosphomimetic mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
295
structure length
282
Chain Sequence
SLRDPAGIFELVEVVVYKGRHVKTGQLAAIKVMDVTEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDREVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
total genus 82
structure length 282
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u3zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u3zA01
2XK3A 2VU3A 3ZO3A 2F9GA 2VWIA 2V62A 4YTCA 3GC9A 1TKIA 2UVXA 5FRIA 4Z3VA 5K5XA 3HV3A 4FIFA 3LLTA 4J98A 4HYSA 3GP0A 4FZDB 5I3RA 3OOMA 2QOFA 4U81A 4EYJA 4C33A 3U6JA 1JLUE 2OFUA 4WUAA 5I5ZA 1P5EA 4EOKA 1ZYCA 2JKKA 3MB6A 4NYEA 3TTJA 3DQXA 5HLNA 1NA7A 1LPUA 3CP9A 3Q60A 4FX3A 2ITOA 1EH4A 2GHLA 3WZKA 4DEHA 3PYYA 1OBDA 2QOKA 2EB3A 4FL3A 4M15A 2OLCA 4PMSA 3TUBA 3KA0A 3QGYA 4FK6A 2FSTX 3NSZA 4JQEA 3A60A 2OJFE 2X7GA 3FKLA 3IG7A 3HUCA 5AR5A 1ND4A 4H1MA 2OU7A 3WYYA 4MF0A 4CFFA 1S9IA 2RG6A 2VGPA 3HL7A 3PA4A 3NUPA 3BYVA 2J0LA 3LXNA 3ENMA 3NW6A 4RVTA 4ASXA 3IK3A 3IONA 3LJ0A 2A27A 1YHVA 4M69A 4DEAA 4ZS0A 5HNGA 2H96A 2ETRA 4XV1A 4C3FA 4AG8A 5CU0A 2ZYBA 5KZIA 3GXLA 4EOMA 2ZVAA 3DXNA 4KIPA 3AMBA 4IHPA 2OJGA 4BICA 4ANOA 1U5RA 3RWPA 4C4EA 1WVWA 5FTGA 3ULZA 3TNHA 4RC2A 3OY1A 1ZOEA 2J6MA 3RPSA 3LIJA 2X9FA 5ANEA 4IWDA 5M06A 3MGYA 5KKRC 2B0QA 1XJDA 4IH8A 3WZJA 4E4NA 3PP0A 4G6NA 1JSUA 1APME 1KE8A 3QAME 3RP9A 4L42A 3PJ2A 2QOLA 4YBKA 3PWDA 4IZAA 1PMUA 5CEOA 4UWBA 3R1NA 4CXAA 4XOYA 4F99A 5A4CA 4XP0A 2C47A 2BRMA 4MWHA 1PF8A 3LVPA 3R9DA 2VWWA 3FLSA 2ITPA 4KABA 4BCMA 3FXXA 4D0XA 2I6LA 3E88A 4DLJA 3CCNA 1Y91A 4X3FB 2QCSA 2PPQA 4JAIA 4XCUA 4M97A 1Q8TA 3Q9XA 4DLIA 3VC4A 3R0TA 3AT2A 3EL7A 4FV3A 3GI3A 3RNYA 2Q0BA 4IX5A 3KMMA 4ZTQA 1HOWA 4U41A 5HO8A 3QTIA 1I09A 4NIFB 5FM3A 5E8ZA 4YO6A 2PU8A 3OCTA 5M4CA 4FNWA 3QRUA 3W10A 4HNIA 3EOCA 4PNIA 3P08A 2W05A 2B53A 3GEQA 4LM5A 4RIWA 3BZ3A 3VUTA 3SDJA 2VWUA 3V5QA 3QQGA 3SA0A 4NK9A 4HGEA 5KBQA 3ZRLA 3FC2A 4HJOA 4EUTA 3O7LD 1O6YA 1YRPA 3TNIA 4C36A 2JEDA 2BZKB 2G2IA 2YIYA 1MQ4A 4S30A 4C61A 3T3VA 3UIUA 5BVDA 2Y0AA 1V0PA 3B8RA 3G5DA 4XS2A 3CKXA 2WQBA 3K3JA 3OXTA 5D9HA 3UG1A 4L46A 2ZM3A 4CTBA 3SXFA 4IDTA 4MD7E 5L2TA 3C9WA 3GC0A 1AGWA 4C4FA 3NIEA 2RKUA 1ZWSA 3QCXA 4HGSA 3BV3A 4YZCA 2CN8A 1WBWA 3EQCA 4DGOA 2I0VA 3OT3A 2XK4A 2WMWA 5CNNA 2WNTA 3FZTA 1Y6AA 1ZMVA 4FTOA 1FMKA 5CXHA 4F6SA 4YO4A 4C38A 5IPJA 2R7IA 2YACA 2E9PA 2B54A 3CPCA 4L68A 4ZTNA 3V51A 5KUPA 2YJSA 2X6EA 3FQSA 2QO7A 4RIXB 3O8TA 1F0QA 4ZMEA 4QMZA 4BDAA 3ZFMA 4DN5A 2BZHB 3ZCLA 3R73A 4P90A 1H01A 2BAQA 4RC3A 3EQGA 4O21A 4GUBA 3MTLA 3LXPA 4LYNA 3BKBA 2QU5A 4APPA 5M4UA 1OKZA 2C6LA 5D11A 4K2RA 3O71A 5B7VA 2YM5A 5HE0A 4AUAA 4E6AA 5E9EA 3MS9A 2W0JA 3R8MA 3SV0A 2X2MA 3V5PA 3V8WA 4E4XA 5J5SA 3LXLA 4PMPA 4QYEA 4L67A 3OOGA 5AV3A 4KAOA 5LMKA 4AW2A 4JG6A 4NJDA 5H8GA 3FLYA 3V5JA 1U4DA 3QRIA 4D4YA 3HMPA 3LAUA 1GY3A 3GC8A 2IO6A 4DFYA 4G2FA 4DEBA 5H2UA 1IASA 2VWZA 4EKLA 2Y6OA 3CY2A 5H8EA 2HXQA 1PXLA 2XIZA 2QHMA 2XIRA 5D12A 3OEFX 3MH2A 5CAUA 4XV3A 4I41A 2VTSA 3CPBA 3ZO1A 2PWLA 5EYKA 3A8WA 1J1BA 4FSYA 3OCSA 3ZHPC 1MUOA 3NNVA 3OFMA 4WKQA 1KSWA 4OR5A 4AN2A 5DFPA 3EQHA 3AD4A 4F9BA 4D55A 3QA0A 4MXCA 3K2LA 2C30A 3AC4A 2H6DA 2YCQA 4LQMA 2I1MA 4QTDA 4WNPA 5BUIA 4YC6A 3FSFA 3U6IA 1TQPA 4YJVA 4GCJA 4M0YA 4FV6A 2CGVA 4BYJA 4Y72A 4JIAA 1PXIA 4UXLA 4L8MA 4OTGA 4IANA 5HCXA 4I23A 3CKWA 3IOPA 3KMUA 4XX9A 5HI2A 3S0OA 4M8TA 4BDBA 1OM1A 2GS2A 2JBPA 3OY3A 3QC9A 1QPEA 5CASA 5C8KA 2QO9A 2JIUA 1B38A 5CALA 3BYSA 4Y85A 4FT9A 2J0IA 2WAJA 5ETIA 1OL1A 3UZTA 4IIRA 3RM7A 3O23A 3UZPA 3MFTA 1K2PA 3AXWA 4M67A 1JKSA 3DDQA 2JD5A 3E8CA 4HPUE 5AP4A 3ZMMA 2IZSA 3OCGA 3O2MA 2XNNA 1OPKA 5J1VA 1CM8A 2HIWA 3FEGA 3KRRA 4CD0A 4DGLC 1FINA 3SG9A 3OUKA 4QMOA 4GT4A 2WU6A 4YHFA 4FT3A 3HUBA 5M09A 4KSQA 2WXVA 4LMUA 4H36A 5ACBC 3W2OA 1QMZA 2J50A 2VTJA 5FWKK 3I7CA 4QP3A 1W7HA 3TNPC 1JQHA 5M4FA 3Q32A 4TKSA 2BRBA 4KINA 4W4WA 5LWMA 4TYEA 5CS6A 4O7VA 5CX9A 4JDHA 3BU6A 3R1SA 4R77A 3MSSA 3KN6A 3QLGA 4FIEA 2AUHA 4MNEB 3GCVA 3UMXA 5DA3A 3VS7A 4CEGA 4QMMA 1TVOA 4E20A 3ZO2A 2I0HA 2PSQA 3D5XA 3OWPA 4RPVA 1ZY5A 5AM7A 4AA0A 5CYIA 3NCZA 4AS0A 2UW8A 4S33A 3V5TA 2F2UA 3DBCA 4JBPA 5EW8A 1YHSA 3HGKA 4PL4A 3V6RA 4JVGA 4ZSLA 2ZB1A 3BEAA 4IVAA 5HG7A 2VWVA 2XS0A 4O27B 5BVWA 4M7IA 3SXSA 5DMZA 5TT7A 1WBVA 2F7ZE 3TNQB 4D1SA 2YDJA 3QD4A 3FQEA 2HZNA 3FMLA 3KVWA 1XH7A 5T68A 3ZM4A 3VS3A 4M3QA 2CPKE 4W9XA 4Y46A 3AC1A 4AGWA 1OITA 4IAIA 5AV2A 5HICA 3ZOSA 5A54A 4U5JA 3E62A 2CGUA 2VGOA 4YSJA 5ICPA 2NRYA 2VAGA 2HY0A 2GTNA 5DVRA 4BKZA 4MK0A 1H28A 4DF3A 3I79A 3FL5A 4RJ3A 1G3NA 3MJ1A 3HMNA 4I4FA 4XUFA 4AOJA 3AQVA 2J7TA 3RAKA 4FA2A 3VS2A 3QZHA 4YPSA 3DFCB 3ZDUA 3ZLWA 4QP8A 4F7JA 2W06A 5L6OA 4QMYA 4ACGA 5A4TA 2W1IA 1PMNA 3QCQA 4IAFA 3EQFA 4KKGA 2EXEA 3KN5A 3Q53A 3FSKA 3OWKA 4FEWA 4XV9A 4BI2A 3F6XA 3MFRA 5HVYA 4Z7HA 3HMIA 2VN9A 2JFLA 4IM0A 5EKNA 2BDWA 3I1AA 2ITVA 5EYDA 2YDKA 3QUDA 4DFBA 5CF5A 2CKPA 5K0XA 5HORA 2GNIA 2BROA 4FYNA 3F3WA 3AD5A 4Y95A 3DXPA 1XH5A 5ANIA 5M4IA 3QCSA 4GFOA 4M69B 3FZPA 4EWQA 2O0UA 2W1CA 1YXTA 5JMSA 2XIXA 4HCTA 3SG8A 1Y8GA 4K11A 4AFJA 2CJMA 1YHWA 5JK3A 4TN6A 3AD6A 4LRJA 2IW6A 4BF2A 1CMKE 4IE9A 4XV2A 5DLSA 4QQTA 1GZNA 4FTJA 4FKPA 4USEA 1OBGA 1OIYA 5F1ZA 3I7BA 3EMGA 5M51A 5I4NA 4E8AA 3MIYA 4UMPA 3RAWA 4GFGA 4O6EA 4DINA 2PUIA 3EN7A 2FSMX 5D1JA 1WZYA 2Z7QA 3PPZA 4NM5A 3VO3A 2FYSA 2Z8CA 4G1WA 4K33A 3VW8A 4MXYA 3U87A 4JG7A 1TQMA 5K3YA 1X8BA 1R1WA 2ERKA 4P5QA 3MH3A 2XK6A 2UZNA 4PP9A 4XRLA 5BVNA 3DLSA 5I9VA 3A4OX 2J4ZA 3DA6A 3PXZA 3ZH8A 4ANLA 5EH0A 1YVJA 4U8ZA 2B9HA 3IKAA 4U42A 3NZ0A 4GG5A 3GU8A 4FIHA 4YNOA 3E3BX 3JPVA 5HIBA 4HGLA 3EIDA 4G5JA 3WE8A 5IUIA 3TZ9A 3RHKA 4E73A 2OH4A 5ANGA 3PIYA 5EM6A 1H25A 5GNKA 4U79A 1E1XA 3Q9WA 1Z9XA 4J52A 3TZMA 4LG4A 2YLFA 2P3GX 3ZM9A 3TT0A 3UOKA 3DTCA 5A6OA 3UQGA 3RAHA 5G1XA 4O7ZA 3F7ZA 3U9NA 3MA3A 4OTQA 4QYGA 2AC3A 4IVDA 3FXWA 4O0YA 2UW4A 4BCFA 4DTBA 5T6KA 3ZO4A 4QD6A 4FYOA 2JDRA 5CAPA 2BIYA 4GG7A 5A3XA 1FVTA 3ORIA 4TT7A 2CNQA 4A4OA 4FTIA 3QZFA 2QR8A 5E92A 3QX4A 4JRVA 5CF4A 2RIOA 3FBVA 4HVIA 3PG3A 2WTVA 4TWOA 3TKHA 3F2AA 4F0GA 3QRTA 1PY5A 4DFXE 2OZAB 3SOAA 3F5GA 3DKOA 1OI9A 1J7UA 3OTVA 3OZ6A 4V01A 4IAAA 3IO7A 4MX9A 4XG3A 4GSBA 3ZSGA 2BPMA 2X39A 4DT8A 4U7ZA 3R9NA 3W8LA 2R7BA 4GV1A 4UALA 2PE2A 4F7SA 1W0XC 3CD3A 5CNOA 3QD0A 4LV8A 2XYUA 2UW9A 5AX9A 3K54A 4EC8A 3F5XA 2BTRA 4NJ3A 5AR3A 3KXNA 2ITWA 4UB7A 1K3AA 3ZC5A 5E8UA 3RCJA 5JFSA 3PJCA 3RVGA 1H07A 1XR1A 2XNPA 2XRUA 4J96A 3BELA 1REJA 2R64A 1H24A 3D9VA 5ANDA 4RZWA 5L2QA 3FLWA 4MHAA 2X6DA 4C7TA 3SRVA 2R3LA 5M44A 4CCBA 5HTIA 4L7FA 3QZGA 3ANRA 4MNEA 4HVHA 4RFZA 3W2CA 5K0KA 2FSOX 3BHUA 4I0RA 5K9IA 5ANOA 5DT4A 4I21A 3U51A 3M11A 4MNFA 5L2SA 4F64A 4ZLYA 4PDSA 4GU6A 2GDOA 2WIPA 4JJRA 2YLEA 3O7LB 1PYEA 4XBUA 5B2KA 5EHOA 2HW7A 3QQHA 2I40A 4FVQA 4FNZA 4RC4A 4ZK5A 5J87A 2W9FB 4OW8A 4L53A 5AV4A 4NEUA 2XEZA 3QD2B 3SHEA 3DPKA 4ONAA 5AR7A 3MA6A 4USDA 4FT0A 4TW9A 3FY2A 4APCA 1GNGA 3ET7A 2BRHA 3RPRA 3NGAA 3EZVA 3P7CA 4S31A 5BMMA 5TOZA 5F4NA 1QPJA 3LFCA 4MBLA 3UE4A 4ACMA 4OTFA 3R7UA 5HVJA 1VR2A 2QURA 3BWFA 4CZUA 3LQ8A 4JBOA 3IECA 5EDRA 1BUHA 3LKMA 4DFUA 4ZTLA 1YOJA 3BE2A 2VNYA 3QCYA 4HW7A 5CXZA 3A4PA 1PJKA 4RZVA 5AUYA 3HEGA 5GZ9A 1OL7A 4MEDA 2PULA 5LMKC 2YJRA 4RVLA 1UNLA 5IQIA 2C0TA 2UW0A 3BHHA 3G33A 1W98A 5HHWA 5JFVA 2HELA 3R1YA 4GH2A 4I5CA 3F88A 3UNKA 4FV0A 3C50A 1UNGA 2ONLA 2IZRA 4WHZA 1PYXA 3F5PA 3L1SA 4BGQA 3PZHA 4F9YA 5AAEA 4PQNA 4N4SA 5FBNC 3W2SA 3R63A 3S00A 4TPTA 5DIAA 3BGPA 2X2KA 3TI1A 4E6QA 5LVLA 5LVNA 4XG9A 2UZBA 3GB2A 4NKAA 1J1CA 4Y83A 2J90A 4CTCA 3C13A 2QKRA 3DBFA 4CYJA 2OIQA 5L8JA 5CSPA 3QTUA 5CU3A 4NH1A 1DAWA 2GNFA 4G3EA 4U6RA 4G16A 2HZ4A 3ORMA 4IVBA 4CKJA 3LMGA 4WNMA 2JITA 1XH4A 5KMLA 2ZB0A 3R22A 4UV0A 3ID6C 4EHVA 3UQCA 4LI5A 4G6OA 2IN6A 4DG3E 1U46A 5CU2A 2G2FA 2VWXA 4YC3A 1KOAA 5FDXA 2G2HA 5A6NA 4O0UA 3ODYX 4XH6A 2X7OA 1FPUA 4NM0A 4WBOA 4F4PA 2UZTA 2B4SB 5AP7A 5HNIX 1DAYA 4G9CA 4CZYB 2JDSA 2BR1A 3E92A 4EOQA 1UWJA 1OIQA 4WG5A 5IA4A 1G8AA 4KSPA 4EHGA 4Z7GA 2BMCA 4BDHA 4CZTA 3FJQE 3HAMA 1CKIA 4FTAA 4FTCA 3IS5A 4O22A 4U43A 4BI0A 3THBA 4YMJA 3NR9A 2GU8A 4FEVA 4A9RA 5C1QB 3NDMA 2EB2A 2OO8X 2PK9A 1R78A 3L8SA 5L8KA 4YZMA 3G6GA 5IQDA 4IZ5A 3VNTA 3QTZA 3DKGA 2UZLA 3L8PA 2OK1A 4KIKB 2X2LA 3ORPA 4H3BA 4XG4A 3LMIA 1PKDA 4MH7A 1S9JA 1H4LA 4ZAUA 1BLXA 2X7FA 5M56A 3C0GA 3P86A 3RZFA 3FPQA 1CTPE 2IVTA 2HK5A 3BIZA 3G9NA 4FV1A 4ZJVA 3NNWA 2YWVA 2YAAA 2J0KA 5EI2A 3M42A 2WTDA 1OIRA 4FOCA 4OLIA 4I0SA 3TUDA 2G01A 3PZEA 2Q0NA 2WMAA 2RFDA 3IDPA 2WTCA 3O17A 3QX2A 3QYZA 4X2FA 5AUXA 4CFVA 3UMWA 3G0FA 5D41A 4E6DA 5HIEA 3MB7A 4IAZA 5JGDA 5M57A 1PXNA 5BNJA 4CCUA 2WQOA 3ZZWA 3UO4A 2GMXA 1OUKA 3JYAA 4BCIA 5LOHA 4J1RA 3WZDA 2VWYA 4ENXA 5KE0A 3NYVA 2X8EA 3OHTA 4OT5A 3CJFA 2QKWB 3HKOA 1J7IA 1O6LA 3MTFA 4B4LA 4RRVA 5EQPA 4M14A 4F7NA 3E93A 4UWYA 4RIWB 5IA1A 1P2AA 4FKVA 4FSMA 4BHZA 3TUCA 3C4ZA 3LOKA 2NO3A 3MY0A 4GT5A 4CT2A 4L9IA 4RJ4A 4O0TA 5IZFA 3FI4A 3DT1A 1YDSE 2WTWA 4UMRA 5KKRB 4RA5A 5AA9A 3W55A 5M53A 5JZNA 4EH5A 3V5LA 1YI6A 3MVLA 4YNEA 3ZEWA 2HW6A 5L6PA 5DEYA 1PHKA 3LM0A 3FKNA 2B52A 4NKSA 4S32A 2WMRA 2YCRA 3WF6A 5BVFA 4HYUA 3SW7A 3D15A 3OS3A 3QHRA 4LMNA 5IUGA 1BMKA 4MD9E 3DK3A 3ATTA 2PMIA 4C3RA 4FTUA 4YBJA 2X1NA 2XBJA 4YJUA 3VBTA 3P9JA 3UIXA 2H9VA 4BWKA 3QLFA 5JGAA 5DNRA 1Y8YA 3JY9A 3V3VA 1DI8A 3VW6A 2WTIA 2X9EA 3V8TA 4HPTE 2PZYA 3ZXZA 2XA4A 4YP8A 4C4HA 2C1BA 3WF8A 3UQFA 5HD7A 2WQNA 3RZBA 1SZMA 3QKLA 4R7IA 5J95A 3OBJA 3C7QA 3I5ZA 5CT7A 4QPSA 2R3GA 3S2PA 5CVFA 2PUNA 2GFCA 4MWIA 3P7BA 5D10A 3C5UA 5E4HA 2BIKB 1UU3A 5AP2A 3ZXTA 3FY0A 3S95A 4CFUA 4L52A 2GNHA 2I0YA 3BCEA 3DB6A 5HNBA 5KBRA 5K5NA 4BDFA 4J71A 4DH5A 3BE9A 4YHTA 3TKUA 4M12A 4O86A 2LGCA 2J5FA 3JVSA 4JX7A 2Y4PA 4OBOA 2R9SA 3ZTXA 4A7CA 3UPXA 2OSCA 4X3JA 4MVFA 5LQFA 2UW5A 4LGHA 3O8UA 3NNUA 1Q5KA 4EQUA 2XMYA 3V04A 5ANJA 5C03A 1XQZA 3KEXA 2Z7SA 1IR3A 2O65A 2WO6A 4YJOA 4NIFA 2EWAA 3OWLA 4GU9A 5LCKA 4BFMA 4ZZOA 3CSVA 2PUPA 4NU1A 3BGZA 3VBXA 2CKEA 4GJ3A 4EL9A 5B2LA 4AN9A 3HV5A 3Q4CA 3QXOA 4XP2A 2XEYA 3G9LX 3KCFA 4L43A 5M55A 4FIJA 3VRYA 3R2BA 2VWBA 1ZYLA 4O7NA 2WMVA 4F6WA 2XUUA 3H0ZA 2PVYA 1UKHA 3W33A 5HLPA 2WGJA 4WBBB 3K5UA 4MKCA 4C35A 3BV2A 3FUPA 4DFNA 3IW7A 4RX9A 5AWMA 2B9FA 4H3PA 4B8MA 4ZY4A 4ZXTA 5BMSA 5K4JA 2ETKA 2VX3A 3R8ZA 2X4ZA 3UO6A 4R3RA 4UZDA 5HE3A 4HVSA 4O7TA 3D5UA 5LJJA 1KUTA 3R21A 4RWLA 1FOTA 4FG9A 1UVRA 2QHNA 3VS1A 4ALWA 1WBPA 3I0OA 1Q62A 1IRKA 3ORXA 3PRFA 3GFEA 4LGGA 2OGVA 5HG9A 3W18A 4BZOA 2VZ6A 5JKGA 4CG8A 3VF8A 2UW6A 3M2WA 4QMNA 2HY81 4F9CA 4ASZA 4RJ8A 4I22A 5CSXA 5HBHA 3RPVA 3UP2A 3ZLSA 3MVJA 4XG8A 5HKMA 5AJQA 4GW8A 5DH3A 3GT8A 4BB4A 3JS2A 2OXXA 4MXOA 3QTQA 4I20A 5IH4A 4GMYA 3TV6A 5IKWA 4PMMA 4EK3A 4JDIA 2DQ7X 3UGCA 5DPVA 3GNIB 1J91A 4H58A 2XNGA 2CKOA 3VJNA 3Q3BA 2PVMA 4M0ZA 2WOUA 4AU8A 5EFQA 3LFQA 4I6FA 1IAHA 4GS6A 2GS6A 3R9OA 2P33A 2QLQA 2JIIA 2F7EE 3GGFA 5AP0A 3PG1A 2C69A 5EW3A 5T3QA 5AM6A 3TEIA 3UIBA 3UYTA 5HQ0A 3TM0A 3KK9A 4GVAA 4HYHA 4E4MA 1U5QA 2RFNA 4BVUA 2CGXA 4ERWA 4EHZA 1AD5A 3UZRA 2C1AA 5J5TA 2W4OA 2VD5A 1SYKA 4GUEA 1NT2A 3KK8A 2G1TA 5KMKA 3B2TA 5KHXA 5H3QA 3OP5A 3FAAA 4AZFA 2YERA 4E26A 3F3TA 2A2AA 2XJ1A 5DE2A 4KIKA 4A9UA 3NLBA 3RINA 3R04A 4ZSJA 2V22A 2YWPA 4EQMA 4UMTA 3PY0A 3I0QA 3RK7A 4IVCA 3SRVB 3UP7A 4FKSA 4F08A 5JQ5A 1XBAA 4FV7A 2JKOA 5CU6A 3VUKA 3SKCA 2VX0A 4RIXA 4G3FA 2WZJA 4PL3A 4FODA 4K8AA 5F20A 5DR9A 2BCJA 5CENA 3C0IA 5I9WA 2A4LA 2O5KA 5JFXA 4A4XA 5HEZA 2VO3A 4Z55A 2QOOA 3NEWA 2ITTA 4TZRA 4YJNA 4KRDA 1KE9A 3PE1A 2X8DA 2CGWA 2BHEA 3KRLA 4I3ZA 2W4JA 3MH0A 2R3QA 2JKMA 3LMHA 1FBNA 4W4VA 3O51A 1UA2A 5AAFA 1U54B 3PIXA 2VNWA 3I6UA 5GJDA 3U8WA 5IDNA 4PF4A 2ZMDA 4IDVA 5FXQA 2PZRA 5AV0A 2W1GA 4I1ZA 3CQWA 3CBLA 3EZRA 5E7RA 3DAEA 3RPYA 1LEZA 4Y5QA 2CHLA 3ZEPA 4BZNA 5J1WA 2QD9A 3C4FA 3MESA 4G34A 3HA8A 5JRQA 4QNYA 2R5TA 3Q96A 4KWPA 4FK3A 4RWJA 4UZHA 1RDQE 3DAJA 2Z02A 3HMOA 1NW1A 2ZV9A 3HA6A 3MBLA 3GVUA 1A48A 4X7QA 3RWQA 2WOTA 3MVHA 1JOWB 3D7ZA 4FF8A 4UY9A 3LFNA 3QA8A 4YHJA 4O2PA 2IWIA 2WTKC 5LARA 2PZPA 3RCDA 5CVHA 2QOIA 4PL5A 3W1FA 5HBEA 3BLQA 3BQCA 3TG1A 4FUXA 3T3UA 4EJ7A 4AZSA 4ITIA 5CLPA 3H3CA 4RBLA 4IAYA 2J51A 2OH0E 3MH1A 3ITZA 5CY3A 4AOIA 3ORTA 4MXZA 4GK4A 5GIOE 2GNLA 4FIIA 5DR6A 3RGFA 2P0CA 2GPHA 3NW5A 5LMAA 2BTSA 3QU0A 4YJSA 3U9CA 3QWJA 4IB3A 4IC7A 4Q9SA 4AZTA 2YCSA 3PXKA 2YM6A 4YJPA 3LCDA 4IZ7A 3ZUVA 3AC3A 3ZBFA 3IPHA 4TNDA 4BDEA 4J8MA 4JG8A 4XRJA 5E90A 2X4FA 1H08A 5EM7A 1URWA 3NUNA 1RQQA 4F6UA 1WBTA 2ITZA 4JR7A 4D9UA 4DHFA 4ZY6A 4NTTA 3E8DA 3HV7A 4UMUA 4ZZNA 1F3MC 2GSFA 4O0WA 2IW8A 3ZSIA 3SVVA 1JWHA 4E5WA 4EONA 2J5EA 2GTMA 1SVHA 2ZAZA 3R30A 4FNYA 1P4FA 2A1AB 2Y4IB 4KA3A 4AN3A 4YZBA 4IADA 4BIEA 4FIGA 4C34A 4D4RA 2BHHA 1OPLA 1BKXA 2IZTA 1REKA 3PVUA 4NSTA 3ZONA 4EH9A 4DT9A 4ZTSA 4A4LA 1OIUA 3QL8A 1OL6A 2H34A 3WBLA 4FT5A 3PTGA 3U6HA 4FC0A 4E7WA 3WOWA 2CNUA 4BDIA 3L9NA 3FI2A 3GCPA 1STCE 4EBVA 3QTSA 3OVVA 3P79A 3EB0A 4FEQA 4RIYA 2WMTA 3UOHA 3CLYA 4CMOA 4D0WA 4HCVA 4WT6A 3TIYA 3UNJA 2W5AA 3H30A 3W2RA 5ITAA 4NCTC 3Q6WA 2VTOA 4OUCA 4P5ZA 3IW4A 4Q5HA 1OL5A 1OGUA 3ZDIA 4F9WA 4IZYA 3LFEA 2C6EA 2VRXA 1GIHA 1M2PA 3C0HA 4RJ5A 4EOPA 5KCVA 3PY1A 5CEKA 4KRCA 1JPAA 2ITUA 1Y6BA 4LGDA 3BLRA 3EN5A 1Z5MA 2R2PA 2XCKA 3FQHA 5TR6A 2UZUE 4C2VA 4EH3A 2JAMA 3CE3A 3MY5A 3DBDA 3HX4A 3R2YA 4XJ0A 1XBCA 1MRVA 1Q3DA 2PTKA 3FMDA 1FGIA 3NCGA 4RLKA 4WOVA 3JY0A 4FSTA 2UZWE 3PLAE 5C9CA 4NWMA 2QLUA 5IEXA 4FZAB 3DS6A 5IH6A 3RTPA 5EM5A 4ARKA 3KULB 3HECA 3SC1A 4QOXA 3II5A 4GYGA 4WNOA 4EH8A 5E1EA 4BKJA 3EQBA 4CT1A 1XH9A 2PMNX 3VRZA 3QD3A 4EH4A 5BYLA 5HU9A 1B6CB 1U54A 2WKMA 4QRCA 4TYIA 2C5VA 5CSWA 1YI4A 3F82A 4AA5A 3DK7A 3KXMA 3KRJA 5IA5A 5IH5A 2R3FA 4BL1A 4IW0A 4JOAA 2B9JA 4I5HA 3DKCA 1WMKA 3FKOA 3QZIA 2B55A 4NTSA 1Z57A 5CWZA 3WZUA 5EI6A 3G0EA 4AWIA 3HRBA 5JZJA 4F7LA 2UVYA 3BGQA 3PFQA 4Y8DA 3KF4A 4NUSA 3W8QA 4EQCA 4XYFA 3WYXA 4HZRA 2XNMA 2RF9A 4GKHA 3H9OA 4U97A 2WMUA 3AG9A 4L7SA 5JSMA 4G31A 4MD8E 3UBDA 3ZUUA 2QOHA 2QC6A 2R3IA 4EOIA 2ZM4A 3EYGA 2CN5A 3B2WA 3R71A 4QMWA 5ETCA 3T9TA 4BBEA 5IA0A 3JR1A 4WRSA 4B7TA 3RBWA 4FKIA 2IPXA 3PPJA 4RIOA 4OTDA 4I4EA 3R7IA 1RE8A 2ITYA 4DH8A 2IVSA 4TNBA 3FLQA 1BYGA 4BIDA 1UKIA 4YZNA 5FEEA 4BDKA 3FLZA 4U9AA 3ZUTA 3GUBA 2XVDA 1P14A 1JVPP 1GZ8A 3LHJA 5E8WA 3RM6A 4DITA 4HOKA 3OROA 1LUFA 2QR7A 4JBQA 3VUGA 5AX3A 4F0IA 5HE2A 4I24A 4OTRA 2W7XA 5EKOA 4CLJA 1B39A 3QXPA 2P55A 1ZZ2A 3FZRA 4W8EA 3UC3A 3CTHA 3R8PA 2EXCX 3HMMA 4IEBA 4TRLA 3MY1A 4MAOA 3KXXA 4BWXA 1WVXA 1GIJA 1A06A 3EYHA 5IA3A 2VUWA 3POOA 4N0SA 2XBAA 5HLWA 5LVOA 2W96B 3W32A 1PMEA 5EG3A 5EQYA 4DC2A 4RLLA 1FGKA 3COKA 2EXMA 3PIZA 4I6HA 3ZLYA 5G6VA 5BUJA 1DS5A 4F1TA 5KMNA 3EQIA 2UVZA 3FMKA 4PPAA 2PVFA 3GOPA 2UZDA 4FKLA 4WNKA 4ZSGA 4B0GA 4FL2A 2PZIA 1JSTA 4TWPA 3SGCA 4D2SA 4DH1A 5A14A 1H1QA 3BHYA 3DAKA 4ANMA 3HV6A 3MW1A 4PPCA 3WIGA 4EUUA 5J7BA 4FOBA 2R3PA 3FZOA 3N51A 3PJ1A 4QPMA 4BCJA 2BFXA 4FT7A 4MBJA 4U80A 4P2KA 5KMJA 3I5NA 5DT3A 3BHVA 4R78A 4TYGA 2WMXA 4IWQA 1YW2A 2QOQA 4PNKA 3OF0A 2XJ0A 4JDJA 2R4BA 3ZZEA 4ZTMA 3BI6A 3KF7A 4AW1A 3MYGA 3D2IA 3FMEA 5IQCA 4GJ2A 3UTOA 4ZY5A 4XNEA 3DU8A 5EHLA 4X6QC 4DBNA 5A46A 4LOOA 4Q9ZA 4ZLOA 1Q61A 3VF9A 1NY3A 1ZY4A 1ZYJA 2A19B 2OFVA 3A7FA 4V0GA 2F49A 4ZMFA 4BZDA 2FA2A 2XCHA 3NUXA 4FUYA 1W83A 2Z7LA 2QO2A 4JBVA 1YXVA 4FVRA 4ZIMA 3D4QA 4A9SA 4BN1A 4DH3A 4EK8A 2Y6MA 3F7WA 3MN3A 3VIDA 4GIIA 4L3LA 2OZOA 3FZ1A 4CVAA 5HE1A 2FSLX 2V7OA 2OZAA 3BWJA 2JDOA 3NAYA 5HZNA 3CQEA 5HTBA 4BWPA 1DM2A 1F5QA 2W1HA 4O6LA 4H1JA 4KIQA 5CAVA 4CRLA 4NM3A 4YJTA 3MPTA 4FEUA 3CY3A 4A06A 1LP4A 1ZAOA 3N9XA 3OW3A 3EQDA 3QQJA 4EH7A 1JSVA 1YWNA 3QTXA 4L45A 2VTIA 3R8VA 3CJGA 3C4XA 3VAPA 3SX9A 2P2HA 3CEKA 1QPDA 2XKDA 1V1KA 4R5SA 2ETMA 3VQHA 3WIKA 2O64A 3RI1A 1GOLA 3IQ7A 4FKOA 4EKKA 4C4JA 4YZDA 1J3HA 4DEIA 4IQ6A 4IXPA 4P7EA 2R3OA 2VO0A 1YQJA 2RFSA 5FXRA 3AC8A 4FV5A 3QTWA 2CMWA 4OTWA 4JAJA 3HDMA 4MBIA 4V0GB 3R7YA 5F94A 3PJ3A 4C2WA 4DCEA 5DG5A 4FNXA 3VS6A 1L8TA 4GK2A 3ATSA 2F7XE 3AC2A 3TKIA 5IA2A 2ZV2A 5BVEA 5IUHA 5C26A 5DR2A 3S3IA 4DGNA 3OEZA 4CV9A 2YN8A 4RWKA 3OUNB 3TTIA 5E8TA 3RAIA 4B8LA 4F1OA 2HZ0A 4LRMA 2PVRA 1NVSA 3QWKA 4IB1A 4TY1A 1OMWA 4JR3A 5EK7A 4GKIA 4BTMA 4XG2A 2OG8A 4EZ7A 4RFYA 5IF1A 3BBTB 1IEPA 2VTAA 3G2FA 4BRXA 4D2PA 4DGMA 5LWNA 3OC1A 4J7BA 1GZKA 3F5UA 2W4KA 3BYMA 3KKVA 4KS8A 3WI6A 4C37A 4O7SA 4EK4A 4DA5A 3DDPA 3GCQA 2RSVA 2PY3A 2PVJA 3BU3A 3LW0A 4AOTA 3P7AA 2IG7A 3V01A 2BILB 3KL8A 2WFYA 1OVEA 3BU5A 1NXKA 3GCUA 5D7VA 3TCPA 4DTKA 4JDKA 4ANQA 2Y7JA 3GU5A 3VBQA 4OTPA 1Q3WA 4E3CA 5DT0A 2PVKA 5CI6A 4BDCA 2CDZA 2R3RA 2YHVA 4KBAA 3OXIA 2XM9A 3VS4A 2F2CB 2XKEA 4IFGA 2VO7A 5HD4A 2DUVA 3HRCA 4WSYA 1M7NA 1GIIA 3GQLA 3G6HA 2PVNA 3VWAA 4QPAA 3NYNA 4MTAA 4NT4A 4OTHA 4OAUC 2VTQA 4C4IA 1VYWA 4UMQA 3ZSHA 2QVSE 5BX0A 3OD6X 4CMUA 5GINE 4CLIA 1WBOA 4ZTRA 5F9EA 2PE1A 2OBJA 4IJ9A 4RA4A 3RNIA 5AIKA 5AUWA 4FZ6A 3AOXA 5IG1A 4RX8A 4EH2A 2XB7A 2WQEA 2C4GA 2HOGA 3VUHA 2VV9A 5CEPA 4DEEA 1XH6A 2ITXA 4IAKA 4TYHB 5FQDC 5I9UA 4LL5A 1RJBA 3MFSA 3QALE 2B9IA 4B99A 3LQ3A 4CFNA 3D0EA 3O0GA 4NL0A 2V5QA 4QP6A 2YIWA 3IDCA 3HV4A 3Q4UA 4L01A 5FP6A 3UPZA 2OW3A 4RQKA 5L6WL 1KE6A 3BYOA 4K9YA 3RKBA 4DEDA 2XJ2A 4CFXA 4J99A 5A4QA 3W2PA 2KULA 1YWRA 3DJ5A 3Q9YA 4E6CA 4EK6A 5FEQA 5KMOA 1VJYA 3UVPA 3HDNA 4K6ZA 4R3PA 3WF9A 5JEBA 4UX9A 3LFBA 3A62A 3N4VA 2RGPA 5AEPA 5AUVA 3PXQA 4S2ZA 5ETFA 5I9ZA 5LVMA 4RWIA 4WO5A 4HGTA 3FHIA 2J2IB 4AT4A 5A4LA 3GC7A 1ZRZA 3QKMA 3K5VA 3R6XA 3Q4TA 4QQCA 3U55A 1PMVA 5CI7A 5L2WA 4RIYB 4AZWA 2GQGA 3H10A 3TWJA 4CFMA 3G51A 4RG0A 4IWPA 4MQ2A 4IACA 1YDTE 2O63A 1YXUA 2WPAA 3SOCA 3A61A 1PXKA 3DK6A 4IX3A 3D7TB 3FC1X 5FG8A 5EW9A 3EN4A 4YGAA 3ROCA 1Q97A 4EI4A 4BY9E 3SLSA 2OJIA 2JBOA 3HP5A 3EN9A 3ETAA 3MIAA 3L9LA 4FTMA 4QT1A 2QOBA 4AGDA 5BYYA 5L4QA 5AP1A 1AQ1A 2EVAA 2RL5A 4RGJA 4II5A 2JGZA 4XP3A 1Q41A 3A7GA 3DFAA 1R3CA 3BX5A 3FLNC 4FTNA 3UDBA 2YITA 3IW5A 3T9IA 3QF9A 4BDDA 4UBAA 3V8SA 1UU9A 2IVVA 4ZJJA 3RALA 3KRWA 2W9ZB 4FTKA 2C5NA 4O7YA 4JQ8A 2ERZE 3MV5A 3FYJX 4FEXA 3KULA 1Q8YA 5HCZA 1Q8UA 2YFXA 3QQKA 4TXCA 3OW4A 2WEIA 2C6KA 4HYIA 3DJ6A 3KGAA 4QMTA 3DTWA 3I81A 3R8UA 4A9YA 3O8PA 5J9ZA 4CQGA 4PDOA 4K1BA 3TNWA 5AA8A 1R0EA 5IQBA 1BL6A 3HVCA 5CT0A 4BGGA 3ERKA 3OT8A 4K18A 4L00A 2JKQA 5FP5A 1JKLA 3FYKX 4G3GA 2XYNA 4WUNA 4ANSA 4BCOA 3AMYA 4C02A 1PXOA 1P4OA 4YC8A 2NRUA 4LFIA 1YI3A 3LPBA 2XH5A 3A2CA 4EOLA 1WBNA 1ZOGA 3JVRA 3VUMA 3KVXA 3MPMA 4JT3A 4O82A 1MRUA 3KB7A 1PXPA 4QTBA 4L3JA 4CG9A 2OXYA 2OXDA 2YISA 4PMTA 4QP9A 4ZS4A 2B1PA 3LJ2A 3E7VA 2GQSA 5I9XA 3NS9A 3PVBA 4RQVA 2XP2A 1H1SA 2C3KA 3EQPA 3FI3A 3NIZA 4KS7A 4WSQA 4QP7A 3R7EA 3TJDA 5GZAA 2GFSA 3DZOA 4EOSA 3ELJA 3GU6A 3N4TA 5CAOA 4F9AA 2OIDA 4QTCA 1OKYA 4ZOGA 3VN9A 5ANKA 4JX3A 1MQBA 3ZYAA 1QL6A 4YTIA 2XIYA 3VHEA 2XM8A 2G15A 4V05A 3UG2A 3F69A 3OG7A 4BDGA 4C62A 3OBGA 5L3AA 3L9MA 4XEYA 4D58A 5KMIA 4EZ5A 3E63A 3PLSA 4LOQA 2ZOQA 3ACKA 3CTQA 3SQQA 1M7QA 3D5WA 5FM2A 2UZOA 1BL7A 2WHBA 3BHTA 4FV8A 4O83A 3I4BA 3MI9A 2HENA 3LJ1A 4BTJA 5C4KA 4PTCA 3LXKA 4WIHA 4EOJA 2R0UA 5H8BA 5LCJA 2XK8A 4CFWA 3Q52A 4QMXA 4ITHA 4K0YA 3NW7A 3QBNA 5EHYA 4EEVA 1RW8A 4J97A 4FG7A 2BAJA 1O6KA 4GRBA 4GVJA 4YLLA 4XOZA 5CF6A 5ETAA 3BLHA 2UZVA 4FR4A 3ANQA 3FI8A 1YDRE 3QRJA 2BZIB 2NP8A 3CGFA 4PV0A 2YM3A 4PX6A 4PDYA 3REPA 5DWRA 4CNHA 3C4WA 3H0YA 4X6RA 2YM7A 5HIDA 3VVHA 4ZP5A 2BVAA 1IA9A 4CQEA 1CKPA 2E9UA 1H1RA 4FVPA 3KXZA 3TJCA 3PVGA 1IG1A 3OXZA 4YU2A 2PE0A 3VBWA 3KY2A 4F63A 4ZSAA 4GFMA 4FKUA 5C8NA 5IMEA 4E93A 4R7BA 3KFAA 1XH8A 3S1HA 3F3UA 1V0OA 5FDPA 1NVRA 3WF7A 2W17A 3KXHA 3WF5A 4OGRA 1OECA 3ORLA 4IC8A 4YJQA 2C5YA 3BEGA 2E9OA 4O96A 3ZU7A 2YM8A 2B7AA 4D9TA 5M07A 5C01A 4G17A 5JT2A 2XIKA 3LCOA 2Z60A 4XMOA 5GZ8A 2KTYA 5A9UA 4GIHA 3JXWA 4O0RA 2YDIA 2YIXA 5IQGA 2Y8OA 4AZEA 4JNWA 4D2VA 2O8YA 3LFAA 3NYOA 3Q2JA 5E8YA 4XHKB 1BX6A 4EHEA 3BQRA 2BRNA 3QC4A 4FKJA 3P5KA 3Q6UA 4O91A 4R6VA 3SAYA 1R0PA 3RPOA 4QYFA 3ODZX 4HNFA 4WA9A 3VS5A 4D4VA 5EYMA 3P23A 4X3FC 5FD2A 3ORNA 3JUHA 4PPBA 3NNXA 3RHXA 4I93A 3RJCA 2J9MA 3EQRA 3KCKA 5LMBA 4Y73A 3FPMA 5AMNA 4C0TA 4FICA 4UYAA 4NW5A 4W4XA 2GQRA 1O9UA 3Q2MA 3V6SA 4QP1A 5EDPA 5KX8A 4MXAA 4DTAA 5CANA 3GU7A 4GEOA 4FSWA 2C5XA 4DE4A 2W1FA 5BPYA 1KV1A 5AFVA 3DY7A 2IVUA 3Q5ZA 3UIMA 4DYMA 3EFJA 2VTRA 1Q8ZA 2OF2A 2J0MB 5CZHA 2V0DA 4I5PA 2J0JA 2NNWB 4W9WA 2ITQA 4AE9A 4ALVA 4CGAA 2ESMA 3CTJA 3G90X 1W82A 3PSCA 4U3ZA 3TV4A 2QG5A 2VTMA 3I6WA 4C3PA 2A0CX 4IWOA 5BYZA 2R3KA 3R28A 2CCIA 5KNJA 2GS7A 2HWOA 2BDJA 3UVRA 4AGCA 2ZV8A 1BI8A 1M14A 1OPJA 3R01A 2QODA 4LUDA 4ID7A 2JAVA 3E8NA 4IFCA 4TWCA 5GJGA 1QCFA 3E8EA 4IBMA 3ZC6A 1SM2A 3NX8A 2YIRA 3H9RA 4OTIA 3NMUF 4FTQA 3UC4A 4YPDA 2UW3A 5TO8A 1H26A 4YLKA 3PJ8A 3GOKA 4ACHA 4CKIA 1L3RE 1H0WA 4KD1A 2NPQA 4BC6A 3Q9ZA 2HCKA 2CCHA 5DRBA 4OBQA 4BGHA 4O81A 4D2RA 2W5HA 5IQFA 4I94A 4EC9A 3TZ7A 3BYUA 5I3OA 2OI4X 3O50A 5HESA 1W84A 3PA5A 3L8XA 1G8SA 4KBKA 4ZZMA 4RJ7A 4QMPA 4FG8A 4JRNA 3ACJA 2OWBA 2PHKA 4M84A 5DBXA 2C6TA 2FH9A 1MRYA 2H8HA 2RFEA 3ZFYA 1Q24A 4PTGA 5BVOA 4BR3A 3AGLA 1ATPE 3CXWA 2VTLA 4J95A 2R3MA 4RX7A 2W99B 5CVGA 3E64A 3QQFA 1FQ1B 4RJ6A 4EK5A 4FSNA 5J9LA 5FUTA 3UOJA 4CMTA 4FSZA 4LV5A 3NAXA 4BYIA 1PW2A 4X2KA 5A4EA 4QMUA 5BQ0A 3ZBXA 4LUEA 4M66A 4XG6A 3WILA 4AAAA 2UUEA 2AYPA 2FUMA 3MPAA 1XKKA 4YLJA 4G3DA 4U40A 1YOLA 2X0GA 2YEXA 3DZQA 2ZJWA 2BKKA 4AW0A 3FXZA 3TDVA 1GZOA 3FMHA 4EORA 1I44A 2IJMA 4AXAA 2ZM1A 2GHGA 3DJ7A 3LM5A 1M2RA 4ALUA 2CKQA 3GCSA 1OL2A 1HCLA 5CSHA 5CEQA 2P2IA 4B6LA 1PKGA 3CS9A 4F0FA 2Y4IC 4J53A 1T46A 3ZRKA 1FMOE 2XKFA 4F70A 2O3PA 4IB5A 2XNBA 4FBXA 4IJPA 5DHJA 2PZ5A 2V7AA 4M13A 5HBJA 5I9YA 4XBRA 3CQUA 3D94A 5DOSA 4QYYA 3OWJA 4IX6A 4E1ZA 2YIQA 4E5BA 5AIRA 4QNAA 4ASEA 2R0IA 5AUUA 2WELA 1IA8A 3D14A 3LQ5A 3TIZA 4AX8A 4NZWB 2E9VA 2XNOA 4QTEA 4LRKA 1JNKA 3LFFA 1IAJA 4IMYA 3COIA 5HCYA 1WCCA 1HCKA 3P0MA 3A99A 2GCDA 3HZTA 2IW9A 1UNHA 3COMA 2ONLC 3OTUA 3UJGA 3VBYA 5C4LA 4PRJA 1E1VA 4QMSA 3ALOA 4QP4A 4FKQA 4RX5A 5ACKA 3VJOA 4AP7A 2REIA 1SMHA 2PYWA 1Q4LA 4AA4A 4FKGA 5FTOA 1KWPA 1E9HA 3HYHA 3WE4A 3VUDA 4PTEA 3NUSA 5CTPA 4WD5A 5L2IA 2QI8A 2GNJA 3DBQA 5D7AA 3UOLA 4FGRA 4X0MA 2C3IB 3AC5A 1WVYA 3MJ2A 3V5WA 4EWHA 3TL8A 3R83A 1QPCA 4DG2E 3E87A 3NPCA 4R8QA 4O0XA 1R39A 2Q83A 3KREA 1Y57A 4A9TA 2BUJA 1OB3A 3KU2A 5CQUA 4C8BA 2E2BA 3EFWA 4X2GA 3NVKI 4Y5HA 3HRFA 3CR0A 3C5IA 4FKTA 4ANBA 3LZBA 3PWYA 3F9NA 4G3CA 4BHNA 5JH6A 4MYGA 5DYJA 2WB8A 1YKRA 4YTHA 2VTPA 3K3IA 3PDTA 1VYZA 2W1EA 5IQAA 4I0TA 4TYJA 4JLCA 2JFMA 2QOCA 4D5HA 4EJNA 4DCAA 4KKHA 5AUTA 2BDFA 3MVMA 5DGZA 3W16A 5HTCA 4D1ZA 2OJJA 4ENYA 2GHMA 5B0XA 4U3YA 1KV2A 3LCSA 5CF8A 5HX6A 5M08A 4TTHB 3DGKA 5KHWA 2C6DA 3GQIA 4DAWA 3KMWA 4MCVA 4NM7A 5IMXA 4N57A 4H39A 5IEVA 3VULA 4FZ7A 4W4YA 3VBVA 2ZV7A 2LAVA 4BCQA 5EDQA 1VEBA 4CSVA 3EJ1A 3P78A 4H3QA 5FGKA 4IX4A 2HXLA 4FSUA 2VO6A 4BBFA 5CU4A 1H0VA 1M52A 4X21A 3NUYA 4I5MA 2C3LA 3HLLA 1PXMA 2C6OA 4DBXA 5C8MA 4FZFB 4R1VA 5JFWA 5EM8A 5J9YA 3IW8A 2W1ZA 1G5SA 4BCNA 1H00A 2EU9A 4WG3A 2PL0A 3FL4A 2V55A 3AMAA 4FKWA 4G5PA 2C5OA 1BI7A 4IM3A 4O1PA 2FVDA 2XK7A 3EWHA 4ZTHA 5EQEA 4PY1A 3FZSA 3ENHA 3QUPA 2WU7A 4MF1A 4TL0A 4YURA 3G15A 4EOOA 4O84A 4JQ7A 3KC3A 3VUIA 1ZXEA 4AF3A 1PRYA 3IDBA 3IOKA 3PSDA 3S4QA 1H27A 5AUZA 2WIHA 4N6ZA 2XK9A 2BFYA 2YA9A 2YZLA 1CDKA 4FKRA 2CSNA 5AP6A 5IU2A 5GIPE 3AT4A 4GL9A 1ERKA 5CEIA 4C59A 3LFDA 5HG5A 4O0VA 4R5YA 3GENA 3LCTA 4O1OA 2R3JA 3QQLA 5E8XA 4BCGA 2DS1A 3MFUA 3NWWA 5J7HA 3SXRA 4E4LA 3LCKA 4ACCA 1V0BA 4I6QA 3TACA 4YR8A 5IDPA 3D2KA 4U45A 3R9RA 2C0IA 2Z2WA 3A7HA 3BBWA 3P1AA 3Q4ZA 4YUQA 4Z9LA 2YZAA 3ULIA 1UU7A 1ZYSA 3CGOA 3FE3A 1M17A 2W5BA 4EBWA 3F2RA 2OKRA 2WQMA 3NUAA 4JS8A 2WMSA 1JBPE 4L3PA 4PP7A 3R7OA 2PUUA 3ZRMA 1XO2B 2DYLA 4CV8A 2OIBA 1WAKA 4O38A 5HVKA 1H8FA 2BAKA 5H9BA 2BZJA 3DOGA 3DCVA 3T8OA 4HZSA 4N6YA 4XG7A 4UYNA 5E8VA 4BKYA 4AW5A 3UO5A 3A8XA 4ZLZA 2P4IA 4ITJA 3C4CA 3D5VA 1KOBA 3W2QA 4QMQA 2JLDA 5E8SA 1Q99A 4KIOA 2VX1A 4GT3A 2XZSA 1SVEA 4QMLA 5EOBA 1GJOA 2ZDTA 3PY3A 3OCBA 2I7QA 1JKTA 4BTFA 1LEWA 3DBEA 3PXRA 3PSBA 4NCTA 4PWNA 4ACDA 2QONA 4X3FA 4UWCA 5CQWA 3QKKA 3VHKA 4ASDA 1YOMA 3EHAA 1KE5A 4QTAA 2QQ7A 1FVVA 2BALA 3MWUA 4DFLA 3TDWA 3RK5A 4YZ9A 3ALNA 3E7OA 3TZ8A 4RT7A 4QQJA 4FGBA 4TYHA 5CZIA 5AV1A 3R00A 2XRWA 4N70A 4ORKA 4F1MA 3COHA 4FV4A 3LFSA 4X2NA 1VZOA 2PMLX 2R3HA 4DFZE 2FB8A 4OBPA 1ZMWA 1ZYDA 2XKCA 2C3JA 2HAKA 3OMVA 3QFVA 1ZOHA 3P4KA 4MXXA 5FTQA 1XBBA 2PMOX 4BBMA 3A7IA 2BRGA 2OICA 3KQ7A 3L9PA 3DB8A 2PVHA 1Q8WA 1W8CA 3UNZA 5IEYA 3F3VA 5FBOA 3IW6A 5HG8A 5HX8A 4RSSA 3I60A 2UZEA 4FTTA 4BCHA 1WFCA 3NYXA 4NFMA 4W8DA 4FTRA 1H1PA 3B8QA 5KMMA 5L8LA 1CKJA 2F4JA 3F2NA 4EZ3A 2VTHA 2VTNA 4FSRA 4ZSEA 3L8VA 2WTJA 4Q5EA 1PXJA 5EYCA 5I0BA 3H9FA 4FSQA 2UV2A 2Y9QA 5KO1A 4BCKA 1NVQA 4H05A 1M2QA 4JXFA 1OKVA 3PVWA 2WMQA 2YM4A 3Q04A 2PVLA 3NRMA 4DH7A 3QTRA 3SW4A 1H1WA 5TE0A 3DQWA 2FO0A 2X81A 3MDYA 1OUYA 5JRSA 3LLAA 1UU8A 4O7WA 2CLQA 3GFWA 3EN6A 4YTFA 5AR2A 4DGGA 3QQUA 4K77A 3IGOA 3FWQA 2C6MA 3ZS5A 1YWVA 4JIKA 4HCUA 5B2MA 4U44A 2I0EA 5LVPA 1J7LA 4I92A 5DEWA 3C51A 2ITNA 4QQ5A 1JKKA 2WEVA 4QP2A 5TKDA 4HVDA 3ROYA 4XLIA 3FMMA 4L6QA 3FHRA 5AR8A 4KUJA 4TWNA 5JN2A 3M1SA 1SNUA 4AZVA 5AAGA 4AGUA 4GK3A 5AP5A 4A07A 4Z16A 1XWSA 3UYSA 4C57A 5BUEA 4S34A 4FE2A 1U59A 3FDNA 1DI9A 3D7TA 1YXXA 3A7JA 5J8IA 5IQHA 4AE6A 3QUEA 3DNDA 4BCPA 2C68A 4D2WA 3N4UA 4R3CA 4NFNA 5AADA 4WG4A 5BVKA 4V04A 5EOLA 1K9AA 4UXQA 4NW6A 4BI1A 4MQ1A 1CSNA 3D83A 4O7RA 5HOAA 3QRKA 3O96A 4D28A 4DG0E 3CC6A 3WARA 4RFMA 4BIBA 2YCFA 3RK9A 4KKEA 2UW7A 4DEGA 2JIVA 3U54A 4LL0A 4AACA 2EUFB 1ZLTA 4OT6A 4GYIA 5J79A 4USFA 4IB0A 2JC6A 1XHAA 3DNEA 3PPKA 3F3ZA 1LR4A 2ZDUA 3DXQA 3QHWA 3GBZA 4RMZA 3EFLA 2X8IA 4FTLA 2QG7A 4HVGA 4D2TA 2ZMCA 3DLZA 1MP8A 4FI1A 4ANNA 4F65A 1URCA 1JAMA 3KRXA 3R7VA 4I6BA 3BPRA 4RVKA 3EFKA 5E1SA 3TV7A 3QGWA 5JQ8A 2SRCA 4ZJIA 4XLVA 4BDJA 5LXMA 3AGMA 3CD8A 5JGBA 3LE6A 3PA3A 4FL1A 1WBSA 5FLFA 5HGIA 2OJ9A 3HNGA 3R9HA 4C58A 3CIKA 2QU6A 5EI8A 3QYWA 4AT5A 4L44A 4X2JA 4QMVA 2IZUA 2W1DA 1UV5A 3NVMB 3PXFA 3SD0A 4D5KA 4G9RA 4YJRA 2JDVA 3UVQA 1SVGA 4D4SA 4WRGA 5C27A 1OZ1A 3C4EA 4UEUA 4EYMA 3ZLXA 4O2ZA 2DWBA 2XF0A 5DI1A 1KE7A 4ZEGA 1SNXA 2XNEA 3UODA 4R1YA 4Q2AA 1YXSA 4JI9A 1TQIA 2JDTA 4J8NA 2WMBA 5FEDA 2YABA 4R7HA 1ZARA 3GU4A 3R02A 3DKFA 4P4CA 5HO7A 2HYYA 2AC5A 3EL8A 3R7GA 5IISA 3PXYA 4C4GA 4E5AX 1T45A 4AQCA 2QNJA 3R1QA 3EKKA 5TF9A 3U4WA 3U4UA 2OF4A 2ACXA 3R8LA 2CNVA 2GNGA 3EH9A 3KXGA 2HWPA 4LOPA 2BKZA 2G9XA 5K4IA 2HZIA 3HP2A 4F09A 2VTTA 4U0IA 3F61A 3E3PA 3HAVA 3FMJA 3IGGA 1ZZLA 1OKWA 2Z7RA 3F66A 3POZA 4G6LA 2YAKA 4FV2A 4AFEA 2O2UA 5GJFA 3PE2A 5CSVA 3TN8A 5HU3A 1A9UA 2CLXA 4CYIA 3ORKA 3NUUA 2E9NA 3EKNA 4KBCA 4D1XA 5DRDA 3H4JA 2WTKB 3PUPA 4O7LA 5E91A 2FGIA 2F57A 4FMQA 4PDPA 1UWHA 3VQUA 1ZMUA 3AT3A 3FV8A 4FV9A 4RVMA 5FXSA 3RMFA 4EH6A 4UN0C 3BRBA 3Q5IA 4B9DA 5CEMA 1FVRA 1GAGA 3ORZA 5KZ0A 3ZFXA 5IQEA 5HO6A 3VS0A 4BTKA 5GHVA 4ERKA 5AP3A 3TXOA 4YSMA 4O0SA 2C6IA 5DN3A 4CKRA 3FMNA 2RG5A 4KB8A 4CRSA 5CAQA 3PRIA 4QYHA 2C0OA 3WZEA 4AT3A 2R3NA 3E5AA 4IM2A 4OAVB 2WD1A 4JL9A 4M68A 4QO9A 3PP1A 5AR4A 4PUZA 4KNBA 3C1XA 5F95A 3DV3A
chains in the Genus database with same CATH superfamily
2XK3A 2VU3A 3ZO3A 2F9GA 2VWIA 3AKLA 2V62A 4YTCA 3GC9A 1TKIA 2UVXA 5FRIA 4Z3VA 5K5XA 3HV3A 4FIFA 3LLTA 4J98A 4HYSA 3GP0A 4FZDB 5I3RA 3OOMA 2QOFA 4U81A 4EYJA 4C33A 3U6JA 1JLUE 2OFUA 4WUAA 5I5ZA 1P5EA 4EOKA 1ZYCA 2JKKA 3MB6A 4NYEA 3TTJA 3DQXA 5HLNA 1NA7A 1LPUA 3CP9A 3Q60A 4FX3A 2ITOA 1EH4A 2GHLA 3WZKA 4DEHA 3PYYA 1OBDA 2QOKA 2EB3A 4FL3A 4M15A 2OLCA 4PMSA 3TUBA 3KA0A 3QGYA 4FK6A 2FSTX 3NSZA 4JQEA 3A60A 2OJFE 2X7GA 3FKLA 3IG7A 3HUCA 5AR5A 1ND4A 4H1MA 2OU7A 3WYYA 4MF0A 4CFFA 1S9IA 2RG6A 2VGPA 3HL7A 3PA4A 3NUPA 3BYVA 2J0LA 3LXNA 3ENMA 2X0PA 3NW6A 4RVTA 4ASXA 3IK3A 3IONA 3LJ0A 2A27A 1YHVA 4M69A 4DEAA 4ZS0A 5HNGA 2H96A 2ETRA 4XV1A 4C3FA 4AG8A 5CU0A 2ZYBA 5KZIA 3GXLA 4EOMA 2ZVAA 3DXNA 4KIPA 3AMBA 4IHPA 2OJGA 4BICA 4ANOA 1U5RA 3RWPA 4C4EA 1WVWA 5FTGA 3ULZA 3TNHA 4RC2A 3OY1A 1ZOEA 2J6MA 3RPSA 3LIJA 2X9FA 5ANEA 4IWDA 5M06A 3MGYA 5KKRC 2B0QA 1XJDA 4IH8A 3WZJA 4E4NA 3PP0A 4G6NA 1JSUA 1APME 1KE8A 3QAME 3RP9A 4L42A 3PJ2A 2QOLA 4YBKA 3PWDA 4IZAA 1PMUA 5CEOA 4UWBA 3R1NA 4CXAA 4XOYA 4O4FA 4F99A 5A4CA 4XP0A 2C47A 2BRMA 4MWHA 1PF8A 3PUFC 3LVPA 3R9DA 2VWWA 3FLSA 2ITPA 4KABA 4BCMA 3FXXA 4D0XA 2I6LA 3E88A 4DLJA 3CCNA 1Y91A 4X3FB 2QCSA 2PPQA 4JAIA 4XCUA 4M97A 1Q8TA 3Q9XA 4DLIA 3VC4A 3R0TA 3AT2A 3EL7A 4FV3A 3GI3A 3RNYA 2Q0BA 4IX5A 3P5JC 3KMMA 4ZTQA 1HOWA 4U41A 5HO8A 3QTIA 1I09A 4NIFB 5FM3A 5E8ZA 4YO6A 2PU8A 3OCTA 5M4CA 4FNWA 3QRUA 3W10A 4HNIA 3EOCA 4PNIA 3P08A 2W05A 2B53A 3GEQA 4LM5A 4RIWA 3BZ3A 3VUTA 3SDJA 2VWUA 3V5QA 3QQGA 3SA0A 4NK9A 4HGEA 5KBQA 4LV7A 3ZRLA 3FC2A 4HJOA 4EUTA 3O7LD 1O6YA 1YRPA 3TNIA 4C36A 2JEDA 2BZKB 2G2IA 2YIYA 1MQ4A 4S30A 4C61A 3T3VA 3UIUA 5BVDA 2Y0AA 1V0PA 3B8RA 3G5DA 4XS2A 3CKXA 2WQBA 3K3JA 3OXTA 5D9HA 3UG1A 4L46A 2ZM3A 4CTBA 3SXFA 4IDTA 4MD7E 5L2TA 3C9WA 3GC0A 1AGWA 4C4FA 3NIEA 2RKUA 1ZWSA 3QCXA 4HGSA 3BV3A 4YZCA 2CN8A 1WBWA 3EQCA 4DGOA 2I0VA 3OT3A 2XK4A 2WMWA 5CNNA 2WNTA 3FZTA 1Y6AA 1ZMVA 4FTOA 1FMKA 5CXHA 4F6SA 4YO4A 4C38A 5IPJA 2R7IA 2YACA 2E9PA 2B54A 3CPCA 4L68A 4ZTNA 3V51A 5KUPA 2YJSA 2X6EA 3FQSA 2QO7A 4RIXB 3O8TA 1F0QA 4ZMEA 4QMZA 4BDAA 3ZFMA 4DN5A 2BZHB 3ZCLA 3R73A 4P90A 1H01A 2BAQA 4RC3A 3EQGA 4O21A 4GUBA 3MTLA 3LXPA 4LYNA 3BKBA 2QU5A 4APPA 5M4UA 1OKZA 2C6LA 5D11A 4K2RA 3O71A 5B7VA 2YM5A 5HE0A 4AUAA 4E6AA 5E9EA 3MS9A 2W0JA 3R8MA 3SV0A 2X2MA 3V5PA 3V8WA 4E4XA 5J5SA 3LXLA 4PMPA 4QYEA 4L67A 3OOGA 5AV3A 4KAOA 5LMKA 4AW2A 4JG6A 4NJDA 5H8GA 3FLYA 3V5JA 1U4DA 3QRIA 4D4YA 3HMPA 3LAUA 1GY3A 3GC8A 2IO6A 4DFYA 4G2FA 4DEBA 5H2UA 1IASA 2VWZA 4EKLA 2Y6OA 3CY2A 5H8EA 2HXQA 1PXLA 2XIZA 2QHMA 2XIRA 5D12A 3OEFX 3MH2A 5CAUA 1OGYA 4XV3A 4I41A 2VTSA 3CPBA 3ZO1A 2PWLA 5EYKA 3A8WA 1J1BA 4FSYA 3OCSA 3ZHPC 1MUOA 3NNVA 3OFMA 4WKQA 1KSWA 4OR5A 4AN2A 5DFPA 3EQHA 3AD4A 4F9BA 3W0QA 4D55A 3QA0A 4MXCA 3K2LA 2C30A 3AC4A 2H6DA 2YCQA 4LQMA 2I1MA 4QTDA 4WNPA 5BUIA 4YC6A 3FSFA 3U6IA 1TQPA 4YJVA 4GCJA 4M0YA 4FV6A 2CGVA 4BYJA 4Y72A 4JIAA 1PXIA 4UXLA 4L8MA 4OTGA 4IANA 5HCXA 4I23A 3CKWA 3IOPA 3KMUA 4XX9A 5HI2A 3S0OA 4M8TA 4BDBA 1OM1A 2GS2A 2JBPA 3OY3A 3QC9A 1QPEA 5CASA 5C8KA 2QO9A 2JIUA 1B38A 5CALA 3BYSA 4Y85A 4FT9A 2J0IA 2WAJA 5ETIA 1OL1A 3UZTA 4IIRA 3RM7A 3O23A 3UZPA 3MFTA 3AKJA 3BL7A 1K2PA 3AXWA 4M67A 1JKSA 3DDQA 2JD5A 3E8CA 4HPUE 5AP4A 3ZMMA 2IZSA 3OCGA 3O2MA 2XNNA 1OPKA 5J1VA 1CM8A 2HIWA 3FEGA 3KRRA 4CD0A 4DGLC 1FINA 3SG9A 3OUKA 4QMOA 4GT4A 2WU6A 4YHFA 4FT3A 3HUBA 5M09A 4KSQA 2WXVA 4LMUA 4H36A 5ACBC 3W2OA 1QMZA 2J50A 2VTJA 5FWKK 3I7CA 4QP3A 1W7HA 3TNPC 1JQHA 5M4FA 3Q32A 4TKSA 2BRBA 4KINA 4W4WA 5LWMA 4TYEA 5CS6A 4O7VA 5CX9A 4JDHA 3BU6A 3R1SA 4R77A 3MSSA 3KN6A 3QLGA 4FIEA 2AUHA 4MNEB 3GCVA 3UMXA 4QEBA 5DA3A 3VS7A 4CEGA 4QMMA 1TVOA 4E20A 3ZO2A 2I0HA 2PSQA 3D5XA 3OWPA 4RPVA 1ZY5A 5AM7A 4AA0A 5CYIA 3NCZA 4AS0A 2UW8A 4S33A 3V5TA 2F2UA 3DBCA 4JBPA 5EW8A 1YHSA 3HGKA 4PL4A 3V6RA 4JVGA 4ZSLA 2ZB1A 3BEAA 4IVAA 5HG7A 2VWVA 2XS0A 4O27B 5BVWA 4M7IA 3SXSA 5DMZA 5TT7A 1WBVA 2F7ZE 3TNQB 4D1SA 2YDJA 3QD4A 3FQEA 2HZNA 3FMLA 3KVWA 1XH7A 5T68A 3ZM4A 3BLAA 3VS3A 4M3QA 2CPKE 4W9XA 4Y46A 3AC1A 4AGWA 1OITA 4IAIA 5AV2A 5HICA 3ZOSA 5A54A 4U5JA 3E62A 2CGUA 2VGOA 4YSJA 5ICPA 2NRYA 2VAGA 2HY0A 2GTNA 5DVRA 4BKZA 4MK0A 1H28A 4DF3A 3I79A 3FL5A 4RJ3A 1G3NA 3MJ1A 3HMNA 4I4FA 4XUFA 4AOJA 3AQVA 2J7TA 3RAKA 4FA2A 3VS2A 3QZHA 4YPSA 3DFCB 3ZDUA 3ZLWA 3PFYA 4QP8A 4F7JA 3NFFB 2W06A 5L6OA 4QMYA 4ACGA 5A4TA 2W1IA 1PMNA 3QCQA 4IAFA 3EQFA 4KKGA 2EXEA 3KN5A 3Q53A 3FSKA 3OWKA 4FEWA 4XV9A 4BI2A 3F6XA 3MFRA 5HVYA 4Z7HA 3HMIA 2VN9A 2JFLA 4IM0A 5EKNA 2BDWA 3I1AA 2ITVA 5EYDA 2YDKA 3QUDA 4DFBA 5CF5A 2CKPA 5K0XA 5HORA 2GNIA 2BROA 4FYNA 3F3WA 3AD5A 1ST0A 4Y95A 3DXPA 1XH5A 5ANIA 5M4IA 3QCSA 4GFOA 4M69B 3FZPA 4EWQA 2O0UA 2W1CA 1YXTA 5JMSA 2XIXA 4HCTA 3SG8A 1Y8GA 4K11A 4AFJA 2CJMA 1YHWA 5JK3A 4TN6A 2XALA 3AD6A 4LRJA 2IW6A 4BF2A 1CMKE 4IE9A 4XV2A 5DLSA 4QQTA 1GZNA 4FTJA 4FKPA 4USEA 1OBGA 1OIYA 5F1ZA 3I7BA 3EMGA 5M51A 5I4NA 4E8AA 3MIYA 4UMPA 3RAWA 4GFGA 4O6EA 4DINA 2PUIA 3EN7A 2FSMX 5D1JA 1WZYA 2Z7QA 3PPZA 4NM5A 3VO3A 2FYSA 2Z8CA 4G1WA 4K33A 3VW8A 4MXYA 4DDGA 3U87A 4JG7A 1TQMA 5K3YA 1X8BA 1R1WA 2ERKA 4P5QA 3MH3A 2XK6A 2UZNA 4PP9A 4XRLA 3O5AA 5BVNA 3DLSA 5I9VA 3A4OX 2J4ZA 3DA6A 3PXZA 3ZH8A 4ANLA 5BV3A 5EH0A 1YVJA 4U8ZA 2B9HA 3IKAA 4U42A 3NZ0A 4GG5A 3GU8A 4FIHA 4YNOA 3E3BX 3JPVA 5HIBA 4HGLA 3EIDA 4G5JA 3WE8A 5IUIA 3TZ9A 3RHKA 4E73A 2OH4A 5ANGA 3PIYA 5EM6A 1H25A 5GNKA 4U79A 1E1XA 3Q9WA 1Z9XA 4J52A 3TZMA 4LG4A 2YLFA 2P3GX 3ZM9A 3TT0A 3UOKA 3DTCA 5A6OA 3UQGA 4MUQA 3RAHA 5G1XA 4O7ZA 3F7ZA 3U9NA 3MA3A 4OTQA 4QYGA 2AC3A 4IVDA 3FXWA 4O0YA 2UW4A 4BCFA 4DTBA 5T6KA 3ZO4A 4QD6A 4FYOA 2XANA 2JDRA 5CAPA 2BIYA 4GG7A 5A3XA 1FVTA 3ORIA 4TT7A 2CNQA 4A4OA 4FTIA 3QZFA 2QR8A 5E92A 3QX4A 4JRVA 5CF4A 2RIOA 3FBVA 1W2CA 4HVIA 4AXFA 3PG3A 2WTVA 4TWOA 3TKHA 3F2AA 4F0GA 3QRTA 1PY5A 4DFXE 2OZAB 3SOAA 3F5GA 3DKOA 1OI9A 1J7UA 3OTVA 3OZ6A 4V01A 4IAAA 3IO7A 4MX9A 4XG3A 4GSBA 3ZSGA 2BPMA 2X39A 4DT8A 4U7ZA 3R9NA 3W8LA 2R7BA 4GV1A 4UALA 2PE2A 4F7SA 1W0XC 3CD3A 5CNOA 3QD0A 4LV8A 2XYUA 2UW9A 5AX9A 3K54A 4EC8A 3F5XA 2BTRA 4NJ3A 5AR3A 3KXNA 2ITWA 4UB7A 1K3AA 3ZC5A 5E8UA 3RCJA 5JFSA 3PJCA 3RVGA 1H07A 1XR1A 2AEGA 2XNPA 2XRUA 4J96A 3BELA 1REJA 2R64A 1H24A 3D9VA 5ANDA 4RZWA 5L2QA 3FLWA 4MHAA 2X6DA 4C7TA 3SRVA 2R3LA 5M44A 4CCBA 5HTIA 4L7FA 3QZGA 3ANRA 4MNEA 4HVHA 4RFZA 3W2CA 5K0KA 2FSOX 3BHUA 4I0RA 5K9IA 5ANOA 5DT4A 4I21A 3U51A 3M11A 4MNFA 5L2SA 4F64A 4ZLYA 4PDSA 4GU6A 2GDOA 2WIPA 4JJRA 2YLEA 3O7LB 1PYEA 4XBUA 5B2KA 5EHOA 2HW7A 3QQHA 2I40A 4FVQA 4FNZA 4RC4A 4ZK5A 5J87A 2W9FB 4OW8A 4L53A 5AV4A 4NEUA 2XEZA 3QD2B 3SHEA 3DPKA 4ONAA 5AR7A 3MA6A 4USDA 4FT0A 4TW9A 3FY2A 4APCA 1GNGA 3ET7A 2BRHA 3RPRA 3NGAA 3EZVA 3P7CA 4S31A 5BMMA 5TOZA 5F4NA 1QPJA 3LFCA 4MBLA 3UE4A 4ACMA 4OTFA 3R7UA 5HVJA 1VR2A 2QURA 3BWFA 4CZUA 3LQ8A 4JBOA 3IECA 5EDRA 1BUHA 3LKMA 4DFUA 4ZTLA 1YOJA 3BE2A 2VNYA 3QCYA 4HW7A 5CXZA 3A4PA 1PJKA 1ST4A 4RZVA 5AUYA 3HEGA 5GZ9A 1OL7A 4MEDA 2PULA 5LMKC 2YJRA 4RVLA 1UNLA 5IQIA 2C0TA 2UW0A 3BHHA 3G33A 1W98A 5HHWA 5JFVA 2HELA 3R1YA 4GH2A 4I5CA 3F88A 3UNKA 3TMOA 4FV0A 3C50A 1UNGA 2ONLA 2IZRA 4WHZA 1PYXA 3F5PA 3L1SA 4BGQA 3PZHA 4F9YA 5AAEA 4PQNA 4N4SA 5FBNC 3W2SA 3R63A 3S00A 4TPTA 5DIAA 3BGPA 2X2KA 3TI1A 4E6QA 5LVLA 5LVNA 4XG9A 2UZBA 3GB2A 4NKAA 1J1CA 4Y83A 2J90A 4CTCA 3C13A 2QKRA 3DBFA 4CYJA 2OIQA 5L8JA 5CSPA 3QTUA 5CU3A 4NH1A 1DAWA 2GNFA 4G3EA 4U6RA 4G16A 2HZ4A 3ORMA 4IVBA 4CKJA 3LMGA 4WNMA 2JITA 1XH4A 5KMLA 2ZB0A 3R22A 4UV0A 3ID6C 4EHVA 3UQCA 4LI5A 4G6OA 2IN6A 4DG3E 1U46A 1XMMA 3NFGB 5CU2A 2G2FA 2VWXA 4YC3A 1KOAA 5FDXA 2G2HA 5A6NA 4O0UA 3ODYX 3VONA 4XH6A 2X7OA 1FPUA 4NM0A 4WBOA 4F4PA 2UZTA 2B4SB 5AP7A 5HNIX 1DAYA 4G9CA 4CZYB 2JDSA 2BR1A 3E92A 4EOQA 1UWJA 1OIQA 4WG5A 5IA4A 1G8AA 4KSPA 4EHGA 4Z7GA 2BMCA 4BDHA 4CZTA 3FJQE 3HAMA 1CKIA 4FTAA 4FTCA 3IS5A 4O22A 4U43A 4BI0A 3THBA 4YMJA 3NR9A 2GU8A 4FEVA 4A9RA 5C1QB 3NDMA 2EB2A 2OO8X 2PK9A 1R78A 3L8SA 5L8KA 4YZMA 3G6GA 5IQDA 4IZ5A 3VNTA 3QTZA 3DKGA 2UZLA 3L8PA 2OK1A 4KIKB 3W0RA 2X2LA 3ORPA 4H3BA 4XG4A 3LMIA 1PKDA 4MH7A 1S9JA 1H4LA 4ZAUA 1BLXA 2X7FA 5M56A 3C0GA 4AQKA 3P86A 3RZFA 3FPQA 1CTPE 2IVTA 2HK5A 3BIZA 3G9NA 4FV1A 4ZJVA 3NNWA 2YWVA 2YAAA 2J0KA 5EI2A 3M42A 2WTDA 1OIRA 4FOCA 4OLIA 4I0SA 3TUDA 2G01A 3PZEA 2Q0NA 2WMAA 2RFDA 3IDPA 2WTCA 3O17A 3QX2A 3QYZA 4X2FA 5AUXA 4CFVA 3UMWA 3G0FA 5D41A 4E6DA 5HIEA 3MB7A 4IAZA 5JGDA 5M57A 1PXNA 5BNJA 4CCUA 2WQOA 3ZZWA 3UO4A 2GMXA 1OUKA 3JYAA 4BCIA 5LOHA 4J1RA 3WZDA 2VWYA 4ENXA 5KE0A 3NYVA 2X8EA 3OHTA 4OT5A 3CJFA 2QKWB 3HKOA 1J7IA 1O6LA 3MTFA 4B4LA 4RRVA 5EQPA 4M14A 4F7NA 3E93A 4UWYA 4RIWB 5IA1A 1P2AA 4FKVA 4FSMA 4BHZA 3TUCA 3C4ZA 3LOKA 2NO3A 3MY0A 4GT5A 4CT2A 3BL9A 4L9IA 4RJ4A 4O0TA 5IZFA 3FI4A 3DT1A 1YDSE 2WTWA 4UMRA 5KKRB 4RA5A 5AA9A 3W55A 5M53A 5JZNA 4EH5A 3V5LA 1YI6A 3MVLA 4YNEA 3ZEWA 2HW6A 5L6PA 5DEYA 1PHKA 3LM0A 3FKNA 2B52A 4NKSA 4S32A 4QDVA 2WMRA 2YCRA 3WF6A 5BVFA 4HYUA 3SW7A 3D15A 3OS3A 3QHRA 4LMNA 5IUGA 1BMKA 4MD9E 3DK3A 3ATTA 2PMIA 4C3RA 4FTUA 4YBJA 2X1NA 2XBJA 4YJUA 3VBTA 3P9JA 3UIXA 2H9VA 4BWKA 3QLFA 5JGAA 5DNRA 1Y8YA 3JY9A 3V3VA 1DI8A 3VW6A 2WTIA 2X9EA 3V8TA 4HPTE 2PZYA 3ZXZA 2XA4A 4YP8A 4C4HA 2C1BA 3WF8A 3UQFA 5HD7A 2WQNA 3RZBA 1SZMA 3QKLA 4R7IA 5J95A 3OBJA 3C7QA 3I5ZA 5CT7A 4QPSA 2R3GA 3S2PA 5CVFA 2PUNA 2GFCA 4MWIA 3P7BA 5D10A 3C5UA 5E4HA 2BIKB 1UU3A 5AP2A 3ZXTA 3FY0A 3S95A 4CFUA 4L52A 2GNHA 2I0YA 3BCEA 3DB6A 5HNBA 5KBRA 5K5NA 4BDFA 4J71A 4DH5A 3BE9A 4YHTA 3TKUA 4M12A 4O86A 2LGCA 2J5FA 3JVSA 4JX7A 2Y4PA 4OBOA 2R9SA 3ZTXA 4A7CA 3UPXA 2OSCA 4X3JA 4MVFA 5LQFA 2UW5A 4LGHA 3O8UA 3NNUA 1Q5KA 4EQUA 2XMYA 3V04A 5ANJA 5C03A 1XQZA 3KEXA 2Z7SA 1IR3A 2O65A 2WO6A 4YJOA 4NIFA 2EWAA 3OWLA 4GU9A 5LCKA 4BFMA 4ZZOA 3CSVA 2PUPA 4NU1A 3BGZA 3VBXA 2CKEA 4GJ3A 4EL9A 5B2LA 4AN9A 3HV5A 3Q4CA 3QXOA 4XP2A 2XEYA 3G9LX 3KCFA 4L43A 5M55A 4FIJA 3VRYA 3R2BA 2VWBA 1ZYLA 3UDSA 4O7NA 2WMVA 4F6WA 2XUUA 3H0ZA 2PVYA 1UKHA 3W33A 5HLPA 2WGJA 4WBBB 3K5UA 4MKCA 4C35A 3BV2A 3FUPA 4DFNA 3IW7A 4RX9A 5AWMA 2B9FA 4H3PA 4B8MA 4ZY4A 4ZXTA 5BMSA 5K4JA 2ETKA 2VX3A 3R8ZA 2X4ZA 3UO6A 4R3RA 4UZDA 5HE3A 4HVSA 4O7TA 3D5UA 5LJJA 1KUTA 3R21A 4RWLA 1FOTA 4FG9A 1UVRA 2QHNA 3VS1A 4ALWA 1WBPA 3I0OA 1Q62A 1IRKA 3ORXA 3PRFA 3GFEA 4LGGA 2OGVA 5HG9A 3W18A 4BZOA 2VZ6A 5JKGA 4CG8A 3VF8A 2UW6A 3M2WA 4QMNA 2HY81 4F9CA 4ASZA 4RJ8A 4I22A 5CSXA 5HBHA 3RPVA 3UP2A 3ZLSA 3MVJA 4XG8A 5HKMA 5AJQA 4GW8A 5DH3A 3GT8A 4BB4A 2IEWA 3JS2A 2OXXA 4MXOA 3QTQA 4I20A 5IH4A 4GMYA 3TV6A 5IKWA 4PMMA 4EK3A 4JDIA 2DQ7X 3UGCA 5DPVA 3GNIB 1J91A 4H58A 2XNGA 2CKOA 3VJNA 3Q3BA 2PVMA 4M0ZA 2WOUA 4AU8A 5EFQA 3LFQA 4I6FA 1IAHA 4GS6A 2GS6A 3R9OA 2P33A 2QLQA 2JIIA 2F7EE 3GGFA 5AP0A 3PG1A 2C69A 5EW3A 5T3QA 5AM6A 3TEIA 3UIBA 3UYTA 5HQ0A 3TM0A 3KK9A 4GVAA 4HYHA 4E4MA 1U5QA 2RFNA 4BVUA 2CGXA 4ERWA 4EHZA 1AD5A 3UZRA 2C1AA 5J5TA 2W4OA 2VD5A 1SYKA 4GUEA 1NT2A 3KK8A 2G1TA 5KMKA 3B2TA 5KHXA 5H3QA 3OP5A 3FAAA 4AZFA 2YERA 4E26A 3F3TA 2A2AA 2XJ1A 5DE2A 4KIKA 4A9UA 3NLBA 3RINA 3R04A 4ZSJA 2V22A 2YWPA 4EQMA 4UMTA 3PY0A 3I0QA 3RK7A 4IVCA 3SRVB 3UP7A 4FKSA 4F08A 5JQ5A 4AAYA 1XBAA 4FV7A 2JKOA 5CU6A 3VUKA 3SKCA 2VX0A 4RIXA 4G3FA 2WZJA 4PL3A 4FODA 4K8AA 5F20A 5DR9A 2BCJA 5CENA 3C0IA 5I9WA 2A4LA 2O5KA 3TYKA 5JFXA 4A4XA 5HEZA 2VO3A 4Z55A 2QOOA 3NEWA 2ITTA 4TZRA 4YJNA 4KRDA 1KE9A 3PE1A 2X8DA 2CGWA 2BHEA 3KRLA 4I3ZA 2W4JA 3MH0A 2R3QA 2JKMA 3LMHA 1FBNA 4W4VA 4QDEA 3O51A 1UA2A 5AAFA 1U54B 3PIXA 2VNWA 3I6UA 5GJDA 3U8WA 5IDNA 4PF4A 2ZMDA 4IDVA 5FXQA 2PZRA 5AV0A 2W1GA 4I1ZA 3CQWA 3CBLA 3EZRA 5E7RA 3DAEA 3RPYA 1LEZA 4Y5QA 2CHLA 3ZEPA 4BZNA 5J1WA 2QD9A 3C4FA 3MESA 4G34A 3HA8A 5JRQA 4QNYA 2R5TA 3Q96A 4KWPA 4FK3A 4RWJA 4UZHA 1RDQE 3DAJA 2Z02A 3HMOA 1NW1A 2ZV9A 3HA6A 3MBLA 3GVUA 1A48A 4X7QA 3RWQA 2WOTA 3MVHA 1JOWB 3D7ZA 4FF8A 4UY9A 3LFNA 3QA8A 4YHJA 4O2PA 2IWIA 2WTKC 5LARA 2PZPA 3RCDA 5CVHA 2QOIA 4PL5A 3W1FA 5HBEA 3BLQA 3BQCA 3TG1A 4FUXA 3T3UA 4EJ7A 4AZSA 4ITIA 5CLPA 3H3CA 4RBLA 4IAYA 3W0OA 2J51A 2OH0E 3MH1A 3ITZA 5CY3A 4AOIA 3ORTA 4MXZA 4GK4A 5GIOE 2GNLA 4FIIA 5DR6A 3RGFA 2P0CA 2GPHA 3NW5A 5LMAA 2BTSA 3QU0A 4YJSA 3U9CA 3QWJA 4IB3A 4IC7A 4O4DA 4Q9SA 4AZTA 2YCSA 3PXKA 2YM6A 4YJPA 3LCDA 4IZ7A 3ZUVA 3AC3A 3ZBFA 3IPHA 4TNDA 4BDEA 4J8MA 4JG8A 4XRJA 5E90A 2X4FA 1H08A 5EM7A 1URWA 3NUNA 1RQQA 4F6UA 1WBTA 2ITZA 4JR7A 4D9UA 4DHFA 4ZY6A 4NTTA 3E8DA 3HV7A 4UMUA 4ZZNA 4AXCA 1F3MC 2GSFA 4O0WA 2IW8A 3ZSIA 3SVVA 1JWHA 4E5WA 4EONA 2J5EA 2GTMA 1SVHA 2ZAZA 3R30A 4FNYA 1P4FA 2A1AB 2Y4IB 4KA3A 4AN3A 4YZBA 4IADA 4BIEA 4FIGA 4C34A 4D4RA 2BHHA 1OPLA 1BKXA 2IZTA 1REKA 3PVUA 4NSTA 3ZONA 4EH9A 4DT9A 4ZTSA 4A4LA 1OIUA 3QL8A 1OL6A 2H34A 3WBLA 3W0MA 4FT5A 3PTGA 3U6HA 4DHZA 4FC0A 4E7WA 3WOWA 2CNUA 4BDIA 3L9NA 3FI2A 3GCPA 1STCE 4EBVA 3QTSA 3OVVA 3P79A 3EB0A 4FEQA 4RIYA 2WMTA 3UOHA 3CLYA 4CMOA 4D0WA 4HCVA 4WT6A 3TIYA 3UNJA 2W5AA 2A98A 3H30A 3W2RA 5ITAA 4NCTC 3Q6WA 2VTOA 4OUCA 4P5ZA 3IW4A 4Q5HA 1OL5A 1OGUA 3ZDIA 4F9WA 2XAMA 4IZYA 3LFEA 2C6EA 2VRXA 1GIHA 1M2PA 4FRFA 3C0HA 4RJ5A 4EOPA 5KCVA 3PY1A 5CEKA 4KRCA 1JPAA 2ITUA 1Y6BA 4LGDA 3BLRA 3EN5A 1Z5MA 2R2PA 2XCKA 3FQHA 5TR6A 2UZUE 4C2VA 4EH3A 2JAMA 3CE3A 3MY5A 3DBDA 3HX4A 3R2YA 4XJ0A 1XBCA 1MRVA 1Q3DA 2PTKA 3FMDA 1FGIA 3NCGA 4RLKA 4WOVA 3JY0A 4FSTA 2UZWE 3PLAE 5C9CA 4NWMA 2QLUA 5IEXA 4FZAB 3DS6A 5IH6A 3RTPA 5EM5A 4ARKA 3KULB 3HECA 3SC1A 4QOXA 3II5A 4GYGA 4WNOA 4EH8A 5E1EA 4BKJA 3EQBA 4CT1A 1XH9A 2PMNX 3VRZA 3QD3A 4EH4A 5BYLA 5HU9A 1B6CB 1U54A 2WKMA 4QRCA 4TYIA 2C5VA 5CSWA 1YI4A 3F82A 4AA5A 3DK7A 3KXMA 3KRJA 5IA5A 5IH5A 2R3FA 4BL1A 4IW0A 4JOAA 2B9JA 4I5HA 3DKCA 1WMKA 3FKOA 3QZIA 2B55A 4NTSA 1Z57A 5CWZA 3WZUA 5EI6A 3G0EA 4AWIA 3HRBA 5JZJA 4F7LA 2UVYA 3BGQA 3PFQA 4Y8DA 3KF4A 4NUSA 3W8QA 4EQCA 4XYFA 3WYXA 4HZRA 2XNMA 2RF9A 4GKHA 3H9OA 4U97A 2WMUA 3AG9A 4L7SA 5JSMA 4G31A 4MD8E 3UBDA