4U3ZA

Apo map4k4 t181e phosphomimetic mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
295
structure length
282
Chain Sequence
SLRDPAGIFELVEVVVYKGRHVKTGQLAAIKVMDVTEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDREVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 282
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u3zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u3zA01
4F1TA 4ITJA 2WO6A 3KMMA 2PULA 1WVWA 3QKKA 2QOLA 1ZARA 4MKCA 4FV6A 3ZS5A 1V0BA 2BIKB 3FXZA 3LW0A 4NIFB 4EH2A 2O63A 4CZUA 2RL5A 3GU5A 4ZEGA 3W2OA 4OBOA 4D1ZA 4NTTA 3ZYAA 4CEGA 1IG1A 2Z7RA 2UW0A 4R7BA 3CEKA 1OECA 4U0IA 1YWRA 5AUUA 1YXSA 2VV9A 3EFJA 3DBDA 3IECA 4I22A 3UVPA 1G3NA 4EUTA 4XG6A 3COMA 4W9XA 3ZLXA 2CNQA 4NEUA 4E5BA 5HESA 2V7OA 3IDBA 3O8TA 5LVLA 4ARKA 2J4ZA 4FKGA 5L8LA 3NGAA 1YI3A 3KXZA 4IB0A 3QF9A 5EH0A 2JKQA 2CDZA 2ITUA 3LLTA 2AUHA 4JDKA 3DLZA 1OIRA 4F63A 3QC4A 5FDPA 3G2FA 4G2FA 1TQIA 4BKJA 5FEQA 4GJ2A 2VWBA 1NVRA 4FIIA 4HGLA 4I6FA 1U4DA 5LXMA 3ZRMA 3RTPA 1R78A 3QZFA 4EH9A 1L3RE 3LMIA 2VD5A 4EL9A 4BDBA 1JVPP 1J1BA 5DIAA 1BMKA 2OIQA 2BHHA 2VX1A 3GUBA 1REJA 5M55A 4C4HA 4FSUA 2WEIA 4ID7A 5BVDA 2W4OA 3OBJA 2PVNA 5D10A 4HCUA 4GS6A 5AAFA 4YO4A 4FSZA 5TF9A 3OTVA 2HW6A 2W7XA 2WU7A 3ZLYA 3AXWA 5ICPA 2J0MB 4FEQA 2W1FA 4I6QA 1TQPA 2W5AA 3LXNA 2BMCA 4F9BA 5J7BA 3GU7A 2CSNA 2OXYA 3FE3A 3NYVA 3UQCA 4WSYA 3AT4A 4IAKA 2OG8A 5E8UA 4A07A 2W9ZB 3SD0A 2YWVA 3G9LX 3PG3A 2V5QA 4K8AA 4UBAA 3K54A 3NIEA 1Q8WA 4RZWA 3FZOA 4FOBA 2HK5A 4FV8A 4M3QA 3NIZA 3QRJA 2UZUE 4BDHA 3HZTA 1OL1A 3C4WA 5DGZA 3BPRA 3NCZA 3ZHPC 3R22A 4FSMA 2WTIA 2CGXA 4TZRA 4BHZA 2QLUA 4BYIA 4D58A 4JLCA 4QMLA 3UNZA 3VBWA 1OL5A 3R28A 3LM0A 1U5QA 1XO2B 5GJDA 4EOOA 5GJFA 4J8MA 5DLSA 1J91A 3F61A 3MFUA 2JC6A 2X2MA 2R0UA 3DT1A 2VNYA 3LZBA 1YKRA 4JDIA 3WILA 3QAME 2EB3A 5HG5A 2BFYA 2WTDA 4BDIA 2ITZA 4KB8A 3NS9A 3RPOA 2IJMA 4D9UA 2CGUA 4K33A 4DTKA 4H1MA 4CXAA 1M52A 4GK2A 1OUKA 4D4RA 3TN8A 4AGDA 4E6CA 3QUDA 2QR8A 1UA2A 2WZJA 3DQWA 3R0TA 4J52A 5FBNC 2IVTA 4Z9LA 2GS6A 3OP5A 4ACHA 3M2WA 2B9HA 5FG8A 4LGGA 2C5YA 3QX4A 3O8UA 5CX9A 4C7TA 4J99A 4YMJA 1WVXA 5I3RA 4E6DA 2J5EA 2W1HA 3FZSA 3U8WA 4UWBA 5IDNA 2C0IA 4IM3A 4WNOA 5HICA 2C6MA 2UV2A 4CGAA 3SXSA 2VX0A 4RFZA 3BLRA 2C30A 3T3UA 2LGCA 5CZHA 1KUTA 2Q0NA 4LL5A 5EKNA 4IWQA 3ZO2A 4BICA 4WNMA 4FTOA 4Y5QA 3R8UA 3DJ7A 4WG4A 3OTUA 2BZHB 3RINA 3D7TB 1WVYA 3UG1A 1U54A 3GC0A 4O86A 2RFNA 3C7QA 3HVCA 1IR3A 4M67A 3LCKA 3A4PA 5FM3A 2R3HA 4NK9A 2SRCA 2IW9A 4DGOA 2YHVA 4QP1A 4EOLA 5IG1A 4RC4A 3UZPA 3C0HA 3I6WA 5JFWA 2GNGA 1URWA 3PE1A 4UYAA 4FSNA 3DTWA 3F88A 5C03A 3LFQA 2ZM3A 3P4KA 3R9NA 3ZU7A 1Q62A 4ANLA 3NVKI 1F5QA 3MH0A 3SW7A 4FKJA 2VRXA 3O96A 3VRYA 3H30A 3DGKA 3VS1A 1OB3A 2C69A 3QYZA 5JRQA 2IWIA 1AQ1A 2WTWA 1YOMA 1M2RA 5AR5A 2R0IA 4A4LA 5KNJA 3P7AA 4M69A 1KOBA 5GZAA 5CNOA 5JK3A 2ERKA 2JLDA 5AA9A 1H01A 2FSTX 3ATTA 2XK7A 4G16A 3R01A 4A9UA 3V5TA 4ZAUA 3MY5A 3I6UA 5AUYA 4OTDA 3WARA 4BI2A 5AWMA 2UW5A 3F5XA 2JDTA 2C6LA 2WMSA 1KE9A 4FTLA 4L52A 3QD3A 4I0RA 4P7EA 5AMNA 3CC6A 4JBVA 2UW3A 5HU9A 3QLFA 4PDPA 3Q04A 5ACKA 4R3PA 2CMWA 3UC4A 2WGJA 1KE8A 3OCSA 5TO8A 4NKSA 1URCA 2IO6A 2YFXA 3MB7A 3MDYA 3QCQA 4FV7A 4RIYB 5H8BA 5A4LA 5KMIA 1NT2A 2OXXA 2W99B 4IB3A 3LFEA 4MD8E 5EK7A 5FP6A 5C8NA 1H28A 3QLGA 1H1RA 3R8MA 4P4CA 3SQQA 4OW8A 3U87A 3EWHA 4M14A 3QZGA 4AUAA 4C8BA 2Z8CA 4NYEA 5EI2A 2XKDA 2HYYA 3QXPA 4IADA 4XBRA 2GNHA 2W5HA 3BHVA 1PXNA 5KO1A 1YHWA 2YCFA 4AZEA 3KVWA 1YXTA 4LUEA 1M2QA 2HY81 2XYUA 1RJBA 2X39A 4D1SA 3MPTA 5H8EA 5CY3A 3D14A 3KA0A 4KD1A 5EKOA 3RAWA 4PX6A 3BGZA 3PJ3A 4PMTA 4U80A 3IO7A 3ZDUA 3LXPA 4LV5A 3QTZA 4RJ7A 4BWPA 4H36A 3WZEA 3ET7A 4EH5A 3BWJA 5BVWA 4F7SA 5CNNA 4YC3A 2ITXA 4KIKB 3PJ1A 4FTIA 2RKUA 3CBLA 4I6BA 3EB0A 4ENYA 4O7TA 2E9VA 2XEYA 4O0RA 3ACJA 1Q24A 4EK6A 2QHMA 2HXLA 3RNYA 3BIZA 5AP5A 5FDXA 3K3JA 5CT7A 3UNJA 4A4OA 2Z02A 2R3PA 5LVNA 1FVTA 2R64A 4JBOA 4EZ5A 2OJJA 3JUHA 2V62A 2CLQA 4YZDA 4AOJA 2PUPA 3EYHA 4DH5A 3LFAA 4RC3A 4GCJA 4EOKA 1ZWSA 2QU6A 3TZMA 3R30A 2JFLA 3BZ3A 2VU3A 4BDKA 4CT2A 3LFSA 2GHMA 4ZTMA 2I1MA 1ZOGA 2E9UA 1Q5KA 2Z7LA 4JG6A 4N6ZA 5KZ0A 2VWUA 5E1SA 4EOIA 4O2PA 1H0VA 5CEIA 4F64A 2EXEA 2Z2WA 4OT6A 3EQRA 4WRSA 5F20A 4YZBA 3N4VA 4GU6A 4IB5A 4IIRA 5TR6A 4AS0A 3UO5A 5HNBA 4ZOGA 4FKSA 1JOWB 3AT3A 3FLWA 4Z16A 4FZ7A 1FGKA 2UZVA 4HCTA 5IU2A 1F3MC 3AMAA 4QMXA 4D5KA 3V5PA 5T68A 4AN3A 2R7IA 4XLIA 3NDMA 5AEPA 4MXYA 3ZXZA 5GNKA 1PRYA 4BBFA 2Y4IC 1H4LA 3R83A 3VS6A 4U40A 3U51A 3RCDA 3LCTA 4ZTSA 4DEAA 2QOFA 3ORMA 2VWZA 3SA0A 1PMNA 4LRJA 2ZJWA 4GT3A 1BI8A 3LJ0A 3ERKA 3T8OA 2B55A 3LQ8A 4EUUA 5FTQA 2JBOA 5HIDA 5KE0A 1KWPA 2XBJA 2W06A 3R8VA 4F0GA 4BTKA 2R3MA 4IZYA 3K5VA 3MIYA 4UMTA 1I44A 3KC3A 2QG5A 4RX8A 2XK4A 1YDRE 3DB6A 3BQCA 3IONA 3LFNA 3ZRKA 4DFUA 2A2AA 2PMLX 3KULA 3FMKA 4H3BA 2PVMA 2BUJA 3E8DA 4JNWA 3T9IA 2GNIA 2I0VA 3D5WA 3SV0A 5JH6A 2GMXA 4PP9A 4E8AA 3TNPC 3ZEPA 4EKLA 4O0WA 4F9WA 5B2MA 3DXNA 4GL9A 2W05A 2WQBA 4I5PA 4FEWA 4A06A 4XEYA 5CXHA 4QYGA 4YBKA 3UE4A 1H07A 4X21A 1WBNA 3PA4A 3Q9ZA 5CI7A 4D5HA 4FK3A 2NRUA 4C3RA 4D2SA 5L4QA 1ZMWA 3NVMB 3UVRA 3F6XA 3OG7A 2OU7A 3HUBA 5HIBA 2Y0AA 5FQDC 3O71A 1OUYA 4CTBA 3ORLA 4D0WA 4UZHA 4FKUA 4BZNA 5L6OA 4XG4A 3SAYA 2X7FA 1R0EA 4QPMA 5AA8A 4RQKA 2BIYA 2JBPA 4Q9SA 3B8RA 1EH4A 2PVJA 2VWXA 4QO9A 3QCYA 2BCJA 2C3LA 3QWJA 3C0GA 2YCQA 3KCKA 3RAIA 4J98A 1JKLA 3OY3A 5EYDA 2A0CX 2WMTA 2YERA 1T46A 3PY0A 3W2SA 4DTBA 3HL7A 3BEGA 4QP9A 2CKOA 4C37A 4TYHA 4AW1A 4USEA 3QXOA 2R9SA 4BTFA 2ESMA 5E92A 5E4HA 3S1HA 1Q3WA 4K11A 5I0BA 5GHVA 4IMYA 2YEXA 1VZOA 2XZSA 5AUVA 4DEGA 4ZMEA 2VX3A 4HNIA 5IQEA 3DTCA 5IEVA 3P0MA 4M97A 4I4EA 4X0MA 2WEVA 1L8TA 1XWSA 3OWPA 2WQMA 4L46A 4OBQA 3VJNA 5IA4A 1LUFA 1ZMUA 2FO0A 2OZOA 2JDRA 1YWVA 4FEVA 5EYMA 2IVSA 4JR3A 4IX5A 4AZVA 3CPBA 2VTLA 5IUIA 3TIZA 2BDJA 4BWKA 5AV1A 4JDHA 3GP0A 4RFYA 2NNWB 2HCKA 4QQTA 3DDPA 3CGFA 4R5SA 4C57A 2YDJA 2VTQA 3NUXA 5KKRC 3MA3A 4V0GA 2HW7A 3R7UA 2VTMA 4LOPA 3QCXA 4R3CA 3SRVA 2UVYA 2XUUA 3KB7A 2FYSA 3Q32A 4EOJA 4CZYB 2RFSA 1OPKA 3O50A 4MXCA 3ZZWA 2ZB1A 4II5A 5ETFA 3A62A 4MNEB 3QTRA 1OPLA 2GS7A 4EONA 5HO8A 4IX6A 4I6HA 4Y83A 5DE2A 2UZTA 3HNGA 3NCGA 2YM8A 4EOQA 1JKSA 3HRCA 4TXCA 3BLHA 1M2PA 3DNEA 2OZAA 2XNOA 5J7HA 2YIWA 3WYYA 4XH6A 4O1PA 3VBTA 2ZV2A 4NUSA 4QP8A 3CQEA 1O6KA 4B99A 1Q8ZA 3A7GA 3K3IA 3MV5A 3R2YA 4FKQA 3NNUA 5DR6A 2UZEA 3HMOA 3QD4A 4BY9E 1KOAA 2I0HA 2YABA 3E3BX 1SVGA 3SC1A 4D0XA 4EH7A 4TTHB 5L3AA 4AW5A 4OLIA 4X3FB 3D5VA 2ITTA 5AAEA 5IZFA 1Q97A 4FT7A 2OH4A 3IQ7A 1ZZ2A 3BBTB 4OTHA 3E62A 5AV2A 4IAAA 2IVVA 4K6ZA 3WF5A 3NYNA 1PXKA 4E4NA 1YXUA 4BC6A 4ORKA 5M09A 4BHNA 5A3XA 3EJ1A 5I9YA 5CSHA 1KSWA 4KRCA 3V5WA 5JKGA 5GZ9A 2C1BA 4YJSA 2X2LA 3PUPA 3FSKA 3VNTA 2W1GA 2C3KA 1PY5A 3MVMA 2UZOA 5FGKA 4ZMFA 3DB8A 3LFDA 4GT4A 2NP8A 4JDJA 5I9WA 3DXPA 3E63A 4ALWA 3KEXA 2NPQA 3C1XA 4U45A 4NFNA 5J8IA 3BKBA 3EKNA 4ZY5A 3GB2A 1SYKA 1P4FA 2CN5A 4JXFA 3TTJA 1XHAA 3FL5A 3VJOA 4USDA 4YZNA 4EKKA 4KS7A 2E9OA 3K2LA 3MB6A 1Y57A 3OS3A 5HLNA 5H2UA 2FB8A 1P14A 2YAAA 2X7GA 3LVPA 3KRXA 3BHUA 3CGOA 4L43A 3MH2A 4LL0A 4RX9A 1O6LA 5K0XA 2PVKA 3SVVA 4NIFA 5I5ZA 4O0YA 2JIIA 3C0IA 4QPSA 4B0GA 2OGVA 4FK6A 1LEZA 1NVQA 3F2NA 3F69A 3QUPA 4F1OA 1AGWA 1R39A 4RX5A 2RGPA 3FI2A 2B9FA 4XV1A 3G6GA 4FTKA 3WZJA 3EQBA 2GSFA 2C6OA 2C5XA 3O0GA 2IZTA 1WFCA 5DR9A 4E20A 3U6HA 4KA3A 4CFMA 2WAJA 2XK6A 3EQHA 3MTFA 3AD5A 4GFGA 3RGFA 4EK4A 1V0PA 2BZJA 2XCKA 3PPZA 4BDJA 3UQFA 2VAGA 4GKIA 2VTTA 4U79A 1OBDA 4RA5A 4UXLA 4HYHA 2Z7SA 3QHRA 3FUPA 3RK7A 5EYCA 1H25A 1JSTA 3DFAA 4FSQA 4P2KA 2WB8A 4WHZA 3VBQA 3IG7A 4I0TA 3HMIA 4RC2A 4WRGA 3ZUVA 4EC8A 4RPVA 5J79A 3P1AA 4QTAA 4IDTA 2VNWA 4AN9A 2FVDA 4UWCA 5M4CA 2XKEA 3EKKA 1W98A 2DQ7X 4QMWA 5DI1A 4AN2A 1W0XC 4O0VA 1QCFA 4WOVA 4N70A 3Q60A 2Y9QA 4U3ZA 2WMRA 3TNWA 5TKDA 1JBPE 3U55A 4JI9A 5IA5A 4MQ1A 4DINA 2YAKA 3S4QA 3REPA 3R7GA 4RQVA 3R1NA 2CKEA 3UPXA 3F2RA 4AACA 3BYSA 2UZNA 3R7OA 3VBXA 2WHBA 2VWIA 3Q4UA 5HVYA 5BYZA 2HZ4A 3QQUA 2GTMA 3AC1A 5HEZA 4AT5A 1X8BA 4XG2A 4TWOA 1BL6A 2CJMA 4GVAA 2XS0A 5E91A 3QWKA 4J95A 3UO4A 1M7QA 3A7FA 3E7VA 1HOWA 4OTFA 3PVUA 3MI9A 4DEEA 5IA1A 4O84A 4FZAB 2GNJA 4XV3A 4QNYA 3GOPA 3BBWA 2YZLA 2QOKA 4BDAA 4LRMA 4JS8A 1KE6A 3U6IA 4F99A 3SX9A 3B8QA 3PXRA 2W0JA 2X9FA 2OF4A 4JJRA 3D15A 5E8VA 3ROCA 1KE7A 3ZBFA 4AZFA 2J0JA 3QRTA 5JZNA 2XM8A 4R3RA 1Y6AA 4TNDA 5GIPE 3R7YA 5LJJA 3IS5A 4PWNA 4O81A 4W8EA 5HOAA 4N57A 3VF8A 3KN5A 2O0UA 1APME 3BE9A 1FVVA 1BLXA 3ORNA 2XNEA 2YM5A 2HY0A 3K5UA 4MCVA 4ZTQA 3WZDA 3FMMA 1PXIA 3A4OX 5CI6A 4DYMA 4EHVA 4EOSA 3JVSA 4F6SA 5AADA 4ACMA 1U5RA 2GPHA 2F2UA 4QMQA 3ZSIA 3U9CA 3P5KA 4ITHA 4XG7A 3U4UA 3IGGA 3G51A 3H0ZA 4KKEA 3HV3A 3ZM9A 4O21A 4X6QC 3TNHA 5BMMA 2PE1A 2IW6A 4MD7E 4FT5A 1J7LA 5J95A 4F9YA 4UMUA 4OTRA 4Q9ZA 2PUNA 4AOIA 3ZSHA 5EQPA 2BRNA 3W55A 5AM6A 2FSOX 3DK3A 2ITYA 3RCJA 3MH1A 3DXQA 3E64A 5HORA 4ZLOA 2ZMDA 3GCUA 1PXMA 4ASXA 3AC8A 4D55A 1YI6A 2B0QA 3D5UA 3AT2A 4Q2AA 2ONLA 2J0LA 3PRIA 4I92A 4X7QA 3V5LA 4LM5A 3A7JA 4IAZA 2QODA 2W17A 3NW5A 4XJ0A 4AA5A 2XJ0A 4JQ7A 5AX9A 3DZOA 2WFYA 5IQIA 5I9VA 3HV7A 3KXGA 2R3LA 1OL6A 3P78A 4RIXA 5EM8A 4ZS4A 4DFXE 4F0FA 4TYGA 3P79A 4FR4A 4KSQA 3QTIA 4CD0A 4P90A 5KHWA 5IKWA 3C50A 3KQ7A 4IACA 3VUDA 4CT1A 2BPMA 2RF9A 2Y7JA 3HDNA 2EWAA 3F7WA 3FY2A 4YNEA 2PE2A 3QUEA 4BIDA 2XKCA 3V01A 4BTMA 5GZ8A 3HAMA 2VO6A 5C4LA 1SVHA 3SW4A 4C3PA 5HVJA 3P08A 4KBAA 4ANOA 2B1PA 3L9MA 4BCOA 5A46A 5JSMA 1OIUA 3VO3A 1FPUA 2X9EA 2VO0A 1FMOE 5AUTA 2XNNA 4CVAA 1Y6BA 4HVIA 4I93A 3DPKA 4H1JA 4O6EA 4YUQA 2WOUA 1PKDA 4OAVB 3WE8A 5HNGA 2O65A 2ZDUA 3DQXA 1ZY5A 1GIIA 4JX3A 3MGYA 2XVDA 3ORIA 2JIUA 4G3GA 4S2ZA 1DAWA 3T3VA 3FJQE 5AP7A 3BU3A 4RIYA 2WQNA 4C36A 5CSVA 1YXXA 3R21A 5HBHA 4EK8A 4YPDA 1G8SA 3S2PA 4XG3A 5AR3A 1J7UA 4G3FA 1PW2A 3DS6A 3MJ1A 4U5JA 3CXWA 5AR2A 4ALVA 5JRSA 1OVEA 5EI6A 3FBVA 4L45A 2ONLC 4XRJA 1NA7A 4I20A 3VHEA 2X8EA 4C38A 5K4IA 4HYSA 3RWPA 4FA2A 3DK6A 4ZSAA 2HELA 3OW3A 4F6UA 2IN6A 2OLCA 4K0YA 3QKMA 1CDKA 2ERZE 4D2PA 5EDPA 5ANOA 3OWJA 3R8PA 3RZBA 4X2FA 4BZDA 3ITZA 4MXZA 1Q3DA 1ZLTA 3CY3A 5H8GA 3NNVA 5EW3A 2YZAA 3BHHA 2B9IA 3O7LD 4XV9A 3R9OA 3BHYA 5DWRA 3W32A 5CENA 2P2HA 1Z9XA 4D4VA 3OMVA 5CLPA 3KMUA 4G17A 3V8TA 4KIKA 4O0TA 1Q8YA 2ZVAA 4J7BA 4R5YA 4G9RA 2YN8A 2OW3A 3I60A 1B38A 2QOIA 3PZEA 4YSJA 1IRKA 3G6HA 4A7CA 1R0PA 1P5EA 5FTGA 5AV0A 3FAAA 3N51A 1M17A 4HGEA 2WMVA 3F3UA 2WTJA 2R3IA 3G0EA 1XBAA 2ZMCA 2UZWE 3GQLA 3PVBA 4AP7A 3D5XA 4G5JA 3D9VA 3NLBA 3HMNA 5JFSA 3E8EA 3DAEA 5D7AA 4ZP5A 3FQHA 3R8LA 4GIHA 4OBPA 4L42A 2GQRA 3MFTA 3KF4A 3KN6A 3NYXA 3ZBXA 1YW2A 4A9YA 5E90A 4IH8A 4DGNA 2VN9A 2JAVA 4BF2A 4FEUA 4PPCA 5EFQA 4PL4A 3RP9A 3I4BA 5DRBA 2WIHA 4BFMA 1O9UA 1PKGA 3JS2A 4I4FA 3TKUA 3VS0A 5CEKA 2CGWA 4MXAA 4CFVA 4AQCA 3ORXA 1YXVA 3WF8A 4GEOA 4IAYA 4NM3A 5F95A 2QQ7A 4K9YA 4Z3VA 3TDWA 2HIWA 3TI1A 4HVHA 2I0EA 1V1KA 3RBWA 4FG8A 4YTIA 3PA3A 3G5DA 4CFFA 2QC6A 3HYHA 3TNIA 5AR7A 4A9TA 5IQGA 1LPUA 4RIWB 5DT0A 3FMNA 3HUCA 5LMBA 2J0KA 2YACA 4C3FA 5LCJA 4DT9A 3NEWA 5KZIA 2VTRA 4FTAA 2DWBA 3PE2A 4WNPA 1XH9A 2GNFA 3TIYA 4P5QA 4XBUA 4FIGA 4PF4A 3CJFA 4GYGA 5BVKA 2HAKA 3RK9A 3UG2A 3FL4A 2VWYA 4HZSA 5ANEA 4EEVA 4EH8A 5LVOA 3NUNA 4BDEA 2OFVA 1NVSA 3UJGA 4F7JA 4IVDA 5HCXA 4HGSA 4AFEA 3NZ0A 1K3AA 3EQFA 4QQ5A 2I7QA 3BHTA 4FZ6A 5K9IA 3HP2A 4YHJA 4FG7A 1OKWA 4G31A 4JRNA 4LOOA 3QD2B 4GT5A 4B8LA 5D11A 2X81A 3UC3A 1A06A 3E93A 4AXAA 4HVSA 1CKJA 4BCMA 2PL0A 3F82A 4C59A 2F9GA 4YHFA 5IUGA 2BROA 4GFMA 1Q8TA 3Q9WA 4FKLA 4EYJA 4TW9A 1JQHA 3QTXA 4YPSA 2B53A 2R5TA 2NO3A 2J9MA 3ZOSA 2OK1A 4W4YA 4DG0E 5CSWA 4DFNA 4O91A 3F5GA 3ZZEA 4PP7A 4WIHA 5JEBA 4U9AA 4YJRA 1BUHA 2X8DA 3ORPA 4TYJA 4AFJA 2CLXA 5M53A 1UV5A 4KSPA 3TCPA 3UGCA 4IJ9A 4PMMA 5CSXA 2XRUA 3VW6A 3TKHA 4ZJJA 3R9RA 4F0IA 5BQ0A 5DEYA 4KIOA 2Q83A 4L3PA 3KREA 3LOKA 4JRVA 4DH7A 4RRVA 5HX8A 5JMSA 2OWBA 2QU5A 3TTIA 3Q96A 4QTDA 2PVRA 3QX2A 3RAHA 1UU8A 2E9PA 2R3OA 4RLLA 1NY3A 3MIAA 4C0TA 1FBNA 3V04A 2PZ5A 4H05A 3W2RA 1YOJA 5M08A 4J96A 3HA6A 3QU0A 5HHWA 1G8AA 1OMWA 5FBOA 4DBXA 4S34A 3B2WA 4L7FA 3OY1A 4QRCA 1PF8A 2AC3A 3L9LA 2FUMA 2WMWA 4MH7A 4QMSA 5BVEA 3PIXA 2O5KA 3O51A 3DK7A 4HW7A 4UYNA 4HJOA 2V7AA 2VTIA 4YBJA 3VC4A 5L2IA 3NUSA 3OWLA 3ZLSA 4JQ8A 1ND4A 3FZTA 3GVUA 4FODA 2JDSA 4FT9A 2R2PA 4N4SA 3FMLA 2UVXA 2OBJA 3JVRA 2GNLA 3UYSA 1T45A 4KIQA 1Q8UA 4C33A 4AU8A 2F2CB 4QTCA 4F7LA 4IQ6A 2QR7A 4BVUA 4C4JA 3RJCA 4NFMA 3Q4TA 4W4XA 1U59A 1LP4A 3PPKA 4RJ4A 2C3IB 2C6TA 5GIOE 3PWDA 1PYXA 3DBCA 1JKKA 4QP7A 3A2CA 4J8NA 2C4GA 5IQAA 3RPSA 3WI6A 5ITAA 2R3FA 3PSCA 1REKA 3BYMA 4RVKA 3BGPA 1SMHA 2W4JA 3PA5A 3R7IA 2J6MA 2JAMA 4XMOA 2OIDA 4OTWA 3W33A 3VQHA 3OXZA 3OXTA 4BTJA 1RDQE 5KBRA 3D2KA 4L67A 5C4KA 2OJFE 4R8QA 5ANGA 5CU4A 3RNIA 4PL5A 4QMPA 5LMKA 3DBEA 3P9JA 3NPCA 2OO8X 4FKWA 4FYNA 3W2PA 2F4JA 2XNGA 1U46A 2ITWA 3IGOA 1IEPA 3ZDIA 3SG9A 3C4FA 3SGCA 5H9BA 2O8YA 1Y8YA 3IOKA 5J1VA 4FKVA 5CU3A 4ANMA 3CIKA 4TPTA 3PY3A 3OROA 3R7EA 4R78A 4RT7A 4BCPA 4CCBA 4NZWB 2ETKA 2C5OA 2X0GA 5DMZA 1UNLA 3NRMA 4X3FA 4AT4A 4XYFA 3RM6A 4GSBA 4EORA 3E5AA 3FI3A 4NKAA 1F0QA 4U81A 5KMLA 5M57A 2V55A 5LWMA 2WTKC 3R00A 1XQZA 4E6AA 2XB7A 3UOJA 1WBTA 3MPAA 4WD5A 2YIXA 3Q3BA 2ITVA 5AX3A 4AE6A 4O27B 3HX4A 2QURA 3QHWA 5D41A 3BV2A 3R02A 3B2TA 3UZTA 2DYLA 3FZRA 2JGZA 5AP4A 3SDJA 5A14A 3EFWA 2GHLA 4YTHA 4MAOA 1YDTE 2BZIB 4DAWA 5J9LA 3PYYA 1GIJA 3DJ6A 4CKIA 4O7YA 5EI8A 1J3HA 2YLEA 4H58A 4QQCA 3ACKA 1XH6A 3UIBA 2YM7A 3PLSA 3NW7A 1FOTA 4XUFA 1OL2A 4GRBA 4Y73A 3LHJA 2W9FB 4PDSA 4XCUA 1QL6A 4C4IA 4DG3E 3PXKA 4CTCA 3L1SA 3OOGA 4IE9A 3Q9XA 3QC9A 4YJNA 1WAKA 3QTUA 3G15A 5CAQA 5A6OA 3JR1A 3DKOA 4IJPA 3WOWA 5LMKC 1OL7A 3UOHA 5HZNA 4O6LA 3FMHA 3LXLA 4C61A 3ZO3A 2BFXA 3TJCA 4CFXA 2J7TA 3ELJA 5CAOA 2ZAZA 1TVOA 5KMOA 2PTKA 2WTCA 1KE5A 1ZYJA 1XR1A 1DAYA 3IW7A 2OJGA 4RJ5A 3HEGA 3KFAA 3EZVA 4FV9A 4IWDA 5HD7A 5I3OA 3ZC6A 3AGLA 4EWHA 2DS1A 1P2AA 3M1SA 3EN5A 3QA0A 3ZMMA 3C4XA 5HVKA 4ZZOA 4DLIA 5KMNA 4FTUA 2BTRA 3U54A 3L8PA 2YIYA 1PJKA 2H8HA 5DT4A 2VWVA 2CN8A 5K5XA 3EN9A 2CPKE 4ZXTA 3VS5A 5IMEA 1MRUA 4O7ZA 4TWCA 1OM1A 3NUAA 5CF5A 4QNAA 3FI8A 4R7HA 4F9CA 4PRJA 5FXRA 1UWJA 4EH6A 4PL3A 2IW8A 2XNPA 4MBIA 4IEBA 4ALUA 4LMNA 3EQPA 2HOGA 3QQHA 2FSLX 2PE0A 3SG8A 4N0SA 5KMKA 5CU6A 4J71A 5DHJA 3DY7A 2QO2A 3GT8A 4UV0A 2C5VA 1IASA 4WT6A 1GY3A 3E92A 4LGDA 4G6LA 3DJ5A 4M0YA 4C4EA 2R3QA 3PXYA 3N4TA 5IA3A 2CGVA 4RVMA 3PIZA 3HA8A 4L7SA 1GZKA 3PP0A 5DA3A 4YGAA 5EM5A 4GMYA 5BUJA 5IH6A 3OBGA 5DYJA 3TUCA 4JOAA 4FV0A 5M51A 5A4TA 2E9NA 2G15A 4E6QA 3F2AA 3QGWA 1RE8A 4F4PA 4QMNA 3LPBA 2YIRA 3PJCA 4KKHA 3UMWA 4ZSEA 4JIAA 3POOA 3OF0A 4TKSA 5DR2A 1H24A 3O2MA 2VTAA 2YISA 4ZLZA 3HP5A 4UWYA 5TE0A 3BWFA 3MESA 4PY1A 5C8KA 3TEIA 4WO5A 4H3QA 4XG9A 1Z57A 4FMQA 3GU6A 4AE9A 4NL0A 4FICA 3A8XA 2C1AA 2W96B 3FPQA 5DG5A 2PVYA 4QP6A 4CKRA 4O22A 3TXOA 3DKFA 3AGMA 4WNKA 3WZKA 2PHKA 3ZFXA 2B52A 3QALE 3EOCA 4KS8A 4YJUA 3COHA 4X3JA 3PSDA 4L53A 3KMWA 4ZJVA 4APPA 5C1QB 2G9XA 2Y4IB 5CWZA 4EQCA 3S95A 4OTPA 5CEQA 4BN1A 5M44A 2JITA 2GHGA 2KULA 3OEZA 4FSYA 3FEGA 1TKIA 4JG7A 1VJYA 4L3JA 4M84A 3VVHA 3PVGA 4ZTHA 4PPBA 5EHYA 1MQ4A 4FTCA 1JSUA 3CD3A 3CTQA 5AP3A 4NM0A 4GK4A 3PY1A 3V5JA 4CMOA 1STCE 4YZCA 4IBMA 3LQ3A 3PIYA 3P23A 3T9TA 5JGAA 4IB1A 4PNIA 4AZWA 4XP2A 4DLJA 4FNXA 4Y85A 4L00A 4NTSA 3GU8A 3EN6A 3C9WA 1ZOHA 5J1WA 2V22A 3UPZA 4AW0A 3RPRA 2WPAA 2YWPA 2HZ0A 3VRZA 1OIQA 4GFOA 5FEEA 4MF0A 4DCAA 1QPJA 3EIDA 1YQJA 3BYOA 5BYYA 2WELA 1BX6A 3OCGA 4WG3A 4Q5EA 3H3CA 4K77A 5F94A 3VS4A 3N9XA 4KKGA 4F1MA 3R7VA 3ZCLA 4GU9A 4TWNA 2BRGA 4ZK5A 4YU2A 4LGHA 3LLAA 4EK3A 2Y8OA 4GW8A 2X2KA 4MBLA 5DRDA 3WE4A 4IANA 3VS3A 2I0YA 4MK0A 2J2IB 5TT7A 2X7OA 3Q4CA 4LI5A 3A7HA 1R3CA 2BILB 3HV4A 4DGLC 3ZONA 4C35A 2XBAA 3NR9A 4LUDA 4X2KA 2WXVA 3DU8A 4FTMA 3ODZX 1V0OA 5DBXA 2QI8A 1ZAOA 3AC3A 2WIPA 2VTHA 3DV3A 3Q4ZA 1OZ1A 1WBPA 2EB2A 3VS2A 1CKIA 2XP2A 1YDSE 1ZYCA 3WF7A 5CQUA 3ZM4A 3PG1A 2XKFA 4I3ZA 4BI0A 5EW8A 4O7VA 1PMUA 3GC9A 3R71A 4BIEA 4NWMA 2YM3A 4O7RA 2YM6A 3KRJA 3NYOA 3VW8A 3DA6A 3NMUF 4FKTA 2BRHA 3TM0A 5T6KA 5FRIA 3IDPA 4FIFA 4YP8A 1ZMVA 3A99A 3E7OA 3AQVA 5L2QA 3KULB 4CRLA 2XH5A 4WUAA 4XX9A 3U6JA 3L9PA 3NSZA 5E9EA 2C68A 4G3CA 2UW6A 3UP2A 1GNGA 3GFWA 3ZFMA 5FXQA 5KKRB 4KNBA 3H9OA 4HPTE 3ZEWA 3PVWA 4BCHA 2BDFA 4BBEA 4X2GA 3RM7A 3WYXA 4ACCA 4FI1A 2CKQA 1SZMA 4EH4A 4WKQA 1XH8A 3LIJA 4D2RA 5CYIA 2J0IA 4R7IA 4AF3A 4I94A 1H1SA 3W18A 1FMKA 1BYGA 4UEUA 5CAPA 4G9CA 3UODA 2W1CA 3OUNB 5FLFA 3RWQA 3GC7A 3HV6A 5HG9A 4C58A 2XNBA 5GINE 4CMUA 5FWKK 4BKYA 3NW6A 3KKVA 4YJVA 3UQGA 4M66A 4FNZA 4HPUE 4FVRA 5HO6A 4F70A 4CQEA 4TYEA 5DEWA 3WIKA 3N4UA 4AA0A 3KL8A 4HCVA 2Z60A 5CTPA 3LCOA 4ZIMA 2WD1A 3BEAA 4CFWA 5DFPA 2ACXA 2VTNA 2P3GX 2XF0A 3GI3A 3ODYX 5HBEA 5IQFA 2XIXA 4DFBA 4FT0A 3ZFYA 3ZH8A 4DH8A 4OTIA 1GOLA 1FINA 4MXXA 2YM4A 4AAAA 4PMPA 3F7ZA 2R3GA 5DT3A 3VUKA 4Y46A 2OH0E 4EBWA 3SLSA 2A4LA 2UUEA 5DPVA 4ANSA 3KY2A 4YTCA 2IG7A 3QZHA 3C5UA 2C6EA 5B2LA 4Y95A 4EHEA 3ZUTA 3KK9A 2FH9A 4FIEA 3NUPA 1WBSA 4FV1A 4PTEA 3VAPA 4V0GB 4B8MA 2PMOX 3I0OA 3II5A 1ZZLA 4OT5A 4D4SA 2QG7A 3TG1A 3SRVB 4BCKA 2XK9A 3U9NA 2OI4X 3MA6A 4BWXA 4YTFA 3QGYA 4O7NA 2BR1A 4FG9A 4RIWA 4JBQA 3R2BA 1SVEA 3E87A 3RHKA 4YURA 1ZYSA 4Y72A 4ERWA 4EJ7A 5E8YA 3VUMA 1UWHA 1IA9A 3R6XA 1DS5A 2ZM4A 3V6RA 2GCDA 5CVHA 5JT2A 4NH1A 3M42A 1W8CA 2OZAB 4HZRA 2ETRA 1QMZA 5FXSA 4D9TA 2VO3A 3GCVA 3UDBA 2ZOQA 3EN7A 3D7TA 2CNUA 3BCEA 3LCDA 4ZLYA 3PJ8A 3HRFA 4C2VA 2X6EA 4KIPA 2QO9A 3AC2A 2XIRA 3QL8A 3MYGA 4O7WA 2QD9A 3IW8A 4U44A 4Y8DA 1JKTA 1W84A 3HDMA 1CM8A 3U4WA 5CEPA 3F3TA 4F08A 2UW9A 3H9RA 3MW1A 3PXZA 4YJPA 4U6RA 2QKRA 5H3QA 5DOSA 5L2SA 5C9CA 2YDKA 3UTOA 4XS2A 3I1AA 4APCA 3COIA 4YZ9A 1WBOA 4YLKA 4MYGA 4XNEA 1WBWA 4RVLA 3KXHA 4BDFA 3PSBA 4E26A 4ONAA 2YITA 5ACBC 4IC7A 4KBKA 4PTGA 3CKXA 5A54A 2VTOA 3VQUA 4ERKA 3FLQA 1RW8A 4NJDA 2W4KA 4HVGA 4O7LA 4HOKA 4YLJA 4BDGA 3FY0A 1TQMA 3CTJA 2R3JA 5ANIA 2PZPA 4C2WA 5CSPA 4U7ZA 2C6IA 3EZRA 1H1QA 5AFVA 3H10A 5K0KA 1UU3A 1PXPA 5ETIA 4BGGA 4ZTNA 4CSVA 1XH7A 1E1XA 1H0WA 1PXLA 2OIBA 4RJ8A 2GQSA 4B9DA 3I7CA 3LQ5A 4ZZNA 4UY9A 3EL7A 5CF6A 3O8PA 1LR4A 3G33A 4IZ5A 4XLVA 3DOGA 5E7RA 5HE3A 3TNQB 2F49A 4A4XA 3KGAA 3GENA 5FP5A 3C4ZA 1H00A 4EJNA 1WCCA 5ANDA 4FGRA 3PZHA 4BIBA 2JKMA 3ULZA 3GXLA 4OAUC 4DG2E 3MVHA 4UMPA 2PWLA 4IC8A 5IH5A 4MBJA 4IXPA 3TV6A 4Y5HA 3O7LB 3UOKA 4MVFA 2R3KA 3FKLA 3QQLA 3VBVA 4Z55A 4KUJA 5CVFA 5LQFA 3CKWA 1H1WA 2BKKA 4EC9A 5HO7A 5HNIX 4G3DA 4FNWA 3MPMA 5G6VA 3OFMA 2GU8A 1SNXA 5C8MA 5I9XA 5L2WA 3LFFA 2OKRA 2J51A 4A9SA 4D2TA 4AW2A 2BZKB 3V3VA 3ORKA 4IAIA 4M12A 3GCPA 4TN6A 4IWPA 4O38A 3OVVA 1QPEA 2HXQA 4OTQA 2XEZA 4FL2A 5TOZA 2XA4A 4ZY4A 5JN2A 4O7SA 3QTQA 3L8SA 3OCTA 4L3LA 4XG8A 5CXZA 3MVLA 4ITIA 3CLYA 4RSSA 5CU2A 5LMAA 5HCZA 4CG9A 5IEXA 5L8JA 3BX5A 4BCFA 3HMPA 1LEWA 2F7XE 2UW4A 3GEQA 1PMEA 3EQGA 4YLLA 4TY1A 2WNTA 5GJGA 3QA8A 3FLZA 4ANQA 5A6NA 4GKHA 2JFMA 1FQ1B 4NM5A 3VN9A 4YR8A 4JAJA 3EQCA 4NJ3A 2OICA 4PMSA 2XJ2A 3H9FA 3AC5A 4XRLA 5KHXA 5ANJA 4TYIA 2OFUA 2XNMA 3FHRA 3RI1A 3RK5A 4FC0A 4LMUA 2OF2A 2JIVA 2XIZA 1SM2A 3I5NA 4PV0A 4RIOA 3CQUA 3D0EA 3QD0A 4FZFB 4GJ3A 4YC8A 3FSFA 5CANA 2UZLA 3LJ2A 5JGBA 3AG9A 3CTHA 5IH4A 2AC5A 3R9HA 3BELA 2W1DA 5IISA 3O17A 2H9VA 5FEDA 2V0DA 1UU9A 4ZSLA 2P33A 1VR2A 4FUXA 5BUEA 4P5ZA 4CV9A 1HCKA 4F09A 2BVAA 3DCVA 3PRFA 3ZO4A 1M7NA 2IZSA 2J90A 4NU1A 4D2WA 3UMXA 2EVAA 3C51A 3FXXA 3QRIA 4GG5A 3EQDA 5HCYA 3UVQA 4FGBA 3Q53A 4QMYA 5LWNA 5FD2A 4GUBA 3KXNA 5M4FA 2QOCA 3EH9A 3BLQA 4JT3A 5AV3A 3LKMA 4UXQA 4NW6A 2XIKA 2VTSA 2OJ9A 3UOLA 4U3YA 3I81A 4OR5A 3FZPA 4RLKA 4AG8A 4CRSA 1JPAA 2PY3A 4PNKA 4FV3A 4GVJA 3F5UA 3AMBA 3A60A 3FDNA 4DEDA 2JDVA 3GCSA 4QMUA 2CKPA 5AJQA 3KF7A 3CPCA 5AP1A 4DHFA 2O3PA 3FMEA 1MRYA 1UNHA 4K2RA 3HAVA 2H6DA 5G1XA 4FTNA 1I09A 4DTAA 1XKKA 5IQCA 3JXWA 5L6WL 4HYIA 4O0UA 4BCQA 3TUDA 3IW4A 4I41A 4EK5A 1XJDA 2UW7A 4W8DA 5BMSA 5IQBA 2HZNA 3CS9A 3MN3A 4JL9A 3FV8A 4FL3A 2OXDA 3TT0A 3E8NA 3UIUA 5BUIA 3RPVA 3PTGA 3RPYA 2NRYA 3MJ2A 3DAKA 2QO7A 5IMXA 4QMOA 3AD4A 5HTBA 3SHEA 4EOMA 4QD6A 1K2PA 3O23A 5ETCA 3D83A 3BGQA 4QMMA 2VGOA 2G2HA 3SXFA 4QTEA 5AP6A 1DI8A 3ID6C 2PUUA 5HIEA 1A48A 4JBPA 3TDVA 4TT7A 5E8SA 3AC4A 5EM6A 3LFCA 4OTGA 1J7IA 3EN4A 3HGKA 1WBVA 2X8IA 2UZBA 4RGJA 4EH3A 1S9JA 1IA8A 4MWIA 4V04A 4RBLA 1OIYA 3F3WA 3NAYA 5JFVA 4RIXB 3UO6A 2B4SB 2F57A 4AZSA 5CF4A 4H3PA 2XMYA 4YHTA 4CFNA 3SOCA 3DAJA 4HGTA 4W4VA 4EZ3A 3W10A 2UZDA 4ENXA 3QZIA 3CD8A 4M7IA 4IVBA 3D4QA 1KV1A 2ZDTA 3BV3A 3R9DA 4R77A 4RJ6A 3Q6UA 4IW0A 4IFCA 5CS6A 1ZRZA 1CKPA 4FIJA 4RMZA 2JKKA 4I5CA 5E8ZA 1H8FA 1R1WA 2REIA 2R3NA 4C4FA 3CSVA 2KTYA 5ANKA 2Y6MA 1M14A 2PK9A 4J1RA 4W4WA 4YNOA 4RWLA 4Z7HA 5J5SA 4AWIA 4CYJA 1Q41A 2R4BA 3PP1A 4NW5A 4MF1A 3KXXA 1WMKA 4FYOA 3A8WA 4UZDA 2PVFA 4AOTA 4E1ZA 1YRPA 4F7NA 1XH5A 3F5PA 3P7BA 4BKZA 5HLWA 3Q2JA 3ZO1A 5LVPA 3QQJA 4AGCA 2QONA 3Q52A 1DM2A 3ANRA 4GUEA 4CMTA 5J9YA 1GAGA 3FMDA 4S31A 5FTOA 4CCUA 2HENA 4WUNA 5KBQA 4BGHA 3ETAA 5M4IA 5JQ5A 2BKZA 5J87A 3W2QA 2QOBA 2X1NA 5IQHA 5IUHA 3GOKA 4FNYA 2ITNA 1GZ8A 5A4QA 1ATPE 4ZTLA 4MNEA 2PMNX 3MY0A 3ENHA 5DNRA 5JGDA 2F7EE 5AR8A 1IAHA 4LYNA 3BI6A 4EYMA 5A9UA 3QQFA 3PLAE 5D12A 5HKMA 3FC2A 2WMUA 3GQIA 1WZYA 1JLUE 4UX9A 4ZZMA 3UIXA 2IPXA 4FSWA 5F9EA 4O82A 1ZY4A 2RG6A 4L6QA 2VZ6A 3DNDA 2P2IA 3H0YA 5HE1A 1MRVA 4C34A 3OZ6A 4BGQA 2C6KA 4RVTA 4IFGA 3OD6X 4PQNA 2GFCA 3FLSA 2DUVA 3G90X 5HE0A 2I40A 2GDOA 3MH3A 4PDYA 3E88A 3E3PA 3VBYA 4FE2A 1OKZA 4NCTA 3TACA 5EOLA 3W8QA 1PXJA 1PXOA 1YVJA 3FI4A 4LFIA 3OHTA 4JG8A 3S3IA 4Z7GA 4M15A 1K9AA 2Y6OA 3MTLA 3UNKA 1NW1A 3RAKA 2ZM1A 3FQEA 2GS2A 4Q5HA 3F3VA 3UZRA 1J1CA 4BRXA 1Q61A 3PXQA 3G0FA 4QOXA 3OOMA 2Y4PA 3EHAA 4IZAA 3VUHA 3W1FA 4YJTA 5AIKA 3D94A 2QLQA 5HG7A 5AV4A 5CEOA 4WA9A 4JR7A 3OT3A 1W82A 1B39A 3V8WA 3POZA 2FSMX 4U97A 4L01A 5DH3A 4QP3A 3QTSA 4U43A 4WBBB 4X2JA 3TZ7A 4FVQA 4NT4A 2WU6A 4LG4A 4G6OA 1W83A 4FUYA 5EDRA 2GFSA 3HLLA 3Q2MA 4G34A 2UW8A 4ACGA 2PZIA 3IOPA 5IQDA 2PZYA 2A27A 4C02A 2B54A 3V6SA 4W9WA 4AZTA 5IA0A 2R7BA 2XJ1A 2PZRA 1S9IA 3QQKA 5BVNA 3KVXA 5K5NA 1GJOA 5JQ8A 4FTQA 1SNUA 2QOOA 3LE6A 3WIGA 4K1BA 5LCKA 4C4GA 4ZJIA 4JQEA 4H39A 5LARA 4AT3A 1H27A 1OITA 1DI9A 2P0CA 3RHXA 4YJOA 5EG3A 4EQMA 3EQIA 5EOBA 4DEIA 5HTIA 3P86A 3QKLA 2RG5A 5EW9A 5M07A 4BR3A 3PWYA 4RJ3A 2I6LA 1PYEA 3TL8A 4XHKB 4B4LA 1VEBA 4YO6A 3DKGA 5E1EA 1CMKE 2QKWB 4QYYA 4GK3A 4NCTC 4X3FC 5CASA 3UYTA 2ITQA 4FKRA 5BX0A 4ZTRA 4E4XA 4FSRA 5ETAA 2O64A 4CKJA 2HZIA 4PPAA 5K3YA 3WZUA 4EWQA 2WOTA 3QRUA 4FOCA 4LV8A 1Q99A 4U42A 5JFXA 1U54B 5L6PA 2PSQA 2P4IA 4V01A 5D1JA 2WQOA 3LMGA 4E5WA 2ZV9A 1A9UA 2ITOA 4AGWA 3OWKA 2ZV8A 4C62A 2X6DA 3BU5A 3MWUA 2WMAA 1O6YA 4XP3A 2IVUA 2BRMA 3PPJA 3VUIA 4IZ7A 2W1ZA 3KU2A 4QQJA 2C0OA 4WBOA 4ZS0A 3WBLA 1UNGA 3CR0A 4L44A 4TRLA 4X2NA 4U41A 4QMTA 4QP2A 3ZTXA 4E73A 3GFEA 3TUBA 3AOXA 5J9ZA 3OC1A 4KWPA 3FLNC 5FM2A 2QVSE 3ZRLA 3JY9A 2ZV7A 3MFSA 4CFUA 5EDQA 2PUIA 3FYKX 4FV5A 4M69B 4QYFA 3SKCA 3NUYA 3F3ZA 4QMVA 4X6RA 2JEDA 4IX3A 2RSVA 3DBQA 3CP9A 3ORZA 1FVRA 3KRLA 3UP7A 4DCEA 4ASDA 4BB4A 4AA4A 4FZDB 4HYUA 4DFLA 4ANBA 3KRRA 2GTNA 2EXCX 2PMIA 1UKIA 4XOZA 5CU0A 5L2TA 3R1YA 4BDCA 4BL1A 4GYIA 3LXKA 3R1SA 4KABA 1CSNA 5AIRA 4ASZA 3IW6A 4QTBA 4RG0A 2ETMA 5I9ZA 3PJ2A 2GQGA 5M4UA 4BYJA 1Z5MA 3CJGA 2WTKB 3FXWA 3ANQA 5EQYA 2QOQA 5EHLA 4O0SA 5HBJA 5HU3A 1YOLA 3VF9A 4TNBA 5HI2A 4MD9E 4BI1A 5A4CA 1BI7A 1ERKA 3KK8A 3ORTA 4FKPA 4DC2A 2PVHA 3RZFA 2VO7A 3NNXA 4FBXA 2BRBA 4FVPA 5BVFA 3OT8A 1H26A 2WTVA 5KX8A 5M56A 2WQEA 3ATSA 3FPMA 4EZ7A 3HRBA 2QCSA 2ZB0A 3BYUA 4G5PA 4RWJA 4ZSGA 3NX8A 2VUWA 4G6NA 1P4OA 4NSTA 3EFKA 5I9UA 4O2ZA 4S30A 4FTRA 4LQMA 4PTCA 4DH1A 4E4LA 4IHPA 4YJQA 4CG8A 1MP8A 3ZSGA 1XH4A 5A4EA 3IK3A 3GU4A 4IVAA 4KRDA 2HWPA 4S33A 4QPAA 3EL8A 5CALA 3S0OA 3VUGA 2IZUA 3ZLWA 2QNJA 4WG5A 4BBMA 3BU6A 1G5SA 3OXIA 5E8XA 5KCVA 3AD6A 5AM7A 5EYKA 4QYHA 2UVZA 1PMVA 2J5FA 2E2BA 3P7CA 3KRWA 4D28A 1KV2A 2WMQA 4B6LA 4BCNA 2CHLA 4ZSJA 1BL7A 3F66A 3I7BA 2C5NA 2YJRA 4R6VA 4E93A 2EXMA 4QMZA 3FWQA 4MXOA 3CCNA 3FYJX 4L9IA 3VWAA 5KUPA 3V8SA 3S00A 3LFBA 1Y91A 3L8XA 5CT0A 3MBLA 5BPYA 2VTPA 2BAJA 3C4CA 2XYNA 1AD5A 3DDQA 3OEFX 4DE4A 3NUUA 4IM0A 4R1VA 2JDOA 2BTSA 2FGIA 4QYEA 5AP2A 2XM9A 4G1WA 3UIMA 5HX6A 4FL1A 4U8ZA 5AUZA 3IW5A 4EHGA 2B9JA 1E1VA 4DGGA 4CV8A 2A1AB 4UB7A 1ZOEA 5CZIA 5B2KA 4M68A 4RWIA 3RALA 4BZOA 2B7AA 3R1QA 3Q6WA 5AP0A 4D4YA 3IDCA 3QTWA 2G2IA 2XIYA 2OSCA 3QFVA 2G1TA 4XP0A 2W1IA 3R73A 3VHKA 4MEDA 4FX3A 2AYPA 4YZMA 2YLFA 4FV4A 5BNJA 4CLJA 4UMQA 2J50A 4J97A 4MQ2A 5AUWA 3L9NA 4I5HA 3WF6A 5M06A 2G01A 3I5ZA 3OCBA 1Q4LA 4IVCA 3I0QA 2C6DA 3TKIA 3DBFA 2BAKA 4IWOA 5HGIA 3QQGA 5KMJA 1W7HA 1ZYDA 3DZQA 1UKHA 2YCSA 5D7VA 4FKOA 4RWKA 5DN3A 5HQ0A 3R8ZA 4XV2A 5CAUA 5I4NA 1E9HA 5L8KA 2QOHA 5CEMA 1JSVA 1GZNA 3FQSA 4OUCA 4O96A 4QT1A 2YA9A 4N6YA 3TV4A 4DFZE 4FEXA 2EUFB 2CCIA 3QBNA 2XK8A 4MHAA 4EBVA 2YIQA 3FKNA 4YC6A 5HD4A 4FV2A 2CNVA 3MVJA 3FHIA 4CYIA 4O0XA 1UU7A 4GH2A 4J53A 4JVGA 3C5IA 4FKIA 2JD5A 4D2VA 3BE2A 3WF9A 3ZC5A 3R63A 4V05A 3DLSA 3GBZA 4L8MA 5IEYA 1ZXEA 3MFRA 3C4EA 1MQBA 3OW4A 3MSSA 1YHSA 4F9AA 3KCFA 1VYWA 2F7ZE 2P55A 2QHNA 5CQWA 4DEBA 3LCSA 2Q0BA 5LVMA 2FA2A 1JAMA 2ZYBA 3ROYA 4ACDA 3MS9A 3GNIB 5AR4A 5FUTA 2XK3A 4EOPA 2ITPA 3AMYA 3A7IA 3G9NA 1OKVA 3LM5A 1GIHA 3HKOA 2BALA 4AX8A 4QP4A 2C0TA 5BVOA 4BDDA 4GV1A 4CQGA 4DT8A 4ZY6A 3CQWA 4ASEA 3PXFA 1RQQA 4TL0A 5T3QA 4E3CA 1JNKA 4M0ZA 2WMBA 2LAVA 1HCLA 2RFDA 3FLYA 3VULA 4E4MA 4IAFA 4LRKA 5EQEA 1XBCA 5J5TA 3GCQA 1OBGA 4IX4A 3QRKA 3E8CA 4HVDA 3EFLA 3F9NA 3L8VA 2C47A 4JAIA 3ZXTA 3M11A 4O83A 4FF8A 2BAQA 2Z7QA 4TWPA 2OJIA 4R1YA 5B0XA 2BDWA 4AGUA 3TWJA 3DFCB 3JPVA 4TYHB 5C01A 3SXRA 5F1ZA 4NM7A 3UBDA 4DFYA 4DF3A 4XOYA 5EM7A 4JIKA 4MTAA 1YHVA 3DKCA 4GG7A 4O1OA 4ANNA 3QCSA 4RA4A 4EQUA 2A19B 2XRWA 4G3EA 5HLPA 4D1XA 3D2IA 4L68A 2G2FA 2VWWA 4E7WA 3TZ8A 2PPQA 4KBCA 1QPCA 5DVRA 5C26A 2W5BA 3C13A 4I23A 4MNFA 4DA5A 3W8LA 1GZOA 2XCHA 3BQRA 2VGPA 5D9HA 3Q5ZA 3TV7A 3VUTA 1XBBA 4PDOA 4M8TA 4CZTA 3GGFA 5AUXA 3TJDA 3FKOA 3RVGA 5JZJA 3ALOA 1OPJA 2C3JA 3NWWA 4MX9A 4OGRA 2WKMA 3CE3A 4BCGA 3FMJA 1VYZA 5CF8A 3IPHA 3V51A 3EYGA 3Q9YA 4DITA 4EHZA 4KAOA 2H34A 4A9RA 3D7ZA 2VTJA 5LOHA 2PU8A 2PYWA 2CCHA 1H1PA 3NNWA 1FGIA 5B7VA 1OKYA 5CAVA 4F65A 2IZRA 4UMRA 5E8WA 3NAXA 4I24A 3R04A 4KINA 5EHOA 3W16A 4FTJA 3ENMA 3ZUUA 4BCJA 5BYLA 4RX7A 2YJSA 4HNFA 4LOQA 1CTPE 1YI4A 2YCRA 4JX7A 3BRBA 3Q5IA 4FIHA 1PHKA 3LMHA 3FZ1A 4IM2A 3ULIA 3HECA 1OGUA 4DH3A 1Y8GA 3MY1A 4BCIA 4YSMA 5E8TA 4E5AX 1IAJA 4PUZA 3VS7A 4CLIA 5IDPA 4MWHA 2X4ZA 3COKA 5F4NA 4DBNA 3BYVA 4DGMA 5IA2A 4M13A 3IKAA 5CVGA 3QYWA 2RIOA 1MUOA 1NXKA 2BHEA 4GIIA 4I0SA 3RKBA 4S32A 4CNHA 4DN5A 5AAGA 4USFA 1B6CB 4FT3A 4I5MA 3GC8A 3ALNA 4WSQA 3JY0A 4RFMA 3SOAA 3KXMA 5HTCA 3PDTA 3A61A 3EMGA 5C27A 2X4FA 3LAUA 2W1EA 3H4JA 2JKOA 4FTTA 5K4JA 1ZYLA 4UALA 3THBA 4FSTA 3JYAA 3PFQA 3HV5A 4I1ZA 3HMMA 4K18A 2WMXA 3OUKA 1YWNA 2YDIA 2H96A 2R3RA 4IDVA 5IF1A 3V5QA 5KMMA 1JWHA 3VIDA 1H08A 4UN0C 4DEHA 3CY2A 3I79A 3W2CA 5HG8A 3RMFA 2EU9A 2O2UA 1UVRA 2PVLA 2RFEA 4B7TA 1OI9A 3FC1X 3LJ1A 1QPDA 4F6WA 3TZ9A 4EI4A 5IPJA 4I21A 1BKXA 5HE2A 2HWOA 4RZVA
chains in the Genus database with same CATH superfamily
4F1TA 4ITJA 2WO6A 3KMMA 2PULA 1WVWA 3QKKA 2QOLA 1ZARA 4MKCA 4FV6A 3ZS5A 1V0BA 2BIKB 3FXZA 3LW0A 4NIFB 4EH2A 2O63A 4CZUA 2RL5A 3GU5A 4ZEGA 3W2OA 4OBOA 4D1ZA 4NTTA 3ZYAA 4CEGA 1IG1A 2Z7RA 2UW0A 4R7BA 3CEKA 1OECA 4U0IA 1YWRA 5AUUA 1YXSA 2VV9A 3EFJA 3DBDA 3IECA 4I22A 3UVPA 1G3NA 4EUTA 4XG6A 3COMA 4W9XA 3ZLXA 2CNQA 4NEUA 4E5BA 5HESA 2V7OA 3IDBA 3O8TA 5LVLA 4ARKA 2J4ZA 4FKGA 5L8LA 3NGAA 1YI3A 3KXZA 4IB0A 3QF9A 5EH0A 2JKQA 2CDZA 2ITUA 3LLTA 2AUHA 4JDKA 3DLZA 1OIRA 4F63A 3QC4A 5FDPA 3G2FA 4G2FA 1TQIA 4BKJA 5FEQA 4GJ2A 2VWBA 1NVRA 4FIIA 4HGLA 4I6FA 1U4DA 5LXMA 3ZRMA 3RTPA 1R78A 3QZFA 4EH9A 1L3RE 3LMIA 2VD5A 4EL9A 4BDBA 1JVPP 1J1BA 5DIAA 1BMKA 2OIQA 2BHHA 2VX1A 3GUBA 1REJA 5M55A 4C4HA 4FSUA 2WEIA 4ID7A 5BVDA 2W4OA 3OBJA 2PVNA 5D10A 4HCUA 4GS6A 5AAFA 4YO4A 4FSZA 5TF9A 3OTVA 2HW6A 2W7XA 2WU7A 3ZLYA 3AXWA 5ICPA 2J0MB 4FEQA 2W1FA 4I6QA 1TQPA 2W5AA 3LXNA 2BMCA 4F9BA 5J7BA 3GU7A 2CSNA 2OXYA 3FE3A 3NYVA 3UQCA 4WSYA 3AT4A 4IAKA 2OG8A 5E8UA 4A07A 2W9ZB 3SD0A 2YWVA 3G9LX 3PG3A 2V5QA 4K8AA 4UBAA 3K54A 3NIEA 1Q8WA 4RZWA 3FZOA 4FOBA 2HK5A 4FV8A 4M3QA 3NIZA 3QRJA 2UZUE 4BDHA 3HZTA 1OL1A 3C4WA 5DGZA 3BPRA 3NCZA 3ZHPC 3R22A 4FSMA 2WTIA 2CGXA 4TZRA 4BHZA 2QLUA 4BYIA 4D58A 4JLCA 4QMLA 3UNZA 3VBWA 1OL5A 3R28A 3LM0A 1U5QA 1XO2B 5GJDA 4EOOA 4CMOA 5GJFA 4J8MA 5DLSA 1J91A 3F61A 3MFUA 2JC6A 2X2MA 2R0UA 3DT1A 2VNYA 3LZBA 1YKRA 4JDIA 3WILA 3QAME 2EB3A 5HG5A 2BFYA 2WTDA 4BDIA 2ITZA 4KB8A 3NS9A 3RPOA 2IJMA 4D9UA 2CGUA 4K33A 4DTKA 4H1MA 4CXAA 1M52A 4GK2A 1OUKA 4D4RA 3TN8A 4AGDA 4E6CA 3QUDA 2QR8A 1UA2A 2WZJA 3DQWA 3R0TA 4J52A 5FBNC 2IVTA 4Z9LA 2GS6A 3OP5A 4ACHA 3M2WA 2B9HA 5FG8A 3BL7A 4LGGA 2C5YA 3QX4A 3O8UA 5CX9A 4C7TA 4J99A 4YMJA 1WVXA 5I3RA 4E6DA 2J5EA 2W1HA 3FZSA 3U8WA 4UWBA 5IDNA 2C0IA 4IM3A 4WNOA 5HICA 2C6MA 2UV2A 4CGAA 3SXSA 2VX0A 4RFZA 3BLRA 2C30A 3T3UA 2LGCA 5CZHA 1KUTA 2Q0NA 4LL5A 5EKNA 4IWQA 3ZO2A 4BICA 4WNMA 4FTOA 4Y5QA 3R8UA 3DJ7A 4WG4A 3OTUA 2BZHB 3RINA 3D7TB 1WVYA 3UG1A 1U54A 3GC0A 4O86A 2RFNA 3C7QA 3HVCA 1IR3A 4M67A 3LCKA 3A4PA 5FM3A 2R3HA 4NK9A 2SRCA 2IW9A 4DGOA 2YHVA 4QP1A 4EOLA 5IG1A 4RC4A 3UZPA 3C0HA 3I6WA 5JFWA 2GNGA 1URWA 3PE1A 4UYAA 4FSNA 3DTWA 3F88A 5C03A 3LFQA 2ZM3A 3P4KA 3R9NA 3ZU7A 1Q62A 4ANLA 3NVKI 1F5QA 3MH0A 3W0NA 3SW7A 4FKJA 2VRXA 3O96A 3VRYA 3H30A 3DGKA 3VS1A 1OB3A 2C69A 3QYZA 5JRQA 2IWIA 1AQ1A 2WTWA 1YOMA 1M2RA 5AR5A 2R0IA 4A4LA 5KNJA 3P7AA 4M69A 1KOBA 5GZAA 5CNOA 5JK3A 2ERKA 2JLDA 5AA9A 1H01A 2FSTX 3ATTA 2XK7A 4G16A 3R01A 4A9UA 3V5TA 4ZAUA 3MY5A 3I6UA 5AUYA 4OTDA 3WARA 4BI2A 5AWMA 2UW5A 3F5XA 2JDTA 2C6LA 2WMSA 1KE9A 4FTLA 4L52A 3QD3A 4I0RA 4P7EA 5AMNA 3CC6A 4JBVA 2UW3A 5HU9A 3QLFA 4PDPA 3Q04A 5ACKA 4R3PA 2CMWA 3UC4A 2WGJA 1KE8A 3OCSA 5TO8A 4NKSA 1URCA 2IO6A 2YFXA 3MB7A 3MDYA 3QCQA 4FV7A 4RIYB 5H8BA 5A4LA 5KMIA 1NT2A 2OXXA 2W99B 4IB3A 3LFEA 4MD8E 5EK7A 5FP6A 5C8NA 1H28A 3QLGA 1H1RA 3R8MA 4P4CA 3SQQA 4OW8A 3U87A 3EWHA 4M14A 3QZGA 4AUAA 4C8BA 2Z8CA 4NYEA 5EI2A 2XKDA 2HYYA 3QXPA 4IADA 4XBRA 2GNHA 2W5HA 3BHVA 1PXNA 5KO1A 4FJVA 1YHWA 2YCFA 4AZEA 3KVWA 1YXTA 4LUEA 1M2QA 2HY81 2XYUA 1RJBA 2X39A 4D1SA 3MPTA 5H8EA 5CY3A 3D14A 3KA0A 4KD1A 5EKOA 3RAWA 4PX6A 3BGZA 3PJ3A 4PMTA 4U80A 3IO7A 3ZDUA 3LXPA 4LV5A 3QTZA 4RJ7A 4BWPA 4H36A 3WZEA 3ET7A 4EH5A 3BWJA 5BVWA 4F7SA 5CNNA 4YC3A 2ITXA 4KIKB 3PJ1A 4FTIA 2RKUA 3CBLA 4I6BA 3EB0A 4ENYA 4O7TA 2E9VA 2XEYA 4O0RA 3ACJA 1Q24A 4EK6A 2QHMA 2HXLA 3RNYA 3BIZA 5AP5A 5FDXA 3K3JA 5CT7A 3UNJA 4A4OA 2Z02A 2R3PA 5LVNA 1FVTA 2R64A 4JBOA 4EZ5A 2OJJA 3JUHA 2V62A 2CLQA 4YZDA 4AOJA 2PUPA 3EYHA 4DH5A 3LFAA 4RC3A 4GCJA 4EOKA 1ZWSA 1VLRA 2QU6A 3TZMA 3R30A 2AQXA 2JFLA 2VU3A 3BZ3A 4BDKA 4CT2A 3LFSA 2GHMA 4ZTMA 2I1MA 1ZOGA 2E9UA 1Q5KA 2Z7LA 4JG6A 4N6ZA 4DHZA 5KZ0A 2VWUA 5E1SA 4EOIA 4O2PA 1H0VA 5CEIA 4F64A 2EXEA 2Z2WA 4OT6A 3EQRA 4WRSA 5F20A 4YZBA 3N4VA 4GU6A 4IB5A 4IIRA 5TR6A 4AS0A 3UO5A 5HNBA 4ZOGA 4FKSA 1JOWB 3AT3A 3FLWA 4Z16A 4FZ7A 1FGKA 2UZVA 4HCTA 5IU2A 1F3MC 3AMAA 4QMXA 4D5KA 3V5PA 5T68A 4AN3A 2R7IA 4XLIA 3NDMA 5AEPA 2ZFYA 4MXYA 3ZXZA 5GNKA 1PRYA 1G8KA 4BBFA 2Y4IC 1H4LA 3R83A 3VS6A 4U40A 3U51A 3RCDA 3LCTA 4ZTSA 4DEAA 2QOFA 3ORMA 2VWZA 3SA0A 1PMNA 4LRJA 2ZJWA 4GT3A 1BI8A 3LJ0A 3ERKA 3T8OA 2B55A 3LQ8A 4EUUA 5FTQA 2JBOA 5HIDA 5KE0A 1KWPA 2XBJA 2W06A 3R8VA 4F0GA 4BTKA 2XAMA 2R3MA 4IZYA 3K5VA 3MIYA 4UMTA 1I44A 3KC3A 2QG5A 4RX8A 2XK4A 1YDRE 3DB6A 3BQCA 3IONA 3LFNA 3ZRKA 3BL9A 4DFUA 2A2AA 2PMLX 3KULA 3FMKA 4H3BA 2PVMA 2BUJA 3E8DA 4JNWA 3T9IA 2GNIA 2I0VA 3D5WA 3SV0A 5JH6A 2GMXA 4PP9A 4E8AA 3TNPC 3ZEPA 4EKLA 4O0WA 4F9WA 5B2MA 3DXNA 4GL9A 2W05A 2WQBA 4I5PA 4FEWA 4A06A 4XEYA 5CXHA 4QYGA 4YBKA 3UE4A 1H07A 4X21A 1WBNA 3PA4A 3Q9ZA 5CI7A 4D5HA 4FK3A 2NRUA 4C3RA 4D2SA 5L4QA 1ZMWA 3NVMB 3UVRA 3F6XA 3OG7A 2OU7A 3HUBA 5HIBA 2Y0AA 5FQDC 3O71A 1OUYA 4CTBA 3ORLA 4D0WA 4UZHA 4FKUA 4BZNA 5L6OA 4XG4A 3SAYA 2X7FA 1R0EA 4QPMA 5AA8A 4RQKA 2BIYA 2JBPA 4Q9SA 3B8RA 1EH4A 2PVJA 2VWXA 4QO9A 3QCYA 2BCJA 2C3LA 3QWJA 3C0GA 2YCQA 3KCKA 3RAIA 4J98A 1JKLA 3OY3A 5EYDA 2A0CX 2WMTA 2YERA 4AXFA 1T46A 3PY0A 3W2SA 4DTBA 3HL7A 3BEGA 4QP9A 2CKOA 4C37A 4TYHA 4AW1A 4USEA 3QXOA 2R9SA 4BTFA 2ESMA 5E92A 5E4HA 3S1HA 1Q3WA 4K11A 5I0BA 5GHVA 3NFFB 4IMYA 2YEXA 1VZOA 2XZSA 5AUVA 4DEGA 4ZMEA 2VX3A 4HNIA 5IQEA 3DTCA 5IEVA 3P0MA 4M97A 4I4EA 4X0MA 2WEVA 1L8TA 1XWSA 3OWPA 2WQMA 4L46A 4OBQA 3VJNA 5IA4A 1LUFA 1ZMUA 2FO0A 2OZOA 2JDRA 1YWVA 4FEVA 5EYMA 2IVSA 4JR3A 4IX5A 4AZVA 3CPBA 2VTLA 5IUIA 3TIZA 2BDJA 4BWKA 5AV1A 4JDHA 3GP0A 4RFYA 2NNWB 2HCKA 4QQTA 3DDPA 3CGFA 4R5SA 4C57A 2YDJA 2VTQA 3NUXA 5KKRC 3MA3A 4V0GA 2HW7A 3R7UA 2VTMA 4LOPA 3QCXA 4R3CA 3SRVA 2UVYA 2XUUA 3KB7A 2FYSA 3Q32A 4EOJA 4CZYB 2RFSA 1OPKA 3O50A 4MXCA 3ZZWA 2ZB1A 4BJJA 4II5A 5ETFA 3A62A 4MNEB 3QTRA 1OPLA 2GS7A 4EONA 2IF8A 5HO8A 4IX6A 4I6HA 4Y83A 5DE2A 2UZTA 3HNGA 3NCGA 2YM8A 4EOQA 1JKSA 3HRCA 4TXCA 3BLHA 1M2PA 3DNEA 2OZAA 2XNOA 5J7HA 2YIWA 3WYYA 4XH6A 4O1PA 3VBTA 2ZV2A 4NUSA 4QP8A 3CQEA 1O6KA 4B99A 1Q8ZA 3A7GA 3K3IA 3MV5A 3R2YA 4FKQA 3NNUA 5DR6A 2UZEA 3HMOA 3QD4A 4BY9E 1KOAA 2I0HA 2YABA 3ML1A 3E3BX 1SVGA 3SC1A 4D0XA 4EH7A 4TTHB 5L3AA 4AW5A 4OLIA 4X3FB 3D5VA 2ITTA 5AAEA 5IZFA 1Q97A 4FT7A 2OH4A 3IQ7A 1ZZ2A 3BBTB 4OTHA 3E62A 5AV2A 4IAAA 2IVVA 4K6ZA 3WF5A 3NYNA 1PXKA 4E4NA 1YXUA 4BC6A 4ORKA 5M09A 4BHNA 5A3XA 3EJ1A 5I9YA 5CSHA 1KSWA 4KRCA 3V5WA 5JKGA 5GZ9A 2C1BA 4YJSA 2X2LA 3PUPA 3FSKA 3VNTA 2W1GA 2C3KA 1PY5A 3MVMA 2UZOA 5FGKA 4ZMFA 3DB8A 3LFDA 4GT4A 2NP8A 4JDJA 5I9WA 3DXPA 3E63A 4ALWA 3KEXA 2NPQA 3C1XA 4U45A 4NFNA 5J8IA 3BKBA 3EKNA 4ZY5A 3GB2A 1SYKA 1P4FA 2CN5A 4JXFA 3TTJA 1XHAA 3FL5A 3VJOA 4USDA 4YZNA 4EKKA 4KS7A 2E9OA 2NYAA 3K2LA 3MB6A 1Y57A 3OS3A 5HLNA 5H2UA 2FB8A 1P14A 2YAAA 2X7GA 3LVPA 3KRXA 3BHUA 3CGOA 4L43A 3MH2A 4LL0A 4RX9A 1O6LA 5K0XA 2PVKA 3SVVA 4NIFA 5I5ZA 4O0YA 2JIIA 3C0IA 4QPSA 1W2FA 4B0GA 2OGVA 4FK6A 1LEZA 1NVQA 3F2NA 3F69A 3QUPA 4F1OA 1AGWA 1R39A 4RX5A 2RGPA 3FI2A 2B9FA 4XV1A 3G6GA 4FTKA 3WZJA 3EQBA 2GSFA 2C6OA 2C5XA 3O0GA 2IZTA 1WFCA 5DR9A 4E20A 3U6HA 4KA3A 4CFMA 2WAJA 2XK6A 3EQHA 3MTFA 3AD5A 4GFGA 3RGFA 4EK4A 1V0PA 2BZJA 2XCKA 3PPZA 4BDJA 3UQFA 2VAGA 4GKIA 2VTTA 4U79A 1OBDA 4RA5A 4UXLA 4HYHA 2Z7SA 3QHRA 3FUPA 3RK7A 5EYCA 1H25A 1JSTA 3DFAA 4FSQA 4P2KA 2WB8A 4WHZA 3VBQA 3IG7A 4I0TA 3HMIA 4RC2A 4WRGA 3ZUVA 4EC8A 4RPVA 5J79A 3P1AA 4QTAA 4IDTA 2VNWA 4AN9A 2FVDA 4UWCA 5M4CA 2XKEA 3EKKA 1W98A 2DQ7X 4QMWA 5DI1A 4AN2A 1W0XC 4O0VA 1QCFA 4WOVA 4N70A 3Q60A 2Y9QA 4U3ZA 2WMRA 3TNWA 5TKDA 4AAYA 1JBPE 3U55A 2A98A 4JI9A 5IA5A 4MQ1A 4DINA 2YAKA 3S4QA 3REPA 3R7GA 4RQVA 3R1NA 2CKEA 3UPXA 3F2RA 4AACA 3BYSA 2UZNA 3R7OA 3VBXA 2WHBA 2VWIA 3Q4UA 5HVYA 5BYZA 2HZ4A 3QQUA 2GTMA 3AC1A 5HEZA 4AT5A 1X8BA 4XG2A 4TWOA 1BL6A 2CJMA 4GVAA 2XS0A 5E91A 3QWKA 4J95A 3UO4A 1M7QA 3A7FA 3E7VA 1HOWA 4OTFA 3PVUA 3MI9A 4DEEA 5IA1A 4O84A 4FZAB 2GNJA 4XV3A 4QNYA 3GOPA 3BBWA 2YZLA 2QOKA 4BDAA 4LRMA 4JS8A 1KE6A 3U6IA 4F99A 3SX9A 3B8QA 3PXRA 2W0JA 2X9FA 2OF4A 4JJRA 3D15A 5E8VA 3ROCA 1KE7A 3ZBFA 4AZFA 2J0JA 3QRTA 5JZNA 2XM8A 4R3RA 1Y6AA 4TNDA 5GIPE 3R7YA 5LJJA 3IS5A 4PWNA 4O81A 4W8EA 5HOAA 4N57A 3VF8A 3KN5A 2O0UA 1APME 3BE9A 1FVVA 1OGYA 1BLXA 3ORNA 2XNEA 2YM5A 2HY0A 3K5UA 4MCVA 4ZTQA 3WZDA 3FMMA 1PXIA 3A4OX 5CI6A 4DYMA 4EHVA 4EOSA 3JVSA 4F6SA 5AADA 4ACMA 1U5RA 2GPHA 2F2UA 4QMQA 3ZSIA 3U9CA 3P5KA 4ITHA 4XG7A 3U4UA 3IGGA 3G51A 3H0ZA 4KKEA 3HV3A 3ZM9A 4O21A 4X6QC 3TNHA 5BMMA 2PE1A 2IW6A 4MD7E 4FT5A 1J7LA 5J95A 4F9YA 4UMUA 4OTRA 4Q9ZA 2PUNA 4AOIA 3ZSHA 4JMQA 5EQPA 2BRNA 3W55A 5AM6A 2FSOX 3DK3A 2ITYA 3RCJA 3MH1A 3DXQA 3E64A 5HORA 4ZLOA 2ZMDA 3GCUA 1PXMA 4ASXA 3AC8A 4D55A 1YI6A 2B0QA 3D5UA 3AT2A 4Q2AA 2ONLA 2J0LA 3PRIA 4I92A 4X7QA 3V5LA 4LM5A 3A7JA 4IAZA 2QODA 2W17A 3NW5A 4XJ0A 4AA5A 2XJ0A 4JQ7A 5AX9A 3DZOA 2WFYA 5IQIA 5I9VA 3HV7A 3KXGA 2R3LA 1OL6A 3P78A 4RIXA 5EM8A 4ZS4A 4DFXE 4F0FA 4TYGA 3P79A 4FR4A 4KSQA 3QTIA 4CD0A 4P90A 5KHWA 5IKWA 3C50A 3KQ7A 4IACA 3VUDA 4CT1A 2BPMA 2RF9A 2Y7JA 3HDNA 2EWAA 3F7WA 3FY2A 4YNEA 2PE2A 3QUEA 4BIDA 2XKCA 3V01A 4BTMA 5GZ8A 3HAMA 2VO6A 5C4LA 1SVHA 3SW4A 4C3PA 5HVJA 3P08A 4KBAA 4ANOA 2B1PA 3L9MA 4BCOA 5A46A 5JSMA 2XAOA 1OIUA 3VO3A 1FPUA 2X9EA 2VO0A 1FMOE 5AUTA 2XNNA 4CVAA 1Y6BA 4HVIA 4I93A 3DPKA 4H1JA 4O6EA 4YUQA 2WOUA 1PKDA 4OAVB 3WE8A 5HNGA 2O65A 2ZDUA 3DQXA 1ZY5A 1GIIA 4JX3A 3MGYA 2XVDA 2X0QA 3ORIA 2JIUA 4G3GA 4S2ZA 1DAWA 3T3VA 3FJQE 5AP7A 3BU3A 4RIYA 2WQNA 4C36A 5CSVA 1YXXA 3R21A 5HBHA 4EK8A 4YPDA 1G8SA 3S2PA 4XG3A 5AR3A 1J7UA 4G3FA 1PW2A 3DS6A 3MJ1A 4U5JA 3CXWA 5AR2A 4ALVA 5JRSA 1OVEA 5EI6A 3FBVA 4L45A 2ONLC 4XRJA 1NA7A 4I20A 3VHEA 2X8EA 4C38A 5K4IA 4HYSA 3RWPA 4FA2A 3DK6A 4ZSAA 2HELA 3OW3A 4F6UA 2IN6A 2OLCA 4K0YA 3QKMA 1CDKA 2ERZE 4D2PA 5EDPA 5ANOA 3OWJA 3R8PA 3RZBA 4X2FA 4BZDA 3ITZA 4MXZA 1Q3DA 1ZLTA 3O5AA 3CY3A 5H8GA 3NNVA 5EW3A 2YZAA 3BHHA 2B9IA 3O7LD 4XV9A 3R9OA 3AKKA 3BHYA 5DWRA 3W32A 5CENA 2P2HA 1Z9XA 4D4VA 3OMVA 5CLPA 3KMUA 4G17A 3V8TA 4KIKA 4O0TA 1Q8YA 2ZVAA 4J7BA 4R5YA 4G9RA 2YN8A 2OW3A 3I60A 1B38A 2QOIA 3PZEA 4YSJA 1IRKA 3G6HA 4A7CA 1R0PA 1P5EA 5FTGA 5AV0A 3FAAA 3N51A 1M17A 4HGEA 2WMVA 3F3UA 2WTJA 2R3IA 3G0EA 1XBAA 2ZMCA 2UZWE 3GQLA 3PVBA 4AP7A 3D5XA 4G5JA 3D9VA 3NLBA 3HMNA 5JFSA 3E8EA 3DAEA 5D7AA 4ZP5A 3FQHA 3R8LA 4GIHA 4OBPA 4L42A 2GQRA 3MFTA 3KF4A 3KN6A 3NYXA 3ZBXA 1YW2A 4A9YA 5E90A 4IH8A 4DGNA 2VN9A 2JAVA 4BF2A 4FEUA 4PPCA 5EFQA 4PL4A 3RP9A 3I4BA 5DRBA 2WIHA 4BFMA 1O9UA 1PKGA 3JS2A 4I4FA 3TKUA 3VS0A 5CEKA 2CGWA 4MXAA 4CFVA 4AQCA 3ORXA 1YXVA 3WF8A 4GEOA 4IAYA 4NM3A 5F95A 2QQ7A 4K9YA 4Z3VA 3TDWA 2HIWA 3TI1A 4HVHA 2I0EA 1V1KA 3RBWA 2AEGA 4FG8A 4YTIA 3PA3A 3G5DA 4CFFA 2QC6A 3HYHA 3TNIA 5AR7A 4A9TA 5IQGA 1LPUA 4RIWB 5DT0A 3FMNA 3HUCA 5LMBA 2J0KA 2YACA 4C3FA 5LCJA 4DT9A 3NEWA 5KZIA 2VTRA 4FTAA 2DWBA 3PE2A 4WNPA 1XH9A 2GNFA 3TIYA 4P5QA 4XBUA 4FIGA 4PF4A 3CJFA 4GYGA 5BVKA 2HAKA 3RK9A 3UG2A 3FL4A 2VWYA 4HZSA 5ANEA 4EEVA 4EH8A 5LVOA 3NUNA 4BDEA 2OFVA 1NVSA 3UJGA 4F7JA 4IVDA 5HCXA 4HGSA 4AFEA 3NZ0A 1K3AA 3EQFA 4QQ5A 2I7QA 3BHTA 4FZ6A 5K9IA 3HP2A 4AXCA 4YHJA 4FG7A 1OKWA 4G31A 4JRNA 4LOOA 3QD2B 4GT5A 4B8LA 5D11A 2X81A 3UC3A 1A06A 3E93A 4AXAA 4HVSA 1CKJA 4BCMA 2PL0A 3F82A 4C59A 2F9GA 4YHFA 5IUGA 2BROA 4GFMA 3AKLA 1Q8TA 3Q9WA 4FKLA 4EYJA 4TW9A 1JQHA 3QTXA 4YPSA 2B53A 2R5TA 2NO3A 2J9MA 3ZOSA 2OK1A 4W4YA 4DG0E 5CSWA 4DFNA 4O91A 3F5GA 3ZZEA 4PP7A 4WIHA 5JEBA 4U9AA 4YJRA 1BUHA 2X8DA 3ORPA 4TYJA 4AFJA 2CLXA 5M53A 1UV5A 4KSPA 3TCPA 3UGCA 4IJ9A 4PMMA 5CSXA 2XRUA 3VW6A 3TKHA 4ZJJA 3R9RA 4F0IA 5BQ0A 5DEYA 4KIOA 2Q83A 4L3PA 3KREA 3LOKA 4JRVA 4DH7A 4RRVA 5HX8A 5JMSA 2OWBA 2QU5A 3TTIA 3Q96A 4QTDA 2PVRA 3QX2A 3RAHA 1UU8A 2E9PA 2R3OA 4RLLA 1NY3A 3MIAA 4C0TA 1FBNA 3V04A 2PZ5A 4H05A 3W2RA 1YOJA 5M08A 4J96A 3HA6A 3QU0A 5HHWA 1G8AA 1OMWA 5FBOA 4DBXA 4S34A 4LV7A 3B2WA 4L7FA 3OY1A 4QRCA 1PF8A 2AC3A 3L9LA 2FUMA 2WMWA 4MH7A 4QMSA 5BVEA 3PIXA 2O5KA 3O51A 3DK7A 4HW7A 4UYNA 3P5JC 4HJOA 2V7AA 2VTIA 4YBJA 3VC4A 5L2IA 3NUSA 3OWLA 3ZLSA 4JQ8A 1ND4A 3FZTA 3GVUA 4FODA 2JDSA 4FT9A 2R2PA 4N4SA 3FMLA 2UVXA 2OBJA 3JVRA 2GNLA 3UYSA 1T45A 4KIQA 1Q8UA 4C33A 4AU8A 2F2CB 4QTCA 4F7LA 4IQ6A 2QR7A 4BVUA 4C4JA 3RJCA 4NFMA 3Q4TA 4W4XA 1U59A 1LP4A 3PPKA 4RJ4A 2C3IB 2C6TA 5GIOE 3PWDA 1PYXA 3DBCA 1JKKA 4QP7A 3A2CA 4J8NA 3W0QA 2C4GA 5IQAA 3RPSA 3WI6A 5ITAA 2R3FA 3PSCA 1G8JA 1REKA 3BYMA 4RVKA 3BGPA 1SMHA 2W4JA 3PA5A 3R7IA 2J6MA 2JAMA 4XMOA 2OIDA 4OTWA 3W33A 3VQHA 3OXZA 3OXTA 4BTJA 1RDQE 5KBRA 3D2KA 4L67A 5C4KA 2OJFE 4R8QA 5ANGA 5CU4A 3RNIA 4PL5A 4QMPA 5LMKA 3DBEA 3P9JA 3NPCA 2OO8X 4FKWA 4FYNA 3W2PA 2F4JA 2XNGA 1U46A 2ITWA 3IGOA 1IEPA 3ZDIA 3SG9A 3C4FA 3SGCA 5H9BA 2O8YA 1Y8YA 3IOKA 5J1VA 4FKVA 5CU3A 4ANMA 3CIKA 4TPTA 3PY3A 5BV3A 3OROA 3R7EA 4R78A 4RT7A 4BCPA 4CCBA 4NZWB 2ETKA 2C5OA 4AXEA 2X0GA 5DMZA 1UNLA 3NRMA 4X3FA 4AT4A 4XYFA 3RM6A 4O4FA 3PFYA 4GSBA 4EORA 3E5AA 3FI3A 4NKAA 1F0QA 4U81A 5KMLA 5M57A 2V55A 5LWMA 2WTKC 3R00A 1XQZA 4E6AA 2XB7A 3UOJA 1WBTA 3MPAA 4WD5A 2YIXA 3Q3BA 2ITVA 5AX3A 4AE6A 4O27B 3HX4A 2QURA 3QHWA 5D41A 3BV2A 3R02A 3B2TA 3UZTA 2DYLA 3FZRA 2JGZA 5AP4A 3SDJA 5A14A 3EFWA 2GHLA 4YTHA 4MAOA 1YDTE 2BZIB 4DHIB 4DAWA 5J9LA 3PYYA 1GIJA 3DJ6A 4CKIA 4O7YA 5EI8A 1J3HA 2YLEA 4H58A 4QQCA 3ACKA 1XH6A 3UIBA 2YM7A 3PLSA 3NW7A 1FOTA 4XUFA 1OL2A 4GRBA 4Y73A 3LHJA 2W9FB 4PDSA 4XCUA 1QL6A 4C4IA 4DG3E 3PXKA 4CTCA 3KIOC 3L1SA 3OOGA 4IE9A 3Q9XA 3QC9A 4YJNA 1WAKA 3QTUA 3G15A 5CAQA 5A6OA 3JR1A 3DKOA 4IJPA 3WOWA 5LMKC 1OL7A 3UOHA 5HZNA 4O6LA 3FMHA 3LXLA 4C61A 3ZO3A 2BFXA 3TJCA 4CFXA 2J7TA 3ELJA 5CAOA 2ZAZA 1TVOA 5KMOA 2PTKA 2WTCA 1KE5A 1ZYJA 1XR1A 1DAYA 3IW7A 2OJGA 4RJ5A 3HEGA 3KFAA 3EZVA 4FV9A 4IWDA 5HD7A 5I3OA 3ZC6A 3AGLA 4EWHA 2DS1A 1P2AA 3M1SA 3EN5A 3QA0A 3ZMMA 3C4XA 5HVKA 4ZZOA 4DLIA 5KMNA 4FTUA 2BTRA 3U54A 3L8PA 2YIYA 1PJKA 2H8HA 5DT4A 2VWVA 2CN8A 5K5XA 3EN9A 2CPKE