4U3ZA

Apo map4k4 t181e phosphomimetic mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
295
structure length
282
Chain Sequence
SLRDPAGIFELVEVVVYKGRHVKTGQLAAIKVMDVTEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDREVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
total genus 82
structure length 282
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u3zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u3zA01
4MAOA 2YA9A 3NEWA 3DLSA 4FV7A 4HVIA 5IQEA 4EH8A 4KBKA 5HE3A 2CSNA 2HZIA 3IW5A 3TNQB 4XEYA 3QGWA 1W7HA 2UZWE 3V01A 3F3WA 4USFA 1U5QA 1XKKA 3R71A 4EOLA 4QQTA 2OXDA 2C5OA 4LG4A 3PA4A 3VBVA 2Y7JA 5IH5A 3FXWA 3U9CA 3DNDA 3KULB 4QPMA 3WF7A 4X3JA 5DWRA 4N70A 2R2PA 3SXRA 2P0CA 3BIZA 3H3CA 4R7HA 3ODZX 3DAJA 3G6HA 5CS6A 4U81A 4FX3A 4KKEA 2JFMA 5AV3A 4IB3A 4CZTA 4J97A 3VULA 3IDBA 2OXYA 3F66A 4YP8A 2FO0A 3CBLA 4M13A 5CASA 2HZ4A 3I6UA 5H2UA 3RI1A 3TKUA 3TV6A 1YXTA 5ETCA 1ZZLA 4XG4A 3V5QA 2VZ6A 4U45A 1PKGA 3GU6A 4CQGA 3VBQA 3GCPA 4N6ZA 4FIEA 4PF4A 2PE0A 2OJ9A 4MQ2A 2WZJA 4C34A 5GJFA 3VHKA 4DH5A 5I9VA 5IA3A 3CCNA 3R7GA 2W06A 3GBZA 2YLEA 2I0VA 4BHZA 4F65A 2R3GA 4LM5A 2QKRA 3ALNA 2W4KA 3G2FA 1JNKA 4UWYA 5BUJA 5HBJA 1DI8A 2C0IA 3H30A 4BDJA 2PUIA 5BVOA 2Y9QA 4RVMA 3GGFA 5EYCA 4U44A 2XUUA 3UOLA 3Q32A 2J5EA 5FXQA 3ZFXA 3ZO3A 5EM5A 3R9DA 2W1EA 5CALA 4CYIA 5KMJA 2YM7A 3LHJA 4QNYA 4BDFA 4IJPA 1R0PA 4FTCA 4ZSGA 1AD5A 4QRCA 3O23A 2Q0BA 2VTLA 3IOPA 2V7AA 4WBBB 4OAUC 1U59A 4O2PA 3QXOA 4GH2A 4BIBA 5A4CA 2WTCA 1PJKA 4IADA 1U5RA 1SNXA 3JS2A 3P86A 5B0XA 5FP5A 4BTKA 2ZM1A 4WRGA 3NUUA 4YBKA 2QI8A 5AUZA 1AQ1A 4NKAA 2R7BA 2UUEA 2WMTA 4I22A 4PRJA 3M2WA 4YJSA 4O7SA 4C57A 4FTNA 4OLIA 2O63A 4BCMA 5KKRC 3N4UA 2HOGA 2ITYA 4RIOA 1YI3A 3NDMA 3QYZA 4FKOA 4ITIA 3L8XA 4O1OA 4S2ZA 3C13A 2GNLA 4DCEA 2YCQA 2E9NA 3QWKA 5IQDA 5H8EA 3L8PA 3EQCA 5ANKA 5A4QA 3T9IA 2W1CA 1WBNA 4GK4A 3NPCA 4XV3A 5CZHA 1H0WA 2O65A 3G15A 3EJ1A 4IVCA 2FSOX 5CEPA 1YDRE 4BWPA 4FODA 4KIQA 3OOMA 2P3GX 3DFAA 4R5YA 2PVMA 5CSVA 2HXLA 1UU8A 4ARKA 5ACBC 5JGAA 2XNMA 3WF8A 2ACXA 3OD6X 5KX8A 3PIXA 2UV2A 5AFVA 3FPMA 3EN5A 4EHZA 2FVDA 3VS7A 3VUGA 3BU3A 1ZOEA 2GTNA 5ETAA 3UDBA 3AD6A 4QMTA 4KWPA 3F7ZA 3LJ2A 4J96A 4QTBA 3U51A 1WAKA 4BZDA 4E4NA 4C0TA 3FKOA 4AFJA 4L52A 5M09A 5EM6A 2OJGA 2BFXA 1JKSA 3BQRA 3FI3A 5HCYA 4C3FA 2I1MA 4CG8A 2GHMA 4EI4A 4NTSA 3W33A 4LMNA 4UMQA 4YO6A 2FSMX 1YRPA 3JR1A 4H05A 3ATTA 4QMUA 3VQHA 2VTTA 3C50A 3E64A 1YDSE 3EQGA 4M12A 4PL5A 1J91A 4YZDA 3ZRKA 4GT3A 4C4IA 5C1QB 4FEXA 3SGCA 2WELA 3EZRA 4RIWA 1H26A 4MD7E 4XH6A 4NT4A 4OUCA 2H9VA 1UWHA 2PZYA 3IQ7A 3KF4A 3I79A 4FV8A 4PDYA 3PFQA 3ZO1A 2Z7SA 5BVFA 4N57A 4O84A 5IQBA 4Y5QA 3QZFA 3FSKA 4BYIA 1J7LA 3Q04A 3HV6A 3C4EA 4FI1A 3BRBA 4O86A 5KBQA 4FTLA 1PXIA 4I92A 3PZEA 3HV4A 5AR2A 3WZUA 3ZDIA 2PMNX 4XBUA 4RFZA 1R0EA 2YACA 4F1TA 2B53A 3ZBFA 3F88A 1QL6A 3KMUA 3TDWA 3QRKA 1RJBA 5HORA 5I0BA 2UZLA 2QD9A 2E9VA 3FBVA 2WEVA 4GVAA 1KE5A 5L4QA 3FHIA 1P5EA 2R3LA 3Q9WA 3IONA 4FUYA 3GC7A 5K9IA 1I44A 1TQMA 3FUPA 3PP1A 3WYYA 5KHXA 3I4BA 3NYOA 3PLAE 2CCHA 5CVFA 3D5XA 3DBEA 3FV8A 2SRCA 4RA4A 4LMUA 1BL6A 3PY1A 2X39A 2FGIA 3KC3A 3W2QA 5LARA 1U54A 2G01A 3FZRA 4YBJA 2ESMA 3BHTA 3C9WA 4OTDA 5GJDA 1R39A 4FE2A 4BCGA 3QCSA 4OTFA 4B9DA 1P2AA 5T6KA 2Y6MA 2NPQA 4UB7A 3KXZA 3ZSGA 4O7LA 1RDQE 3WZJA 2I0HA 2PUUA 3AC8A 2PPQA 3MTFA 1MQBA 5FXSA 3F3VA 4FIIA 4DG3E 3FQSA 3CKXA 4G17A 3D4QA 4P90A 2VTRA 1V0OA 2REIA 3NNUA 3R6XA 3EB0A 3MFUA 3NAXA 1FQ1B 5J79A 5CVGA 4XRJA 4BDAA 4F9WA 2JEDA 3ZMMA 1LEZA 2XJ0A 4K9YA 3W32A 5I9ZA 3RZBA 1XHAA 2XIXA 2ITWA 4O0TA 5JT2A 4DTBA 1ZY5A 4D2VA 5LVLA 4FV5A 4QMYA 3R8PA 4D4VA 2ONLC 5IKWA 4YSMA 3ERKA 3VS1A 2QR7A 3EFKA 4A9RA 2X0GA 2X7GA 2YFXA 4YSJA 5HG5A 4DTAA 4O0VA 3U87A 3E87A 3ELJA 4FBXA 5AV4A 3POZA 4YC8A 2FH9A 1LUFA 3TL8A 1BYGA 3PY3A 5CWZA 5FTOA 4USEA 2R0UA 3A99A 5HLNA 4NK9A 4K0YA 4OTWA 2GMXA 1JWHA 1UU3A 4ALWA 3MFSA 5E1SA 4JDKA 1H1SA 4WUAA 3TN8A 3TZ8A 4UY9A 5AUVA 2UW5A 4JG7A 5DRBA 4G3CA 4M0ZA 2ERKA 5AP5A 3D7ZA 3JUHA 2BHHA 2PVHA 4CLJA 5CSXA 5JFWA 2QOKA 2YM3A 4KSPA 4XOZA 3VRZA 5FEDA 2CCIA 2XIKA 2R9SA 4W9WA 2OJFE 3KMMA 4CKIA 3QU0A 4QYHA 4IH8A 2Y4IC 5EW8A 3ZS5A 4E73A 4GSBA 3QLFA 4IX5A 2C3IB 3MYGA 4R6VA 1H24A 3WZEA 4DFXE 3R9RA 4XCUA 1H27A 3DZOA 4DH8A 3SAYA 3B8RA 4U43A 4IAYA 4ASEA 4PDSA 2R3HA 5K0KA 3BLQA 4E4LA 2YN8A 2VX1A 4QMPA 3NGAA 2RG5A 5J95A 4APCA 4QPSA 4CSVA 4HVGA 1ZAOA 2W1DA 4F4PA 2OH4A 2EB3A 1J3HA 5IEYA 3NIZA 5BYLA 5C4KA 5HVKA 3AT4A 4WNKA 4YTIA 3TZ9A 3CEKA 5C8MA 4ID7A 5HU3A 2PY3A 4RWKA 4AZEA 2ZYBA 3ULZA 4X3FB 5L2TA 3EQRA 2IZSA 2EXEA 2VWXA 4IDVA 4BKZA 4G5PA 4EOQA 4RG0A 5CQUA 3PLSA 1REKA 4TYHB 4FSMA 1IASA 5L6WL 4ASZA 4A4LA 1OZ1A 5AAGA 4D28A 4IMYA 4M69B 3Q5IA 4X2NA 3PPZA 3TDVA 4JX3A 2QLQA 1WBOA 2UW4A 4ALUA 2BRMA 4U6RA 1FVRA 4BCQA 4ZLOA 2WMRA 3KGAA 2VTOA 4FNWA 4NEUA 4C3PA 2JKOA 2ITQA 3I0QA 2CNUA 4W9XA 4CRSA 1PXJA 3QLGA 4BBMA 3VBXA 3F6XA 4EH2A 4PNKA 4ACHA 3R9NA 4RWLA 1GIHA 2ITPA 2X8IA 3R7OA 5FXRA 4HZRA 4WA9A 3N4TA 3OP5A 2B4SB 4XG6A 2XH5A 3RWQA 4DF3A 4EYJA 4QTEA 3FKNA 3LCOA 3A7GA 4WO5A 2BRGA 4C33A 3TUBA 4WD5A 3LFSA 3ZUTA 4LL0A 4II5A 3W2SA 2XIRA 4AZFA 3ZM9A 4DFYA 2HY0A 2P33A 4EOOA 3FY2A 3HDNA 4FIHA 5M44A 2C30A 4IC8A 4BFMA 5IQFA 2YISA 3DFCB 3G51A 2JAMA 3OF0A 4LL5A 5CENA 4BZNA 3DQXA 3PPJA 1OI9A 4ITHA 5HIDA 2HELA 2VGPA 5JGBA 3MTLA 4FKGA 3LCDA 4FR4A 3NW7A 5AMNA 5T68A 4CD0A 4DH7A 4TL0A 1JKLA 2XEZA 3ZC6A 2WTKB 3IO7A 3PJ2A 4G31A 1M14A 5DEWA 3A60A 2XF0A 3IK3A 5F94A 3ORKA 3F2NA 2WMUA 4LI5A 5KMOA 4WSQA 2X1NA 5L8KA 2C5YA 5DLSA 3ETAA 4G6OA 5CAUA 4OBOA 2BAJA 4UALA 2Z7LA 1HCKA 1KE7A 2WU6A 5LVOA 4EZ7A 3QQFA 3DA6A 4DTKA 3ZUVA 4JAJA 3TWJA 3ANQA 3CS9A 4J53A 3QF9A 4HYSA 2X81A 5DVRA 5DN3A 3CTQA 2V5QA 1CSNA 1IRKA 3COHA 1PF8A 5JKGA 3BV2A 3MV5A 2GNHA 2XK8A 3QQLA 2QCSA 2UVXA 4IHPA 4YZ9A 2VAGA 5FDPA 2I7QA 4X2JA 3LFDA 4UXQA 1CDKA 4QMSA 4FICA 4OTGA 5M08A 4IVAA 3PDTA 4O1PA 3R73A 1JPAA 4C2WA 3AT3A 4KA3A 4AZVA 1DM2A 4FEUA 2JIIA 4KUJA 1G3NA 3CY3A 4DBNA 3FYKX 3P7CA 4FG8A 2X6DA 3WIGA 4ZTLA 2XM8A 3V6SA 3DS6A 4EBWA 3FI8A 3ZSHA 1M7NA 2YZAA 1H1RA 4W8DA 5G6VA 4FVPA 3GFEA 4L42A 4EH3A 3L1SA 3TNHA 3VS3A 3V6RA 5KMKA 5JN2A 5C27A 4AWIA 3KQ7A 3UBDA 4TNDA 4PTEA 1W82A 4D2WA 5D10A 3QC4A 3FMKA 3VN9A 2BROA 3OHTA 4D4RA 4A06A 4RGJA 1UKHA 2P2HA 3E8EA 3HRFA 3DZQA 1PYXA 3HLLA 2GPHA 3RNYA 4RMZA 3TV4A 3UMWA 4BDGA 5IA2A 2WQBA 5AX3A 5AA8A 1BUHA 3ZO2A 2YDJA 4HZSA 1OBDA 4J8NA 4H36A 4FV0A 3V8TA 3ZSIA 2PYWA 1STCE 2QG7A 4DGLC 3LOKA 4J7BA 2AUHA 3GXLA 2XCKA 3FLNC 3VW6A 4ALVA 1CMKE 2YITA 4NFMA 2WTWA 4LGDA 3HMNA 3W2CA 3DB8A 3H4JA 4YTCA 3QTIA 2QHNA 4ZTMA 3IGOA 1YVJA 3F61A 2C68A 4QMVA 4ANOA 4C37A 3SDJA 5A4LA 3QALE 2JIVA 3MS9A 5HNBA 1ZMUA 4FKWA 4M68A 3OZ6A 5C8NA 2ZV8A 5CU2A 5CVHA 4CMUA 3R8ZA 5K4JA 3HKOA 5GJGA 5AUXA 2BRBA 2VTHA 2HIWA 2VWZA 5HBEA 4ENYA 5KMNA 5FUTA 3QQGA 2G15A 2QC6A 2JKQA 2DWBA 4P2KA 2JIUA 3ZZWA 3PE1A 3MBLA 2YM5A 4JAIA 3MB7A 2ITZA 3Q4UA 4G3FA 2C6LA 3LMHA 4MVFA 5DI1A 2WMWA 2HCKA 4QMNA 5AV1A 2G2IA 4IEBA 3QGYA 3EMGA 5E1EA 3E5AA 1V1KA 3ORZA 3UIBA 2IW6A 3MSSA 2VTMA 2VGOA 4Q2AA 5BVEA 3O17A 5FLFA 5AR4A 3K5VA 1M2PA 4ZSJA 3R02A 2RKUA 4F6UA 5CAPA 3FC2A 3QQHA 3PSBA 4U8ZA 2PZ5A 4ASXA 4M66A 2PVNA 3HV5A 4ZY4A 2RFNA 3Q9YA 3L9PA 2ITTA 1YI6A 3GEQA 3UG1A 2XKEA 1PW2A 2DYLA 3WOWA 2JC6A 2CN8A 2R3NA 4G1WA 4CYJA 2R0IA 1E1VA 3MH3A 4IXPA 1WMKA 3MPAA 1GIIA 4L01A 4MXYA 4EK8A 3PPKA 3B8QA 3RMFA 4KIOA 3C4WA 2PWLA 3QQKA 5DEYA 3H9FA 3I6WA 3ZXZA 3HYHA 3UVRA 3Q9XA 3Q3BA 4ACGA 5A6NA 2BUJA 5ANOA 3F3ZA 4M84A 4RPVA 4JRNA 3TNIA 1CKJA 3NCGA 3BHHA 3QXPA 4KNBA 3ZZEA 3EFWA 4JNWA 3CQUA 3R7EA 2EVAA 3G33A 2XNEA 3V04A 4J95A 1G5SA 1IAJA 4ORKA 5EHOA 3LFAA 2VWUA 1Y8GA 4P4CA 3CE3A 4OTPA 3QKKA 3UIXA 3KL8A 3MY1A 1XJDA 5HBHA 2BDFA 3FQEA 4AU8A 3MY0A 4CV8A 5EQYA 3CJFA 2WIHA 3FMJA 3NWWA 4O81A 3GNIB 4IW0A 3UPZA 1XQZA 4FMQA 4OBQA 3QD2B 2JDTA 2QHMA 4JG8A 4AN9A 5HNIX 5EHYA 2YM6A 2YIWA 1ZYLA 4IDTA 3DXNA 3NAYA 1NXKA 4KS7A 3OW4A 4I1ZA 4QP4A 3UQCA 2CNVA 3LCSA 3OVVA 4DITA 2PMLX 3D5WA 3KB7A 3RP9A 4DEDA 3DDQA 5A4EA 3PJ8A 3R1NA 5E8UA 3LFQA 2R7IA 1T45A 5ACKA 2PUPA 4HGTA 4FTIA 3V5JA 3V3VA 3AC5A 3ENHA 3OUNB 4YC3A 3RKBA 3R1YA 4DH1A 4DFBA 3QBNA 3BGPA 4WRSA 2GQSA 1NA7A 1Q8WA 4IM3A 3HL7A 5EYMA 1Q3WA 2BIKB 2QKWB 3L9MA 1UVRA 3TT0A 2P4IA 3RHXA 5J5SA 5AJQA 2XS0A 3B2WA 4PPAA 4BCFA 2OFVA 4K6ZA 3KN5A 3RALA 3HAMA 3CTHA 3QYWA 4ERKA 2UW7A 3KRJA 4FT9A 3OCGA 4CKJA 4HVHA 5GINE 4RLLA 2YZLA 3QAME 1M52A 1EH4A 3DAEA 3ZLSA 2OIBA 3MJ2A 5BVDA 1OL6A 3RCJA 5IH4A 4G3EA 2ITUA 3K5UA 3U55A 4DEGA 4FKRA 3CJGA 1KV2A 3EN4A 4EYMA 4FOCA 4OTIA 4O7VA 3V8WA 5CANA 2BZKB 3FMLA 2Y4PA 3ZLXA 5I4NA 4DEHA 4FKIA 2HZNA 1MUOA 2VTQA 3PA3A 4JIKA 2OU7A 3RHKA 4J8MA 4IZYA 4BKYA 2GHLA 4FSNA 5EM8A 3FMDA 5EI8A 1JSUA 3OWJA 4AAAA 3RPSA 5LVNA 3QTRA 4DLJA 1UU7A 4EQCA 4CFUA 5D11A 2C6TA 4JR7A 4HGEA 5FG8A 4IQ6A 1WBPA 4I93A 4L67A 3QRJA 4CLIA 1W8CA 5JGDA 4MQ1A 3LMIA 2RG6A 4O83A 1KE6A 5GIPE 4APPA 4BF2A 4XLVA 4L53A 3FEGA 3R2BA 3TI1A 5CZIA 4A4XA 1OKYA 1BKXA 3A7JA 5KHWA 1R78A 4Y8DA 5AUUA 4FZ6A 5KBRA 4KBAA 3MFRA 3T3UA 2CNQA 2QURA 3ORIA 3ZU7A 2W05A 5ICPA 5HO6A 5AM7A 2JKMA 2JFLA 4KIKA 4LOPA 5AV0A 5M53A 1U46A 3U6JA 2OIQA 3R7YA 2WQOA 2ZM3A 2R5TA 3F5XA 4OTHA 2H6DA 3OWLA 3TNWA 2F49A 2XYUA 1WVYA 5JZNA 3REPA 3OWKA 5K0XA 3CR0A 3FQHA 2Z2WA 3FC1X 3Q4ZA 3V8SA 3K2LA 1JKKA 2OKRA 2H8HA 3IS5A 4L44A 4GMYA 4S33A 4UN0C 4GFGA 3BU5A 3TXOA 2HXQA 5L2QA 5EQEA 3C4XA 2ONLA 4GEOA 4I23A 3F82A 3DNEA 3FZOA 4RX5A 4RJ3A 4YZBA 2XRWA 1P14A 4IM0A 5M55A 2P2IA 2OWBA 4Q9ZA 4DEIA 5FEQA 3UE4A 2QVSE 4MXCA 2DUVA 4MCVA 3KY2A 3MVJA 3PXQA 2C6MA 5I9UA 3AC1A 3U4UA 2W1FA 2WTDA 4HNFA 2XK7A 4XV9A 3DJ7A 3F5GA 2XJ1A 5EYDA 4EOKA 3DJ6A 1JQHA 4IFCA 4RRVA 2BKKA 2QOFA 4QP8A 4WNPA 5LVMA 2BZHB 2BZIB 5M51A 4FZAB 4F70A 4U7ZA 4TRLA 4RWJA 5EDQA 3R8LA 2Z7QA 4J98A 3QRIA 2IWIA 4AQCA 1OITA 2I0EA 2ITNA 3SKCA 2IPXA 3U54A 1YXUA 3E8DA 4FSTA 4AG8A 2VO0A 2OF4A 3MH0A 3KXGA 4ZZOA 4L68A 3QRUA 4EK4A 4PDPA 2G2FA 4FKTA 4ZTRA 1IR3A 3R9OA 5LMKC 2XNGA 3AT2A 4LUEA 2GNJA 5CX9A 4EUTA 3DBCA 4G9CA 2OICA 4WNOA 4XOYA 2OJJA 5EW3A 4UWBA 3SRVA 4OR5A 2WTJA 4BZOA 1UNGA 1OGUA 2J51A 4YU2A 2CLQA 4UMUA 1Q3DA 2C1BA 5GZ9A 4AE6A 3I5ZA 2QLUA 2WB8A 4YPSA 4DGNA 2GNIA 2VWYA 3HRCA 3NS9A 2WFYA 4LFIA 4GYGA 1K9AA 5E8VA 3UNZA 3TIYA 4B0GA 4MD9E 3C1XA 2UZUE 3ZCLA 1MRVA 4PDOA 5KZIA 3KRXA 5IA5A 1PXMA 2X7OA 3EQIA 3O8UA 5J7HA 2R3RA 2X2LA 2UW6A 3KVWA 5HE1A 3JPVA 4GV1A 3A2CA 4WOVA 5EI6A 4R7IA 4H3QA 1M17A 4L8MA 1H0VA 5IF1A 4TWCA 5IQGA 1OVEA 4CTCA 3W16A 3GU4A 1ZRZA 3C4FA 4ERWA 5L3AA 5HHWA 5L6OA 3HV7A 3D7TA 3FZSA 2NNWB 3OCBA 3TTIA 1L3RE 1GZOA 3QCXA 2OH0E 3QUEA 4RVKA 3HUBA 3IW4A 2EWAA 2J0MB 3EQPA 1WFCA 4RJ7A 5DMZA 2VO3A 3GCVA 4UBAA 3P78A 2ERZE 4BCIA 2NP8A 5E8XA 2UZTA 2R3QA 2C5XA 4K33A 5IA0A 5LMBA 3GU5A 3RVGA 4OT6A 3VO3A 2CGWA 5ANJA 3FY0A 4D55A 1OPJA 4FIFA 4CV9A 4ENXA 4EOMA 4F08A 4GL9A 2HK5A 1PMUA 4IAAA 3E7VA 3KA0A 2AC3A 4E3CA 2OJIA 2ZJWA 4AT4A 3T9TA 2WEIA 1FINA 4XV1A 4EK5A 5A3XA 4QP7A 2PULA 4I5HA 5C01A 2BDWA 4AOJA 2OK1A 1NT2A 4UZHA 3TUCA 3UNJA 5CF5A 4RIWB 1Q24A 3OEZA 4EK6A 4C61A 5CXHA 4Z3VA 5EQPA 4C2VA 3CY2A 4IAFA 2XK9A 4BY9E 4FVRA 4S34A 1NVRA 1H1QA 5BPYA 5IQHA 4C35A 3GUBA 5IZFA 5E4HA 3KKVA 2HENA 3HP2A 1WBSA 2X7FA 5E91A 3Q96A 4RFYA 4FV3A 2A19B 4M3QA 3A7HA 4JDHA 2QU6A 1ZYJA 5C8KA 3L9LA 4ZOGA 3GU7A 4Q9SA 4R1VA 2YDIA 4MKCA 3GC8A 2ZOQA 3E93A 2GNGA 1IAHA 5C9CA 4JG6A 3PVWA 1J7UA 2BTRA 4CZUA 2X4ZA 2ZV2A 5J1VA 3MA6A 4XG9A 4JBVA 4CVAA 1MP8A 4IZAA 4JDIA 2PVYA 2YCSA 4ACCA 1TQIA 3FLQA 4FKQA 3JY9A 3AGLA 3TJCA 3HA6A 2JDSA 4IVDA 5AP7A 5T3QA 4BDCA 4Z7HA 4NYEA 4DBXA 4FEWA 4XG2A 1KWPA 3ZEWA 5IEXA 3MI9A 4RFMA 4U80A 1UNLA 2XNNA 3EL7A 4LRKA 5IG1A 5J5TA 1ZARA 2YDKA 2CKEA 3LAUA 3TUDA 4FVQA 3OT8A 1GJOA 2E9UA 1SVHA 2X6EA 2YJRA 4IANA 4CFWA 5AIRA 1U54B 4D5KA 3S00A 5E8WA 3A8XA 3EOCA 4AGDA 3FE3A 5EM7A 3PXFA 3QRTA 4H3PA 4HCVA 4MNFA 3HDMA 4M15A 5AP6A 4AZWA 4C4EA 4AXAA 4YMJA 1WVXA 3NZ0A 2X4FA 4EEVA 4RWIA 1H08A 3EN7A 5KMIA 3GFWA 2XKDA 4J1RA 4N4SA 5TOZA 1H1PA 2HW6A 1UU9A 3EZVA 1DS5A 5AUWA 3QL8A 1A48A 2UW0A 3FLZA 3I60A 4GK2A 1SZMA 2RFEA 4WNMA 4V0GA 3RZFA 2YIRA 2QG5A 4HYHA 1UKIA 5JEBA 2VRXA 3RM7A 3R01A 5BQ0A 3WZDA 4UX9A 1MRUA 1CTPE 4I6FA 3QWJA 3ET7A 2W1GA 5BVWA 5HZNA 2BHEA 4DFNA 1YOLA 1Q41A 4F63A 4ZK5A 3V5TA 3O8PA 4L7SA 4H3BA 5JRSA 2GFSA 1HOWA 4E20A 1YHWA 3LQ3A 1W84A 1SM2A 2CLXA 2WO6A 4C8BA 4RX9A 4M14A 4C38A 4H1MA 5ANEA 1L8TA 3JVRA 3AD5A 3RK7A 3PIZA 4FUXA 4EOJA 4ANMA 5CU3A 4BCNA 2WGJA 3LIJA 3QD0A 3DCVA 3AQVA 4ZTHA 3IG7A 4C58A 4GG5A 1O6YA 5CI6A 1BLXA 2V7OA 4P5ZA 3PRFA 4YPDA 2XMYA 3G5DA 5E8ZA 5CT0A 2NRUA 3ZM4A 4RJ4A 3S2PA 3QD3A 2HWPA 1YXVA 3DKOA 4QYEA 3PG3A 4D1ZA 1J1CA 4E1ZA 4NUSA 5LVPA 4G9RA 4ASDA 2Z02A 3LFEA 1PMVA 3DK3A 5J7BA 4HGLA 3PXYA 3VJOA 5CAOA 3FJQE 5FWKK 5CNOA 5CSHA 1H1WA 5FD2A 3EL8A 3BWFA 3P0MA 2B9IA 3PVBA 3C4ZA 4GKHA 2VX0A 4FV4A 3DK7A 2XKCA 4BVUA 1KE9A 2PVFA 3R1QA 1VZOA 3SOCA 3BX5A 3UC3A 4CFVA 3Q5ZA 3W1FA 2QO2A 4UYNA 4W4WA 2YCRA 2C5VA 5EI2A 5C03A 3VW8A 3HZTA 4PTGA 4AGUA 4R7BA 2OG8A 4GT4A 4X6RA 4KABA 4XV2A 3S95A 4DGMA 4LOOA 1XBBA 5AR5A 1Q61A 1XH6A 3PJ1A 1PXLA 2WKMA 4ZP5A 4EKLA 3PVGA 3QUPA 4GG7A 4MWHA 2B52A 3ANRA 2PZIA 3MGYA 4GRBA 5EK7A 5FDXA 3LM5A 4RQVA 4ZSAA 4YJTA 1M7QA 3CPCA 1URCA 4GK3A 4LUDA 4O2ZA 5IDPA 4ZY6A 4FEVA 5CLPA 3AC4A 2FUMA 3D94A 1ZMVA 2XZSA 3UNKA 4ANQA 2EXCX 4YJUA 2YCFA 4EKKA 2XK3A 4O7NA 5LWNA 2QR8A 3UG2A 5HTCA 2C3KA 3DXQA 1B39A 1E9HA 2F2CB 5EH0A 4ZLYA 2FSLX 2JITA 5I3OA 2HWOA 3R7IA 2GFCA 4E4MA 2R4BA 4CMOA 1OIYA 4CZYB 3FZTA 1XWSA 3MPMA 4I0TA 4D5HA 4NCTC 4EH4A 4GCJA 4TPTA 1ZYSA 4O0SA 4BDKA 3N4VA 4I6HA 4XP2A 1F5QA 4F6WA 4NJ3A 4IX6A 4XHKB 1TKIA 4AN3A 3FSFA 4RC2A 1OKZA 4MK0A 4XLIA 3I0OA 4EHEA 2YIXA 1B6CB 3L8VA 1PXKA 3F3TA 3GENA 1GIJA 4QPAA 4CMTA 4MF1A 5F95A 4TYIA 5TF9A 4FZFB 2Z7RA 3PWYA 5CI7A 4OGRA 3MH1A 3PJ3A 4FTMA 5JRQA 3F2RA 1ZOGA 4BI1A 3UVQA 3KRWA 2E2BA 3OBJA 3ALOA 4NM0A 4YJRA 4D0XA 4DFUA 5HQ0A 4C4JA 3VUKA 3DLZA 4BDHA 3KCFA 4KINA 4RBLA 1JVPP 2Y6OA 1FMKA 1O9UA 4TKSA 4TNBA 4YTHA 4BTFA 4NM5A 4EZ5A 3NLBA 2BTSA 3UOKA 4PP7A 4EH5A 5JH6A 2VU3A 2VO6A 3D2IA 2NRYA 3I7BA 3LJ0A 2PE2A 3JXWA 4G3DA 4LYNA 5CEIA 3CPBA 5B2KA 5IQCA 2QOCA 2J0LA 2R3OA 3FWQA 3NSZA 3ZHPC 4IAIA 3UZRA 2QO9A 3FI4A 4QTDA 3LFBA 3GOPA 5JQ8A 5AIKA 2A4LA 4BGQA 2O0UA 1H25A 1X8BA 3ACKA 3Q4TA 1CKIA 3ENMA 1U4DA 4ZXTA 1S9IA 3MVLA 3OW3A 3KXHA 5FM3A 4QYYA 4TYJA 3RM6A 4G34A 5AP3A 3TZ7A 2WTVA 2XYNA 1PHKA 3U4WA 1OB3A 1S9JA 2WD1A 2YJSA 4FKJA 4F7SA 3GCUA 3R8UA 5IPJA 3CC6A 2Q83A 4XUFA 4YR8A 5HCZA 2ZDTA 3RPRA 3VBYA 4E5WA 1OIUA 3RTPA 3KXXA 5HKMA 5CU4A 4NL0A 3GI3A 4IZ5A 5DRDA 4DH3A 4M7IA 4N6YA 3OTVA 3DAKA 3Q2MA 4NIFB 3FMEA 3ZC5A 4EUUA 4EORA 4BTJA 3UP7A 4L7FA 4PMSA 5HVYA 1NVQA 5HLPA 3E3BX 5I9XA 4H58A 3ZFYA 3D14A 1FVVA 1OBGA 3E8NA 2O8YA 3QTZA 4FV6A 4YJVA 4WG3A 1H28A 5CEKA 4JT3A 4BGHA 5D12A 4C4GA 1ZYDA 3P4KA 4I5MA 4RVLA 4RX7A 4CCUA 4D1XA 4CEGA 4U9AA 4FG9A 2W0JA 5E8SA 3WI6A 3MFTA 5LQFA 1JBPE 4F9YA 3ORXA 2F7ZE 4XP0A 4E93A 3R21A 4ANSA 3SG8A 4X6QC 4B7TA 3Q6UA 2EUFB 1PMEA 2JDOA 1GZ8A 2UZEA 3RWPA 3BHUA 1GY3A 5C26A 3RPVA 2UW8A 4S31A 4S30A 3QA0A 2ITVA 4FGBA 4MBLA 4F64A 4IIRA 2A27A 2QU5A 1ZWSA 1MQ4A 1V0BA 3P79A 4QTCA 5M57A 4KSQA 3RJCA 3Q6WA 3UGCA 1MRYA 2XBAA 3CSVA 1ERKA 1H00A 2PL0A 4HPUE 5ETFA 4BIDA 2W1IA 4R78A 3ZEPA 5CEOA 1OL5A 3QUDA 2XIYA 3WE4A 3T3VA 2F7XE 4FF8A 3NUXA 1XBCA 2BMCA 3DDPA 3HP5A 2GNFA 2H96A 2VTAA 4WG5A 4D9UA 5K4IA 4NSTA 4U40A 4Y95A 5DIAA 3QQJA 4FK3A 3SA0A 1K2PA 3OOGA 1XH8A 2A0CX 3PRIA 4I4FA 5HGIA 4EQMA 5E8YA 4BI0A 5KMMA 3HEGA 3IDPA 4LOQA 2VWBA 5DYJA 2GQGA 3RBWA 4HVDA 2BRHA 1YDTE 3P7AA 2OZAB 4JDJA 3WBLA 4CNHA 3RCDA 5IU2A 5CAVA 5LCJA 4KRCA 2W5BA 4O21A 4QMWA 4YZNA 2VUWA 4U3ZA 4V01A 3OBGA 3ACJA 2XBJA 3OEFX 1SVEA 3AC2A 5D9HA 3ZDUA 4FC0A 3C0IA 4ZY5A 4RIXA 4TT7A 2ZB0A 4OTRA 5GNKA 4ZSEA 3BWJA 2OW3A 3PZHA 5KKRB 3T8OA 2HYYA 3OFMA 4CFXA 3UQFA 4E4XA 4MF0A 4RLKA 2YABA 1BX6A 3A7IA 4AT3A 4U42A 1H01A 3ORLA 3KK8A 4XRLA 4DAWA 3NYXA 4BTMA 3O8TA 4E6AA 1GAGA 4QP3A 3HMPA 3DT1A 3O71A 4DFZE 3UYTA 3A4PA 4L3JA 3KREA 3COMA 3MVHA 3DJ5A 3QZIA 2ZM4A 3ORMA 5CQWA 4O0UA 1NY3A 4FNZA 3VS0A 1Q8TA 2J7TA 4F7LA 3O0GA 3WYXA 4FKUA 3LCTA 1SNUA 4RZVA 1XO2B 4AS0A 5HU9A 3TG1A 1ZZ2A 3F2AA 1ZMWA 4K1BA 3NUPA 4D58A 4TZRA 5F9EA 3DXPA 1CKPA 4DE4A 1SYKA 5D7VA 3PWDA 5EKOA 5M07A 4RJ5A 3ORNA 3JVSA 4O91A 5KCVA 3LXPA 1PXNA 5LJJA 2UVYA 3OXIA 4F0FA 4F09A 5M4IA 3ID6C 4M0YA 1NVSA 4IBMA 5CXZA 2X2MA 2XNPA 2ETKA 2VD5A 4PL4A 5TR6A 3UC4A 2CJMA 3VQUA 2PMIA 3QCYA 3Q4CA 5J87A 2JDVA 4OAVB 3C0HA 3H10A 5IQAA 3NUAA 4FZDB 1UV5A 3NYVA 4MXZA 4TWPA 4L9IA 2JAVA 4A07A 4TYEA 1P4FA 5A9UA 4D2SA 4IM2A 4L45A 4JR3A 2GQRA 2IVSA 2ITOA 4R8QA 2AC5A 3FXXA 2W9FB 3CD8A 2R3FA 4KKHA 3DTWA 4YJOA 3PSDA 5KE0A 3H0ZA 1Q99A 4EWHA 1NW1A 4FL1A 4AZSA 1TQPA 2Y8OA 3KU2A 4X2KA 3C0GA 2V62A 4KBCA 2E9OA 4LRMA 3SD0A 3ULIA 4A7CA 2UZBA 3MVMA 4EQUA 5AEPA 5FP6A 2UZOA 4EH6A 3R30A 4E6CA 4BCJA 4E5AX 2WTIA 5HE2A 2XNBA 5HLWA 3EQFA 3GU8A 4USDA 3HGKA 3K3JA 5FTQA 2J2IB 4D9TA 1Q8YA 3A61A 3IPHA 5ANGA 3AG9A 2FYSA 2HW7A 4OT5A 1YXSA 4R3PA 5LMAA 4B6LA 1Q4LA 2W1ZA 5BUEA 2C6DA 4MWIA 3C5IA 4F9CA 3RPYA 3AD4A 4O7RA 4PP9A 1GZKA 5F4NA 4JJRA 4G6NA 4X7QA 4XJ0A 5AM6A 4FNYA 1QCFA 2XNOA 4TY1A 2F9GA 5IQIA 3ZLWA 1JKTA 3H9RA 4G2FA 5AUYA 4CCBA 4YZCA 4U41A 2BVAA 5DT0A 2ZAZA 5AP1A 3W2OA 4LQMA 5TT7A 4JQ8A 4CG9A 4YNEA 2W99B 5HICA 1J1BA 4AA4A 4BDIA 4Z55A 4KIKB 2XJ2A 3BBWA 4HNIA 4IB0A 3NNWA 4DG2E 2YIQA 4QD6A 3HVCA 3RK5A 3ROCA 4PX6A 5FGKA 4FTJA 2B55A 4EHVA 4FOBA 3EN6A 3S1HA 4A4OA 4FV2A 2BALA 3FHRA 3QHWA 3D9VA 4MYGA 3ZYAA 4WSYA 1IA9A 2R3KA 4JBOA 5DE2A 4BCHA 3GOKA 3M1SA 1H8FA 2VWIA 1XH5A 4BL1A 4FSRA 2RFDA 3JY0A 3NX8A 4ZS0A 1LP4A 2WMAA 4EZ3A 5K5XA 1YHVA 3ZOSA 3U6HA 3QQUA 4BN1A 3UIMA 2GU8A 4O6EA 5BVNA 3DGKA 2WQEA 3IW8A 4TWOA 3V5PA 3DBFA 4AOTA 5ANIA 3A62A 5HG8A 2R3MA 4BDDA 4HPTE 4TN6A 4QOXA 3PJCA 5JFVA 3ORTA 3QKMA 5JMSA 2B7AA 4CKRA 4AA0A 1Q5KA 4J99A 5CU6A 1KE8A 4O38A 3VWAA 3LLAA 5TE0A 1YKRA 2BZJA 2GS7A 2PVLA 2C3LA 3D2KA 3NW6A 2PHKA 3DBQA 2VV9A 4OTQA 4RIYA 5KO1A 4YGAA 4C4FA 5E9EA 2RFSA 2QOHA 3R63A 2Y4IB 1CM8A 2ZMDA 5EDPA 1VYZA 1QPCA 2Y0AA 4LGHA 4W4XA 4X3FC 4W4YA 3QD4A 1H07A 5KUPA 5LCKA 5IISA 5JSMA 4U0IA 3CKWA 5KZ0A 2GTMA 5J9LA 3SRVB 3SVVA 4ITJA 3LXLA 3LXKA 4QQ5A 4DEEA 2FB8A 2KULA 4IB5A 3SW7A 5H8BA 3EQBA 3NCZA 4GT5A 2XKFA 2IW9A 3VJNA 1H4LA 5AX9A 4UV0A 4Y73A 3WF9A 1FVTA 4FIGA 5HTBA 4XX9A 1FGIA 4JQEA 4JLCA 5A4TA 4NJDA 2J90A 5K5NA 4ZMEA 1WCCA 1APME 2JKKA 3DPKA 3PTGA 2VNWA 3WIKA 4GU9A 5BMMA 3WF6A 5IEVA 1OECA 4QMLA 3V5LA 3BYVA 2RL5A 3E62A 4QNAA 1Q8ZA 2C6IA 3FLWA 4K2RA 2X9FA 2WHBA 2DQ7X 3D7TB 2W4JA 5M56A 5FBNC 3HECA 4MNEA 1G8AA 3ORPA 3BHVA 3NVMB 5BYZA 2RF9A 3IGGA 3SQQA 4U5JA 1WBTA 4L6QA 3V51A 5AR8A 1IG1A 4KKGA 3VUTA 2C6OA 1XH4A 5DR9A 4TXCA 4ZTNA 2BAQA 4FT0A 4IX3A 4H1JA 4IWDA 2XB7A 4D4SA 4EH7A 3AC3A 4KIPA 3R8MA 3LQ5A 4Q5HA 2VTSA 3KXNA 2WTKC 5CY3A 3ODYX 4C02A 3R2YA 2R3JA 4YTFA 4OBPA 1UWJA 2OSCA 4D2PA 1M2RA 2WXVA 3DB6A 4F9BA 1YHSA 2OZOA 3IW7A 4FV1A 4NW5A 4QMMA 4DFLA 2XA4A 4YHTA 3NVKI 1BI7A 4Y46A 5L2IA 5BMSA 4IE9A 4O0RA 4WBOA 4I4EA 4EH9A 4UZDA 1KV1A 3CIKA 5GZ8A 3R7VA 4NCTA 4RQKA 4A9YA 3NW5A 3SG9A 1PY5A 5AP2A 4AE9A 4DT9A 4X0MA 4Z9LA 3UPXA 4QYFA 3C4CA 3LE6A 1OPLA 3EQDA 4ZTQA 4JBQA 4FTRA 3GB2A 2CGXA 1OL7A 1W0XC 4AP7A 4F7JA 3UOHA 4FA2A 2WQNA 3BGZA 3FLSA 2XCHA 3O50A 5EOLA 1Y91A 1URWA 2XK6A 1JAMA 5A46A 2QODA 4PY1A 5HESA 2PUNA 1HCLA 3TEIA 4YC6A 1VR2A 3U8WA 4F7NA 3LVPA 5J8IA 1K3AA 2JLDA 3VVHA 3CTJA 2BKZA 2XM9A 3TZMA 3U9NA 3WF5A 3ZO4A 3DQWA 4FTQA 4I0RA 4W4VA 3SC1A 4ZJJA 3PUPA 3IOKA 3RAIA 5IUHA 2BAKA 2JBOA 4K77A 3VUMA 3H0YA 3NR9A 4PV0A 4JVGA 4L3PA 3V5WA 3M11A 5FEEA 1UA2A 2R64A 4CGAA 4FKSA 1ZXEA 2C0OA 3GCSA 5DBXA 4WUNA 5HX8A 2IJMA 4FT5A 2P55A 5DOSA 4OW8A 4GW8A 3ZLYA 3OC1A 4FSZA 3KULA 3R1SA 3EHAA 2CGUA 5AR7A 3P08A 2X8DA 5EYKA 3THBA 3UODA 2B9JA 4V0GB 4O0WA 4JRVA 4UMRA 3EKKA 4ANNA 2G2HA 1KSWA 2GHGA 3LQ8A 4ZAUA 5GZAA 4JX7A 2IVVA 4DEBA 5DT3A 1ZYCA 4QQCA 4EK3A 4FSQA 2A2AA 5BYYA 4MTAA 2XK4A 1OIQA 2X9EA 3EYGA 3QTSA 4PQNA 2QOIA 4PNIA 2Q0NA 4KD1A 3QHRA 2CDZA 4AGCA 3BU6A 3PA5A 4G16A 5EW9A 4EHGA 3TKIA 4FTTA 3HV3A 4YUQA 2H34A 4AN2A 2OBJA 4QMQA 2WOTA 4YO4A 2YEXA 2QOLA 4HCTA 5J9ZA 2R3PA 4FK6A 4WT6A 1DI9A 5HEZA 4UWCA 3LKMA 3BYUA 1WZYA 4Q5EA 4QTAA 2LGCA 2EB2A 5AP0A 3TIZA 3AGMA 5I9YA 2YAKA 1PXPA 4AF3A 2GS2A 2YWPA 2GCDA 2PVJA 2YERA 1OL2A 2C1AA 2QOBA 4MXXA 3LW0A 4PMTA 3DY7A 3FMNA 3EFLA 1OL1A 1DAYA 4I5PA 4XMOA 4O7YA 4FTUA 4GUBA 5CEMA 1WVWA 3G9LX 2XEYA 4DCAA 4AUAA 4XG3A 4O7TA 5CEQA 2WMSA 2F7EE 4HGSA 3BCEA 3VNTA 4GVJA 4JXFA 1YWNA 5HIBA 4IB1A 3DTCA 4FKPA 2ZV7A 4Y83A 3UO6A 4M67A 4DGOA 4F1MA 3P9JA 3LMGA 4DT8A 1Z57A 4UXLA 2YLFA 4I0SA 3UMXA 1R3CA 3KEXA 3P23A 4FYOA 2UZNA 3ITZA 1A9UA 4QT1A 1O6LA 5A54A 3ZTXA 4DN5A 3NUNA 2CKPA 2G1TA 1JSTA 2BILB 2UZDA 4FSYA 5DNRA 5HCXA 4DC2A 4ZJVA 2JBPA 3LM0A 2HZ0A 2PZPA 3BBTB 3GCQA 1QMZA 2B9FA 3LFNA 3LPBA 4JIAA 1QPEA 1UNHA 2GDOA 2JGZA 2YAAA 4NTTA 3W2RA 4ACMA 3BEAA 4D2TA 3I5NA 3KMWA 3UJGA 3QKLA 4ONAA 4B4LA 5M4UA 4BCKA 3LFCA 5BNJA 3IECA 3SW4A 2OI4X 2RIOA 3COKA 4J71A 3VF8A 1VEBA 3RINA 1YOMA 3DKCA 3NIEA 3C5UA 5ITAA 3R9HA 1OKVA 4IX4A 3MY5A 2X2KA 4X2FA 4CXAA 4U97A 5JFXA 5AUTA 3AMBA 2C0TA 2FSTX 5CAQA 3CD3A 5H3QA 2O2UA 4QMZA 2C4GA 4O96A 2V0DA 3G90X 3OXZA 2J5FA 5L2SA 4EWQA 3P5KA 4JOAA 5EFQA 2J4ZA 5AAFA 3ZRLA 3R8VA 3CXWA 2B54A 2OO8X 4DA5A 4TW9A 1GNGA 4PTCA 3PP0A 1PYEA 2V55A 3MA3A 4V05A 4XG8A 3NUYA 4NW6A 2QO7A 3VUDA 2F4JA 4F0IA 3FZPA 4O82A 3HA8A 2C3JA 1LR4A 3KXMA 3LZBA 2WIPA 2F2UA 4I24A 4H39A 4YNOA 3VUIA 4XS2A 3NUSA 3QFVA 4JS8A 5BX0A 2QOOA 4AA5A 2VWWA 5HD7A 2HY81 3D83A 5HIEA 3MIYA 2A1AB 5M06A 2O3PA 4QO9A 4RJ8A 4U79A 2W96B 4DYMA 3E8CA 4ZIMA 4AW2A 5IH6A 2O64A 3PXKA 2YWVA 2VTPA 3NMUF 1BMKA 4S32A 3R04A 5FBOA 5KMLA 4I6QA 1VYWA 3BI6A 2FA2A 4RVTA 4B8MA 3DKGA 1GOLA 2ETRA 3KRRA 3QZHA 4FEQA 3A7FA 3WARA 4E5BA 4NM3A 4GIHA 5HX6A 4FKVA 3R83A 4HJOA 4UEUA 3DBDA 3HRBA 2VNYA 4JL9A 3OT3A 4MBIA 1G8SA 3PY0A 4CT2A 5ETIA 4O27B 4M97A 4FTKA 2O5KA 2NO3A 5B2LA 2IZUA 4YLLA 4GKIA 5L8JA 4P5QA 3TJDA 3POOA 3GC0A 1SMHA 3GVUA 4A9UA 3VC4A 2ETMA 4E7WA 5GIOE 4BWXA 2ZB1A 3B2TA 3OY3A 2QONA 4MXOA 4HOKA 5AV2A 2C6EA 3BYOA 4BWKA 2JD5A 4TWNA 4IZ7A 1WBVA 1YWRA 2W1HA 4K8AA 3Q52A 1ZY4A 3FYJX 3VS6A 2CN5A 4FIJA 3O2MA 2PMOX 2BCJA 4F1OA 2ZVAA 4RSSA 1YOJA 3PVUA 5DT4A 3KK9A 3KRLA 4IC7A 4RZWA 3WILA 3ZONA 3FLYA 3OMVA 5H8GA 4CTBA 4XG7A 3KVXA 4L00A 2WMXA 1LEWA 3EQHA 2VTNA 5CSWA 2J50A 2WU7A 4XBRA 3W2PA 1KOBA 3D0EA 4FZ7A 3OXTA 1VJYA 3BGQA 3DOGA 5DA3A 3FZ1A 2IVUA 3F69A 5HG9A 1Q8UA 5AR3A 2GSFA 1RQQA 4TYGA 5K3YA 2C47A 1I09A 4UMTA 3LJ1A 4E8AA 2J0JA 4O0XA 5EG3A 3CP9A 3MJ1A 4EONA 5HG7A 4DGGA 3OUKA 3QZGA 1SVGA 3G0EA 4CFFA 5AA9A 5B7VA 5CF8A 2WQMA 3COIA 1Z5MA 2RSVA 2J0KA 3QX2A 4GIIA 2VN9A 3TACA 3C7QA 4PPBA 5DH3A 3ZXTA 3HMOA 1QPDA 3EFJA 4BBFA 3BV3A 3D5UA 3BHYA 4O6LA 2YM4A 3K3IA 2XRUA 3C51A 2CPKE 4FKLA 4BCPA 3OS3A 4EC8A 5HNGA 5HOAA 4RC3A 4YZMA 2WMBA 3IKAA 1DAWA 2W5HA 4BICA 1R1WA 3ZH8A 3O96A 3EIDA 2I0YA 2PE1A 4GYIA 3E88A 4IFGA 4YLJA 5HVJA 3MB6A 3BQCA 3NRMA 5E92A 3BE2A 4NWMA 3VS4A 1W83A 4K11A 4ZZMA 4KAOA 3QTQA 3WE8A 2QQ7A 4MEDA 3W8LA 3KFAA 1LPUA 1A06A 2OXXA 5DG5A 5HO7A 3E63A 1W98A 4FV9A 4IWPA 3ROYA 3TKHA 3R28A 4FT3A 5LXMA 1XH9A 3MN3A 1PKDA 3QTWA 1IEPA 1QPJA 3QTXA 4NH1A 4ZLZA 2WPAA 3DKFA 1OUKA 3E3PA 4M8TA 3ZBXA 3MESA 4R77A 5IMEA 4C62A 1YW2A 4DLIA 4QMOA 2B1PA 4BIEA 4D1SA 1JOWB 2EU9A 4ZTSA 3TCPA 2ITXA 5BVKA 3UVPA 3K54A 4MX9A 1Y6BA 2OIDA 4BDEA 1FPUA 3MIAA 4FSUA 2VO7A 3HAVA 4X3FA 1OKWA 3KCKA 4UYAA 4AW1A 4PL3A 4BCOA 4QP1A 1YI4A 4WIHA 2ZMCA 3HMMA 3HNGA 5EDRA 1OPKA 3FMHA 4RIXB 4TYHA 3D5VA 3CQWA 4DG0E 1Q62A 3A8WA 1Y8YA 3ZUUA 5I9WA 3QA8A 4FL2A 1OMWA 4M69A 2KTYA 4CFNA 3S0OA 4IACA 4E6DA 3BEGA 3IDCA 3CGFA 3FL5A 5LOHA 5AADA 3S3IA 4BBEA 2IZRA 1B38A 4L3LA 4PMPA 5HTIA 2V22A 1BI8A 2J6MA 4ANLA 2WMVA 3HMIA 3PXRA 3PE2A 4FYNA 4QMXA 3OTUA 3VF9A 4DEAA 2BRNA 4BDBA 5M4FA 4C3RA 3MW1A 3N9XA 4IVBA 5AAEA 3OCTA 4IJ9A 4D0WA 4EBVA 2Z8CA 5CYIA 3UZPA 1Q97A 4YJPA 4HW7A 5HD4A 3FL4A 3PXZA 4MXAA 4GU6A 3VUHA 4Y5HA 5E90A 4Y72A 5BUIA 3EWHA 2CMWA 5FM2A 1YQJA 4AGWA 5L6PA 4RA5A 4PPCA 4A9SA 3ATSA 4WG4A 4YHJA 5JFSA 3BPRA 5DHJA 3P7BA 2I40A 2AYPA 4IAZA 1RW8A 5D7AA 2WOUA 2YHVA 4Y85A 1ZOHA 1YXXA 3NNXA 5EOBA 5LMKA 3BZ3A 4I94A 2IN6A 4N0SA 4L43A 5DR2A 5J9YA 4PMMA 4EOPA 4ACDA 5AWMA 5J1WA 5IUIA 1OM1A 2J0IA 4NIFA 4CQEA 4HYUA 4W8EA 4LRJA 4FSWA 5CNNA 5CF4A 5H9BA 2W9ZB 3Q9ZA 4I5CA 3VS5A 2QNJA 2PK9A 3BYSA 1M2QA 3IW6A 3MWUA 4GFOA 2BIYA 2CGVA 4J52A 5CTPA 5AP4A 3VBTA 3OCSA 2VWVA 3W10A 4AACA 3O7LB 3FKLA 4ZMFA 3UIUA 4HYIA 3G9NA 2IVTA 4BC6A 1PXOA 3BLRA 3PIYA 1ZLTA 2X8EA 2W4OA 3DK6A 4BHNA 2EXMA 4ANBA 5JZJA 2I6LA 4B99A 5FQDC 4FGRA 4EJNA 4I21A 3W8QA 4D2RA 3GC9A 3G0FA 3AMYA 3QTUA 3KF7A 2LAVA 1P4OA 4IWQA 1XR1A 2Z60A 4A9TA 3SOAA 3U6IA 4PUZA 1KOAA 4YJQA 2UW9A 3II5A 3GT8A 2IZTA 2XP2A 4Z16A 3OY1A 4RJ6A 3LFFA 3CQEA 5DFPA 2ZDUA 4ZZNA 3FPQA 2BPMA 2QOQA 3D15A 4Z7GA 3RGFA 4R3RA 3N51A 1Y57A 5F20A 3SX9A 4AW5A 3FI2A 3I1AA 2DS1A 3KN6A 4LV5A 5D41A 3SLSA 4AFEA 2BR1A 3RNIA 5LWMA 3UO5A 2IW8A 4AX8A 3L8SA 3R7UA 4DHFA 3AOXA 4R5SA 4CT1A 2G9XA 4GUEA 2PVRA 4QP2A 1FOTA 3FDNA 5IA1A 3TV7A 1JSVA 3AXWA 5EKNA 3L9NA 2F57A 1T46A 3BKBA 2C6KA 3SHEA 3H9OA 1OUYA 2OZAA 2CKOA 4F99A 3O51A 1F0QA 1V0PA 4BB4A 5G1XA 3QCQA 3R22A 2PU8A 3JYAA 1FGKA 3NNVA 2OFUA 4MBJA 4AT5A 1KUTA 4ZSLA 3LLTA 3UQGA 5CSPA 3O7LD 4F6SA 1OIRA 5TO8A 4XNEA 2GS6A 3VAPA 4YURA 4UMPA 3RAWA 4G6LA 1F3MC 1YWVA 3VRYA 3F7WA 3W18A 3VIDA 3VBWA 2WAJA 4L46A 5IDNA 3AMAA 3Q2JA 4I20A 3CLYA 4D4YA 1GZNA 2XVDA 3Q60A 3UTOA 5IUGA 5FRIA 5E7RA 4MH7A 4R1YA 4RC4A 5CF6A 3M42A 3MDYA 2C69A 3MH2A 1XH7A 4GFMA 2PZRA 4C36A 5A6OA 4EJ7A 3MPTA 2BDJA 3GP0A 3I7CA 3SXFA 4RIYB 3LCKA 3P1AA 4AZTA 3WZKA 2RGPA 2CKQA 3PG1A 3DU8A 3E92A 3TNPC 3ZFMA 3NYNA 3OWPA 4JQ7A 1Z9XA 3GQLA 4LGGA 3RK9A 4NM7A 4NU1A 4FL3A 3S4QA 1FMOE 3R0TA 4JBPA 1JLUE 5ANDA 5HE0A 3FXZA 2E9PA 4IWOA 4AOIA 2YIYA 3F9NA 4QP9A 4X2GA 3BE9A 2J9MA 5CT7A 4LV8A 3HX4A 3UZTA 3DV3A 2OF2A 3TM0A 4O7WA 3FMMA 5L2WA 2YM8A 4B8LA 1RE8A 2W17A 4HVSA 4FG7A 4JI9A 1ATPE 4NFNA 4I3ZA 4EOIA 2PTKA 3FAAA 2W5AA 3HUCA 4I41A 3F5UA 1IA8A 4RX8A 4CRLA 5KNJA 3EH9A 1WBWA 4KS8A 2PVKA 3UP2A 4CFMA 4C59A 4FNXA 3UYSA 3ZRMA 2WNTA 3QX4A 4ZEGA 5B2MA 2WMQA 2BFYA 4I6BA 1AGWA 3EKNA 4QQJA 2B0QA 4AW0A 4V04A 4GS6A 4E26A 4MNEB 4P7EA 4PWNA 3RAKA 2UVZA 1PRYA 4BR3A 2OLCA 2JDRA 3BELA 4TTHB 4BYJA 5JQ5A 4O22A 2W7XA 4XP3A 3VHEA 3GQIA 4ZS4A 2OGVA 3TTJA 3VS2A 5F1ZA 5D1JA 4O0YA 3BLHA 3F5PA 4MHAA 4U3YA 3E7OA 4NKSA 4WKQA 2IG7A 4EOSA 1TVOA 1O6KA 5IMXA 4BGGA 2C5NA 4G5JA 1BL7A 3Q53A 5HI2A 4C7TA 4F9AA 3CGOA 5A14A 1ND4A 3EYHA 5I5ZA 3F3UA 2IO6A 2PSQA 3QC9A 2HAKA 3LXNA 3W55A 5M4CA 4HCUA 4GJ3A 5L8LA 3UOJA 4FT7A 2R3IA 3PYYA 5E8TA 5C4LA 5EHLA 1Y6AA 3I81A 4KRDA 4EL9A 2VTIA 5FTGA 3EN9A 4BI2A 4XYFA 3BYMA 3OROA 4QP6A 4R3CA 4YLKA 4F0GA 4GJ2A 3R00A 4O7ZA 4MD8E 5IA4A 1REJA 4ZJIA 1XBAA 4K18A 3SXSA 5DGZA 2VX3A 1J7IA 4NZWB 4QYGA 2UW3A 4IAKA 4KB8A 3G6GA 3UO4A 5I3RA 4YJNA 3RAHA 2ZV9A 4DINA 4RT7A 2UZVA 3PSCA 3RPOA 2XIZA 4EC9A 1PMNA 4FTAA 5DPVA 5DR6A 5HO8A 5CU0A 2CHLA 2B9HA 1E1XA 4C4HA 3SV0A 4X21A 5JK3A 3A4OX 4FTOA 3OG7A 4G3GA 5GHVA 4YHFA 4E6QA 4BKJA 5TKDA 2VTJA 4WHZA 1FBNA 4BRXA
chains in the Genus database with same CATH superfamily
4MAOA 2YA9A 3NEWA 3DLSA 4FV7A 4HVIA 5IQEA 4EH8A 4KBKA 4O4DA 5HE3A 2CSNA 2HZIA 3IW5A 3TNQB 4XEYA 3QGWA 1W7HA 2UZWE 3V01A 3F3WA 4USFA 1U5QA 1XKKA 3R71A 4EOLA 4QQTA 2OXDA 2C5OA 4LG4A 3PA4A 3VBVA 2Y7JA 5IH5A 3FXWA 3U9CA 3DNDA 3KULB 4QPMA 3WF7A 4X3JA 5DWRA 4N70A 2R2PA 3SXRA 2P0CA 3BIZA 3H3CA 4R7HA 3ODZX 3DAJA 3G6HA 5CS6A 4U81A 4FX3A 4KKEA 2JFMA 5AV3A 4IB3A 4CZTA 4J97A 3VULA 3IDBA 2OXYA 3F66A 4YP8A 2FO0A 1W2CA 3CBLA 4M13A 5CASA 2HZ4A 3I6UA 5H2UA 3RI1A 3TKUA 3TV6A 1YXTA 5ETCA 1ZZLA 4XG4A 3V5QA 2VZ6A 4U45A 1PKGA 3GU6A 4CQGA 3VBQA 3GCPA 4N6ZA 4FIEA 4PF4A 2PE0A 2OJ9A 4MQ2A 2WZJA 4C34A 5GJFA 2AEGA 3VHKA 4DH5A 5I9VA 5IA3A 3CCNA 3R7GA 2W06A 3GBZA 2YLEA 2I0VA 4BHZA 4F65A 2R3GA 4LM5A 2QKRA 3ALNA 2W4KA 3G2FA 1JNKA 4UWYA 5BUJA 5HBJA 1DI8A 2C0IA 3H30A 4BDJA 2PUIA 5BVOA 2Y9QA 4RVMA 3GGFA 5EYCA 4U44A 2XUUA 3UOLA 3Q32A 2J5EA 5FXQA 3ZFXA 3ZO3A 5EM5A 3R9DA 2W1EA 5CALA 4CYIA 5KMJA 2YM7A 3LHJA 4QNYA 4BDFA 4IJPA 1R0PA 4FTCA 4ZSGA 1AD5A 4QRCA 3O23A 2Q0BA 2VTLA 3IOPA 2V7AA 4WBBB 4OAUC 1U59A 4O2PA 3QXOA 4GH2A 4BIBA 5A4CA 2WTCA 1PJKA 4IADA 1U5RA 1SNXA 3JS2A 3P86A 5B0XA 5FP5A 4BTKA 2ZM1A 4WRGA 3NUUA 4YBKA 2QI8A 5AUZA 1AQ1A 4NKAA 2R7BA 2UUEA 2WMTA 4I22A 4PRJA 3M2WA 4YJSA 4O7SA 4C57A 4FTNA 4OLIA 2O63A 4BCMA 5KKRC 3N4UA 2HOGA 2ITYA 4RIOA 1YI3A 3NDMA 3QYZA 4FKOA 4ITIA 3L8XA 4O1OA 4S2ZA 3C13A 2GNLA 4DCEA 2YCQA 2E9NA 3QWKA 5IQDA 5H8EA 3L8PA 3EQCA 5ANKA 4JMQA 5A4QA 3T9IA 2W1CA 1WBNA 4GK4A 3NPCA 4XV3A 5CZHA 1H0WA 2O65A 3G15A 3EJ1A 4IVCA 2FSOX 5CEPA 1YDRE 4BWPA 4FODA 4KIQA 3OOMA 2P3GX 3DFAA 4R5YA 2PVMA 5CSVA 2HXLA 1UU8A 4ARKA 5ACBC 5JGAA 2XNMA 3WF8A 2ACXA 3OD6X 5KX8A 3PIXA 2UV2A 5AFVA 3FPMA 3EN5A 4EHZA 2FVDA 3VS7A 3VUGA 3BU3A 1ZOEA 2GTNA 5ETAA 3UDBA 3AD6A 4QMTA 4KWPA 3F7ZA 3LJ2A 4J96A 4QTBA 3U51A 1WAKA 4BZDA 4E4NA 4C0TA 3FKOA 4AFJA 4L52A 5M09A 5EM6A 2OJGA 2BFXA 1JKSA 3BQRA 3FI3A 5HCYA 4C3FA 2I1MA 4CG8A 2GHMA 4EI4A 4NTSA 3W33A 4LMNA 4UMQA 4YO6A 2FSMX 1YRPA 3JR1A 4H05A 3ATTA 4QMUA 3VQHA 2VTTA 3C50A 3E64A 1YDSE 3EQGA 4M12A 4PL5A 1J91A 4YZDA 3ZRKA 4GT3A 4C4IA 5C1QB 4FEXA 3SGCA 2WELA 3EZRA 4RIWA 1H26A 4MD7E 4XH6A 4NT4A 4OUCA 2H9VA 1UWHA 2PZYA 3IQ7A 3KF4A 3I79A 4FV8A 4PDYA 3PFQA 3ZO1A 2Z7SA 5BVFA 4N57A 4O84A 5IQBA 4Y5QA 3QZFA 3FSKA 4BYIA 1J7LA 3Q04A 4DDIA 3HV6A 3C4EA 4FI1A 3BRBA 4O86A 5KBQA 4FTLA 1PXIA 4I92A 3PZEA 3HV4A 5AR2A 3WZUA 3ZDIA 2PMNX 4XBUA 4RFZA 1R0EA 2YACA 4F1TA 2B53A 3ZBFA 3F88A 1QL6A 3KMUA 3TDWA 3QRKA 1RJBA 5HORA 5I0BA 2UZLA 2QD9A 2E9VA 3FBVA 2WEVA 4GVAA 1KE5A 5L4QA 3FHIA 1P5EA 2R3LA 3Q9WA 3IONA 4FUYA 3GC7A 5K9IA 1I44A 1TQMA 3FUPA 3PP1A 3WYYA 5KHXA 3I4BA 3NYOA 3PLAE 2CCHA 5CVFA 3D5XA 3DBEA 3FV8A 2SRCA 4RA4A 4LMUA 1BL6A 4DHJA 3PY1A 2X39A 2FGIA 3KC3A 3W2QA 5LARA 1U54A 2G01A 3FZRA 4YBJA 2ESMA 3BHTA 3C9WA 4OTDA 5GJDA 1R39A 4FE2A 4BCGA 3QCSA 4OTFA 4B9DA 1P2AA 5T6KA 2Y6MA 2NPQA 4UB7A 3KXZA 3ZSGA 4O7LA 1RDQE 3WZJA 2I0HA 2PUUA 3AC8A 2PPQA 3MTFA 1MQBA 5FXSA 3F3VA 4FIIA 4DG3E 3FQSA 3CKXA 4G17A 3D4QA 4P90A 2VTRA 1V0OA 2REIA 3NNUA 3R6XA 3EB0A 3MFUA 3NAXA 1FQ1B 5J79A 5CVGA 4XRJA 4BDAA 4F9WA 2JEDA 3ZMMA 1LEZA 2XJ0A 4K9YA 3W32A 5I9ZA 3RZBA 1XHAA 2XIXA 2ITWA 4O0TA 5JT2A 4DTBA 1ZY5A 4D2VA 5LVLA 4FV5A 4QMYA 3R8PA 4D4VA 2ONLC 5IKWA 4YSMA 3ERKA 3VS1A 2QR7A 3EFKA 4A9RA 2X0GA 2X7GA 2YFXA 4YSJA 5HG5A 4DTAA 4O0VA 3U87A 3E87A 3ELJA 4FBXA 5AV4A 3POZA 4YC8A 2FH9A 1LUFA 3TL8A 1BYGA 3PY3A 5CWZA 5FTOA 4USEA 2R0UA 3A99A 5HLNA 4NK9A 4K0YA 4OTWA 2GMXA 1JWHA 1UU3A 4ALWA 3MFSA 5E1SA 4JDKA 1H1SA 4WUAA 3TN8A 3TZ8A 4UY9A 5AUVA 2UW5A 4JG7A 5DRBA 4G3CA 4M0ZA 3UDZA 2ERKA 5AP5A 3D7ZA 3JUHA 2BHHA 2PVHA 4CLJA 5CSXA 5JFWA 2QOKA 2YM3A 4KSPA 4XOZA 3VRZA 5FEDA 2CCIA 2XIKA 2R9SA 4W9WA 2OJFE 3KMMA 4CKIA 3QU0A 4QYHA 4IH8A 2Y4IC 5EW8A 3ZS5A 4E73A 4GSBA 3QLFA 4IX5A 2C3IB 3MYGA 4R6VA 1H24A 3WZEA 4DFXE 3R9RA 4XCUA 1H27A 3DZOA 4DH8A 3SAYA 4QEBA 3B8RA 4U43A 4IAYA 4ASEA 4PDSA 2R3HA 5K0KA 3BLQA 4E4LA 2YN8A 2VX1A 4QMPA 3NGAA 2RG5A 5J95A 4APCA 4QPSA 4CSVA 4HVGA 1ZAOA 2W1DA 4F4PA 2OH4A 2EB3A 1J3HA 5IEYA 3NIZA 5BYLA 5C4KA 5HVKA 3AT4A 4WNKA 4YTIA 3TZ9A 3CEKA 5C8MA 4ID7A 5HU3A 2PY3A 4RWKA 4AZEA 2ZYBA 3ULZA 4X3FB 5L2TA 3EQRA 2IZSA 2EXEA 2VWXA 4IDVA 4BKZA 4G5PA 4EOQA 4RG0A 5CQUA 3PLSA 1REKA 4TYHB 4FSMA 3AKLA 1IASA 5L6WL 4ASZA 4A4LA 1OZ1A 5AAGA 4D28A 4IMYA 4M69B 3Q5IA 4X2NA 3PPZA 3TDVA 4JX3A 2QLQA 1WBOA 2UW4A 4ALUA 2BRMA 4U6RA 1FVRA 4BCQA 4ZLOA 2WMRA 3KGAA 2VTOA 4FNWA 4NEUA 4C3PA 3TYKA 2JKOA 2ITQA 3I0QA 2CNUA 4W9XA 4CRSA 1PXJA 3QLGA 4BBMA 3VBXA 3F6XA 4EH2A 4PNKA 4ACHA 3R9NA 4RWLA 1GIHA 2ITPA 2X8IA 3R7OA 5FXRA 4HZRA 4WA9A 3N4TA 3OP5A 2B4SB 4XG6A 2XH5A 3RWQA 4DF3A 4EYJA 4QTEA 3FKNA 3LCOA 3A7GA 4WO5A 2BRGA 4C33A 3TUBA 4WD5A 3LFSA 3ZUTA 4LL0A 4II5A 3W2SA 2XIRA 4AZFA 3ZM9A 4DFYA 2HY0A 2P33A 4EOOA 3FY2A 3HDNA 4FIHA 5M44A 2C30A 4IC8A 4BFMA 5IQFA 2YISA 3DFCB 3G51A 2JAMA 3OF0A 4LL5A 5CENA 4BZNA 3DQXA 3PPJA 1OI9A 4ITHA 5HIDA 2HELA 2VGPA 5JGBA 3MTLA 4FKGA 3LCDA 4FR4A 3NW7A 5AMNA 5T68A 4CD0A 4DH7A 4TL0A 1JKLA 2XEZA 3ZC6A 2WTKB 3IO7A 3PJ2A 4G31A 1M14A 5DEWA 3A60A 2XF0A 3IK3A 5F94A 2XARA 3ORKA 3F2NA 2WMUA 4LI5A 3ML1A 5KMOA 4WSQA 2X1NA 5L8KA 2C5YA 5DLSA 3ETAA 4G6OA 5CAUA 4OBOA 2BAJA 4UALA 2Z7LA 1HCKA 1KE7A 2WU6A 5LVOA 4EZ7A 3QQFA 3DA6A 4DTKA 3ZUVA 4JAJA 3TWJA 3ANQA 3CS9A 4J53A 3QF9A 4HYSA 2X81A 5DVRA 5DN3A 3CTQA 2V5QA 1CSNA 1IRKA 3COHA 1PF8A 5JKGA 3BV2A 3MV5A 2GNHA 2XK8A 3QQLA 2QCSA 2UVXA 4IHPA 4YZ9A 2VAGA 5FDPA 2I7QA 4X2JA 3LFDA 4UXQA 1CDKA 4QMSA 4FICA 4OTGA 5M08A 4IVAA 3PDTA 4O1PA 3R73A 1JPAA 4C2WA 3AT3A 4KA3A 4AZVA 1DM2A 4FEUA 2JIIA 4KUJA 1G3NA 3CY3A 4DBNA 3FYKX 3P7CA 4FG8A 2X6DA 1G8KA 3WIGA 4ZTLA 2XM8A 3V6SA 3DS6A 4EBWA 3FI8A 3ZSHA 1M7NA 2YZAA 1H1RA 4W8DA 5G6VA 4FVPA 3GFEA 4L42A 4EH3A 3L1SA 3TNHA 2ZFYA 3VS3A 3V6RA 5KMKA 5JN2A 5C27A 4AWIA 3KQ7A 3UBDA 4TNDA 4PTEA 1W82A 4D2WA 5D10A 3QC4A 3FMKA 3VN9A 2BROA 3OHTA 4D4RA 4A06A 4RGJA 1UKHA 2P2HA 3E8EA 3HRFA 3DZQA 1PYXA 3HLLA 2GPHA 3RNYA 4RMZA 3TV4A 3UMWA 4BDGA 3AKKA 3VONA 5IA2A 2WQBA 5AX3A 5AA8A 1BUHA 3ZO2A 2YDJA 4HZSA 1OBDA 4J8NA 4H36A 4FV0A 3V8TA 3ZSIA 2PYWA 1STCE 2QG7A 4DGLC 3LOKA 4J7BA 2AUHA 3GXLA 2XCKA 3FLNC 3VW6A 4ALVA 1CMKE 2YITA 4NFMA 2WTWA 4LGDA 3HMNA 3W2CA 3DB8A 3H4JA 4YTCA 3QTIA 2QHNA 4ZTMA 3IGOA 1YVJA 3F61A 2C68A 4QMVA 4ANOA 4C37A 3SDJA 5A4LA 3QALE 2JIVA 3MS9A 5HNBA 1ZMUA 4FKWA 4M68A 3OZ6A 5C8NA 2ZV8A 5CU2A 5CVHA 4CMUA 3R8ZA 5K4JA 3HKOA 5GJGA 5AUXA 2BRBA 2VTHA 2HIWA 2VWZA 5HBEA 4ENYA 5KMNA 5FUTA 3QQGA 2G15A 2QC6A 2JKQA 2DWBA 4P2KA 2JIUA 3ZZWA 3PE1A 3MBLA 2YM5A 4JAIA 3MB7A 2ITZA 3Q4UA 4G3FA 2C6LA 3LMHA 4MVFA 5DI1A 2WMWA 2HCKA 4QMNA 5AV1A 2G2IA 4IEBA 3QGYA 3EMGA 5E1EA 3E5AA 1V1KA 3ORZA 3UIBA 2IW6A 3MSSA 2VTMA 2VGOA 4Q2AA 5BVEA 3O17A 5FLFA 5AR4A 3K5VA 1M2PA 4ZSJA 3R02A 2RKUA 4F6UA 5CAPA 3FC2A 3QQHA 2A98A 3PSBA 4U8ZA 2PZ5A 4ASXA 4M66A 2PVNA 3HV5A 4ZY4A 2RFNA 3Q9YA 3L9PA 2ITTA 1YI6A 3GEQA 3UG1A 4DHZA 2XKEA 1PW2A 2DYLA 3WOWA 2JC6A 2CN8A 2R3NA 4G1WA 4CYJA 2R0IA 1E1VA 3MH3A 4IXPA 1WMKA 3MPAA 1GIIA 4L01A 4MXYA 4EK8A 3PPKA 3B8QA 3W0MA 3RMFA 4KIOA 3C4WA 2PWLA 3QQKA 5DEYA 3H9FA 3I6WA 3ZXZA 3HYHA 3UVRA 3Q9XA 3Q3BA 4ACGA 5A6NA 2BUJA 5ANOA 3F3ZA 4M84A 4RPVA 4JRNA 3TNIA 1CKJA 3NCGA 3BHHA 3QXPA 4KNBA 3ZZEA 3EFWA 4JNWA 3CQUA 3R7EA 2EVAA 3G33A 2XNEA 3V04A 4J95A 1G5SA 1IAJA 4ORKA 5EHOA 3LFAA 2VWUA 1Y8GA 4P4CA 3CE3A 4OTPA 3QKKA 3UIXA 3KL8A 3MY1A 1XJDA 5HBHA 2BDFA 3FQEA 4AU8A 3MY0A 4CV8A 5EQYA 3CJFA 2WIHA 3FMJA 3NWWA 4O81A 3GNIB 4IW0A 3UPZA 1XQZA 4FMQA 4OBQA 3QD2B 2JDTA 2QHMA 4JG8A 4AN9A 5HNIX 5EHYA 2YM6A 2YIWA 1ZYLA 4IDTA 3DXNA 3NAYA 1NXKA 4KS7A 3OW4A 4I1ZA 4QP4A 3UQCA 2CNVA 3LCSA 3OVVA 4DITA 2PMLX 3D5WA 3KB7A 3RP9A 4DEDA 3DDQA 5A4EA 3PJ8A 3R1NA 4O4EA 5E8UA 3LFQA 2R7IA 1T45A 5ACKA 2PUPA 4HGTA 4FTIA 3V5JA 3V3VA 3AC5A 3ENHA 3OUNB 4YC3A 3BL9A 3RKBA 3R1YA 4DH1A 4DFBA 3QBNA 3BGPA 4WRSA 2GQSA 1NA7A 1Q8WA 4IM3A 3HL7A 5EYMA 1Q3WA 2BIKB 2QKWB 3L9MA 1UVRA 3TT0A 2P4IA 3RHXA 5J5SA 5AJQA 2XS0A 3B2WA 4PPAA 4BCFA 2OFVA 4K6ZA 3KN5A 3RALA 3HAMA 3CTHA 3QYWA 4ERKA 2UW7A 3KRJA 4FT9A 3OCGA 4CKJA 4HVHA 5GINE 4RLLA 2YZLA 3QAME 1M52A 1EH4A 3DAEA 3ZLSA 2OIBA 3MJ2A 5BVDA 1OL6A 3RCJA 5IH4A 4G3EA 2ITUA 3K5UA 3U55A 4DEGA 4FKRA 3CJGA 1KV2A 3EN4A 4EYMA 4FOCA 4OTIA 4O7VA 3V8WA 5CANA 2BZKB 3FMLA 2Y4PA 3ZLXA 5I4NA 4DEHA 4FKIA 2HZNA 1MUOA 2VTQA 3PA3A 4JIKA 2OU7A 3RHKA 4J8MA 4IZYA 4BKYA 2GHLA 4FSNA 5EM8A 3FMDA 5EI8A 1JSUA 3OWJA 4AAAA 3RPSA 5LVNA 3QTRA 4DLJA 1UU7A 4EQCA 4CFUA 5D11A 2C6TA 4JR7A 4HGEA 5FG8A 4IQ6A 1WBPA 4I93A 4L67A 3QRJA 4CLIA 1W8CA 5JGDA 4MQ1A 3LMIA 2RG6A 4O83A 1KE6A 5GIPE 4APPA 4BF2A 4XLVA 4L53A 3FEGA 3R2BA 3TI1A 5CZIA 4A4XA 3O5AA 1OKYA 1BKXA 3A7JA 5KHWA 1R78A 4Y8DA 5AUUA 4FZ6A 5KBRA 4KBAA 3MFRA 3T3UA 2CNQA 2QURA 3ORIA 3ZU7A 2W05A 5ICPA 5HO6A 5AM7A 2JKMA 2JFLA 4KIKA 4LOPA 5AV0A 5M53A 1U46A 3U6JA 2OIQA 3R7YA 2WQOA 2ZM3A 2R5TA 3F5XA 4OTHA 2H6DA 3OWLA 3TNWA 2F49A 2XYUA 1WVYA 5JZNA 3REPA 3OWKA 5K0XA 3CR0A 3FQHA 2Z2WA 3FC1X 3Q4ZA 3V8SA 3K2LA 1JKKA 2OKRA 2H8HA 3IS5A 4L44A 4GMYA 4S33A 4UN0C 4GFGA 3BU5A 3TXOA 2HXQA 5L2QA 5EQEA 3C4XA 2ONLA 4GEOA 4I23A 3F82A 3DNEA 3FZOA 4RX5A 4RJ3A 4YZBA 2XRWA 1P14A 4IM0A 5M55A 2P2IA 2OWBA 4Q9ZA 4DEIA 5FEQA 3UE4A 2QVSE 4MXCA 2DUVA 4MCVA 3KY2A 3MVJA 3PXQA 2C6MA 5I9UA 3AC1A 3U4UA 2W1FA 2WTDA 4HNFA 2XK7A 4XV9A 3DJ7A 3F5GA 2XJ1A 5EYDA 4EOKA 3DJ6A 1JQHA 4IFCA 4RRVA 1XMLA 2QOFA 2BKKA 4QP8A 4BJJA 4WNPA 5LVMA 2BZHB 2BZIB 5M51A 4FZAB 4F70A 4U7ZA 4TRLA 4RWJA 5EDQA 3R8LA 2Z7QA 4J98A 3QRIA 2IWIA 4AQCA 1OITA 2I0EA 2ITNA 3SKCA 2IPXA 3U54A 1YXUA 3E8DA 4FSTA 4AG8A 2VO0A 2OF4A 3MH0A 3KXGA 4ZZOA 4L68A 3QRUA 1OGYA 4EK4A 4PDPA 2G2FA 4FKTA 4ZTRA 1IR3A 4QDVA 3R9OA 5LMKC 2XNGA 3AT2A 4LUEA 4MUQA 2GNJA 5CX9A 4EUTA 3DBCA 4G9CA 2OICA 4WNOA 4XOYA 2OJJA 5EW3A 4UWBA 3SRVA 4OR5A 2WTJA 4BZOA 1UNGA 1OGUA 2J51A 4YU2A 2CLQA 4UMUA 1Q3DA 1VLRA 2C1BA 5GZ9A 4AE6A 3I5ZA 2QLUA 2WB8A 4YPSA 4DGNA 2GNIA 2VWYA 3HRCA 3NS9A 2WFYA 4LFIA 4GYGA 1K9AA 5E8VA 3UNZA 3TIYA 4B0GA 4MD9E 3C1XA 2UZUE 3ZCLA 1MRVA 4PDOA 5KZIA 3KRXA 5IA5A 1PXMA 2X7OA 3EQIA 3O8UA 5J7HA 2R3RA 2X2LA 2UW6A 3KVWA 5HE1A 3JPVA 4GV1A 3A2CA 4WOVA 5EI6A 4R7IA 4H3QA 4F78A 1M17A 4L8MA 1H0VA 5IF1A 4TWCA 5IQGA 1OVEA 4CTCA 3W16A 3GU4A 1ZRZA 3C4FA 4ERWA 5L3AA 5HHWA 5L6OA 3HV7A 3D7TA 3FZSA 2NNWB 3OCBA 3TTIA 1L3RE 1GZOA 3QCXA 2OH0E 3QUEA 4RVKA 3HUBA 3IW4A 2EWAA 2J0MB 3EQPA 1WFCA 4RJ7A 5DMZA 2VO3A 3GCVA 4UBAA 3P78A 2ERZE 4BCIA 2NP8A 5E8XA 2UZTA 2R3QA 2C5XA 4K33A 5IA0A 5LMBA 3GU5A 3RVGA 4OT6A 3VO3A 2CGWA 5ANJA 3FY0A 4D55A 1OPJA 4FIFA 4CV9A 4ENXA 4EOMA 4F08A 4GL9A 2HK5A 1PMUA 4IAAA 3E7VA 3KA0A 2AC3A 4E3CA 2OJIA 2ZJWA 4AT4A 3T9TA 2WEIA 1FINA 4XV1A 1XMMA 4EK5A 5A3XA 4QP7A 2PULA 4I5HA 5C01A 2BDWA 4AOJA 2OK1A 1NT2A 4UZHA 3TUCA 3UNJA 5CF5A 4RIWB 1Q24A 3OEZA 1W2FA 4EK6A 4C61A 5CXHA 4Z3VA 5EQPA 4C2VA 3CY2A 4IAFA 2XK9A 4BY9E 4FVRA 4S34A 1NVRA 1H1QA 5BPYA 5IQHA 4C35A 3GUBA 5IZFA 5E4HA 3KKVA 2HENA 3HP2A 1WBSA 2X7FA 4FRFA 3Q96A 5E91A 4RFYA 4FV3A 2A19B 4M3QA 3A7HA 4JDHA 2QU6A 1ZYJA 5C8KA 3L9LA 4ZOGA 3GU7A 4Q9SA 4R1VA 2YDIA 4MKCA 3GC8A 2ZOQA 3E93A 2GNGA 1IAHA 5C9CA 4JG6A 3PVWA 1J7UA 2BTRA 4CZUA 2X4ZA 2ZV2A 5J1VA 3MA6A 4XG9A 4JBVA 4CVAA 1MP8A 4IZAA 4JDIA 2PVYA 2YCSA 4ACCA 1TQIA 3FLQA 4FKQA 3JY9A 3AGLA 3TJCA 3HA6A 2JDSA 4IVDA 5AP7A 5T3QA 4BDCA 4Z7HA 4NYEA 4DBXA 4FEWA 4XG2A 1KWPA 3ZEWA 5IEXA 3MI9A 4RFMA 4U80A 1UNLA 2XNNA 3EL7A 4LRKA 5IG1A 5J5TA 1ZARA 2YDKA 2CKEA 3LAUA 3TUDA 4FVQA 3OT8A 1GJOA 2E9UA 1SVHA 2X6EA 2YJRA 4IANA 4CFWA 5AIRA 1U54B 4D5KA 3S00A 5E8WA 3A8XA 3EOCA 4AGDA 3FE3A 5EM7A 3PXFA 3QRTA 4H3PA 4HCVA 4MNFA 3HDMA 4M15A 5AP6A 4AZWA 4C4EA 4AXAA 4YMJA 1WVXA 3NZ0A 2X4FA 4EEVA 4RWIA 1H08A 3EN7A 5KMIA 3GFWA 2XKDA 4J1RA 4N4SA 5TOZA 1H1PA 2HW6A 1UU9A 3EZVA 1DS5A 5AUWA 3QL8A 1A48A 4AXEA 2UW0A 3FLZA 3I60A 4GK2A 1SZMA 2RFEA 4WNMA 4V0GA 3RZFA 2YIRA 4DHIB 2QG5A 4HYHA 1UKIA 5JEBA 2VRXA 3RM7A 3R01A 5BQ0A 3WZDA 4UX9A 1MRUA 1CTPE 4I6FA 3QWJA 3ET7A 2W1GA 5BVWA 5HZNA 2BHEA 4DFNA 1YOLA 1Q41A 4F63A 4ZK5A 3V5TA 3O8PA 4L7SA 4H3BA 5JRSA 2GFSA 1HOWA 4E20A 1YHWA 3LQ3A 1W84A 1SM2A 2CLXA 2WO6A 4C8BA 4RX9A 4M14A 4C38A 4H1MA 5ANEA 1L8TA 3JVRA 3AD5A 3RK7A 3PIZA 4FUXA 4O4BB 4EOJA 4ANMA 5CU3A 4BCNA 2WGJA 4O4FA 3LIJA 3QD0A 3DCVA 3AQVA 4ZTHA 3IG7A 4C58A 4GG5A 1O6YA 5CI6A 1BLXA 2V7OA 4P5ZA 3PRFA 4YPDA 2XMYA 3G5DA 5E8ZA 5CT0A 2NRUA 3ZM4A 4RJ4A 3S2PA 3QD3A 2HWPA 1YXVA 3TMOA 3DKOA 4QYEA 3PG3A 4D1ZA 1J1CA 4E1ZA 4NUSA 5LVPA 4G9RA 4ASDA 2Z02A 3LFEA 1PMVA 3DK3A 5J7BA 4HGLA 3PXYA 3VJOA 5CAOA 3FJQE 5FWKK 5CNOA 5CSHA 1H1WA 5FD2A 3EL8A 3BWFA 3P0MA 2B9IA 3PVBA 3C4ZA 4GKHA 2VX0A 4FV4A 3DK7A 2XKCA 4BVUA 1KE9A 2PVFA 3R1QA 1VZOA 3SOCA 3BX5A 3UC3A 4CFVA 3Q5ZA 3W1FA 2QO2A 4UYNA 4W4WA 2YCRA 2C5VA 5EI2A 5C03A 3VW8A 3HZTA 4PTGA 4AGUA 4R7BA 2OG8A 4GT4A 4X6RA 4KABA 4XV2A 3S95A 4DGMA 4LOOA 1XBBA 5AR5A 1Q61A 1XH6A 3PJ1A 1PXLA 2WKMA 4ZP5A 4EKLA 3PVGA 3QUPA 4GG7A 4MWHA 2B52A 3ANRA 2PZIA 3MGYA 4GRBA 5EK7A 5FDXA 3LM5A 4RQVA 4ZSAA 4YJTA 1M7QA 3CPCA 1URCA 4GK3A 4LUDA 4O2ZA 5IDPA 4ZY6A 4FEVA 5CLPA 3AC4A 2FUMA 3D94A 1ZMVA 2XZSA 3UNKA 4ANQA 2EXCX 4YJUA 1ST4A 2YCFA 4EKKA 2XK3A 4O7NA 5LWNA 2QR8A 3UG2A 5HTCA 2XALA 2C3KA 3DXQA 1B39A 1E9HA 2F2CB 5EH0A 4ZLYA 2FSLX 2JITA 5I3OA 2HWOA 3R7IA 2GFCA 4E4MA 2R4BA 4CMOA 3NFFB 1OIYA 4CZYB 3FZTA 1XWSA 3MPMA 4I0TA 4D5HA 4NCTC 4EH4A 4GCJA 4TPTA 1ZYSA 4O0SA 4BDKA 3N4VA 4I6HA 4XP2A 1F5QA 4F6WA 4NJ3A 4IX6A 4XHKB 1TKIA 4AN3A 3FSFA 4RC2A 1OKZA 4MK0A 4XLIA 3I0OA 4EHEA 2YIXA 1B6CB 3L8VA 1PXKA 3F3TA 3GENA 1GIJA 4QPAA 4CMTA 4MF1A 5F95A 4TYIA 5TF9A 4FZFB 2Z7RA 3PWYA 5CI7A 4OGRA 3MH1A 3PJ3A 4FTMA 5JRQA 3F2RA 1ZOGA 4BI1A 3UVQA 3KRWA 2E2BA 3OBJA 3ALOA 4NM0A 4YJRA 4D0XA 4DFUA 5HQ0A 4C4JA 3VUKA 3DLZA 4BDHA 3KCFA 4KINA 4RBLA 1JVPP 2Y6OA 1FMKA 1O9UA 4TKSA 4TNBA 4YTHA 4BTFA 4NM5A 4EZ5A 3NLBA 2X0OA 2AQXA 2BTSA 3UOKA 4PP7A 4EH5A 5JH6A 2VU3A