3KF7A

Crystal structure of human p38alpha complexed with a triazolopyrimidine compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Continued exploration of the triazolopyridine scaffold as a platform for p38 MAP kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kf7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kf7A01
3LXNA 2W4JA 3VAPA 1SMHA 4I1ZA 1ZY4A 4XG6A 4IAAA 3MFUA 3VS3A 2RSVA 3ZXTA 4H1MA 3EFWA 3L1SA 1Y57A 2VGPA 4YPDA 4DH3A 2QOKA 1OL1A 4A4LA 4IC8A 2GNFA 4V0GB 1GY3A 3SXRA 4AT3A 5DFPA 4EHZA 3BQRA 5LWMA 5LJJA 5IH4A 2GDOA 3KK8A 3ALOA 2E2BA 3NAYA 3R1YA 5EW9A 2P33A 2XIZA 3VS1A 4BTJA 4FA2A 2I0YA 2XP2A 3DLSA 3BHVA 4RQKA 3EN5A 2O63A 3UG1A 3G15A 3NUAA 3RGFA 3ORZA 4JIAA 3OUNB 4XUFA 3KL8A 1Y6BA 2R7BA 3QQJA 4O96A 2XEZA 3FZPA 5AAGA 2QU6A 5JQ5A 3FY2A 5F4NA 2OJGA 3L9MA 4NFMA 5LCJA 1NXKA 2GS7A 2JIVA 4XRJA 4YGAA 5FBNC 4F70A 4IVBA 3MFSA 4TYJA 4CMOA 2BFXA 1YHWA 3TUCA 1E1XA 2YN8A 2F7ZE 4E26A 4R1VA 4XEYA 4FTKA 2EU9A 3PP1A 3RALA 3S3IA 3DTCA 2R4BA 3ZTXA 4JQ8A 3TNHA 3IPHA 5CEKA 4PQNA 3PJCA 4QTAA 4BBMA 3QHRA 4B7TA 2ITPA 4BDDA 3R2YA 4BKJA 4IB3A 2YACA 3Q5IA 3P79A 3R7EA 1T45A 3PY3A 5CF4A 3OWPA 4YJTA 4UX9A 1R1WA 3ZO3A 3WOWA 3GU6A 4ZTLA 4GJ3A 3BQCA 2BHHA 4RA5A 3H10A 1E1VA 2PUPA 3AG9A 2Y6OA 3QA0A 4EUTA 5IEVA 2LAVA 3GCUA 2HENA 3LFSA 4NW5A 4L00A 1ZYCA 1URCA 3I4BA 1XHAA 3A8XA 4YLLA 3F2NA 3OTVA 3F9NA 1FVRA 3E8EA 4AGCA 3LKMA 2VX1A 3BGQA 3CTHA 5M57A 3BYUA 4CLIA 4D2RA 4FV6A 4UWBA 4XP2A 4ZSGA 3LHJA 4YJOA 1ZYJA 3D5XA 4F6UA 2ZV7A 1H0VA 4RJ3A 4ITHA 4I5PA 1XH8A 5KO1A 3CQEA 4IBMA 3WF6A 3A99A 2VTNA 4ZSJA 3O50A 2UZNA 3SKCA 4AACA 4ZY6A 4FEVA 4O1OA 1BUHA 4UXLA 4BWXA 3RMFA 5CXZA 4CFXA 3UC3A 2QQ7A 4GU6A 5FM2A 5FXQA 3PRIA 4ERKA 3SC1A 1ZWSA 2J0KA 5AADA 3ZSHA 5E9EA 1V0BA 4GFMA 4EJNA 1NY3A 4QO9A 2BAKA 5IMEA 2X2MA 4YC8A 3T9IA 3W2CA 4PL4A 5K3YA 4QP7A 4KRCA 2WD1A 4ENXA 4FICA 5ACKA 1IEPA 2YABA 3EQHA 3HGKA 5AA8A 4U9AA 5M4CA 3EN6A 3FMLA 4GT4A 3CTQA 4QMMA 2CGWA 3NNVA 2XH5A 3K3JA 4QYHA 1OGUA 2PE2A 4XV1A 5GJDA 3R8MA 1PXNA 3PPKA 4ZTNA 2Y6MA 4YJNA 5M56A 3COIA 3R8VA 4L52A 2H96A 4IH8A 3EFLA 4TWNA 3B2TA 3OCSA 2XK8A 2XBAA 3SV0A 4NM7A 5A4EA 4JBPA 4U45A 4FNXA 3N4VA 5CEPA 4EH7A 4HYSA 5L6WL 3NWWA 4FSUA 4EZ5A 3N9XA 3PXZA 4OTDA 3FY0A 4RIOA 4U0IA 3SXSA 2XNPA 3QRUA 3F2RA 3VULA 3WIGA 5L8LA 3LQ3A 5ANEA 4L7FA 4H3QA 4ZY5A 1FBNA 3QLFA 3VHEA 3ZXZA 4UMUA 4FMQA 3VUTA 4EWHA 4AA4A 4M3QA 4YZMA 5IMXA 5A4CA 3QZFA 2BHEA 2X39A 4WT6A 3SQQA 4NU1A 1P5EA 1YDRE 3CQUA 3UIXA 3M1SA 2VNWA 3TNPC 2YA9A 3G9LX 1REJA 4R6VA 2ZAZA 4O2PA 4A7CA 5HO6A 4FUYA 5AP5A 5H8EA 4C36A 3QCQA 2C3KA 2GU8A 3ERKA 4FKIA 5AP1A 2YITA 3ORKA 1ZOGA 2W4KA 4ZLYA 5HLPA 4IIRA 3UOKA 5JMSA 3P0MA 4Y85A 3ANRA 1RJBA 4R5SA 4AZWA 2W9ZB 3FLNC 3F69A 4RWKA 2Q0NA 1YKRA 4QT1A 2QR8A 5HI2A 4D55A 4CFFA 3N4UA 2YM5A 3QTUA 4W4XA 4EOQA 1F5QA 4GYGA 2VZ6A 3QUPA 4AUAA 4I6HA 5EKOA 1LPUA 3QXOA 2XKCA 2IG7A 1PMNA 3MPTA 4IANA 3I5ZA 4O0WA 3R9RA 3IW7A 5CENA 5AM7A 2WOTA 4Q9ZA 3ZUUA 3PP0A 3KCKA 4FKRA 2OJFE 5DBXA 3VS5A 2ZOQA 3RBWA 4IVCA 4RWJA 2G15A 4O38A 5AM6A 1KUTA 2UW7A 4C2WA 2ITNA 5AP0A 4TNBA 2VTAA 3D5UA 5AV2A 4F7NA 1M14A 1YRPA 3H0YA 3PVGA 4L3PA 4W4VA 2QHNA 2VTSA 5K4JA 5F20A 2BTRA 4BDCA 1PXPA 2VU3A 3BGPA 4YJUA 3O8PA 3KVXA 3HKOA 2W1EA 2C6EA 4FX3A 4IAFA 2FUMA 4D5KA 2JKQA 4CTCA 2E9UA 4FNZA 3SOCA 5K0XA 2XB7A 3GEQA 4K8AA 2VTHA 4KKGA 2RIOA 4BCJA 3OWLA 3FC2A 3PDTA 2VWBA 2X6EA 4FTQA 3ULZA 5JGDA 4IZ7A 5EDQA 1V0PA 1CTPE 2C5VA 2PVFA 3NUUA 1AQ1A 3VUIA 1GZKA 1JAMA 5FEQA 3P86A 2XCHA 2VTOA 3EQCA 4HPUE 4M67A 3T3VA 3RZBA 3S0OA 1GAGA 4CXAA 2UW3A 4QPSA 4QMYA 4ZSEA 4R3PA 2CNQA 5C4LA 4CRLA 4GV1A 3PRFA 3H9RA 1Q62A 1UNHA 1YVJA 2VTIA 3C5UA 5G1XA 4B9DA 4F4PA 1G3NA 2YIQA 2YJSA 4TYGA 2P55A 3KRXA 3QU0A 1UWJA 2ZB0A 5CU6A 3TTIA 3EN9A 4JX7A 1PY5A 4ANQA 3I1AA 2XNNA 3FQHA 4BDEA 3UVQA 5GZ8A 1ZOEA 3R7GA 2ZV2A 4AFJA 5BVDA 4TZRA 4YHTA 2CHLA 2WGJA 4UXQA 1XBBA 4LGGA 1JSVA 3F5PA 4X3FA 2CKOA 2PVLA 3QZIA 4GT3A 4M12A 3RM7A 5HBEA 3GU7A 4MQ2A 2IWIA 3GBZA 3Q4TA 3GCVA 3ZO1A 2YM4A 2BRBA 4AW2A 3D94A 3ZBXA 2X4FA 3BE9A 4XBUA 1Q41A 4XJ0A 3ALNA 4G3EA 5HLNA 2V5QA 4XP3A 1P2AA 3D83A 3FZSA 4O7ZA 4MCVA 2G2IA 5C8KA 4QNAA 2ITVA 3P23A 4KBCA 5EHOA 3U54A 1K9AA 2GSFA 2BPMA 3IW8A 1AD5A 2F57A 3DNDA 3EIDA 5JKGA 3EQDA 3KU2A 2AC5A 4YTHA 5FWKK 2A19B 1G5SA 3R21A 3HVCA 3C5IA 3KMMA 4BR3A 4IXPA 4WNKA 3UIMA 4FZFB 2RKUA 2ITQA 3WYYA 2VV9A 2F2CB 4FIGA 5HICA 1JSUA 4DEBA 1YWNA 3GC9A 3QX4A 2UVXA 4L53A 3W33A 4AX8A 2RFDA 4JBVA 2UZDA 3CGOA 4PMPA 1CSNA 4U44A 4AP7A 4C37A 3QWJA 5IUIA 2XYUA 4JI9A 1ZAOA 4HYHA 2Z8CA 1GZNA 4IZ5A 4RLKA 4TRLA 5AR5A 4FZAB 3NX8A 2X9FA 3MB7A 3BYOA 4ACGA 1H01A 3MVJA 1XBAA 4K18A 5L4QA 3VC4A 4ZZOA 5HD4A 4G31A 5DWRA 4GSBA 4RFMA 3QQKA 5EYKA 1M7NA 4PPBA 4RRVA 4O0TA 3NEWA 4O1PA 3CY2A 3FI4A 3LCSA 4II5A 3TZ7A 2O3PA 4D2PA 5LARA 3RAHA 4I5HA 2EUFB 3H30A 4IMYA 4G3CA 4I5MA 5DIAA 3JR1A 3UNKA 4QYGA 3GVUA 3A4OX 2BALA 2J5FA 5EFQA 2WIPA 3R7IA 4DG2E 5IQIA 3PVUA 3NW7A 4IDVA 5CSVA 5CZIA 3VBXA 4F1OA 2YZLA 4EKLA 2H8HA 3VO3A 2WTCA 3PLSA 5DT3A 5CX9A 5AV0A 3GXLA 4NCTC 4P5ZA 3OCBA 4IAZA 4OTFA 1L8TA 4LV5A 3WARA 4QQ5A 1WMKA 3OXTA 3AT4A 5EH0A 4GW8A 4QMWA 3QTWA 4UALA 3HRFA 3DXPA 1DAYA 2LGCA 4QQCA 5DH3A 3TJDA 4EH3A 2X0GA 1KOAA 2WEVA 3FSKA 5KMMA 2VWIA 2ZV9A 4UV0A 1VR2A 4EK4A 3SRVB 3LW0A 4O27B 4Y46A 3U6IA 3II5A 4IVDA 1CDKA 3DFCB 4XX9A 4HVGA 2GNLA 2VTMA 4FTUA 2XK4A 2XK9A 2RF9A 3MJ2A 5F94A 2IZUA 3ZCLA 3P08A 3R8LA 3RPYA 4I6FA 5BQ0A 3RPVA 4FVQA 2QI8A 5J9ZA 5FUTA 5AUVA 1ZZLA 3ZDUA 4FSYA 4F08A 3HUBA 2OXDA 3EOCA 2OO8X 3GFWA 1ZZ2A 2C5OA 4CFVA 5E8WA 1B6CB 1BLXA 3BHUA 1OIUA 2QOHA 3C13A 4G3DA 4O2ZA 3UVPA 1O9UA 3C50A 2YCRA 4FV0A 3O7LD 2IZTA 1XH9A 2YAKA 3GNIB 4RC4A 1FINA 2EXCX 3HV7A 4M66A 5AUTA 3MVLA 3AC3A 3DT1A 3RNYA 1QPDA 4X3FC 1KE5A 4KKHA 4PL5A 1ZXEA 3POZA 4QQTA 3RAIA 3ODZX 2JDSA 3UPZA 3WF9A 4Z9LA 3F66A 5AUUA 1B38A 3PIZA 4O6EA 4PY1A 3ZO4A 4ZTHA 1REKA 3VWAA 4EH4A 4N70A 3DK6A 2GCDA 4ZTSA 4LV8A 4A06A 4J95A 2AUHA 3SHEA 4AQCA 4FV2A 1XJDA 4DE4A 2HYYA 4FG8A 4I24A 4IWPA 3FAAA 3ENMA 2Y0AA 3QWKA 4EEVA 2IPXA 4PDSA 1UKHA 5K9IA 3MTLA 4YO6A 4KIKA 1UNGA 4E6DA 2ETKA 4TXCA 3RHKA 2WB8A 3IOKA 5CYIA 3PIYA 4E6AA 2QURA 2ZB1A 5BVFA 4IAKA 3DBCA 3ANQA 5CI7A 2PZYA 4KUJA 2QKWB 3NPCA 3UOLA 2W17A 5FP6A 4YJQA 4LG4A 4I20A 5HESA 1SNUA 5CS6A 3TV7A 3FQEA 4HZRA 4O7VA 4Q5EA 4JIKA 4RJ6A 3WF5A 4PP9A 4YZDA 3QZGA 4O7WA 3AD4A 4O91A 1GIIA 3WZJA 1PHKA 4O7RA 3VBWA 2FSTX 2OF4A 2JAMA 2QOOA 5AR4A 2B1PA 2QVSE 3L8SA 4CYIA 4KIPA 3VBQA 2PVMA 2WQOA 4FSQA 4U3ZA 4BCNA 1B39A 1H8FA 1OMWA 3KN6A 4J96A 5C01A 2CPKE 3FI8A 4YJRA 3QYWA 3VVHA 3HMIA 5FTOA 3S00A 2G2HA 5CU4A 4NSTA 4BYIA 5F9EA 4EZ7A 3PJ1A 4C57A 3FLQA 3VS4A 3UPXA 2BZKB 2OSCA 4JX3A 3OY1A 4WBBB 5BPYA 3P7BA 2G1TA 2B54A 4RIXB 3MA3A 3QFVA 4XG9A 1YWRA 5DEWA 5FD2A 3JY9A 5FQDC 3MWUA 3SDJA 3VQHA 1WVXA 2OU7A 5C9CA 4PPAA 1JKTA 2J50A 4GIHA 4AFEA 4NK9A 4DGNA 4HOKA 4AT5A 1ZARA 4EZ3A 4RIWB 4FZDB 3TIZA 2QHMA 3NDMA 3R01A 4DT9A 1NT2A 3AC2A 4KA3A 3PPZA 5EHYA 4R7HA 3V51A 1A48A 4FEWA 3OCTA 4L45A 3V6SA 4DHFA 4F9WA 4FNWA 4TWCA 4KB8A 1OPJA 2I0HA 5LVMA 1TQIA 3BGZA 4PP7A 5JN2A 2GQSA 2HZ0A 1WBSA 2O65A 3LCOA 4ANOA 5IF1A 4FNYA 1DI9A 4Y8DA 4WOVA 5AIKA 5KKRC 4MK0A 3HLLA 5D41A 1KE6A 4IB1A 3VBYA 4EOKA 5DR6A 3CEKA 3NCGA 4I22A 4FEUA 4DINA 2UZBA 4EONA 2WQMA 4E5AX 1YW2A 2W0JA 3M42A 5KCVA 1NVSA 2E9OA 4Y72A 3AXWA 5EM7A 3MVMA 4O0XA 4DGMA 3CLYA 5AIRA 1S9IA 2CMWA 5IQCA 4Y95A 4YC6A 4D1ZA 1H07A 3OD6X 3W8LA 5HBJA 3FZOA 3SD0A 2CN8A 1GNGA 5TR6A 4YMJA 2WAJA 5F95A 1ND4A 4R3RA 3NSZA 4I23A 5FRIA 3VJOA 2WQNA 2ZM3A 1SZMA 5JGAA 2OK1A 4QP9A 1OKZA 3QTIA 2EB3A 3UZPA 5JRQA 4FG7A 5KMLA 3BWJA 1OBDA 3CS9A 4CV8A 3R9NA 4Z55A 4EOSA 1UNLA 3KGAA 4CRSA 5KHWA 2IO6A 4F6SA 3E64A 5CF8A 3W18A 3Q5ZA 4Y83A 3RINA 3DBQA 4JS8A 3V5TA 4HGTA 3F3VA 4OT6A 4RFYA 3JUHA 4J71A 1J7IA 5EM8A 5BVEA 4L68A 1Q97A 4CFWA 1L3RE 4WRSA 4ZZMA 3GP0A 2X8DA 2P2IA 3IDCA 3Q9XA 5C4KA 3ACKA 4JNWA 4LRJA 4NJDA 5ETCA 2WO6A 3QBNA 1M2PA 3ZU7A 4D4YA 3L9NA 4X6RA 4MYGA 3ZM4A 4K33A 2HOGA 2C6IA 2FSLX 2UW0A 3OCGA 4U42A 3QUDA 4C3FA 2OLCA 3G2FA 4YBJA 5BVWA 3C0HA 4H39A 3R0TA 2R3RA 4L3LA 4J8MA 3N4TA 4MXCA 3NS9A 4X2NA 4UMRA 4I41A 3H3CA 3QRIA 5HE0A 3A62A 4BFMA 2WNTA 4JLCA 4KABA 4RJ7A 4QTEA 5C1QB 5HORA 5IU2A 2ZDTA 4PRJA 2C6TA 3E7VA 4HZSA 4UYAA 5BYZA 4WUNA 1OIQA 4RPVA 3PSDA 3QD0A 5BX0A 4RIYA 1Q24A 5AP3A 4CMTA 3V01A 3KCFA 2XNEA 2WQEA 5DA3A 3LMGA 3D4QA 5L2SA 4G5PA 4NUSA 2B55A 3DV3A 4U3YA 4EYMA 4FEXA 3ROCA 4C3PA 5BVNA 3COKA 3OWKA 2R3NA 4FSWA 5CSPA 5ICPA 4D4RA 4IACA 4FT0A 3BWFA 4ZSAA 4D5HA 2CLQA 5KBRA 1SVGA 3MDYA 2R3QA 2RGPA 3I79A 4FL3A 5HU9A 4FYNA 1BI7A 5JFWA 3LM0A 2JIUA 3DBFA 1Q5KA 2CKEA 3LIJA 4F0GA 3C4FA 4RVTA 5FGKA 4AGUA 4ID7A 3O71A 4DAWA 2YERA 4O7SA 5BUIA 4IVAA 4WRGA 1IA9A 2BDWA 3CY3A 3FQSA 4KIOA 2V55A 4I4EA 4CZYB 4O6LA 5HD7A 3UOHA 4M15A 4FTIA 2GNHA 5DNRA 3FSFA 3TV4A 3ZUTA 5E1EA 5LMKC 2PMIA 4XP0A 4TYHB 4IEBA 2FGIA 2J5EA 4C4IA 4CLJA 2VGOA 5TE0A 3W8QA 3C4XA 2XK7A 2GQRA 3E62A 4JDJA 2Z7QA 2X2LA 3DFAA 4DT8A 3L8PA 3EL7A 3EQGA 3PXFA 4BDHA 3QTZA 3F3UA 4AE9A 4GK2A 3UQCA 2UW9A 4I6QA 3RPOA 4WHZA 2XJ2A 3GGFA 4EOOA 1I44A 1OITA 1Z5MA 3CIKA 5FDXA 4WBOA 3QRTA 3KXXA 4F9YA 4ACHA 2ZMDA 4JL9A 2QG7A 1STCE 3D7TB 4AW0A 1LP4A 4JDIA 4IADA 2WEIA 2W1HA 4BY9E 4ZS0A 4DEAA 4F0FA 4FTCA 4QTDA 4CMUA 4KS8A 3CQWA 4ZJIA 5L2QA 3HRBA 4HYIA 3U87A 4KSQA 1KE7A 3LQ5A 4WNMA 2PYWA 3E3BX 3ZFYA 4D4SA 5CAPA 1WBWA 2WPAA 3OFMA 4IX3A 5AMNA 5DR2A 3WZUA 3H0ZA 3JPVA 5CNNA 4ANBA 2XRUA 2XCKA 4E8AA 2UZUE 3TV6A 5C8MA 3IGGA 5JGBA 3FMMA 5IPJA 5D7AA 4DFXE 4L7SA 5J8IA 1JKLA 2X4ZA 4RZWA 4X21A 4DEIA 5HHWA 4AOTA 3QGWA 5J7BA 2JBOA 4F0IA 2JITA 4MF1A 3BLQA 5EI2A 3ORPA 3V5QA 1A9UA 3U55A 3G6HA 4GFOA 5CEIA 2G9XA 3PXKA 2P4IA 3ATSA 4FTMA 4MNFA 5KUPA 4ANNA 2J0LA 3WZKA 3IDPA 4WA9A 3COMA 5E8UA 3GQIA 3WILA 4BZNA 2XNBA 4RA4A 3B2WA 5CAVA 4XOYA 2QOCA 3ZMMA 4FT7A 4ZOGA 3SOAA 4DLJA 3AC8A 3GU8A 3V8WA 4DBNA 1VYZA 2CGUA 2HCKA 4FTTA 5KZ0A 1OUYA 4MD9E 3MB6A 4BDGA 5J79A 4XLVA 2VX3A 4V01A 3ZFMA 2I7QA 2I0VA 3DKOA 4QRCA 2IJMA 4IAIA 5K0KA 2XM8A 5HG5A 5AUYA 3UBDA 1OL6A 3AOXA 3UQGA 3GU4A 4RC3A 2JKKA 2BCJA 3BU6A 3NGAA 1CKIA 2OBJA 1U54A 2W1GA 5IQFA 2UZWE 4DITA 3OW3A 2WKMA 3V5WA 4CFNA 4D0WA 4FTRA 4F7SA 3G51A 2YIXA 4ZEGA 4BWKA 5CI6A 5CSXA 5DT4A 5HGIA 2W4OA 3DTWA 3UNZA 4CG9A 3JVSA 4RC2A 3O96A 4EH8A 2UW8A 2FB8A 2YISA 4EI4A 2J7TA 3EN4A 2B4SB 4C62A 4QMUA 3ZLXA 4G3GA 4RJ4A 2DQ7X 2J2IB 5IA4A 4RJ8A 3GC7A 3NW6A 4BCGA 1PXJA 5CVFA 4YSMA 4QMQA 4CT1A 4O7LA 2X1NA 2VTJA 4M14A 4G6LA 4DH1A 1OL5A 2B9HA 3FHIA 4MF0A 4YO4A 5BUEA 3DK3A 5L2WA 2R3GA 2WZJA 4OLIA 2XKFA 4LOQA 2YM7A 4NJ3A 5ANIA 3V04A 4V05A 3UE4A 4ZTMA 2Y7JA 4G9RA 2WMRA 2EXMA 1PJKA 3MJ1A 3P7CA 5I9UA 5KE0A 5A14A 3KC3A 4ZSLA 4BDFA 4L46A 5HCYA 2PZPA 1OI9A 3VBVA 4L01A 1QCFA 3BPRA 3I7BA 4OBPA 5AV3A 5E8YA 3ZDIA 1U5RA 2OG8A 4W4WA 4F63A 5H9BA 1JPAA 4YZ9A 2E9VA 4FKQA 5HX6A 2XKDA 5E8XA 4D2VA 3P7AA 3RK5A 3WYXA 5IQHA 3Q9ZA 4E4MA 4OAVB 2VWYA 5CF5A 4K6ZA 4RX9A 3ZEWA 3EMGA 3R8ZA 4K77A 3MN3A 3F3WA 1UKIA 4O7YA 4CNHA 4FIJA 2J9MA 3JY0A 1V1KA 2F9GA 2OIDA 2X2KA 4I21A 4BCMA 4MX9A 3G0FA 4LRKA 2XIRA 4M69B 4O82A 3FLSA 4U41A 4IX5A 4FV1A 2JKMA 3R7VA 4ASEA 4N57A 4C4HA 1ZMUA 5CT7A 4Q5HA 4AXAA 5B2LA 2YFXA 4GUEA 2YIWA 5AAEA 3BV3A 3ZLYA 2C6OA 5DEYA 2A1AB 3FYJX 3NIZA 3O8TA 4MWIA 2WTVA 3OMVA 3AC4A 4MNEB 2AC3A 2XRWA 5D12A 3W55A 2Y4IB 3T9TA 4AW5A 4I0SA 3FEGA 1RDQE 3HV6A 1E9HA 3MFTA 4O0VA 2IVTA 2XMYA 2YEXA 4HGSA 3PZEA 2IW6A 4DCAA 3WE4A 5HVYA 4ZY4A 2JLDA 3BELA 2P0CA 4G3FA 4YHJA 5ANKA 4TPTA 3VS2A 2BILB 2XNGA 5HTBA 5IG1A 4TWOA 3TL8A 4E5BA 2JIIA 5J1VA 5AR2A 3KA0A 4H36A 4WD5A 3UIUA 3UP2A 3Q4ZA 3ITZA 4BKYA 2PL0A 3E3PA 2PZIA 5BYLA 3BV2A 2YJRA 3IW6A 3LFCA 4NW6A 4MD8E 3DB6A 2BDFA 3PSBA 3ZRMA 4A9SA 4A9YA 3C9WA 3LE6A 4JDKA 2ITXA 5AP7A 1PKDA 4M8TA 5C27A 3WI6A 3MPAA 1OECA 2UVZA 5LVPA 3TNQB 5HTIA 1FPUA 2RG6A 5FXSA 1HCKA 1CKJA 4CFUA 3QQUA 4XV9A 3CJGA 4GKIA 3FJQE 4OTHA 3AGMA 3TDVA 3QQLA 4NCTA 4NTTA 4R77A 5AUWA 3W2QA 3ZSGA 4DEEA 1Q8UA 3E92A 5GJFA 2UV2A 5E90A 3HA6A 4LGDA 3G33A 4F1TA 5JT2A 2W1CA 3AD5A 1RE8A 3GOKA 4QP2A 5EW3A 5T68A 4BI2A 3HDNA 3E7OA 4IWQA 4X2GA 5BVOA 2YM3A 2QO9A 4KD1A 4CTBA 4RT7A 2FVDA 2X9EA 4NKSA 4QP8A 1H1RA 3NUYA 3HV3A 4J1RA 3Q32A 4ARKA 4FV5A 3FWQA 3GC0A 4ZMFA 4FF8A 4UYNA 1OB3A 4O0RA 5D9HA 3CD3A 5F1ZA 3DBDA 3MW1A 2R2PA 2RFSA 4RFZA 4UZHA 1ZYLA 4M0YA 2PY3A 5EYMA 2PUNA 1ZOHA 3A2CA 3Q3BA 4WG4A 3OHTA 1UU3A 4YBKA 2ERKA 3P9JA 3D5WA 4DF3A 4FKJA 1EH4A 1AGWA 4BI1A 2I40A 5JFSA 3FMDA 2ZMCA 4J53A 5IDPA 3REPA 1H27A 4BIEA 5A6NA 4L42A 4MBIA 3PWYA 1WFCA 3K5VA 2VRXA 5DGZA 5I0BA 4C33A 3UMWA 1PF8A 3K54A 2BZIB 4QMOA 5CEMA 3G9NA 1J1BA 2PVHA 4FKTA 3E8CA 5ANJA 5IA2A 3HAMA 1IG1A 4O0UA 3JVRA 3HDMA 3HMNA 4OTQA 2BIYA 3UO6A 3W1FA 1UU7A 2C3IB 4AA0A 4GS6A 4RQVA 4O0YA 4CCUA 3VW6A 4DH7A 2HWOA 5IUHA 2BMCA 3NYOA 2VTLA 2JDOA 3A7GA 3Q9YA 1H1PA 4CD0A 3NYVA 5IKWA 2Q83A 1HCLA 3I60A 4JR7A 5CVHA 2I0EA 4B4LA 2R3PA 4EWQA 1IAHA 4BIBA 4XG7A 3RK9A 3DDPA 3KEXA 3MPMA 4RX5A 5IEYA 4B6LA 4UMQA 1FGKA 1BKXA 3RK7A 5HG9A 5AAFA 2PK9A 1H26A 4M0ZA 3ULIA 1W98A 4EHVA 4A9TA 1UV5A 3JYAA 3KVWA 3V8SA 5HVJA 4M68A 2UVYA 3W10A 5FDPA 3OOGA 1KV2A 5CTPA 3WF8A 2C6DA 4ALWA 2BIKB 2G01A 3I0OA 4CT2A 4EH2A 1SVHA 5HE3A 3TEIA 4KKEA 2EXEA 3ZEPA 2C69A 2V7OA 2HELA 3CBLA 3OBGA 4M84A 4M97A 4BF2A 5CVGA 4YZBA 2WTWA 5HEZA 3I6UA 2FA2A 2QLUA 5AV4A 1U4DA 3ODYX 3S95A 2CLXA 2ITUA 2Y9QA 2REIA 3EJ1A 3W32A 5IISA 4ENYA 1G8AA 3C4EA 4DEGA 5AJQA 3NIEA 5CU3A 5GIPE 4X2FA 4K11A 2X7GA 4Q2AA 3QYZA 4EYJA 4O83A 3BZ3A 4DFYA 3AC5A 3Q53A 3HMOA 3KKVA 2HW7A 4L43A 4NM5A 1PYXA 5D11A 4B0GA 3NNWA 3PVWA 3UDBA 4F9CA 3P4KA 2XF0A 4TT7A 4FKPA 3ZSIA 3FDNA 2UZEA 4YSJA 4FE2A 2PVRA 3EKKA 2RL5A 3MGYA 4FTJA 4EK6A 2YWPA 3OP5A 3U6JA 3FLWA 1XWSA 2R64A 2WMWA 3BI6A 3O17A 2PVYA 4JDHA 4JXFA 1OKVA 1QMZA 1OPLA 4BCIA 3VN9A 4JAJA 2VD5A 3IO7A 4BCOA 5M53A 3M2WA 4I0RA 2FSMX 4IC7A 2YCSA 4U40A 3COHA 2BTSA 1WBTA 2GQGA 4TYIA 4RVKA 3KF7A 4L6QA 3LJ2A 5IH5A 3ELJA 4UWCA 5JH6A 3QD2B 4FSZA 4NFNA 4DBXA 4FI1A 5J5SA 2JKOA 4IWDA 3TJCA 3TNIA 3ZYAA 3QGYA 4FTNA 2YIYA 3R73A 3U4UA 1WVWA 1WBNA 3NCZA 4B99A 3PJ2A 2OWBA 3BU3A 2WELA 4CZUA 4ASZA 3LPBA 3LXKA 5KMIA 4LYNA 3C0IA 3UO4A 3F5XA 4I92A 4APPA 3LJ0A 1YOMA 1YDSE 3CKWA 3RTPA 5CSWA 5BYYA 2GFCA 2YIRA 5DI1A 3PSCA 3QZHA 4LMUA 3DAJA 1CMKE 4KAOA 1Z9XA 3DJ7A 4AZTA 2BRNA 2BAJA 3ZLSA 3LFDA 3BHTA 4V04A 3DAEA 4YLJA 4W9XA 1ATPE 3DZOA 3W2SA 1DM2A 5M55A 4IZAA 4ZLOA 4QMLA 4OT5A 3A8WA 3HP2A 1Y91A 5JRSA 1OVEA 5AP6A 4KNBA 4IJ9A 4H1JA 5HU3A 3BEAA 5DRDA 4YJSA 3A7IA 3KXHA 3V5LA 3UP7A 3DBEA 3SG9A 3EQPA 3MVHA 4AW1A 4EBVA 3QC4A 4EBWA 2OI4X 3UC4A 2J51A 1TQPA 4C02A 1W8CA 5AA9A 5J1WA 4ASXA 3ATTA 3EL8A 4QPMA 3QUEA 1GZ8A 1XQZA 1H1SA 3GCPA 3QRJA 1ERKA 4MTAA 2ZJWA 5E92A 4A9UA 4Z7HA 2O64A 2R9SA 1O6LA 2HZIA 1YHVA 4MXXA 4K0YA 4A07A 4IFGA 3VIDA 3KULA 3QLGA 4FIIA 4MVFA 5H2UA 3BYSA 2QONA 1H4LA 5ANGA 4C4GA 2WU6A 4RJ5A 4IM0A 4IB0A 2DWBA 2OZAA 5I9VA 2PVJA 3D0EA 2VWWA 1KV1A 4EOLA 1Q8WA 5DT0A 3S2PA 4ZK5A 2PPQA 4AT4A 3QCYA 1H00A 2GNJA 4IAYA 4XS2A 4RLLA 3OUKA 4PDOA 4C61A 5J9YA 1KWPA 1H08A 2F4JA 4QP3A 3V6RA 3LOKA 4QOXA 1Y8YA 5GZ9A 3SGCA 2BAQA 4BZOA 3VRZA 3AC1A 4FKOA 4X3JA 4EH9A 5JQ8A 5HTCA 3TI1A 4LI5A 4D9UA 3NVKI 1FMKA 4OTPA 3K5UA 5DR9A 1JBPE 2GHLA 2QOFA 3ETAA 3ZUVA 3DKCA 2J4ZA 1JSTA 4TL0A 2QOIA 4DFZE 5EOLA 2W1ZA 4F09A 2QLQA 2OXXA 4P7EA 5D1JA 4C58A 4C2VA 4I0TA 4C4JA 4DTBA 5AR8A 3TNWA 1NA7A 4E7WA 4HCTA 2WTKB 2JDVA 4ASDA 4EOMA 1QPCA 3KRRA 2QODA 3PE2A 2C5YA 2P3GX 3PXRA 3O2MA 4FV8A 3OEZA 2C47A 4QTCA 3UNJA 2C4GA 3DA6A 3O7LB 4DGGA 2JDTA 2KULA 3SAYA 3EQIA 4TYHA 3DY7A 3W2RA 4N6ZA 4YTCA 4GL9A 2HZNA 3EH9A 2Z7RA 3K3IA 2HAKA 3RI1A 5EKNA 3RNIA 2VX0A 2WIHA 3V3VA 3L9PA 1YXTA 3ZS5A 5CAOA 1HOWA 5HG8A 5HNBA 2BRMA 3FMJA 3THBA 4F6WA 4R78A 3L8VA 4E73A 3VRYA 1APME 1SYKA 2O5KA 3FXWA 4UWYA 3G5DA 3A7JA 2R3IA 4MQ1A 1OBGA 1XH6A 4Z7GA 2JAVA 4RSSA 3FZRA 2IVUA 4CGAA 4QP6A 5CEQA 4AN3A 5HIBA 3MI9A 4JQEA 3ORLA 4GEOA 5FP5A 4D2SA 3IG7A 3HUCA 2DUVA 3KMUA 3PXQA 3VS0A 5LMKA 3R04A 5H3QA 1VYWA 3P5KA 5A6OA 3B8RA 4GG5A 3F7WA 3IS5A 4MXAA 3D7ZA 4C4EA 2R5TA 4DGLC 4V0GA 4FT3A 5IQEA 1O6YA 4YC3A 4PMTA 3R2BA 3JS2A 4FIHA 5EDPA 4ACMA 4D4VA 3RZFA 5H8BA 1YI6A 4U43A 4XG2A 2HW6A 1F3MC 3LFFA 3PUPA 3QD3A 4PNKA 2ETMA 4F65A 4FTOA 5I9XA 3OT3A 2OFUA 4U79A 1YOLA 4QP4A 4CYJA 5IUGA 4ERWA 3Q2JA 5M09A 3GFEA 4JT3A 3BKBA 3HP5A 4R7BA 4QQJA 4TTHB 5EQPA 2C3JA 3I7CA 2XYNA 4K2RA 2WU7A 3C1XA 1W7HA 3IK3A 3R8UA 4S32A 2ERZE 4RG0A 3ORTA 1JNKA 4PV0A 5CZHA 5C8NA 4HCUA 2EB2A 2UW6A 3IKAA 4J7BA 4ANLA 3IECA 3NMUF 2IVVA 2I1MA 2WMVA 4CVAA 2Z7SA 4U81A 2BVAA 5I4NA 2QOBA 4L8MA 1W84A 3LCKA 2YDIA 4XNEA 5HG7A 3VF9A 4AZEA 5JFVA 3HECA 5K4IA 2BZHB 5I3OA 2R0IA 2UZVA 1LEZA 4GH2A 1Q8YA 4KSPA 5E1SA 2XIYA 4F9AA 3C4ZA 1MRVA 3P1AA 3ZOSA 4BGGA 2C6KA 3H9FA 3DJ6A 4GCJA 5DLSA 4EUUA 4HVHA 4ITIA 3MH1A 5AFVA 3BBTB 2ZM1A 1Q8TA 2C68A 4RVMA 4FEQA 4I5CA 4EOIA 2R3MA 2GTNA 5KMOA 3Q2MA 4E6CA 4DG0E 2V62A 3HAVA 1OIYA 1OZ1A 1XH5A 4CEGA 1OKYA 4KBKA 4BC6A 3ORMA 1DAWA 3TN8A 1T46A 2IN6A 4E3CA 2OICA 5EM6A 4FIFA 5A4TA 2PE0A 4FOBA 1YXXA 2YM6A 3NUPA 2XNMA 3W2PA 2JEDA 2JC6A 3Q96A 1JVPP 4PPCA 4S34A 4F9BA 3OF0A 4D1SA 3I81A 5HE1A 3PVBA 2VN9A 3PJ3A 2PTKA 3R71A 3NZ0A 5HX8A 4CCBA 5M44A 2ZVAA 3ZFXA 5IQDA 2W1DA 3D14A 4YNOA 3EQRA 4EHEA 2FYSA 2PUIA 3ZBFA 1YQJA 4FT5A 5DN3A 4C59A 5I9YA 3FI2A 2PVNA 2W1FA 3KXNA 5CQWA 3R22A 4QNYA 4FC0A 3V5PA 4FVRA 1KSWA 3FLZA 2X7FA 3MSSA 4PX6A 5FM3A 3ENHA 3E93A 4PMMA 5HNGA 4CSVA 2VNYA 4I3ZA 4Q9SA 4KIKB 3Q4CA 3SG8A 4L9IA 3FKOA 4FK3A 3RM6A 3QCXA 4PTEA 4S2ZA 4BICA 1K2PA 5CAUA 4FSNA 4F99A 3QQHA 3BIZA 3UJGA 1FVVA 4USFA 2C5XA 2WMSA 5CF6A 5M4UA 3CCNA 4O21A 2C6LA 2FO0A 3LM5A 2GMXA 3LQ8A 4AA5A 3MTFA 4OGRA 1ZMWA 3DLZA 4NYEA 4R8QA 4E1ZA 1YXVA 4LGHA 3VJNA 4BCPA 5ETFA 1GIHA 4KINA 4YTIA 5E8SA 5ACBC 3QQFA 5LOHA 2PSQA 2WMAA 3QX2A 1MRUA 2UW4A 2GTMA 4Y5QA 5AP4A 4W8DA 1DS5A 2QC6A 4BTMA 4YZNA 1R0EA 4EQUA 3EN7A 2NPQA 2YLEA 4IW0A 1ZYDA 4AG8A 1JWHA 2YCQA 4FT9A 3I0QA 1JOWB 1PXLA 4NT4A 3GENA 4IE9A 3PY0A 4ZZNA 1OIRA 2VO3A 5LQFA 3FKLA 3OWJA 4LFIA 5E91A 5J87A 4DLIA 3TCPA 3DU8A 3ROYA 5JEBA 4B8MA 3LZBA 4BZDA 3NRMA 3KQ7A 3RWPA 3H4JA 3TTJA 3W16A 3CP9A 3DXQA 2FSOX 3IDBA 1IRKA 3OZ6A 5EOBA 4B8LA 4O7NA 1U59A 4G34A 4HCVA 3TXOA 2BFYA 2JDRA 3VBTA 3QHWA 4M13A 3GC8A 3MH3A 3BEGA 3UVRA 3TZ9A 4UMTA 4D0XA 3GCQA 2J0IA 3E88A 4QMSA 3T3UA 3PTGA 3NNUA 4FK6A 3ZC6A 4FUXA 4G2FA 3QTQA 4J99A 3QD4A 5ETIA 3VUDA 4DN5A 2ZV8A 5DOSA 4ALUA 3IOPA 5GIOE 3PFQA 4FKWA 4WNOA 3ET7A 4Y73A 3R9DA 3EZRA 1IR3A 1UA2A 4HVSA 2CCIA 2W9FB 3SW4A 3E63A 4N6YA 3DOGA 3BHHA 1ZYSA 3QA8A 3VUMA 2GNIA 3DPKA 3FV8A 4C35A 4DCEA 1J7UA 3ZZEA 2NO3A 1MP8A 3BX5A 1KOBA 4FKLA 1H24A 3IW4A 1IASA 3F5UA 2XIKA 3HZTA 5KNJA 2PU8A 4EQMA 1YI4A 5IH6A 3KRWA 3R00A 5IQAA 2YDJA 4UY9A 4OTWA 1Q4LA 3QCSA 2XJ0A 4U80A 5LMBA 4D28A 4HW7A 2Y8OA 1P4OA 3G90X 5KZIA 2V0DA 3F6XA 4BVUA 5M07A 4K9YA 4E4NA 2JGZA 2E9NA 3GUBA 1GJOA 4JBQA 4X2JA 4DEDA 4EC9A 2WTJA 4G17A 3FZTA 3PA5A 4RMZA 4BTFA 2PZRA 5AWMA 3U9CA 5LVNA 3PWDA 4DFLA 3BCEA 2B52A 1FQ1B 3MYGA 3GCSA 4ZJVA 1I09A 3Q04A 3RPRA 1RW8A 5CLPA 4QTBA 4XBRA 2QOQA 4DTAA 1U5QA 3UGCA 1GZOA 1TKIA 4FV3A 2C1AA 2QNJA 4HGEA 3WIKA 2JFLA 5HIEA 5J5TA 4Y5HA 5CWZA 3CD8A 3LCTA 2XZSA 4G6NA 4EH6A 2B9IA 2ONLA 3PPJA 3OVVA 4FKSA 3R30A 3Q4UA 4Z3VA 3R7UA 4WSQA 1VJYA 4MH7A 4EL9A 3EZVA 4E4XA 2W99B 4OTRA 4W9WA 3OW4A 3AMAA 3NAXA 4C8BA 1H1QA 5KHXA 4P5QA 1J91A 2UZOA 4AGDA 5BNJA 3Q52A 1UU9A 2CKQA 3EWHA 4P4CA 3UODA 4J98A 3JXWA 3FMKA 4NM0A 2XBJA 2W7XA 2ZM4A 3BU5A 3LMHA 3HEGA 4F64A 4R1YA 3FPQA 3PIXA 3DNEA 3VNTA 5I5ZA 1MRYA 4FZ6A 4D2TA 2XS0A 3OROA 3UYSA 2WXVA 3NNXA 4PL3A 2HXLA 3MESA 3LFNA 4J52A 3LLAA 3TM0A 4YHFA 1BX6A 3KF4A 5L6OA 5GINE 1OL7A 4GK4A 4U97A 2A4LA 5A4LA 4JAIA 4CKJA 5EM5A 4FODA 3O51A 4RIYB 3BRBA 5FG8A 4F1MA 5KMJA 1H28A 4G16A 4W4YA 5E8TA 5A54A 3HNGA 3R1QA 4XV2A 3VS6A 4GT5A 3SVVA 4RZVA 3UO5A 3ZLWA 2Y4IC 4EKKA 3T8OA 3KMWA 4J97A 2WMBA 4TYEA 5JK3A 3HMPA 5L8KA 4RX7A 1YI3A 3TDWA 5CALA 5HCXA 5E7RA 2OIQA 3C7QA 1JQHA 1URWA 5D7VA 4LL5A 3WE8A 4ZS4A 4E5WA 1FVTA 3MV5A 3FL4A 4JVGA 4JJRA 2PULA 2OJIA 4E4LA 4S33A 5TF9A 2CKPA 2B9FA 2YDKA 5EDRA 4UN0C 2QOLA 2J90A 2QKRA 1DI8A 3DK7A 3GOPA 3L8XA 3GT8A 1MUOA 4LL0A 4XLIA 2PE1A 5L2IA 4G1WA 4GMYA 3R7YA 5K5NA 3UOJA 2KTYA 2OIBA 3VF8A 2CCHA 2B0QA 4CQEA 5LVLA 5BMMA 3IONA 1PMVA 4YURA 4K1BA 3DXNA 4NEUA 4NIFB 2PZ5A 4OR5A 3UIBA 3FUPA 2WHBA 4BBEA 4XG4A 4GRBA 4D58A 5M4IA 3QL8A 5ANDA 4O7TA 3HV4A 1XBCA 4FYOA 4L67A 3LMIA 4PDYA 3F3ZA 4FSMA 5B0XA 3V8TA 4ANMA 2BUJA 4LMNA 4YU2A 3ZO2A 3QALE 4JQ7A 3VQUA 3ZHPC 1GIJA 1SNXA 4G6OA 3E8DA 3NYNA 4FKGA 2WMQA 3AMYA 3DQWA 3LFAA 3DQXA 3MIAA 3OY3A 2VWZA 4GVAA 3SLSA 5FTGA 3SRVA 1BI8A 3QF9A 4WG3A 3PLAE 5BUJA 3P78A 4NM3A 3CPBA 3AQVA 2C1BA 2J6MA 5EHLA 4AS0A 4CFMA 4AE6A 3UG2A 3TKUA 3R1SA 4WKQA 3NUNA 1MQ4A 3U6HA 4EH5A 4YR8A 3PZHA 3L9LA 4GYIA 4N4SA 2BKZA 3R1NA 1G8SA 2XNOA 3R8PA 4C0TA 4PMSA 4EOPA 5FLFA 2VO7A 2VAGA 2YHVA 5AP2A 1WBVA 2ITYA 4S30A 3UYTA 3UTOA 1P4FA 5AR3A 4ZJJA 3CTJA 4OBQA 4DTKA 4BBFA 4GFGA 3F5GA 2PHKA 3EKNA 5A3XA 2ONLC 1PW2A 5JFXA 3EFJA 4H3PA 1WCCA 3ACJA 3FMEA 4FG9A 1J3HA 2C6MA 4AN9A 1SM2A 3KXZA 5AV1A 1PXOA 2O8YA 3CXWA 4AOIA 4PTCA 2EWAA 4FV4A 2R3JA 2J0JA 3BHYA 1JLUE 4QMNA 3FMNA 5I9WA 2HZ4A 5IA0A 3EYHA 3LFEA 5DE2A 4R5YA 3OOMA 2QR7A 4O86A 2AYPA 3DDQA 1KE9A 2B9JA 4G5JA 4AZSA 4P2KA 4XOZA 5L8JA 3CR0A 5LVOA 4D9TA 1UWHA 4I94A 1PXKA 1ZY5A 3N51A 4JBOA 1W83A 4UZDA 3ZH8A 4IHPA 3QXPA 3FC1X 3MY1A 1U54B 3E5AA 5DG5A 5L2TA 5CT0A 4LRMA 3TIYA 3WZDA 3CKXA 3LCDA 2GHGA 4ONAA 3UZRA 2VWUA 3U51A 4ZTRA 3D15A 4JG7A 2JD5A 4BHNA 1RQQA 3KRJA 3SXFA 1NVQA 2XIXA 1Y8GA 3AT2A 3ORXA 3D5VA 2E9PA 4EHGA 1WZYA 4IQ6A 1PYEA 4FIEA 4WG5A 3F2AA 3ORNA 3TT0A 1W82A 1IA8A 2OJJA 2UZTA 4MXOA 3NYXA 4LUEA 2EVAA 4ZIMA 3VUGA 2W5BA 3GQLA 5CASA 5CXHA 2QD9A 4CV9A 3AD6A 4UMPA 2ITZA 4HGLA 2GFSA 2C0IA 2VTQA 4I93A 5AR7A 4BDAA 4E93A 4IX6A 2CN5A 5EW8A 4DYMA 1BL6A 3MH2A 4ACCA 5B2MA 1YOJA 2NRYA 2V7AA 4L44A 4P90A 5HBHA 4JOAA 3RVGA 4USEA 5HLWA 3IQ7A 4FGBA 3KFAA 5CANA 2F7XE 4WIHA 2PMNX 3DB8A 4ANSA 3HL7A 3D2IA 2A2AA 4R7IA 4PNIA 2X8EA 4IWOA 4EK8A 5JZNA 4RIXA 4ZAUA 2WFYA 4FR4A 2W1IA 5CSHA 2OFVA 4KS7A 4BI0A 5CU0A 3TZ8A 2VO6A 3QKKA 4JRVA 4DFBA 3C4WA 1U46A 2OKRA 3PXYA 3VW8A 5HNIX 2R3OA 3OEFX 2C5NA 3KN5A 4H58A 1UVRA 3I6WA 2W05A 5ITAA 4XG3A 2ACXA 4X2KA 4JRNA 4RIWA 5B7VA 1W0XC 2C0TA 5BVKA 3TKIA 4BGQA 3ZZWA 4HVDA 3A61A 4FOCA 2GPHA 3R28A 4ZTQA 4UEUA 3SW7A 4E6QA 4EORA 2YLFA 3AT3A 4NKAA 3QKLA 3AGLA 2F2UA 2BRGA 4GUBA 3OXZA 2GNGA 3SA0A 5CAQA 4J8NA 4LOPA 4DFNA 3PJ8A 1H1WA 5IEXA 4YPSA 4XHKB 4G9CA 1OL2A 1M2RA 5KMNA 2X8IA 3MY0A 3DKFA 4YJVA 1PMUA 3NUXA 1R78A 5BMSA 3FKNA 3LVPA 1KE8A 1Q8ZA 2BROA 3FL5A 2RFEA 1YDTE 3LJ1A 3MBLA 1J7LA 3A4PA 2H6DA 3FI3A 4IZYA 3MS9A 4X0MA 2GHMA 4BWPA 3WF7A 1R3CA 4HPTE 5TOZA 2A27A 2YAAA 1Z57A 3AMBA 3HV5A 2ITWA 3DZQA 1CM8A 4PF4A 5HKMA 5AEPA 5E8VA 3CSVA 2XUUA 1XH7A 4A4OA 3QKMA 3C51A 3FYKX 5IA1A 1M52A 4O81A 1Q3WA 3BYVA 5L3AA 1R0PA 4GJ2A 2CJMA 1WAKA 3Q6UA 5IQGA 2WMXA 4QYEA 4LOOA 5IDNA 4AOJA 5GNKA 2OH4A 4WO5A 4Z16A 3DGKA 3NUSA 5CU2A 2XM9A 3LFQA 3ZONA 1OM1A 1Q99A 4IFCA 2VWXA 2IW8A 5J9LA 4MHAA 2QO2A 4FV9A 3U4WA 1GOLA 4BTKA 2PMOX 2UUEA 3TKHA 3ZC5A 3DAKA 4W8EA 4NH1A 3RPSA 2ESMA 3LFBA 4BCKA 5EK7A 2NNWB 4AGWA 5GZAA 5IA5A 2VTTA 4EJ7A 3UQFA 4OUCA 1NVRA 5EI6A 5M06A 2XJ1A 3OBJA 5J7HA 5E8ZA 2ZYBA 3I5NA 4I6BA 3FZ1A 5EYCA 4AN2A 4BYJA 3B8QA 3FE3A 4BHZA 4R3CA 5FEDA 4U7ZA 2F49A 2W5HA 3RAKA 2ITTA 5D10A 4S31A 1K3AA 3C0GA 3G0EA 3K2LA 4RBLA 4X7QA 2BZJA 2NP8A 4BDIA 5KBQA 2HIWA 3RJCA 4CQGA 4DGOA 4BDBA 3PY1A 1P14A 3CE3A 5A4QA 4N0SA 5JSMA 2XA4A 2Q0BA 5IQBA 4KIQA 2Z02A 2C30A 2UZLA 1NW1A 4RWLA 3TWJA 2WTKC 3EB0A 2R3LA 2HXQA 4OTIA 4QYYA 4X6QC 3QTXA 5DPVA 2Z60A 5A9UA 1VEBA 2OH0E 4H3BA 4FTLA 5TKDA 4BRXA 5M4FA 4RVLA 2BDJA 1OKWA 2ITOA 4QD6A 2OGVA 4U6RA 5T6KA 4BN1A 1WBOA 4PWNA 4X3FB 4C7TA 4XRLA 5HO8A 3R7OA 3FXXA 2PMLX 4WNPA 5CY3A 1M7QA 3D9VA 4AU8A 3KB7A 5CNOA 4TW9A 4CKRA 3QAME 5EYDA 2YWVA 4YTFA 1H25A 2IZRA 4TNDA 3FXZA 4JG8A 3EHAA 2HK5A 3BBWA 5HQ0A 4GKHA 3GI3A 5DVRA 3NW5A 2RG5A 4O0SA 4DH5A 1J1CA 4KRDA 4D1XA 3R63A 4HNIA 4U8ZA 3MFRA 2IVSA 3OXIA 4E20A 4OAUC 2DS1A 4YNEA 5GHVA 4RWIA 3E8NA 1CKPA 4IM2A 5HO7A 1YXSA 4HVIA 3R9OA 3ID6C 3NR9A 2PWLA 3HMMA 4FTAA 4H05A 1ZLTA 3MA6A 3F7ZA 3WZEA 3CPCA 4M7IA 3S1HA 2ETRA 3Q6WA 2CNUA 3SX9A 3U8WA 1PRYA 3TG1A 3QTRA 5IZFA 5DRBA 4KWPA 4FL1A 3HA8A 1PKGA 2HWPA 4ORKA 4HYUA 3CC6A 4MKCA 4L3JA 2WOUA 4PTGA 3FMHA 4QMXA 1PXIA 5GJGA 3KXMA 3KRLA 2J0MB 3E87A 3PA3A 4LM5A 4BIDA 1LUFA 4DC2A 4BGHA 4EOJA 2WQBA 3A60A 1VZOA 3G6GA 3OG7A 3ZRKA 4ZMEA 1LEWA 3CJFA 3O8UA 2R3FA 4USDA 3TZMA 3ZRLA 5HZNA 2PUUA 3D7TA 4MEDA 1PXMA 3QTSA 4QMTA 2RFNA 4ITJA 5AUZA 4U5JA 4O22A 3PE1A 4DH8A 5A46A 3FLYA 3ZM9A 2XK3A 3Q9WA 3UMXA 3FBVA 4NWMA 4C4FA 4QYFA 4OTGA 4QMVA 4HNFA 4YZCA 2CDZA 2HY81 2Y4PA 2BRHA 4NTSA 3VUHA 4DA5A 1ZRZA 3PG1A 4XMOA 4XYFA 3PA4A 2OXYA 3BE2A 1F0QA 5M51A 2OF2A 3LXLA 4BCQA 2X6DA 3CGFA 4O84A 1WVYA 1R39A 2YCFA 3DCVA 2CGXA 4APCA 3LLTA 4XCUA 2IZSA 2X81A 3FPMA 4F7LA 3EQFA 1OPKA 5E4HA 3BLHA 5DMZA 3MIYA 1PMEA 4BDJA 2YM8A 4BL1A 2R3KA 3A7HA 3R02A 4GG7A 3VUKA 3POOA 3UZTA 3F88A 3QC9A 2DYLA 2GS6A 2R3HA 3DJ5A 3OTUA 4GK3A 3GB2A 4IB5A 4ZP5A 3S4QA 5KX8A 3KREA 2V22A 4XV3A 1TVOA 3C4CA 5B2KA 2IW9A 5LCKA 2R7IA 5G6VA 2XEYA 2BKKA 2XVDA 1O6KA 5KKRB 1QPJA 1OUKA 3O23A 4AZVA 1MQBA 2C3LA 4D2WA 4ZLZA 1UU8A 4NL0A 5TO8A 4DG3E 4XG8A 3QRKA 3O0GA 4FZ7A 4AWIA 5HVKA 5KMKA 3MY5A 4TKSA 1LR4A 4OW8A 3U9NA 4F7JA 3HX4A 3M11A 2W06A 2Z2WA 5CQUA 5ANOA 4MBLA 1M2QA 3Q60A 4YLKA 1SVEA 4TN6A 5C26A 5FXRA 2XKEA 4UBAA 4ACDA 4QPAA 1H0WA 2OW3A 3RKBA 3W2OA 1XH4A 2WTIA 3A7FA 4WUAA 2QCSA 1ZMVA 4LQMA 3KXGA 4OBOA 5HCZA 4CKIA 2B53A 4BCFA 4NZWB 4FBXA 4IM3A 4EQCA 4IX4A 1XKKA 3V5JA 5K5XA 4FGRA 4EK3A 2CSNA 2VWVA 3KY2A 4GU9A 1Q3DA 4EK5A 4KBAA 4AAAA 2VTRA 3RHXA 2QG5A 3PG3A 3TUDA 4BB4A 5I3RA 4MBJA 5EQEA 3EQBA 3FHRA 4HJOA 4MD7E 3R9HA 2R0UA 3HYHA 1YXUA 3F3TA 5LWNA 5DHJA 4RGJA 3BYMA 3VS7A 4MXZA 2O2UA 2GS2A 1QL6A 1FOTA 4FSTA 5ETAA 3EYGA 3KK9A 3EFKA 4BKZA 4EC8A 1IAJA 4CG8A 5L6PA 2I6LA 2WMTA 4ZXTA 3MH0A 5T3QA 5I9ZA 2WTDA 3D2KA 3WBLA 5J95A 3RCDA 3F82A 4WSYA 1QPEA 3BLRA 3KULB 5FTQA 2NRUA 2XK6A 2OJ9A 4IJPA 4C38A 2YZAA 2H9VA 1A06A 2JFMA 2VUWA 4TY1A 5AX3A 2OZAB 2W5AA 5H8GA 5DYJA 2JBPA 1BMKA 4FKUA 2W96B 5EQYA 4JR3A 3GU5A 5JZJA 2G2FA 1Q61A 1YWVA 3TUBA 3RAWA 4YP8A 2F7EE 5LXMA 2VO0A 3F61A 2P2HA 1X8BA 2HY0A 4TWPA 3NVMB 5HIDA 4PDPA 5AUXA 4MAOA 4QMPA 4BDKA 2CNVA 2OZOA 4M69A 4DFUA 1YHSA 1M17A 1FMOE 3IW5A 5EG3A 1Y6AA 2BR1A 1TQMA 4MWHA 5LMAA 4FSRA 5TT7A 3IGOA 2CGVA 2VTPA 2Z7LA 5AX9A 1WBPA 3OT8A 4FVPA 4QMZA 4QP1A 3RWQA 3R6XA 3H9OA 5EI8A 3RCJA 3LXPA 5HOAA 4C34A 5C03A 2C0OA 4FKVA 4MNEA 3QQGA 3RP9A 4FL2A 5M08A 2A0CX 2QU5A 2UW5A 4A9RA 4BCHA 1S9JA 4LUDA 1V0OA 2B7AA 4JG6A 1JKSA 3VHKA 4FV7A 4ALVA 4I4FA 4XH6A 1XR1A 4GIIA 4C3RA 3DKGA 4NIFA 3ORIA 3OS3A 2SRCA 2FH9A 3HRCA 4RX8A 2PVKA 2WMUA 4AZFA 5FBOA 1BL7A 4A4XA 3OC1A 3R83A 4IDTA 1XO2B 5FEEA 3NLBA 3TACA 1BYGA 2O0UA 4AF3A 4DEHA 4PUZA 1JKKA 3LAUA 4MXYA 2X7OA 4YJPA 4GVJA 3DS6A 2H34A 2QO7A 5CEOA 4UB7A 5HE2A 4CZTA 4YUQA 3PYYA 2ZDUA 5IA3A 1FGIA
chains in the Genus database with same CATH superfamily
3LXNA 2W4JA 3VAPA 1SMHA 4I1ZA 1ZY4A 4XG6A 4IAAA 3MFUA 3VS3A 2RSVA 3ZXTA 4H1MA 3EFWA 3L1SA 1Y57A 2VGPA 4YPDA 4DH3A 2QOKA 1OL1A 4A4LA 4IC8A 2GNFA 4V0GB 1GY3A 3SXRA 4AT3A 5DFPA 4EHZA 3BQRA 5LWMA 5LJJA 5IH4A 2GDOA 3KK8A 3ALOA 2E2BA 3NAYA 3R1YA 5EW9A 2P33A 2XIZA 3VS1A 4BTJA 4FA2A 2I0YA 2XP2A 3DLSA 3BHVA 4RQKA 3EN5A 2O63A 3UG1A 3G15A 3NUAA 3RGFA 3ORZA 4JIAA 3OUNB 4XUFA 3KL8A 1Y6BA 2R7BA 3QQJA 4O96A 2XEZA 3FZPA 5AAGA 2QU6A 5JQ5A 3FY2A 5F4NA 2OJGA 3L9MA 4NFMA 5BV3A 3O5AA 5LCJA 1NXKA 2GS7A 2JIVA 4XRJA 4YGAA 5FBNC 4F70A 4IVBA 3MFSA 4TYJA 4CMOA 2BFXA 1YHWA 3TUCA 1E1XA 2YN8A 2F7ZE 4E26A 4R1VA 4XEYA 4FTKA 2EU9A 3PP1A 3RALA 3S3IA 3DTCA 2R4BA 3ZTXA 4JQ8A 3TNHA 3IPHA 5CEKA 4PQNA 3PJCA 4QTAA 4BBMA 3QHRA 4B7TA 2ITPA 4BDDA 3R2YA 4BKJA 4IB3A 2YACA 3Q5IA 3P79A 3R7EA 1T45A 3PY3A 5CF4A 3OWPA 4YJTA 4UX9A 1R1WA 3ZO3A 3WOWA 3GU6A 4ZTLA 4GJ3A 3BQCA 2BHHA 4RA5A 3H10A 1E1VA 2PUPA 3AG9A 2Y6OA 3QA0A 4EUTA 5IEVA 2LAVA 3GCUA 2HENA 3LFSA 4NW5A 4L00A 1ZYCA 1URCA 3I4BA 1XHAA 3A8XA 4YLLA 3F2NA 3OTVA 3F9NA 1FVRA 3E8EA 4AGCA 3LKMA 2VX1A 3BGQA 3CTHA 5M57A 3BYUA 4CLIA 4D2RA 4FV6A 4UWBA 4XP2A 4ZSGA 3LHJA 4YJOA 1ZYJA 3D5XA 4F6UA 2ZV7A 1H0VA 4RJ3A 4ITHA 4I5PA 1XH8A 5KO1A 3CQEA 4IBMA 3WF6A 3A99A 2VTNA 4ZSJA 3O50A 2UZNA 3SKCA 4AACA 4ZY6A 4FEVA 4O1OA 1BUHA 4UXLA 4BWXA 3RMFA 5CXZA 4CFXA 3UC3A 2QQ7A 4GU6A 5FM2A 5FXQA 3PRIA 4ERKA 3W0RA 3SC1A 1ZWSA 2J0KA 5AADA 3ZSHA 5E9EA 1V0BA 4GFMA 4EJNA 1NY3A 4QO9A 2BAKA 5IMEA 2X2MA 4YC8A 3T9IA 3W2CA 4PL4A 5K3YA 4QP7A 4KRCA 2WD1A 4O4EA 4ENXA 4FICA 5ACKA 1IEPA 2YABA 3EQHA 3HGKA 5AA8A 4U9AA 5M4CA 3EN6A 3FMLA 4GT4A 3CTQA 4QMMA 2CGWA 3NNVA 2XH5A 3K3JA 4QYHA 1OGUA 2PE2A 4XV1A 5GJDA 3R8MA 1PXNA 3PPKA 4ZTNA 2Y6MA 4YJNA 5M56A 3COIA 3R8VA 4L52A 2H96A 4IH8A 3EFLA 4TWNA 4LDTA 3B2TA 3OCSA 2XK8A 2XBAA 3SV0A 4NM7A 5A4EA 4JBPA 4U45A 4FNXA 3N4VA 5CEPA 4EH7A 4HYSA 5L6WL 3NWWA 4FSUA 4EZ5A 3N9XA 3PXZA 4OTDA 3FY0A 4RIOA 4U0IA 3SXSA 2XNPA 3QRUA 3F2RA 3VULA 3WIGA 5L8LA 3LQ3A 5ANEA 4L7FA 4H3QA 4ZY5A 1FBNA 3QLFA 3VHEA 3ZXZA 4UMUA 4FMQA 3VUTA 4EWHA 4AA4A 4M3QA 4YZMA 5IMXA 5A4CA 3QZFA 2BHEA 2X39A 4WT6A 3SQQA 4NU1A 1P5EA 1YDRE 3CQUA 3UIXA 3M1SA 2VNWA 3TNPC 2YA9A 3G9LX 1REJA 4R6VA 2ZAZA 4O2PA 4A7CA 5HO6A 4FUYA 5AP5A 5H8EA 4C36A 3QCQA 2C3KA 2GU8A 3ERKA 4FKIA 5AP1A 2YITA 3ORKA 1ZOGA 2W4KA 4ZLYA 5HLPA 4IIRA 3UOKA 5JMSA 3P0MA 4Y85A 3ANRA 1RJBA 4R5SA 4AZWA 2W9ZB 3FLNC 3F69A 4RWKA 2Q0NA 1YKRA 4QT1A 2QR8A 5HI2A 4D55A 4CFFA 2ZFYA 3N4UA 2YM5A 3QTUA 4W4XA 4EOQA 1F5QA 4GYGA 2VZ6A 3QUPA 4AUAA 4I6HA 5EKOA 1LPUA 3QXOA 2XKCA 2IG7A 1PMNA 3MPTA 4IANA 3I5ZA 4O0WA 3R9RA 3IW7A 5CENA 5AM7A 2WOTA 4Q9ZA 3ZUUA 3PP0A 3KCKA 4FKRA 2OJFE 5DBXA 3VS5A 2ZOQA 3RBWA 4IVCA 4RWJA 4I6LA 2G15A 4O38A 5AM6A 1KUTA 2UW7A 4C2WA 2ITNA 5AP0A 4TNBA 2VTAA 3D5UA 5AV2A 4F7NA 1M14A 1YRPA 3H0YA 3PVGA 4L3PA 4W4VA 2QHNA 2VTSA 5K4JA 5F20A 2BTRA 4BDCA 1PXPA 4AAYA 2VU3A 3BGPA 4YJUA 3O8PA 3KVXA 3HKOA 2W1EA 2C6EA 4FX3A 4IAFA 2FUMA 4D5KA 2JKQA 4CTCA 2E9UA 4FNZA 3SOCA 5K0XA 2XB7A 3GEQA 4K8AA 2VTHA 4KKGA 2RIOA 4BCJA 3OWLA 3FC2A 3PDTA 2VWBA 2X6EA 4FTQA 3ULZA 5JGDA 4IZ7A 5EDQA 1V0PA 1CTPE 2C5VA 2PVFA 3NUUA 1AQ1A 3VUIA 1GZKA 1JAMA 5FEQA 3P86A 2XCHA 2VTOA 3EQCA 4HPUE 4M67A 3T3VA 3RZBA 3S0OA 1GAGA 4CXAA 2UW3A 4QPSA 4QMYA 4ZSEA 4R3PA 2CNQA 5C4LA 4CRLA 4GV1A 3PRFA 3H9RA 1Q62A 1UNHA 1YVJA 2VTIA 3C5UA 5G1XA 4B9DA 4F4PA 1G3NA 2YIQA 2YJSA 4TYGA 2P55A 3KRXA 3QU0A 1UWJA 2ZB0A 5CU6A 1G8JA 3TTIA 3EN9A 4JX7A 1PY5A 4ANQA 3I1AA 2XNNA 3FQHA 4BDEA 3UVQA 5GZ8A 1ZOEA 3R7GA 2ZV2A 4AFJA 5BVDA 4TZRA 4YHTA 2CHLA 2WGJA 4UXQA 1XBBA 4LGGA 1JSVA 3F5PA 4X3FA 2CKOA 2PVLA 3QZIA 4GT3A 4M12A 3RM7A 5HBEA 3GU7A 4MQ2A 2IWIA 3GBZA 3Q4TA 3GCVA 3ZO1A 2YM4A 2BRBA 4AW2A 3D94A 3ZBXA 2X4FA 3BE9A 4XBUA 1Q41A 4XJ0A 3ALNA 4G3EA 5HLNA 2V5QA 4XP3A 1P2AA 3D83A 3FZSA 4O7ZA 4MCVA 3W0OA 2G2IA 5C8KA 4QNAA 2ITVA 3P23A 4KBCA 5EHOA 3U54A 1K9AA 2GSFA 2BPMA 3IW8A 1AD5A 2F57A 3DNDA 3EIDA 5JKGA 3EQDA 3KU2A 3AKLA 2AC5A 4YTHA 5FWKK 2A19B 1G5SA 3R21A 3HVCA 3C5IA 3KMMA 4BR3A 4IXPA 4WNKA 3UIMA 4FZFB 2RKUA 2ITQA 3WYYA 2VV9A 2F2CB 4FIGA 5HICA 1JSUA 4DEBA 1YWNA 3GC9A 3QX4A 2UVXA 4L53A 3W33A 3NFGB 4AX8A 2RFDA 4JBVA 2UZDA 3CGOA 4PMPA 1CSNA 4U44A 4AP7A 4C37A 3QWJA 5IUIA 2XYUA 4JI9A 1ZAOA 4HYHA 2Z8CA 1GZNA 4IZ5A 4RLKA 4TRLA 5AR5A 4FZAB 3NX8A 2X9FA 3MB7A 3BYOA 4ACGA 1H01A 3MVJA 1XBAA 4K18A 5L4QA 3VC4A 4ZZOA 5HD4A 4G31A 5DWRA 4GSBA 4RFMA 3QQKA 5EYKA 4O4CA 1M7NA 4PPBA 4RRVA 4O0TA 3NEWA 4O1PA 3CY2A 3FI4A 3LCSA 4II5A 3TZ7A 2O3PA 4D2PA 5LARA 3RAHA 4I5HA 2EUFB 3H30A 4IMYA 4G3CA 4I5MA 5DIAA 3JR1A 3UNKA 4QYGA 3GVUA 3A4OX 2BALA 2J5FA 5EFQA 2WIPA 3R7IA 4DG2E 5IQIA 3PVUA 3NW7A 4IDVA 5CSVA 5CZIA 3VBXA 4F1OA 2YZLA 4EKLA 2H8HA 3VO3A 2WTCA 3PLSA 5DT3A 5CX9A 5AV0A 3GXLA 4NCTC 4P5ZA 3OCBA 4IAZA 4OTFA 1L8TA 4LV5A 3WARA 4QQ5A 1WMKA 3OXTA 3AT4A 5EH0A 4GW8A 4QMWA 3QTWA 4UALA 3HRFA 3DXPA 3W0SA 1DAYA 2LGCA 4QQCA 5DH3A 3TJDA 4EH3A 2X0GA 1KOAA 2WEVA 3FSKA 4O4BB 5KMMA 2VWIA 2ZV9A 4UV0A 1VR2A 4EK4A 3SRVB 3LW0A 4O27B 4Y46A 3U6IA 3II5A 4IVDA 1CDKA 3DFCB 4XX9A 4HVGA 3W0QA 2GNLA 2VTMA 4FTUA 2XK4A 2XK9A 2RF9A 3MJ2A 5F94A 2IZUA 3ZCLA 3P08A 3R8LA 3RPYA 4I6FA 5BQ0A 3RPVA 4FVQA 2QI8A 5J9ZA 5FUTA 5AUVA 1ZZLA 3ZDUA 4FSYA 4F08A 3HUBA 2OXDA 3EOCA 2OO8X 3GFWA 1ZZ2A 2C5OA 4CFVA 5E8WA 1B6CB 3AKKA 1BLXA 3P5JC 3BHUA 1OIUA 2QOHA 3C13A 4G3DA 4O2ZA 3UVPA 1O9UA 3C50A 2YCRA 4FV0A 3O7LD 2IZTA 1XH9A 2YAKA 3GNIB 4RC4A 1FINA 2EXCX 3HV7A 4M66A 5AUTA 3MVLA 3AC3A 3DT1A 3RNYA 1QPDA 4X3FC 1KE5A 4KKHA 4PL5A 1ZXEA 3POZA 4QQTA 3RAIA 3ODZX 2JDSA 3UPZA 3WF9A 4Z9LA 3F66A 5AUUA 1B38A 3PIZA 4O6EA 4PY1A 3ZO4A 4ZTHA 1REKA 3VWAA 4EH4A 4N70A 3DK6A 2GCDA 4ZTSA 4LV8A 4A06A 4J95A 2AUHA 3SHEA 4AQCA 4FV2A 1XJDA 4DE4A 2HYYA 4FG8A 4I24A 4IWPA 3FAAA 3ENMA 2Y0AA 3QWKA 4EEVA 2IPXA 4PDSA 1UKHA 5K9IA 3MTLA 4YO6A 4KIKA 1UNGA 4E6DA 2ETKA 4TXCA 2AQXA 3RHKA 2WB8A 3IOKA 5CYIA 3PIYA 4E6AA 2QURA 2ZB1A 5BVFA 4IAKA 3DBCA 4BJJB 3ANQA 5CI7A 2PZYA 4KUJA 2QKWB 3NPCA 3UOLA 2W17A 5FP6A 4YJQA 4LG4A 4I20A 5HESA 1SNUA 5CS6A 3TV7A 3FQEA 4HZRA 4O7VA 4Q5EA 4JIKA 4RJ6A 3WF5A 4PP9A 4YZDA 3QZGA 4O7WA 3AD4A 4O91A 1GIIA 3WZJA 1PHKA 4O7RA 3VBWA 2FSTX 2OF4A 2JAMA 2QOOA 5AR4A 2B1PA 2QVSE 3L8SA 4CYIA 4KIPA 3VBQA 2PVMA 2WQOA 4FSQA 4U3ZA 4BCNA 1B39A 1H8FA 1OMWA 3KN6A 4J96A 5C01A 2CPKE 3FI8A 4YJRA 3QYWA 3VVHA 3HMIA 5FTOA 3S00A 2G2HA 5CU4A 4NSTA 4BYIA 5F9EA 4EZ7A 3PJ1A 4C57A 3FLQA 3VS4A 3UPXA 2BZKB 2OSCA 4JX3A 3OY1A 4WBBB 5BPYA 3P7BA 2G1TA 2B54A 4RIXB 3MA3A 3QFVA 4XG9A 1YWRA 5DEWA 5FD2A 3JY9A 5FQDC 3MWUA 3SDJA 3VQHA 1WVXA 2OU7A 5C9CA 4PPAA 1JKTA 2J50A 4GIHA 4AFEA 4NK9A 4DGNA 4HOKA 4AT5A 1G8KA 1ZARA 4EZ3A 4RIWB 4FZDB 3TIZA 2QHMA 3NDMA 3R01A 4DT9A 1NT2A 3AC2A 4KA3A 3PPZA 5EHYA 4R7HA 3V51A 1A48A 4FEWA 3OCTA 4L45A 3V6SA 4DHFA 4F9WA 4FNWA 4TWCA 4KB8A 1OPJA 2I0HA 5LVMA 1TQIA 3BGZA 4PP7A 5JN2A 2GQSA 2HZ0A 1WBSA 2O65A 3LCOA 4ANOA 5IF1A 4FNYA 1DI9A 4Y8DA 4WOVA 5AIKA 5KKRC 4MK0A 3HLLA 5D41A 1KE6A 4IB1A 3VBYA 4EOKA 5DR6A 3CEKA 3NCGA 4I22A 4FEUA 4DINA 2UZBA 4EONA 2WQMA 4E5AX 1YW2A 2W0JA 3M42A 3VONA 5KCVA 1NVSA 2E9OA 4Y72A 3AXWA 5EM7A 3MVMA 4O0XA 4DGMA 3CLYA 5AIRA 1S9IA 2CMWA 5IQCA 4Y95A 4YC6A 4D1ZA 1H07A 3OD6X 3W8LA 5HBJA 3FZOA 3SD0A 2CN8A 1GNGA 5TR6A 4YMJA 2WAJA 5F95A 1ND4A 4R3RA 3NSZA 4I23A 5FRIA 3VJOA 2WQNA 2ZM3A 1SZMA 5JGAA 2OK1A 4QP9A 1OKZA 3QTIA 2EB3A 3UZPA 5JRQA 4FG7A 5KMLA 4LV7A 3BWJA 1OBDA 3CS9A 4CV8A 3R9NA 4Z55A 4EOSA 1UNLA 3KGAA 4CRSA 5KHWA 2IO6A 4F6SA 3E64A 2A98A 3PFYA 5CF8A 3W18A 3TMOA 3Q5ZA 4Y83A 3RINA 3DBQA 4JS8A 3V5TA 4HGTA 3F3VA 4OT6A 4RFYA 3JUHA 4J71A 1J7IA 5EM8A 5BVEA 1ST4A 4L68A 1Q97A 4CFWA 1L3RE 4WRSA 4ZZMA 2XALA 3GP0A 2X8DA 2P2IA 3IDCA 3Q9XA 5C4KA 3ACKA 4JNWA 4LRJA 4NJDA 5ETCA 2WO6A 3QBNA 1M2PA 3ZU7A 4D4YA 3PUFC 3L9NA 4X6RA 4MYGA 3ZM4A 4K33A 2HOGA 2C6IA 2FSLX 2UW0A 3OCGA 4U42A 3QUDA 4C3FA 2OLCA 3G2FA 4YBJA 5BVWA 3C0HA 4H39A 3R0TA 2R3RA 4L3LA 4J8MA 3N4TA 4MXCA 3NS9A 4X2NA 4UMRA 4I41A 3H3CA 3QRIA 5HE0A 3A62A 4BFMA 2WNTA 4JLCA 4KABA 4RJ7A 4QTEA 5C1QB 5HORA 5IU2A 2ZDTA 4PRJA 2C6TA 3E7VA 4HZSA 4UYAA 5BYZA 4WUNA 1OIQA 4RPVA 3PSDA 3QD0A 5BX0A 4RIYA 1Q24A 5AP3A 4CMTA 3V01A 3KCFA 2XNEA 2WQEA 5DA3A 3LMGA 3D4QA 5L2SA 4G5PA 4NUSA 2B55A 3DV3A 4U3YA 4EYMA 4FEXA 3ROCA 4C3PA 5BVNA 3COKA 3OWKA 2R3NA 4FSWA 5CSPA 5ICPA 4D4RA 4IACA 4FT0A 3BWFA 4ZSAA 4D5HA 2CLQA 5KBRA 1SVGA 3MDYA 2R3QA 2RGPA 3I79A 4FL3A 5HU9A 4FYNA 1BI7A 5JFWA 3LM0A 2JIUA 3DBFA 1Q5KA 2CKEA 3LIJA 4F0GA 3C4FA 4RVTA 5FGKA 4AGUA 4ID7A 3O71A 4DAWA 2YERA 4O7SA 5BUIA 4IVAA 4WRGA 1IA9A 2BDWA 3CY3A 3FQSA 4KIOA 2V55A 4I4EA 4CZYB 4O6LA 5HD7A 3UOHA 4M15A 4FTIA 2GNHA 5DNRA 3FSFA 3TV4A 3ZUTA 5E1EA 5LMKC 2PMIA 4XP0A 4TYHB 4IEBA 2FGIA 2J5EA 4C4IA 4CLJA 2VGOA 5TE0A 3W8QA 3C4XA 2XK7A 2X0PA 2GQRA 3E62A 4JDJA 2Z7QA 2X2LA 3DFAA 4DT8A 3L8PA 3EL7A 3EQGA 3PXFA 4BDHA 3QTZA 3F3UA 4AE9A 4GK2A 3UQCA 2UW9A 4DHJA 4I6QA 3RPOA 4WHZA 2XJ2A 3GGFA 4EOOA 1I44A 1OITA 1Z5MA 3CIKA 5FDXA 4WBOA 3QRTA 3KXXA 4F9YA 4ACHA 2ZMDA 4JL9A 2QG7A 1STCE 3D7TB 4AW0A 1LP4A 4JDIA 4IADA 2WEIA 2W1HA 4BY9E 4ZS0A 4DEAA 4F0FA 4FTCA 4QTDA 4CMUA 4KS8A 3CQWA 4ZJIA 5L2QA 3HRBA 4DHZA 4HYIA 3U87A 4KSQA 1KE7A 3LQ5A 4WNMA 2PYWA 3E3BX 3ZFYA 4D4SA 5CAPA 1WBWA 2WPAA 3OFMA 4IX3A 5AMNA 5DR2A 3WZUA 3H0ZA 3JPVA 5CNNA 4ANBA 2XRUA 2XCKA 4E8AA 2UZUE 3TV6A 5C8MA 3IGGA 5JGBA 3FMMA 5IPJA 5D7AA 4DFXE 4L7SA 3BL9A 5J8IA 1JKLA 2X4ZA 4RZWA 4X21A 4DEIA 5HHWA 4AOTA 3QGWA 5J7BA 2JBOA 4F0IA 2JITA 4MF1A 3BLQA 5EI2A 3ORPA 3V5QA 1A9UA 3U55A 3G6HA 4GFOA 5CEIA 2G9XA 3PXKA 2P4IA 3ATSA 4FTMA 4MNFA 5KUPA 4ANNA 2J0LA 3WZKA 3IDPA 4WA9A 3COMA 5E8UA 3GQIA 3WILA 4BZNA 2XNBA 4RA4A 3B2WA 5CAVA 4XOYA 2QOCA 3ZMMA 4FT7A 4ZOGA 3SOAA 4DLJA 3AC8A 3GU8A 3V8WA 4DBNA 1VYZA 2CGUA 2HCKA 4FTTA 5KZ0A 1OUYA 4MD9E 4DDIA 3MB6A 4BDGA 5J79A 4XLVA 2VX3A 4V01A 3ZFMA 2I7QA 2I0VA 3DKOA 4QRCA 2IJMA 4IAIA 5K0KA 2XM8A 5HG5A 5AUYA 3UBDA 1OL6A 3AOXA 3UQGA 3GU4A 4RC3A 2JKKA 2BCJA 3BU6A 3NGAA 1CKIA 2OBJA 1U54A 2W1GA 4FRFA 2UZWE 4DITA 3OW3A 2WKMA 3V5WA 4CFNA 4D0WA 4FTRA 4F7SA 3G51A 2YIXA 4ZEGA 4BWKA 5CI6A 5CSXA 5DT4A 5HGIA 2W4OA 3DTWA 3UNZA 4CG9A 3JVSA 4RC2A 3O96A 4EH8A 2UW8A 2FB8A 2YISA 4EI4A 2J7TA 3EN4A 2B4SB 4C62A 4QMUA 3ZLXA 4G3GA 4RJ4A 2DQ7X 2J2IB 5IA4A 4RJ8A 3GC7A 3NW6A 4BCGA 1PXJA 5CVFA 4YSMA 4QMQA 4CT1A 4O7LA 2X1NA 2VTJA 4M14A 1W2CA 2AEGA 4G6LA 4DH1A 1OL5A 2B9HA 3FHIA 4MF0A 4YO4A 5BUEA 3DK3A 5L2WA 2R3GA 2WZJA 4OLIA 2XKFA 4LOQA 2YM7A 4NJ3A 5ANIA 3V04A 4V05A 3UE4A 4ZTMA 2Y7JA 4G9RA 2WMRA 1W2FA 1PJKA 2EXMA 3MJ1A 3P7CA 3AKJA 1VLRA 5I9UA 5KE0A 5A14A 3KC3A 4ZSLA 4BDFA 4L46A 5HCYA 2PZPA 1OI9A 3VBVA 4L01A 1QCFA 3BPRA 3I7BA 4OBPA 5AV3A 5E8YA 3ZDIA 1U5RA 2OG8A 4W4WA 4F63A 5H9BA 1JPAA 4YZ9A 2E9VA 4FKQA 5HX6A 2XKDA 5E8XA 4D2VA 3P7AA 3RK5A 3WYXA 5IQHA 3Q9ZA 4E4MA 4OAVB 2VWYA 5CF5A 4K6ZA 4RX9A 3ZEWA 3EMGA 3R8ZA 4K77A 3MN3A 3F3WA 1UKIA 4O7YA 4CNHA 4FIJA 2J9MA 3JY0A 1V1KA 2F9GA 2OIDA 2X2KA 4I21A 4BCMA 4MX9A 3G0FA 4LRKA 2XIRA 4M69B 4O82A 3FLSA 4U41A 4IX5A 4FV1A 2JKMA 3R7VA 4ASEA 4N57A 4C4HA 1ZMUA 5CT7A 4Q5HA 4AXAA 5B2LA 2YFXA 4AXEA 4GUEA 2YIWA 5AAEA 3BV3A 3ZLYA 2C6OA 5DEYA 2A1AB 3FYJX 3NIZA 3O8TA 4MWIA 1XMLA 2WTVA 3OMVA 3AC4A 4MNEB 2AC3A 2XRWA 5D12A 3W55A 2Y4IB 3T9TA 4AW5A 4I0SA 3FEGA 1RDQE 3HV6A 1E9HA 3MFTA 4O0VA 2IVTA 2XMYA 2YEXA 2XARA 4HGSA 3PZEA 2IW6A 4DCAA 3WE4A 5HVYA 4ZY4A 2JLDA 3BELA 2P0CA 4G3FA 4YHJA 5ANKA 4TPTA 3VS2A 2BILB 2XNGA 5HTBA 5IG1A 4TWOA 3TL8A 4E5BA 2JIIA 5J1VA 5AR2A 3KA0A 4H36A 4WD5A 3UIUA 3UP2A 3Q4ZA 3ITZA 4BKYA 2PL0A 3E3PA 2PZIA 5BYLA 3BV2A 2YJRA 3IW6A 3LFCA 4NW6A 4MD8E 3DB6A 2BDFA 3PSBA 3ZRMA 4A9SA 4A9YA 3C9WA 3LE6A 4JDKA 2ITXA 5AP7A 1PKDA 4M8TA 5C27A 3WI6A 3MPAA 1OECA 2UVZA 5LVPA 3TNQB 5HTIA 1FPUA 2RG6A 5FXSA 1HCKA 1CKJA 4CFUA 3QQUA 4XV9A 3CJGA 4GKIA 3FJQE 4OTHA 3AGMA 3TDVA 3QQLA 4NCTA 4NTTA 4R77A 5AUWA 3W2QA 3ZSGA 4DEEA 1Q8UA 3E92A 5GJFA 2UV2A 5E90A 3HA6A 4LGDA 3G33A 4F1TA 5JT2A 2W1CA 3AD5A 1RE8A 3GOKA 4QP2A 5EW3A 5T68A 4BI2A 3HDNA 3E7OA 4IWQA 4X2GA 5BVOA 2YM3A 2QO9A 4KD1A 4CTBA 4RT7A 2FVDA 2X9EA 4NKSA 4QP8A 1H1RA 3NUYA 3HV3A 4J1RA 3Q32A 4ARKA 4FV5A 3FWQA 3GC0A 4ZMFA 4FF8A 4UYNA 1OB3A 4O0RA 5D9HA 3CD3A 5F1ZA 3DBDA 3MW1A 2R2PA 2RFSA 4RFZA 4UZHA 1ZYLA 4M0YA 2PY3A 5EYMA 2PUNA 1ZOHA 3A2CA 3Q3BA 4WG4A 3OHTA 1UU3A 4YBKA 5IQFA 2ERKA 3P9JA 3D5WA 4DF3A 4FKJA 1EH4A 1AGWA 4BI1A 2I40A 5JFSA 3FMDA 2ZMCA 4J53A 5IDPA 3REPA 1H27A 4BIEA 5A6NA 4QDVA 4L42A 4MBIA 3PWYA 1WFCA 3K5VA 2VRXA 5DGZA 5I0BA 4C33A 3UMWA 1PF8A 3K54A 2BZIB 4QMOA 2XAMA 5CEMA 3G9NA 1J1BA 2PVHA 4FKTA 3E8CA 5ANJA 5IA2A 3HAMA 1IG1A 4O0UA 3JVRA 3HDMA 3HMNA 4OTQA 2BIYA 3UO6A 3W1FA 1UU7A 2C3IB 4AA0A 4GS6A 4RQVA 4O0YA 4CCUA 3VW6A 4DH7A 2HWOA 5IUHA 2BMCA 3NYOA 2VTLA 2JDOA 3A7GA 3Q9YA 1H1PA 4CD0A 3NYVA 5IKWA 2Q83A 1HCLA 3I60A 4JR7A 5CVHA 2I0EA 4B4LA 2R3PA 4EWQA 1IAHA 4BIBA 4XG7A 3RK9A 3DDPA 3KEXA 3MPMA 4RX5A 4QEBA 5IEYA 4B6LA 4UMQA 1FGKA 1BKXA 2X0QA 3RK7A 5HG9A 5AAFA 2PK9A 1H26A 4M0ZA 3ULIA 1W98A 4EHVA 4A9TA 1UV5A 2NYAA 3JYAA 3KVWA 3V8SA 5HVJA 4M68A 2UVYA 3W10A 5FDPA 3OOGA 3W0PA 1KV2A 5CTPA 3WF8A 2C6DA 4ALWA 2BIKB 2G01A 3I0OA 4CT2A 4EH2A 1SVHA 5HE3A 3TEIA 4KKEA 1TZDA 2EXEA 3ZEPA 2C69A 2V7OA 2HELA 3CBLA 3OBGA 4M84A 4M97A 4BF2A 5CVGA 4YZBA 2WTWA 5HEZA 3I6UA 2FA2A 2QLUA 5AV4A 1U4DA 3ODYX 3S95A 2CLXA 2ITUA 2Y9QA 2REIA 3EJ1A 3W32A 5IISA 4ENYA 1G8AA 3C4EA 4DEGA 5AJQA 3NIEA 5CU3A 5GIPE 4X2FA 4K11A 2X7GA 4Q2AA 3QYZA 4EYJA 4O83A 3BZ3A 4DFYA 3AC5A 3Q53A 3HMOA 3KKVA 2HW7A 4L43A 4NM5A 1PYXA 5D11A 4B0GA 3NNWA 3PVWA 3UDBA 4F9CA 3P4KA 2XF0A 4TT7A 4FKPA 3ZSIA 3FDNA 2UZEA 4YSJA 4FE2A 2PVRA 3EKKA 2RL5A 3MGYA 4FTJA 4EK6A 2YWPA 3OP5A 3U6JA 3FLWA 1XWSA 2R64A 2WMWA 3BI6A 3O17A 2PVYA 4JDHA 4JXFA 1OKVA 1QMZA 1OPLA 4BCIA 3VN9A 4JAJA 2VD5A 3IO7A 4BCOA 5M53A 3M2WA 4I0RA 2FSMX 4IC7A 2YCSA 4U40A 3COHA 2BTSA 1WBTA 2GQGA 4TYIA 4RVKA 3KF7A 4L6QA