3KF7A

Crystal structure of human p38alpha complexed with a triazolopyrimidine compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Continued exploration of the triazolopyridine scaffold as a platform for p38 MAP kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kf7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kf7A01
2R7IA 3O8PA 3PXKA 3EZVA 4YPSA 5FLFA 4HVHA 1BUHA 2QOCA 2WMBA 3TIYA 3TCPA 4ENXA 4EONA 2WNTA 4YJOA 5EYKA 2J0MB 1OL5A 4KSPA 3ULZA 4FTUA 3HZTA 3Q6UA 3R73A 4YLLA 4EHGA 3SHEA 1VZOA 5DYJA 5C27A 1GIHA 4XNEA 5IMEA 3RHKA 1MRVA 2VZ6A 1LPUA 2QD9A 2XCHA 4GH2A 3TNPC 4YLJA 3GOPA 4CKJA 4ZTHA 5HD4A 4AFJA 3M1SA 2A2AA 3NUYA 5LVLA 3LQ3A 3C0GA 3EQIA 3MVLA 4FZ6A 4LRKA 4FOCA 4G5JA 4TW9A 5LARA 4LV8A 4BCPA 4RGJA 4XLVA 3R8LA 4IAIA 1RJBA 4U42A 3ZLXA 5ANDA 3MYGA 4GW8A 3QQFA 5FM2A 3R7YA 4TWOA 2YERA 3WIKA 4S34A 3RTPA 2XH5A 5AUWA 4FSNA 3W18A 3JXWA 4CMUA 5EKOA 3RJCA 3OUNB 1Q8WA 3HAMA 4R7BA 2QOKA 1P14A 3W2PA 5B2KA 3PRFA 1BYGA 2UW9A 4FX3A 5TOZA 3BGQA 4AWIA 3MPTA 4RX9A 5IA4A 3FMKA 2XRWA 5K5NA 5IQCA 1SVGA 2BRBA 2XJ0A 1OBGA 4U40A 2HK5A 4F09A 3EJ1A 3CS9A 2XNOA 3G5DA 2WU7A 1XR1A 2CHLA 4AT3A 5I5ZA 1RDQE 4MX9A 3PZHA 3VVHA 4XP0A 3P1AA 4DGGA 3N51A 3QTWA 1OKYA 3Q60A 4JG6A 2JFMA 2WQBA 1Q8TA 3E8DA 3PY3A 3IONA 3WZDA 2B9HA 2VTLA 3FY2A 3T3VA 3FEGA 2YEXA 4PPCA 3TL8A 2ACXA 2VWIA 3U51A 3QF9A 5CXHA 4YJVA 2QURA 3LFQA 3NNVA 3KRWA 3SD0A 2PVMA 3Q32A 4D55A 4RJ6A 3EN7A 4QTEA 1OM1A 4P7EA 2OIQA 4M69B 4FKWA 4ZLZA 1ZZLA 1H25A 3QA0A 5IQHA 2P0CA 4GKHA 2C3KA 5EQPA 2ZB0A 2VO6A 4YHJA 4WNPA 4GFMA 5DEWA 3MW1A 4DH3A 3GU7A 2OSCA 4UALA 5JT2A 5LVPA 3QXOA 5DI1A 3HGKA 3FLSA 1PYEA 2BIYA 3VQHA 5ANJA 3MH2A 4I5PA 4O7SA 3E5AA 1ZOGA 2FGIA 3GC8A 4FOBA 2JIIA 4NM5A 5CAPA 2PK9A 5DBXA 1OIQA 3ALOA 3QRUA 1OBDA 2VO3A 2Z8CA 4PL5A 3ZZWA 4L67A 2VTNA 2JBOA 4L42A 4FI1A 3PXRA 4L01A 5GJFA 3PG1A 2YZAA 4HGLA 5HD7A 4C4JA 3AD6A 3UIBA 3DOGA 3I79A 5KX8A 3NVMB 5CEMA 3N4TA 2ZV7A 5M06A 4UBAA 4ANNA 3C4FA 2ZJWA 3KXMA 4KS7A 4IM3A 5CANA 3QLGA 2HIWA 4QTBA 3CQEA 3QD2B 2XNPA 5HG8A 4O2ZA 4XV2A 2V5QA 3TZ9A 4MTAA 1Q5KA 3KFAA 2VWUA 1LUFA 2J0LA 2J50A 3G0EA 4L52A 5BVKA 4WSQA 4ZJVA 3AT4A 3ZEWA 3GC0A 4WKQA 5HG5A 1WZYA 3BHUA 3RAHA 3RZFA 4G3GA 2CLQA 4TNBA 4JG8A 2CSNA 2OGVA 5HCYA 2X7GA 2O65A 2ZM4A 4G2FA 2QOLA 3TZMA 4AA0A 2YIQA 1MRUA 2YJSA 4NYEA 4JBOA 2C5VA 5EK7A 4DINA 5GJDA 3HKOA 2HWPA 4BDAA 5DR9A 2J5FA 1H07A 3KEXA 4AOIA 1ZY4A 2OH0E 4MXYA 3A2CA 1OZ1A 3AC3A 4NKAA 4QP8A 4RJ5A 3T9TA 1J7IA 4DE4A 1ZMUA 1BKXA 4FTLA 4IW0A 3ENHA 5HBEA 3C5IA 4HW7A 5TKDA 3TJDA 3MVJA 4NTTA 2GNGA 2HY0A 1U54A 3QHRA 4X7QA 4XP2A 3V6SA 4PV0A 5AIKA 2YIRA 2IW6A 3QGWA 1JSTA 3PSDA 5HCZA 1PMEA 3EQRA 3KB7A 3TN8A 2VWBA 5C1QB 5M4FA 3LCOA 4AE9A 1J7LA 5EM7A 5F20A 4O7NA 3OC1A 1I09A 2PY3A 4RC3A 4JRNA 5J1VA 3NYVA 3GENA 4EK5A 4IJ9A 1URCA 4PTCA 2XS0A 4XOYA 1QMZA 4CTCA 1IEPA 3UOHA 5J8IA 4G9CA 2RG5A 2CJMA 3B2TA 3VS7A 1KSWA 4M0YA 4E6DA 1QPEA 2ZYBA 3KF7A 2JEDA 3KRLA 2FUMA 3MFTA 1GJOA 1WBOA 4N6YA 2ZMCA 5B0XA 3DJ6A 3L1SA 2PE2A 3FL5A 4FZ7A 4CXAA 1M17A 3FZSA 5CSHA 3BHVA 3O7LB 1PYXA 4U6RA 4CCUA 2C6KA 4DEHA 4R77A 3LM5A 4RZVA 4DH8A 5CSVA 4OTWA 1GAGA 3LM0A 4HOKA 3E87A 5D10A 3FLZA 3P4KA 3R7IA 4MD8E 4ZS4A 2EXMA 4KRDA 3Q04A 3OZ6A 4LL5A 1Q3WA 4XS2A 3JVRA 4FIGA 4BI1A 4LUEA 2VV9A 4FVQA 3ZC6A 1YOMA 5FUTA 2X2MA 4O6EA 1FOTA 4NIFA 5AADA 5BVNA 3PG3A 3U55A 3ID6C 2P3GX 2W05A 4NZWB 3R8MA 1GZ8A 2W9FB 4QYYA 3UP2A 5B2MA 3F3TA 3ALNA 5BVWA 4PTEA 5LQFA 4ZZNA 4R8QA 3KY2A 3CTJA 4S30A 5L8LA 2R3QA 3FUPA 3NUNA 2PMIA 5IH4A 4EI4A 5HZNA 2ZVAA 4RIWA 3FQEA 3GFWA 3LJ1A 4YJPA 3DKOA 4I0SA 4NK9A 4F6WA 4YR8A 1H00A 3PA4A 3E8NA 1H1RA 4MXXA 1YHVA 3QWJA 4YJQA 1PJKA 4DEEA 3BIZA 3V51A 5KMNA 5L2SA 3QTSA 3LLAA 1ZYLA 2QLUA 2HYYA 1CDKA 1YW2A 4W4YA 5D11A 5ANOA 1V1KA 4PTGA 2OXYA 3RPVA 3RPOA 4FODA 5J95A 3QUDA 4BYIA 2YAKA 4AZEA 5IG1A 5CT0A 4FKLA 5CENA 1ZARA 2XKEA 4AFEA 3N9XA 2AC3A 3DZOA 3P08A 3C9WA 3HNGA 5AM7A 5LVMA 3EQFA 4LRJA 4DCEA 3LKMA 4FVPA 2DWBA 3EN6A 3E63A 2WQNA 3BE2A 4FV8A 1PKGA 3QRJA 2OI4X 4FBXA 4OTRA 3DB8A 5K9IA 3JY0A 4FKVA 4G17A 4RC2A 4FYNA 4CFMA 3EKNA 4TPTA 2RFDA 3BU5A 3V5PA 5FDXA 2XKDA 2J0KA 3CY3A 3D4QA 3R71A 4FTCA 2QNJA 4QP2A 2HZIA 5IQAA 2J6MA 3JR1A 4OUCA 4F9CA 4HVGA 3KULA 4E93A 2R3JA 3ZC5A 3DJ5A 4YSMA 4QQCA 3SOAA 5DT4A 4EWHA 5I9ZA 4O81A 2WMVA 4LUDA 2E9VA 4YZ9A 3UC3A 4EOIA 2WMXA 4O0VA 2P55A 2RFEA 3UE4A 3CE3A 5AP1A 3BGPA 4BY9E 4AOJA 5H3QA 2IO6A 2YABA 2B4SB 3OMVA 5A4QA 3HMIA 3ORTA 4ZZOA 4FYOA 4JXFA 4FIJA 4AZTA 3PJ2A 4E20A 4ZSEA 5KHXA 3COIA 4G3DA 2GHLA 2W7XA 3F2NA 4MXOA 1TQPA 2JC6A 4KIPA 2BILB 4FGRA 4N70A 4K11A 3G90X 1E9HA 5E8ZA 4NU1A 2XA4A 3R83A 3ZUUA 3NX8A 2XM9A 1M7NA 4AT5A 4U44A 4QMUA 3C13A 4M14A 3WYYA 3P7CA 1OB3A 4WO5A 1IRKA 4P5ZA 4OR5A 2YLFA 4DG3E 2YCRA 4O0WA 4FKUA 4C3PA 2WTWA 2VTSA 3FYJX 3A7IA 3OWKA 2CKOA 4DGMA 5HOAA 2BZHB 5HU3A 3MV5A 3G0FA 3IW4A 3R00A 4M7IA 3TWJA 1A48A 4EKKA 3VQUA 4G3FA 3RI1A 4QYHA 2HAKA 3L9MA 3OF0A 3BX5A 3O51A 4LGHA 1AGWA 3RCDA 3F82A 3VW6A 3BQRA 5AR2A 4OTQA 3F5XA 4JNWA 4HVDA 3DLSA 5AA8A 1STCE 5EOBA 2QHNA 3L8XA 5BQ0A 5ANEA 4N6ZA 4O6LA 1H0VA 5GZAA 1MRYA 2UW6A 4Y85A 4BFMA 3K3JA 4S31A 5CQUA 4M0ZA 4Q9ZA 4GVAA 2XIXA 2HY81 5AWMA 3PVWA 4RQVA 3TJCA 3DS6A 1OUKA 3WILA 2ITPA 2WEIA 1PRYA 4BDKA 4HGEA 2O64A 3NNXA 3VF9A 1P5EA 1LP4A 3B8RA 4NL0A 4RIOA 2XNNA 4RZWA 3G51A 3S4QA 3Q4ZA 2VGOA 5AR7A 2IW8A 3BI6A 3KXNA 2GPHA 1VEBA 4JAJA 4BHZA 2B0QA 2G9XA 2JDRA 2WEVA 4LQMA 1DAWA 1ZYDA 5HTIA 4HVIA 1F3MC 1NXKA 2GNLA 2VUWA 4DTBA 2WB8A 4WA9A 1W0XC 4ARKA 2XNBA 3SXSA 3CQUA 4QMLA 3ACKA 3W10A 1MQBA 4MBIA 2PTKA 4E6QA 5CU0A 4USEA 5ICPA 4BZDA 3HMOA 5EFQA 3S00A 1W83A 2JKKA 4XX9A 3IDCA 4PP7A 4U0IA 4DHFA 3ZBXA 1ZAOA 1OVEA 3P5KA 4LRMA 2F7ZE 4QMWA 3ZCLA 1KV1A 3GU6A 2G2FA 5EYCA 3FHRA 5HCXA 4S32A 5IQIA 4UX9A 1TVOA 4JS8A 4F7LA 1KE6A 2J0JA 3TKUA 5CYIA 1YDRE 4L00A 5HGIA 4BF2A 3BYMA 3FLYA 4J8MA 3DU8A 3Q9ZA 4XH6A 3ZFMA 4C33A 1PY5A 5K4IA 5CAUA 1FVRA 2B9JA 1YXSA 2QR7A 3FZOA 4DFNA 4IDTA 4BDBA 2GNHA 2EWAA 4C4FA 4ACHA 1OIYA 4YBKA 5JQ5A 5AFVA 2W4OA 4XG8A 5A54A 4BCHA 4PPBA 1IA8A 3E7VA 4FT9A 1ZOEA 2WHBA 2YHVA 3F3VA 3FL4A 5AP7A 3HRCA 2Q0NA 5EH0A 3M11A 4B7TA 5AAFA 4B8LA 1NVSA 4EK6A 1FGIA 3EQHA 2WMRA 2B9FA 3BCEA 3D15A 5CEIA 1L8TA 1PXKA 5LOHA 1BX6A 4D9TA 1GIJA 1PXJA 4I5MA 3E62A 3VS4A 3PZEA 5IPJA 2OWBA 4FV6A 3ULIA 5CY3A 3VS3A 1J3HA 3ZTXA 3LJ2A 2QOHA 3GXLA 5DIAA 3WZKA 3P79A 3LFCA 3VS6A 3OW3A 3WF8A 4CQGA 2IVVA 3ZONA 4IIRA 1REKA 4EH4A 3R0TA 3A99A 5L6PA 2ZV9A 5M55A 3REPA 2F49A 5K0XA 3ANRA 3BPRA 4ALUA 4Z7GA 2RGPA 1H1PA 1M2RA 4FTMA 1H26A 1WVWA 3NNUA 2W9ZB 3MIYA 3LCSA 3UO4A 4GFGA 2Y6OA 3QRTA 5FM3A 4BKJA 3HUBA 4P90A 5HTCA 3UMWA 1PF8A 3QTRA 2W1ZA 4HPUE 3QALE 2HOGA 3Q53A 3VUMA 4EH2A 2QO2A 2Y6MA 2JDTA 3PLSA 2VU3A 2X7FA 4JDJA 3AOXA 3QTXA 1W82A 2WTCA 3SRVA 5FDPA 5JMSA 4XV3A 2H6DA 4Y46A 3EWHA 4KABA 2X8IA 3LCDA 4XCUA 3SKCA 4BVUA 4GRBA 4WUNA 4JRVA 3CIKA 5HE0A 3VS0A 4EEVA 3DV3A 3OCGA 1ZXEA 1ATPE 2X39A 3H10A 5B2LA 1Q3DA 4A07A 3DDPA 3PFQA 3GEQA 3KVXA 2HELA 4TXCA 4MXCA 2J4ZA 4HYHA 2FSMX 4RWKA 2CMWA 3UPZA 5I3OA 2C47A 2ITTA 3FMNA 3ZLSA 4BDCA 1B39A 4O7VA 1KE7A 5ANIA 2EXEA 1IAHA 4ZSAA 4AACA 2XJ2A 1YI3A 2BPMA 2YM6A 2Y4PA 1Z57A 2AC5A 4QNYA 4E4LA 3ZFXA 3ZYAA 4JIAA 1ZYJA 1PKDA 5AX3A 3SX9A 1CSNA 3DBCA 4WT6A 2VWXA 4FZDB 4QMVA 5CU6A 2RFNA 1ZMWA 3HDNA 4EH5A 2B54A 3SXRA 2WO6A 4KBAA 3WZUA 3R8VA 2GS6A 2GDOA 2YDKA 5HO6A 5IUGA 1CKIA 3AMBA 4GV1A 1FVVA 4K9YA 3PE1A 4FV1A 1WBWA 4FF8A 4EQMA 4TT7A 1KWPA 4NH1A 1YOJA 4MNEB 3UG2A 4MXAA 2QR8A 4O91A 4ZMFA 1R3CA 4O7WA 5TT7A 3I5NA 4E6CA 2R64A 1WBTA 3SW4A 4V05A 4BR3A 4U79A 4FIIA 1JKSA 3GU4A 5ACBC 5ITAA 3WOWA 3PWYA 5EYDA 3R9DA 3B8QA 5ACKA 3HECA 4BBMA 3PRIA 5LWNA 2I40A 1OKWA 2BTRA 4I1ZA 4GS6A 3TTJA 1SZMA 2XYUA 3V5QA 1G3NA 4CTBA 2NP8A 5C01A 4NFNA 5FTQA 3KREA 2OH4A 2DYLA 4EQUA 4ITJA 5JFSA 3OFMA 3UJGA 4FTTA 4DF3A 3QC4A 5JFWA 3T3UA 4I0RA 3ZDIA 4EOSA 2PMNX 4TKSA 2KTYA 3VHEA 4HGTA 4B99A 3A4PA 5BNJA 4CKIA 5LMKA 3OUKA 4QMQA 5D9HA 2OLCA 3ERKA 3ZMMA 3FMMA 1HOWA 3UYSA 4ANSA 3QHWA 4R78A 3DKGA 4FA2A 4X2FA 4L7FA 5J5SA 1H0WA 2RSVA 1NY3A 5KZ0A 3QQJA 4AQCA 1J7UA 5CI7A 4QP7A 3QQKA 4RJ8A 3IPHA 3COKA 3GU8A 4G6LA 4O0SA 3MTLA 4PL4A 4D4SA 2CLXA 3H0ZA 4J71A 3UBDA 4C3FA 1OL1A 2W5AA 3SV0A 5AAEA 1UWHA 2VWVA 2HZ4A 4ASZA 4QMOA 4S33A 5A4LA 1UNLA 3AT2A 3BLHA 4K2RA 3W2RA 2QO7A 3UVQA 4JG7A 4KIQA 2YLEA 2GS7A 2WMAA 4TWNA 4BTJA 3FI3A 4E4XA 5KBQA 4W4VA 2VWZA 1R0EA 3TV6A 3BZ3A 2R7BA 4EOKA 5FBNC 5AMNA 5E92A 1Y57A 2X4FA 3HEGA 2VTPA 1IR3A 2WIHA 4BCJA 4FKSA 2G2IA 3FQSA 3QUPA 4KIOA 3F66A 3OWLA 4QO9A 5BPYA 3MA3A 4QQTA 1P2AA 4OBOA 5HTBA 4A9YA 4ZSGA 3PUPA 4D4RA 1H01A 4JX7A 3A7GA 4W4WA 4M8TA 4DITA 4XG9A 4K1BA 4GJ3A 4IHPA 3G6HA 4L68A 3SOCA 1PW2A 3TNIA 4BN1A 4CD0A 4YBJA 5JSMA 3LXPA 1XBAA 4AZFA 5EI2A 3UO5A 3DNEA 2W1CA 4QP9A 4R1YA 2OXDA 2Z7QA 3VUIA 3DAKA 5JKGA 3DTCA 3IK3A 5C03A 1OKVA 1VYZA 3JVSA 3EL7A 3IG7A 1MP8A 1YWRA 4BCGA 4GT5A 4IAKA 3NZ0A 3HRFA 2UZOA 2PHKA 4C2WA 5IEXA 5C8NA 4HGSA 2C1BA 4RVKA 4F65A 4EOPA 2XK6A 1I44A 1NA7A 1Q99A 4XBRA 4D2SA 3SG9A 2C6DA 4F08A 1IA9A 2YM8A 3RVGA 3CKXA 3OOMA 5DG5A 4D2WA 3F69A 3PVGA 2W5BA 1MUOA 1YHWA 2PZIA 3VRYA 4BBFA 2C6MA 4FTKA 3UVPA 2OF2A 1CTPE 2O3PA 3PY1A 4E73A 1Y6BA 5JH6A 4OBQA 2HENA 5E8SA 4EH9A 4ENYA 4NW6A 5KCVA 1PXNA 4EL9A 4YP8A 3ZLWA 3HV7A 5HBHA 4DFXE 4H3BA 4AE6A 2YZLA 3P23A 3A60A 1Q8ZA 2QONA 3CR0A 4U80A 4ZTQA 3FYKX 2BRMA 2BR1A 5JN2A 4IZYA 3RM6A 3CEKA 5JZNA 3D7TB 4XRLA 3R1NA 4GMYA 2BDWA 4UXLA 4K6ZA 1GY3A 3F88A 4RLLA 1AD5A 4ANBA 3TV4A 3SVVA 3CCNA 4BC6A 1UU9A 2ETKA 4PDOA 2CGVA 4FEQA 4FVRA 2XB7A 4Z7HA 4X3FB 4RMZA 3V04A 3BWJA 3QQHA 4UWBA 4CG8A 2E9PA 1H28A 1PHKA 1V0BA 3BV2A 4A9TA 5CAQA 4UXQA 3VBYA 4AW0A 5IMXA 4ZOGA 3FXZA 3CJGA 2PUIA 4F63A 2Y8OA 1FPUA 2BMCA 5CT7A 5C26A 3A7FA 3NLBA 2YM5A 3RAWA 4X3FA 2HW7A 2XK7A 3LQ8A 5GINE 3NYXA 4K33A 3W8LA 3CC6A 2DQ7X 2BZIB 4TTHB 1M7QA 4IM0A 3KRRA 1BI8A 4QPAA 5EW3A 4AG8A 1WMKA 4CRLA 4UMRA 5J7HA 5FQDC 5IUHA 5HNGA 3O23A 4R7IA 3LFDA 4PWNA 2R3NA 5M4UA 1H8FA 5AIRA 3V5TA 5CZIA 5L2IA 5CQWA 2OIDA 1W84A 4QMSA 4X3JA 4ZTNA 1YOLA 4YZBA 3WZJA 2XEYA 4UMUA 4A4OA 5E7RA 5BVOA 3V5LA 3KC3A 5G6VA 3D0EA 2QCSA 3NUSA 1CKPA 2NRYA 3EYHA 3V01A 4E5AX 5FG8A 3ZOSA 4HJOA 5K0KA 4I0TA 3Q96A 5DOSA 4FZAB 4JBVA 4ZSLA 2JAVA 2X7OA 2YN8A 1WBSA 3IO7A 3ACJA 4IJPA 3R9NA 4HCUA 3RNIA 3VBQA 3PIXA 3BWFA 1XHAA 2FH9A 3AD5A 3FMLA 4K8AA 3DY7A 4D2VA 3BELA 2FYSA 4XMOA 4CT1A 5EI6A 4TZRA 3HV5A 4BIEA 4H3QA 4I41A 3TUDA 4YTHA 4BKYA 3W8QA 3TT0A 3ZRKA 3CBLA 5BMSA 3GBZA 4LGGA 4FR4A 2BAJA 2RG6A 1CMKE 4K77A 3ROYA 2QKRA 5IA1A 5C4KA 5AV3A 3QFVA 1IASA 3BHTA 4D4YA 4JX3A 5A4EA 1KV2A 2C5OA 4I4FA 4MNFA 3QX2A 3VJNA 5HU9A 2BUJA 5JK3A 1UKHA 3IGOA 3K3IA 3KRXA 5FGKA 3TACA 3I81A 1YQJA 4OTPA 5AP2A 4EH3A 2R3FA 4U3ZA 3PJ8A 2A0CX 3P9JA 4M69A 2NNWB 5BMMA 2CCIA 3UYTA 2ITOA 4QMMA 5HI2A 3OW4A 3GB2A 2VX1A 3HMPA 3T9IA 3MDYA 4GKIA 1BMKA 2C3LA 4EHZA 1UU3A 4FTNA 2BCJA 2OJGA 4LMNA 2C6LA 5IISA 1GIIA 2QC6A 5KNJA 4BBEA 2W96B 2X6EA 3GI3A 3ORZA 3P78A 5A4TA 2YWPA 2C3JA 5F4NA 4WRSA 4OTGA 5HBJA 3UGCA 1SNUA 4AZSA 2R3GA 4RG0A 3R63A 4I93A 2VTAA 3FQHA 2IN6A 4CZUA 3C7QA 2W99B 5G1XA 1K9AA 2H96A 3VN9A 3GT8A 2G15A 1Q61A 3NWWA 4KAOA 5GZ8A 4FTOA 3IQ7A 4C57A 2X1NA 2YIXA 4IMYA 4UB7A 3FZTA 4ONAA 3NEWA 2BZJA 4ZJJA 4LMUA 5J1WA 4QP1A 2XIYA 3SDJA 5L6OA 2CGUA 2WQMA 3FDNA 4D0WA 2XK8A 4WSYA 5IA0A 1G8AA 1YXUA 2X2LA 4RWJA 3O50A 4DTKA 4FT5A 4DFUA 1XWSA 4YO4A 2OIBA 1Y8YA 2UV2A 1XQZA 2UW7A 4G6NA 3NS9A 3GC7A 3FBVA 4WNKA 3ZBFA 4IAFA 3RM7A 5E9EA 4G34A 4ZLYA 4J98A 5JFVA 5A14A 3OY1A 4ZMEA 3AD4A 1KE5A 1JAMA 2UZBA 3GU5A 3HP2A 3IW8A 3MH1A 4P5QA 5CASA 2BROA 3HYHA 4DH5A 3R8UA 3AC1A 2QO9A 2QU5A 4I6FA 5GIPE 3H0YA 4C4GA 3TTIA 4R3PA 1OL6A 2YISA 4O0XA 4XYFA 3KVWA 4ANLA 4BHNA 3MWUA 5EHLA 3HDMA 3DKCA 1WVXA 5DLSA 2JD5A 4NFMA 4IVCA 2UVZA 2F4JA 4D0XA 5LMBA 5DVRA 4ZTRA 2WMSA 2CKQA 5LWMA 4YZDA 1QPJA 5DRBA 4EC8A 3TUCA 3B2WA 3ZH8A 5EG3A 1MQ4A 5EQYA 2ZDTA 4HYSA 2PVRA 2UW3A 2BKZA 3IDBA 3MY0A 3NGAA 3PSBA 4QP4A 4NKSA 3TKIA 4EQCA 4IAZA 4YGAA 3E8CA 5F9EA 1W8CA 4DH7A 1DAYA 3RAIA 2X9EA 4GUBA 5M56A 1YWVA 4FIFA 3TZ7A 2W4KA 2WTKB 3N4UA 3FMJA 2JLDA 4LV5A 3PP1A 4RVTA 4ZP5A 5AP5A 3FAAA 5HG7A 5EDQA 3U4WA 5BVDA 2LAVA 5KUPA 5CEQA 5HVJA 4ACGA 4IACA 3JUHA 3FY0A 3NUPA 3R9RA 4M84A 3H9RA 4O96A 5HX6A 3NUAA 2I6LA 2B9IA 1O6LA 3KMMA 3LQ5A 5CU3A 5AR4A 4BDEA 2J0IA 4B6LA 4X21A 5FXQA 4ALVA 5ETIA 5FTGA 3II5A 3IDPA 4NT4A 3LXLA 4HNIA 3ENMA 2RIOA 1SYKA 4PRJA 3O96A 4I6QA 4QYGA 3VUKA 5FXSA 4E4NA 3QX4A 3EQCA 4UZDA 2ZV8A 2BZKB 3O17A 4G16A 3PPZA 3WI6A 3FC1X 3TNWA 1KUTA 5AM6A 3EKKA 4X2JA 3GC9A 5AUXA 3PLAE 5KMOA 3WF6A 2VTMA 4JT3A 5FP6A 5GJGA 4YC3A 4FKGA 3COHA 3QBNA 3LOKA 5AJQA 4M97A 3O0GA 4R3CA 4BGGA 4PNIA 3R8PA 4EBVA 5CALA 2UZLA 4CZTA 1PXIA 3ZS5A 4L9IA 4FKQA 3UNJA 1Z5MA 2BVAA 5H8GA 4F9WA 4USDA 2OZOA 4O7TA 4PDYA 4Y83A 3LFNA 4X6RA 3OOGA 3FZRA 3DGKA 5A4CA 4DC2A 4A9RA 3MB7A 4PMPA 4KD1A 3VBVA 3F61A 5BUJA 3DJ7A 3LLTA 4JLCA 3NUUA 4LGDA 4FC0A 4CSVA 4L7SA 3PDTA 3Q5IA 4QTCA 3DDQA 3QWKA 4FL1A 5KKRB 3N4VA 5I9YA 2X81A 4WRGA 2C6OA 5BX0A 3ZSHA 2O8YA 3D2KA 4GSBA 4APPA 1UWJA 3ODZX 2QOBA 4ZTLA 1WAKA 4G3CA 4CFNA 4LOQA 3F7WA 2OJIA 3R28A 2JFLA 2R3IA 4I24A 4LI5A 3EN5A 2XM8A 4QMXA 4V0GB 5DGZA 5M07A 4ZY5A 1J91A 3K5VA 3V5WA 4FV7A 4C35A 4E7WA 4AGUA 4A7CA 3AC2A 2FSOX 2XZSA 3I5ZA 4ZSJA 3FE3A 4QT1A 3Q6WA 4RT7A 4ITIA 2OJ9A 2YM3A 1NT2A 1E1VA 2ONLA 2B53A 3HV4A 3MFSA 3OTUA 5FEQA 4RIYB 3IW7A 4AF3A 1R39A 4EYMA 5L2TA 4HZRA 4HVSA 4HPTE 1KE9A 5EM8A 1DI9A 3EIDA 4FSTA 4GFOA 1YXTA 3RZBA 4EZ7A 3OP5A 4ZLOA 3G9NA 4AS0A 4E5WA 1H4LA 2ONLC 4F6SA 2VO7A 4ALWA 4U97A 4FIHA 4DFBA 4TN6A 4FT7A 3KGAA 4RIYA 3EL8A 3LCTA 4MH7A 5L8KA 4GL9A 3VBTA 3HV3A 2YIYA 3EFKA 3LFEA 4MVFA 5AR8A 3JY9A 5KBRA 5ETCA 4U9AA 2CKEA 4BGHA 4H05A 2ITXA 3F5GA 4UWCA 3DK7A 1UU7A 3W16A 2QKWB 4BWPA 4DGLC 3MPAA 3VW8A 4I3ZA 2NPQA 4FV0A 3GGFA 4IB5A 4L43A 3NW6A 4MQ1A 5CTPA 4QPMA 2J5EA 4MWIA 3IW5A 4CEGA 4FUYA 4FL3A 4IWDA 4RIXB 4FG8A 2XP2A 2UZWE 2VTQA 4W9WA 5AAGA 4DEAA 1BL7A 1JLUE 1Y91A 3K5UA 3OWJA 4BWXA 3IKAA 4IM2A 5H8BA 3UOKA 4H3PA 4IE9A 3NPCA 4QP6A 5B7VA 2PVKA 3EFWA 1ZOHA 2UUEA 3BEGA 3H30A 4FKOA 1JKTA 4IXPA 4WBBB 5D7VA 5HE3A 4KSQA 2C3IB 5E1SA 3UODA 4CFWA 3BYVA 4FSWA 5A6OA 4UMQA 4BICA 4ANQA 2B55A 2W0JA 3TUBA 2JAMA 3ATTA 4YJRA 5E8VA 2QOOA 3L9NA 5E8YA 4C59A 3DPKA 4O83A 3VS1A 4JBQA 4PY1A 4R6VA 3R9HA 4GG5A 3CXWA 3ORIA 3OT3A 4HYIA 3RKBA 4BKZA 4R5SA 3LVPA 1PXPA 4QYEA 4I5CA 3PPKA 3UQFA 1FINA 1L3RE 2J7TA 3EMGA 4MBLA 2C1AA 3DK6A 4RA5A 3GCPA 2W17A 3LXKA 5CF5A 2PWLA 3UIXA 2UZUE 4MKCA 3RINA 4AGDA 2X8DA 5KMJA 2XK9A 3QUEA 3A7HA 4RFZA 3NSZA 4ACMA 2Q0BA 4O7RA 5HIBA 2PVFA 4IVDA 1JKLA 5EW8A 4F1OA 4FT3A 5DFPA 5M4IA 1F5QA 2W5HA 4Z9LA 1ND4A 4FG7A 3WBLA 1B38A 2QVSE 3BBTB 5KMMA 3POZA 4E1ZA 4RPVA 3FI8A 4ZIMA 4O7YA 4OT5A 2BFXA 3NAXA 4GVJA 1HCKA 3QRKA 5IUIA 4FEXA 4U45A 1IG1A 3I60A 3M2WA 4DEBA 3CSVA 4FEUA 1X8BA 1QPCA 3LIJA 3PVBA 5DEYA 4P4CA 4ORKA 3RPYA 3IECA 3PY0A 3ZXZA 4KINA 4QTAA 5CF6A 3ANQA 1APME 2F2UA 3ZDUA 3UVRA 5EQEA 3PSCA 4YHTA 4TYIA 4DBNA 4I23A 4WNOA 3QQLA 4FSUA 2IVUA 2F7XE 3OCBA 5L8JA 2CNUA 2OICA 3D5UA 2CGWA 2F2CB 2R5TA 4JDKA 2YWVA 5IQEA 1YWNA 4O0TA 1EH4A 2WKMA 2G01A 2VNYA 3AGMA 3R22A 4FV5A 3U6HA 3LMIA 1YDSE 3R8ZA 2VAGA 5JGAA 4E5BA 2E9NA 3LCKA 5L2QA 2R3MA 5ANGA 1R1WA 3ORNA 3VUDA 3MS9A 2F57A 3NNWA 3PXQA 4GK3A 2GSFA 2OZAB 2UZVA 1M52A 3FKNA 4IX3A 4QMTA 4L45A 4K18A 5J9ZA 2KULA 3CGOA 3C4CA 3QRIA 2XIKA 4KKEA 2CCHA 3LHJA 4FG9A 5CF4A 5K5XA 3P7BA 3QTIA 1H1SA 5J7BA 4RJ3A 3UMXA 2OZAA 4NJDA 2JDSA 3DBDA 5D1JA 5FTOA 3G6GA 4B4LA 3DLZA 5K4JA 4FKRA 4F7NA 2VO0A 4ZY4A 3ZO2A 3W2SA 3MIAA 4BYJA 4B9DA 4N4SA 4ZS0A 3LMGA 2Q83A 4PMMA 4RBLA 5AUUA 5I9VA 4FTJA 4AZVA 4ZY6A 4IX5A 1H1QA 2ZM1A 3QQGA 4ZXTA 1KOAA 1S9JA 2ERZE 3W33A 3CD3A 1JSUA 3EN9A 4KNBA 5CU4A 3DFAA 3R7OA 2J2IB 2V0DA 5E8XA 5M4CA 3Q4TA 2YDJA 2ITYA 5CEPA 1FVTA 3QZHA 4ZEGA 3EQDA 2XK3A 1Q4LA 3WF9A 3BE9A 3SC1A 2A1AB 3KN6A 4EZ3A 3U6JA 3E92A 5AV2A 1UNHA 4FL2A 3TM0A 3EOCA 4NTSA 2X6DA 2WFYA 4O7ZA 3I0QA 4O2PA 2XNEA 3VC4A 4BI2A 4J52A 3R21A 2A19B 3BYUA 1RQQA 4YJSA 3Q9WA 3UIUA 5M57A 2AYPA 3FKOA 4YO6A 4RJ7A 3ZFYA 3KXXA 3UPXA 3QTUA 4OTHA 4YTCA 2XNGA 3E88A 3QD4A 4FNZA 4IC7A 3MVHA 4GCJA 4RC4A 4RVLA 2B7AA 4IVAA 5HESA 3UDBA 1A9UA 4L46A 5LCKA 4RSSA 4LOPA 3QZIA 4JVGA 4FICA 1XO2B 2PE0A 4U3YA 4Q2AA 5EM5A 4RX8A 4WNMA 1WBNA 3FMEA 4IC8A 4AW1A 4YU2A 4TYGA 4BWKA 5AP0A 1DI8A 4NCTA 4JDIA 4BTFA 3NMUF 4PUZA 4CFVA 3WF5A 3R2BA 4UEUA 5BVFA 5L3AA 4MNEA 3KXZA 3QC9A 4F9BA 2BHHA 1PMVA 4CFFA 2PVLA 3ROCA 4FMQA 4H1JA 2R3HA 4RA4A 5FD2A 4NCTC 1V0OA 4DT9A 3DCVA 5A3XA 4BCIA 5C4LA 2GU8A 3NYNA 1PXMA 4NSTA 3CQWA 4BZOA 3QCQA 4AN9A 3TXOA 3W55A 1R0PA 3DK3A 4IAYA 3UQGA 4DFLA 1OIRA 4PF4A 4FV4A 4XG4A 3QKKA 4DEDA 4NUSA 3RPSA 3PTGA 3KF4A 5E8TA 5AUVA 5FEEA 2QG5A 4Y72A 4BCQA 4G1WA 2FVDA 4JQ7A 4TRLA 2BFYA 2PVHA 2PZYA 3OCSA 3MA6A 4J99A 4AP7A 4YTFA 3UZRA 5IDPA 3C0HA 3EQPA 3ZO3A 1WFCA 3RMFA 5AUZA 2O63A 2Y0AA 4YPDA 3RCJA 4BDFA 1SNXA 2BTSA 2HXQA 4IB1A 2W1IA 1VYWA 2G2HA 3O8UA 5LMKC 5C8KA 2BAKA 4XV1A 4QRCA 3I6WA 4YLKA 4FNXA 1JSVA 3MFRA 4F4PA 2Y4IB 4TYJA 4ZAUA 3U9NA 3OD6X 5CLPA 3D2IA 4RWIA 5CZHA 4D58A 4IZAA 1ZY5A 3EB0A 5HLPA 3CTQA 3HL7A 5DE2A 4GU9A 2C6IA 4UWYA 3MPMA 5L2WA 4YZMA 4D5KA 3LPBA 5HICA 4ANOA 4IB3A 4AT4A 3RNYA 5DNRA 4DEIA 2WAJA 5T3QA 5E90A 3PE2A 1DS5A 2ITVA 3TNHA 5IF1A 3SG8A 4RWLA 2VTIA 4KUJA 3RAKA 4TY1A 5I3RA 4WD5A 3F2AA 3DQXA 3ORKA 4A9UA 2O0UA 4EH7A 2WELA 3R6XA 4Q5EA 2YCSA 2W06A 3UNZA 1SVEA 3QZFA 3I7CA 4AX8A 3O71A 3R9OA 3WF7A 5CSWA 2J90A 4H39A 3V6RA 4C38A 4BDHA 2ITUA 4IAAA 1XBCA 4DN5A 2ZM3A 3PJ1A 3LJ0A 3C4ZA 3RK7A 3H9FA 4DTAA 1OL2A 2B52A 5HVYA 3FSKA 5I4NA 3L8VA 4U5JA 4A06A 4AW2A 1B6CB 3Q4CA 3CGFA 3QCSA 2Y9QA 3HVCA 2VN9A 1JWHA 4LL0A 5CF8A 4YNEA 4JBPA 3PJ3A 4QMNA 1SM2A 4B0GA 1OL7A 5IEYA 4KKGA 4W4XA 2VTHA 4W8EA 4O84A 1OMWA 5CVGA 2R9SA 3OWPA 4FEVA 3AMAA 2VD5A 3TI1A 5IQGA 2ESMA 1ZYCA 3NR9A 3TEIA 3IW6A 1WCCA 3P0MA 4M3QA 4GK2A 3AGLA 2YACA 4OAUC 3GVUA 4IQ6A 4IZ7A 4E6AA 4DEGA 1XBBA 4YTIA 5I9WA 3FSFA 4NJ3A 3QU0A 3ZU7A 2OBJA 4ITHA 2BDJA 4DG0E 2NRUA 4L53A 5IH5A 5J9LA 5TE0A 2WD1A 3RWQA 3UZTA 5H8EA 5HO8A 4CFXA 4EJNA 3SW7A 4GJ2A 4D4VA 2VTRA 3CP9A 4GK4A 3U87A 2GQGA 4FKTA 5IZFA 2XMYA 1A06A 3NRMA 2ITZA 4YJNA 2PULA 5AA9A 2EVAA 1K3AA 5DR2A 4CVAA 2WTIA 5M53A 5J87A 3W2CA 2VTOA 3D7TA 4JQ8A 1FMOE 3KQ7A 1LEWA 3ZXTA 2O5KA 3R02A 2HXLA 2I7QA 3A62A 4CGAA 5CS6A 5GHVA 3P7AA 4RRVA 2QG7A 2AUHA 4HCTA 4DFYA 2WXVA 4YJUA 2XVDA 4OAVB 4DLIA 3L8PA 5CVHA 3MBLA 2IPXA 4X3FC 5CI6A 4J1RA 4RQKA 2QU6A 3MVMA 4QQJA 4O1OA 3ELJA 3ZSGA 2I0YA 4TWPA 1OUYA 3PA5A 5EI8A 4QTDA 1K2PA 5CWZA 3PJCA 2UW5A 5F1ZA 3H3CA 3CY2A 2XYNA 3QD3A 4MF0A 4EOJA 1DM2A 4DA5A 4DGNA 1G8SA 3FMDA 2C6TA 4I6BA 3V8WA 1Y8GA 4C36A 3NYOA 3TG1A 4CYIA 5GIOE 2PUUA 1PXLA 3EFLA 4FSMA 4IFCA 4BCOA 3ZUTA 1U4DA 2GNIA 4I21A 4XEYA 2R3LA 1XH4A 2FB8A 4M15A 5HHWA 5M44A 2QOIA 3D5WA 4Y73A 4FGBA 5CX9A 2JITA 3I7BA 4LOOA 3W2QA 3QTQA 4AAAA 2C0OA 4BTMA 4APCA 5H9BA 5KMLA 3V3VA 3A7JA 4O82A 5HE1A 5A6NA 2BRGA 5HEZA 3KKVA 1NW1A 3Q2JA 3KRJA 3SLSA 5HO7A 1XH9A 3OG7A 4N0SA 5IA2A 2XBJA 3Q52A 4OT6A 4GYIA 4YZCA 4KA3A 4O86A 4ERWA 2UZTA 3HA8A 3VHKA 4AA4A 4D2TA 3E3BX 2PUNA 4QMPA 3FJQE 3SAYA 3R7VA 3DQWA 2IZTA 3HP5A 2E9UA 2C0TA 5IKWA 4YMJA 1O6KA 4MXZA 3HA6A 4BGQA 4C37A 3RWPA 4C4IA 4BCNA 4AXAA 5DT3A 4IWPA 4GG7A 2XUUA 2V7OA 3MH0A 3ZUVA 4L44A 4WBOA 4F7JA 4EOLA 2GQSA 3R1QA 3MJ2A 2UW0A 4EH8A 2V22A 3DXNA 2GHGA 1GNGA 3R01A 5FBOA 3UQCA 2CNVA 4F9YA 1WBPA 3KXHA 4ACDA 2WMUA 3ZHPC 3UZPA 4FV3A 4IB0A 4ASDA 3I1AA 2GHMA 1YDTE 5F94A 2YDIA 2OW3A 3T8OA 2ZB1A 4F0IA 5EM6A 2OFUA 4HCVA 4RJ4A 4XG2A 3BHHA 4FKIA 2DS1A 3LAUA 3QKMA 1QPDA 3OBJA 1Q24A 2OG8A 4JAIA 5KMKA 3L9PA 4QQ5A 4ASXA 4QMZA 2PE1A 4J8NA 2V62A 3OT8A 2CPKE 3TKHA 2PZ5A 5AP3A 4C02A 1W7HA 4AW5A 2PZRA 3F3UA 4J7BA 4IZ5A 3D94A 3LFFA 2PUPA 3IS5A 2Y7JA 3LFSA 3RP9A 4FTIA 3KA0A 5IA5A 5K3YA 4BI0A 4CQEA 3V5JA 3UO6A 3NUXA 5IQBA 4DG2E 3U8WA 1GZNA 1XJDA 1AQ1A 5DWRA 2X9FA 4NM3A 4EORA 4BDGA 2EXCX 1ZLTA 2UW8A 3PP0A 1VR2A 4B8MA 4OLIA 4XLIA 1OIUA 2G1TA 5AUYA 4PDPA 2Z7SA 4JJRA 2HCKA 4IADA 4FK3A 1JKKA 3F6XA 3ZRLA 3V8TA 1U54B 4FIEA 5F95A 3DA6A 2OKRA 2YM7A 1WBVA 4O21A 4PP9A 4YJTA 4L6QA 4UMPA 3ETAA 4FTRA 4PMSA 3CKWA 3OXIA 3DKFA 3FI4A 2X8EA 4O0RA 4XJ0A 2R0IA 4L3PA 2PL0A 3HRBA 5DR6A 4O7LA 3PXYA 3EN4A 2XKCA 3VJOA 4EHVA 3U54A 2W1GA 3EZRA 5EDRA 5LMAA 5D7AA 4H58A 2WGJA 3BHYA 3F3ZA 4UYNA 3DAEA 3AMYA 3FPMA 1YI4A 4KBKA 2WIPA 2WQEA 2FO0A 5HNBA 5JQ8A 5KHWA 2XIRA 1SMHA 4EHEA 4EK4A 5C8MA 3KN5A 4QYFA 5AR3A 4BRXA 4JI9A 4W9XA 3KK9A 3E64A 3TV7A 4FEWA 3F2RA 4DGOA 2XCKA 1T45A 2R4BA 2GFCA 2PZPA 2RL5A 4QNAA 4MWHA 3L8SA 4UN0C 5JRQA 5FWKK 1TQMA 3DB6A 3VS2A 4QP3A 3VWAA 4JOAA 4CG9A 4ZTSA 2JBPA 3S0OA 4UY9A 3CJFA 2XKFA 5JEBA 4IWOA 1WVYA 4JIKA 3NAYA 3JYAA 5LXMA 4C8BA 3GOKA 4D9UA 3HUCA 3QXPA 4XG3A 4U41A 2A27A 4GIHA 3CPBA 4U7ZA 2WQOA 5CAVA 4JDHA 5LVOA 4NIFB 3R2YA 4WG4A 3VO3A 4Y95A 4H36A 1BLXA 4ZTMA 4GUEA 3MI9A 4C0TA 3K2LA 2QI8A 2WTKC 1UVRA 2R3KA 3KK8A 4OBPA 3ORMA 2BALA 4EUTA 1JVPP 2ITNA 4RIWB 2IVSA 5TO8A 4TYHB 5LVNA 2HZ0A 2XF0A 3G2FA 1TQIA 1U46A 3AXWA 2IVTA 3W1FA 3MN3A 1ZZ2A 3MFUA 5HVKA 5I9XA 3ZO4A 5GNKA 5EHYA 3KL8A 2BHEA 4FNWA 2FSTX 2P33A 3DFCB 4LM5A 5FEDA 3RHXA 3WZEA 4DLJA 3U6IA 2X2KA 3C4XA 4ZK5A 4A4LA 3C4EA 3D5VA 3F7ZA 3RK9A 4BDJA 2IWIA 2ERKA 4HZSA 3AG9A 4NWMA 4TYHA 4XV9A 5DRDA 3NVKI 2VGPA 4O38A 1RW8A 5EHOA 3GNIB 3FI2A 4L8MA 3ZSIA 3OTVA 3Q9YA 3LFAA 1M2PA 4FSYA 2C5XA 4ID7A 2C4GA 4I22A 2QHMA 4M68A 4CYJA 1W98A 5BUIA 5KO1A 2UW4A 2JKMA 2BAQA 4BZNA 3D83A 2R3OA 4O0YA 3QCYA 2H9VA 4U8ZA 2PU8A 4FV2A 5EOLA 4JQEA 4U81A 5CVFA 3MY1A 3O8TA 5IA3A 1XH6A 3EHAA 3HMNA 3KCFA 4CNHA 3ZZEA 4RX5A 4PMTA 5HLWA 2BRNA 1ERKA 4D2RA 2Z7LA 3ZEPA 4GIIA 1CM8A 3GQIA 3UIMA 4E4MA 5ETFA 3G15A 4BCKA 3HAVA 3DBFA 4N57A 3MSSA 2A4LA 3KULB 5CSXA 2QQ7A 2YA9A 4GEOA 5JZJA 3LW0A 3RPRA 4F0GA 4MF1A 4W8DA 2UVYA 2YCFA 5DA3A 1R78A 3GQLA 5LCJA 3PVUA 2WPAA 2GQRA 4F0FA 4KIKB 5DPVA 5HNIX 3EQBA 3PXZA 4ACCA 3UP7A 3CD8A 4L3LA 3TIZA 5KKRC 2W1DA 2IG7A 4MCVA 3POOA 2IZSA 3QLFA 4DBXA 2EB3A 2GFSA 1Y6AA 4V0GA 3TZ8A 3UC4A 4DT8A 1LEZA 4OGRA 5AUTA 4KKHA 2ETRA 5J79A 3CTHA 2XBAA 4KBCA 1SVHA 4WOVA 2PVNA 3R7EA 2VWWA 1S9IA 5AV1A 3FLQA 3HV6A 4KIKA 1XKKA 3BQCA 2EB2A 4I94A 3TNQB 5ANKA 1YXXA 3Q5ZA 5BVEA 2PSQA 3GP0A 4BB4A 3FV8A 2J51A 4C2VA 3MESA 3FLWA 3FLNC 4C7TA 3A8XA 3S1HA 2R3RA 1GZOA 3A4OX 4NW5A 5FP5A 2CNQA 1FQ1B 4MD7E 1P4OA 4D5HA 3Q9XA 4IEBA 2CN5A 1YI6A 2OK1A 2OU7A 5E91A 3R7GA 5HKMA 3O2MA 4CLJA 2PYWA 3MTFA 4II5A 3LFBA 4D28A 3PYYA 4PX6A 4V01A 4YC6A 3FC2A 3IOKA 2IW9A 3KCKA 5DHJA 4O1PA 3AC4A 3E3PA 4FSRA 2GCDA 5JGBA 4OTDA 3CLYA 1FGKA 1Q8YA 4QMYA 1JPAA 5E8WA 3QL8A 4C34A 3QQUA 1GOLA 4QOXA 2VRXA 4Z3VA 3KXGA 2F9GA 2VNWA 5HQ0A 2P4IA 5CNOA 3D14A 5DH3A 5A9UA 3G33A 5T6KA 1H24A 1Q62A 3FMHA 5AX9A 4M67A 4RIXA 2IZUA 3I0OA 2YITA 4BL1A 5HLNA 3FPQA 3S95A 2ITWA 2V7AA 3KMWA 3WE8A 4BCFA 4D1ZA 4F9AA 2UVXA 3ZM9A 4IX6A 5J5TA 4X6QC 2FA2A 2WOTA 5I9UA 4JR3A 1G5SA 4O22A 2BDFA 3UOLA 3R1YA 3EYGA 5L6WL 3HX4A 4AGWA 4DYMA 3BU3A 4X2KA 1UA2A 3A61A 4CKRA 3MY5A 4FUXA 4M66A 4F70A 3FKLA 3ORXA 4HNFA 2WOUA 1J1BA 3E8EA 3FZ1A 2QOFA 4BCMA 1H1WA 4USFA 2C30A 2R2PA 1URWA 3SGCA 5AP6A 5KMIA 5CEOA 2OJJA 4EK8A 2CN8A 4ZJIA 1YKRA 3VF8A 2GMXA 4WG5A 2C69A 2PMLX 5T68A 2XJ1A 3BEAA 4OTFA 1NVRA 4CCBA 3OCTA 4NM7A 3R04A 4YHFA 3BGZA 2ETMA 4IDVA 3ZO1A 5CXZA 5HX8A 3F5UA 4AN3A 3I6UA 3FXWA 3SA0A 4Q9SA 2R0UA 4D1SA 3DNDA 4Y8DA 3RK5A 1YRPA 3GCSA 5CAOA 3I4BA 3UOJA 4GU6A 3DT1A 3A8WA 3VUGA 1YHSA 4BIDA 3EH9A 4EH6A 3NIEA 1T46A 2C6EA 4P2KA 1PXOA 4UV0A 3EFJA 4I6HA 2OXXA 1YVJA 4PL3A 4AN2A 3F5PA 2C5YA 4MBJA 2VX3A 3V8SA 4HYUA 3BYOA 4WG3A 3QA8A 4S2ZA 4RLKA 3ODYX 1QCFA 4C3RA 3C50A 5AV4A 4O0UA 2BKKA 2IJMA 3VUHA 5BUEA 4EYJA 3QZGA 3VS5A 4MD9E 2PMOX 4TYEA 1XH5A 4X2NA 3BV3A 3OEFX 1NVQA 4L3JA 5HE2A 4ASEA 2W4JA 1HCLA 2FSLX 2I0VA 5TR6A 5IQFA 5IQDA 2OFVA 3L9LA 3NW7A 2X0GA 1RE8A 3LE6A 4FE2A 4FZFB 3CPCA 4GYGA 2GNFA 2HWOA 2NO3A 2WTDA 3AC8A 3BYSA 4X0MA 4EKLA 1H27A 5AP4A 3DAJA 5BYYA 3OEZA 4XHKB 2HZNA 2JKQA 3R1SA 5CSPA 1VJYA 3MJ1A 4X2GA 2O2UA 4YNOA 4DH1A 3TDVA 3VUTA 3WARA 4M12A 2QLQA 4LG4A 2VTTA 4IWQA 2GTMA 4JR7A 5JFXA 3QYZA 2GTNA 2ITQA 1OECA 2RKUA 4GT4A 2WZJA 2WU6A 4UYAA 4Y5QA 5EW9A 4F1MA 4Z16A 4CMOA 1O9UA 3THBA 4DCAA 2WTVA 3KMUA 3W2OA 2YJRA 2Z2WA 2PVYA 5FXRA 2PPQA 2YM4A 1OPKA 4OW8A 4XBUA 2ZDUA 4KRCA 4RX7A 4ANMA 3VNTA 5AEPA 3HLLA 4CV8A 2XNMA 4UZHA 2XK4A 3SXFA 3OBGA 4AZWA 1KE8A 3E7OA 3Q3BA 4WHZA 3SRVB 4BDDA 1LR4A 1ZRZA 2P2HA 4C58A 4F6UA 5IH6A 3LMHA 5ETAA 4PPAA 3BRBA 4AU8A 4V04A 2JGZA 5JRSA 3BU6A 3PIYA 4D2PA 3QD0A 2W1FA 5E1EA 2JDOA 3C1XA 4EC9A 2CGXA 2HW6A 2LGCA 3QCXA 3WYXA 3AT3A 2EUFB 3IOPA 3QGYA 4XOZA 1YXVA 4PQNA 5HIDA 3VBWA 4TWCA 4Z55A 3E93A 3TDWA 5I0BA 3OVVA 4AOTA 2F7EE 5CU2A 4GT3A 4J96A 3QKLA 3QYWA 1JNKA 4UMTA 5AR5A 1BL6A 4XG6A 5FRIA 3RALA 1U5QA 3OXZA 4EJ7A 4C4EA 1OKZA 3QAME 2E2BA 3NW5A 1OI9A 4IANA 3FXXA 2CKPA 2CDZA 1REJA 2PVJA 4MEDA 4A9SA 5M08A 3VIDA 4ERKA 4F99A 4FK6A 3DXQA 5M09A 4IH8A 4RFYA 3NCZA 2V55A 4IVBA 4NM0A 3ORPA 3PA3A 4Y5HA 2GS2A 3C5UA 3GUBA 3ATSA 2BRHA 3DBQA 3W32A 3ZLYA 2QOQA 1Q97A 1UU8A 3OY3A 4FKPA 3FHIA 3ZM4A 3PPJA 3HMMA 4FT0A 4EOQA 4MYGA 4H1MA 2VTJA 4AGCA 4FSZA 3GCUA 4D1XA 2R3PA 4R3RA 4EBWA 3BKBA 4XP3A 4XG7A 5A46A 2UZEA 3FWQA 2ZOQA 4E8AA 4R1VA 3R30A 3D7ZA 2I0EA 3F9NA 4F64A 1U5RA 4EUUA 3GCQA 3GCVA 2UZNA 2WMTA 1O6YA 1ZYSA 2E9OA 5HG9A 1OPJA 5CNNA 1OITA 3RGFA 2JIUA 2RF9A 2WTJA 4J95A 1PMUA 3OROA 3K54A 3PIZA 4MK0A 4TNDA 3EQGA 4E26A 1BI7A 3DZQA 4IX4A 5TF9A 1JOWB 4ZZMA 3JPVA 3WE4A 5KE0A 4FTQA 5IEVA 1OPLA 4MHAA 3NDMA 4EZ5A 2H34A 4KB8A 5BYZA 3H4JA 3UTOA 4EWQA 2YAAA 3U4UA 3F3WA 3VULA 3D9VA 3KU2A 1J1CA 3S3IA 4CZYB 3VRZA 2WMQA 4EOMA 2EU9A 5EYMA 3P86A 4BIBA 3BLRA 4G31A 1ZMVA 4EK3A 5KZIA 3FZPA 1PMNA 5E4HA 2H8HA 4DAWA 2YIWA 3AQVA 4WIHA 5CEKA 2Z60A 1OGUA 3Q2MA 4LFIA 3SQQA 3COMA 2OJFE 3O7LD 4OTIA 4BTKA 5IU2A 2C0IA 4DFZE 1JQHA 3MH3A 5EKNA 1IAJA 1Q8UA 4PDSA 3OHTA 2B1PA 3Q4UA 4AA5A 3C0IA 3U9CA 4XUFA 3RBWA 4IBMA 5GZ9A 5HIEA 1FBNA 4KS8A 4IFGA 3VBXA 3BLQA 4YURA 4FSQA 2YFXA 4C61A 3ZRMA 4QD6A 4NEUA 1U59A 1E1XA 4C62A 4C4HA 2Y4IC 1H08A 4FTAA 4G6OA 3H9OA 2YCQA 4MQ2A 4I20A 5H2UA 3WIGA 2W1EA 4A4XA 4E3CA 4F1TA 2I1MA 5DMZA 5E8UA 1UKIA 2I0HA 2VX0A 2P2IA 2OO8X 3ITZA 4KWPA 4QPSA 5M51A 4G3EA 3OS3A 4R5YA 4CV9A 4CLIA 2GNJA 5DN3A 2REIA 4F7SA 2W1HA 3JS2A 2ZAZA 4YZNA 1XH8A 3GFEA 1JBPE 3ORLA 2UZDA 3C51A 4RFMA 5C9CA 3NCGA 1ZWSA 2XEZA 3MB6A 4J53A 5LJJA 3VAPA 3DBEA 4G5PA 2ZMDA 2C5NA 4M13A 5DT0A 3M42A 3QTZA 2DUVA 2BIKB 2XIZA 4BDIA 5HORA 5BYLA 3LZBA 2IZRA 4I92A 4FNYA 4G9RA 3OXTA 1Q41A 2XRUA 1KOBA 2JDVA 3UG1A 3IGGA 4FKJA 5IDNA 1TKIA 3AC5A 4YSJA 2Z7RA 1CKJA 4YC8A 4CT2A 3DXPA 1P4FA 1FMKA 2WMWA 2ZV2A 3D5XA 4FV9A 4R7HA 4K0YA 3PXFA 1F0QA 3NIZA 3G9LX 4J97A 4EOOA 1UV5A 2QODA 1M14A 3PWDA 3DTWA 4U43A 5JGDA 4TL0A 4O27B 3BBWA 5D12A 2Z02A 2JKOA 1XH7A 4RVMA 4WUAA 2SRCA 4I4EA 2OF4A 5D41A 3S2PA 4CMTA 2C68A 1V0PA 1Z9XA 3MGYA 3C4WA 4JL9A 2J9MA 5L4QA 5EDPA 3LXNA 4CRSA 1QL6A 3R7UA 2X4ZA 4XRJA 4YUQA 4I5HA 2VWYA 4MAOA 4CFUA 1M2QA 2RFSA 4LYNA 4PNKA 1UNGA 4Q5HA 4AUAA 3UNKA 5AV0A 5J9YA 1GZKA 3ET7A 2JIVA
chains in the Genus database with same CATH superfamily
2R7IA 3O8PA 3PXKA 3EZVA 4YPSA 5FLFA 4HVHA 1BUHA 2QOCA 2WMBA 3TIYA 3TCPA 4ENXA 4EONA 2WNTA 4YJOA 5EYKA 2J0MB 1OL5A 4KSPA 3ULZA 4FTUA 3HZTA 3Q6UA 3R73A 4YLLA 4EHGA 3SHEA 1VZOA 5DYJA 5C27A 1GIHA 4XNEA 5IMEA 3RHKA 1MRVA 2VZ6A 1LPUA 2QD9A 2XCHA 4GH2A 3TNPC 4YLJA 3GOPA 4CKJA 4ZTHA 5HD4A 4AFJA 3M1SA 2A2AA 3NUYA 5LVLA 3LQ3A 3C0GA 3EQIA 3MVLA 4FZ6A 4LRKA 4FOCA 4G5JA 4TW9A 5LARA 4LV8A 4BCPA 4RGJA 4XLVA 3R8LA 4IAIA 3ML1A 1RJBA 4U42A 3ZLXA 5ANDA 3MYGA 4GW8A 3QQFA 5FM2A 3R7YA 4TWOA 2YERA 3WIKA 4S34A 3RTPA 2XH5A 5AUWA 4FSNA 3W18A 3JXWA 4CMUA 5EKOA 3RJCA 3OUNB 1Q8WA 3HAMA 4R7BA 2QOKA 1P14A 3W2PA 5B2KA 3PRFA 1BYGA 2UW9A 4FX3A 5TOZA 3BGQA 4AWIA 3MPTA 4RX9A 5IA4A 3FMKA 2XRWA 5K5NA 5IQCA 1SVGA 2BRBA 2XJ0A 1OBGA 4U40A 2HK5A 4F09A 3EJ1A 3CS9A 2XNOA 3G5DA 2WU7A 1XR1A 2CHLA 4AT3A 5I5ZA 1RDQE 4MX9A 3PZHA 3VVHA 4XP0A 3P1AA 4DGGA 3N51A 3QTWA 1OKYA 3Q60A 4JG6A 2JFMA 2WQBA 1Q8TA 3E8DA 3PY3A 3IONA 3WZDA 2B9HA 2VTLA 3FY2A 3T3VA 3FEGA 2YEXA 4PPCA 3TL8A 2ACXA 2VWIA 3U51A 3QF9A 5CXHA 4YJVA 2QURA 3LFQA 3NNVA 3KRWA 3SD0A 2PVMA 3Q32A 4D55A 4RJ6A 3EN7A 4QTEA 1OM1A 4P7EA 2OIQA 4M69B 4FKWA 4ZLZA 1ZZLA 1H25A 3QA0A 5IQHA 2P0CA 4GKHA 2C3KA 5EQPA 2ZB0A 2VO6A 4YHJA 4WNPA 4GFMA 5DEWA 3MW1A 4DH3A 3GU7A 2OSCA 4UALA 5JT2A 5LVPA 3QXOA 5DI1A 3HGKA 3FLSA 1PYEA 2BIYA 3VQHA 5ANJA 3MH2A 4I5PA 4O7SA 3E5AA 1ZOGA 2FGIA 3GC8A 4FOBA 2JIIA 4NM5A 5CAPA 2PK9A 5DBXA 1OIQA 3ALOA 3QRUA 1OBDA 2VO3A 2Z8CA 4PL5A 3ZZWA 4L67A 2VTNA 2JBOA 4L42A 1XMMA 4FI1A 3PXRA 4L01A 5GJFA 3PG1A 2YZAA 4HGLA 5HD7A 4C4JA 3AD6A 3UIBA 3DOGA 3I79A 5KX8A 3NVMB 5CEMA 3N4TA 2ZV7A 5M06A 4UBAA 4ANNA 3C4FA 2ZJWA 3KXMA 4KS7A 4IM3A 5CANA 3QLGA 2HIWA 4QTBA 3CQEA 3QD2B 2XNPA 5HG8A 4O2ZA 4XV2A 2V5QA 3TZ9A 4MTAA 1Q5KA 3KFAA 2VWUA 1LUFA 2J0LA 2J50A 3G0EA 4L52A 5BVKA 4WSQA 4ZJVA 4QDEA 3AT4A 3ZEWA 3GC0A 3KIOC 4WKQA 5HG5A 1WZYA 3BHUA 3RAHA 3RZFA 4G3GA 2CLQA 4TNBA 4JG8A 2CSNA 2OGVA 5HCYA 2X7GA 2O65A 2ZM4A 4G2FA 2QOLA 3TZMA 4AA0A 2YIQA 1MRUA 2YJSA 4NYEA 4JBOA 2C5VA 5EK7A 4DINA 5GJDA 3HKOA 2HWPA 4BDAA 5DR9A 2J5FA 1H07A 3KEXA 4AOIA 1ZY4A 2OH0E 4MXYA 3A2CA 1OZ1A 3AC3A 4NKAA 4QP8A 4RJ5A 3T9TA 1J7IA 4DE4A 1ZMUA 1BKXA 4FTLA 4IW0A 3ENHA 5HBEA 3C5IA 4HW7A 5TKDA 3TJDA 3MVJA 4NTTA 2GNGA 2HY0A 1U54A 3QHRA 4X7QA 4XP2A 3V6SA 4PV0A 5AIKA 2YIRA 2IW6A 3QGWA 1JSTA 3PSDA 5HCZA 1PMEA 3EQRA 3KB7A 3TN8A 2VWBA 5C1QB 5M4FA 3LCOA 4AE9A 4O4FA 5EM7A 5F20A 1J7LA 3OC1A 1OGYA 1I09A 2PY3A 4RC3A 4O7NA 4JRNA 5J1VA 3NYVA 3GENA 4EK5A 4IJ9A 1URCA 4PTCA 2XS0A 4XOYA 1QMZA 4CTCA 1IEPA 3UOHA 5J8IA 4G9CA 2RG5A 2CJMA 3B2TA 3VS7A 1KSWA 4M0YA 4E6DA 1QPEA 2ZYBA 3KF7A 2JEDA 3KRLA 2FUMA 3MFTA 1GJOA 1WBOA 4N6YA 2ZMCA 5B0XA 3DJ6A 3L1SA 2PE2A 3FL5A 4FZ7A 4CXAA 1M17A 3FZSA 5CSHA 3BHVA 3O7LB 1PYXA 4U6RA 4CCUA 2C6KA 4DEHA 4R77A 3LM5A 4RZVA 4DH8A 5CSVA 4OTWA 1GAGA 3LM0A 4HOKA 3E87A 5D10A 3FLZA 3P4KA 3R7IA 4MD8E 4ZS4A 2EXMA 4KRDA 3Q04A 3OZ6A 4LL5A 1Q3WA 4XS2A 3JVRA 4FIGA 4BI1A 4LUEA 2VV9A 4FVQA 3ZC6A 1YOMA 5FUTA 2X2MA 4O6EA 1FOTA 4NIFA 5AADA 5BVNA 3PG3A 3U55A 3ID6C 2P3GX 2W05A 4NZWB 3R8MA 1GZ8A 2W9FB 4QYYA 3UP2A 5B2MA 3F3TA 3ALNA 5BVWA 4PTEA 5LQFA 4ZZNA 4R8QA 3KY2A 3CTJA 4S30A 5L8LA 2R3QA 3FUPA 3BL7A 3NUNA 2PMIA 5IH4A 4EI4A 5HZNA 2ZVAA 4RIWA 3FQEA 3GFWA 3LJ1A 4YJPA 3W0OA 3DKOA 4I0SA 4NK9A 4F6WA 4YR8A 1H00A 3PA4A 1VLRA 3E8NA 1H1RA 4MXXA 1YHVA 3QWJA 4YJQA 1PJKA 4DEEA 3BIZA 3V51A 5KMNA 5L2SA 3QTSA 3LLAA 1ZYLA 2QLUA 2HYYA 1CDKA 1YW2A 4W4YA 5D11A 5ANOA 1V1KA 4PTGA 2OXYA 3RPVA 3RPOA 4FODA 5J95A 3QUDA 4BYIA 2YAKA 4AZEA 5IG1A 5CT0A 4FKLA 5CENA 1ZARA 2XKEA 4AFEA 3N9XA 2AC3A 3DZOA 3P08A 3C9WA 3HNGA 5AM7A 5LVMA 3EQFA 4LRJA 4DCEA 3LKMA 4FVPA 2DWBA 3EN6A 3E63A 2WQNA 3BE2A 4FV8A 1PKGA 3QRJA 2OI4X 4FBXA 4OTRA 3DB8A 5K9IA 3JY0A 4FKVA 4LDTA 4G17A 4RC2A 4FYNA 4CFMA 3EKNA 4TPTA 2RFDA 3BU5A 3V5PA 5FDXA 2XKDA 2J0KA 3CY3A 3D4QA 3R71A 4FTCA 2QNJA 4QP2A 2HZIA 5IQAA 2J6MA 3JR1A 4OUCA 4F9CA 4HVGA 3KULA 4E93A 2R3JA 3ZC5A 3DJ5A 4YSMA 4QQCA 3SOAA 5DT4A 4EWHA 5I9ZA 4O81A 2WMVA 4LUDA 2E9VA 4YZ9A 3UC3A 4EOIA 2WMXA 4O0VA 2P55A 2RFEA 3UE4A 3CE3A 5AP1A 3BGPA 4BY9E 4AOJA 5H3QA 2IO6A 2YABA 2B4SB 3OMVA 5A4QA 3HMIA 3ORTA 4ZZOA 4FYOA 4JXFA 4FIJA 4AZTA 3PJ2A 4E20A 4ZSEA 5KHXA 3COIA 4G3DA 2GHLA 2W7XA 3F2NA 4MXOA 1TQPA 2JC6A 4KIPA 2BILB 4FGRA 4N70A 4K11A 3G90X 1E9HA 5E8ZA 4NU1A 2XA4A 3R83A 3ZUUA 3NX8A 2XM9A 1M7NA 4AT5A 4U44A 4QMUA 3C13A 4M14A 3WYYA 3P7CA 1OB3A 4WO5A 1IRKA 4P5ZA 4OR5A 2YLFA 4DG3E 2YCRA 4O0WA 4O4CA 4FKUA 4C3PA 2WTWA 2VTSA 3FYJX 3A7IA 3OWKA 4LV7A 2CKOA 4DGMA 2A98A 5HOAA 2BZHB 5HU3A 3MV5A 3G0FA 3IW4A 3R00A 4M7IA 3TWJA 1A48A 4EKKA 3O5AA 3VQUA 4G3FA 3RI1A 4QYHA 2HAKA 3L9MA 3OF0A 3BX5A 3O51A 4LGHA 1AGWA 3RCDA 3F82A 3VW6A 3BQRA 5AR2A 4OTQA 3F5XA 4JNWA 4HVDA 3DLSA 4O4BB 5AA8A 1STCE 5EOBA 2QHNA 3L8XA 5BQ0A 5ANEA 4N6ZA 4O6LA 1H0VA 5GZAA 1MRYA 2UW6A 4Y85A 4BFMA 3K3JA 4S31A 5CQUA 4M0ZA 4Q9ZA 4GVAA 2XIXA 2HY81 5AWMA 3PVWA 4RQVA 3TJCA 3DS6A 1OUKA 3WILA 2ITPA 2WEIA 1PRYA 4BDKA 4HGEA 2O64A 3NNXA 3VF9A 1P5EA 1LP4A 3B8RA 4NL0A 4RIOA 2XNNA 4RZWA 3G51A 3S4QA 3Q4ZA 2VGOA 5AR7A 2IW8A 3BI6A 3KXNA 2GPHA 1VEBA 4JAJA 4BHZA 2B0QA 2G9XA 2JDRA 2WEVA 4LQMA 1DAWA 1ZYDA 5HTIA 4HVIA 1F3MC 1NXKA 2GNLA 2VUWA 4DTBA 2WB8A 4WA9A 1W0XC 4ARKA 2XNBA 3SXSA 3CQUA 4QMLA 3ACKA 3W10A 1MQBA 4MBIA 2PTKA 4E6QA 5CU0A 4USEA 5ICPA 4BZDA 3HMOA 5EFQA 3S00A 1W83A 2JKKA 4XX9A 3IDCA 4PP7A 4U0IA 4DHFA 3ZBXA 1ZAOA 1OVEA 3P5KA 4LRMA 2F7ZE 4QMWA 3ZCLA 1KV1A 3GU6A 2G2FA 5EYCA 3FHRA 5HCXA 4S32A 5IQIA 4UX9A 1TVOA 4JS8A 4F7LA 1KE6A 2J0JA 3TKUA 5CYIA 1YDRE 4L00A 5HGIA 4BF2A 3BYMA 3FLYA 4J8MA 3DU8A 3Q9ZA 4XH6A 3ZFMA 4C33A 1PY5A 5K4IA 5CAUA 2AEGA 1FVRA 2B9JA 1YXSA 2QR7A 3FZOA 4DFNA 4IDTA 4BDBA 2GNHA 2EWAA 4C4FA 4ACHA 1OIYA 4YBKA 5JQ5A 5AFVA 2W4OA 4XG8A 5A54A 4BCHA 4PPBA 2NYAA 1IA8A 3E7VA 4FT9A 1ZOEA 2WHBA 2YHVA 3F3VA 3FL4A 5AP7A 3HRCA 2Q0NA 5EH0A 3M11A 4B7TA 5AAFA 4B8LA 1NVSA 4EK6A 1FGIA 3EQHA 2WMRA 2B9FA 3BCEA 3D15A 5CEIA 3NFFB 1L8TA 1PXKA 5LOHA 1BX6A 4D9TA 1GIJA 1PXJA 4I5MA 3E62A 3VS4A 3PZEA 5IPJA 2OWBA 4FV6A 3ULIA 5CY3A 3VS3A 1J3HA 3ZTXA 3LJ2A 2QOHA 3GXLA 5DIAA 3PFYA 3WZKA 3P79A 3LFCA 3VS6A 3OW3A 3WF8A 4CQGA 2IVVA 3ZONA 4IIRA 1REKA 4EH4A 3R0TA 3A99A 5L6PA 2ZV9A 5M55A 3REPA 2F49A 5K0XA 3ANRA 3BPRA 4ALUA 4Z7GA 2RGPA 1H1PA 1M2RA 4FTMA 1H26A 1WVWA 3NNUA 2W9ZB 3MIYA 3LCSA 3UO4A 4GFGA 2Y6OA 3QRTA 5FM3A 4BKJA 3HUBA 4P90A 5HTCA 3UMWA 1PF8A 3QTRA 2W1ZA 4HPUE 3QALE 2HOGA 3Q53A 3VUMA 4EH2A 2QO2A 2Y6MA 2JDTA 3PLSA 2VU3A 2X7FA 4JDJA 3AOXA 3QTXA 1W82A 3W0MA 2WTCA 3SRVA 5FDPA 5JMSA 4XV3A 2H6DA 4Y46A 3EWHA 4KABA 2X8IA 3LCDA 4XCUA 3SKCA 4BVUA 4GRBA 4WUNA 4JRVA 3CIKA 5HE0A 3VS0A 4EEVA 3DV3A 3OCGA 1ZXEA 1ATPE 2X39A 3H10A 5B2LA 1Q3DA 4A07A 3DDPA 3PFQA 3GEQA 3KVXA 2HELA 4TXCA 4MXCA 2J4ZA 4HYHA 2FSMX 4RWKA 2CMWA 3UPZA 5I3OA 2C47A 2ITTA 3FMNA 3ZLSA 4BDCA 1B39A 4O7VA 1KE7A 5ANIA 4MUQA 2EXEA 1IAHA 4ZSAA 4AACA 2XJ2A 1YI3A 2BPMA 2YM6A 4F78A 2Y4PA 1Z57A 2AC5A 4QNYA 4E4LA 3ZFXA 3ZYAA 4JIAA 3NFGB 1ZYJA 1PKDA 5AX3A 3SX9A 1CSNA 3DBCA 4WT6A 2VWXA 4FZDB 4QMVA 5CU6A 2RFNA 1ZMWA 3HDNA 4EH5A 2B54A 3SXRA 4AQKA 2WO6A 4KBAA 3WZUA 2IF8A 3R8VA 2GS6A 2GDOA 2YDKA 5HO6A 5IUGA 1CKIA 3AMBA 4GV1A 1FVVA 4K9YA 3PE1A 4FV1A 1WBWA 4FF8A 4EQMA 4TT7A 1KWPA 4NH1A 1YOJA 4MNEB 3UG2A 4MXAA 2QR8A 4O91A 4ZMFA 1R3CA 4O7WA 5TT7A 3I5NA 4E6CA 2R64A 1WBTA 3SW4A 4V05A 4BR3A 4U79A 4FIIA 1JKSA 3GU4A 5ACBC 5ITAA 3WOWA 3PWYA 5EYDA 3R9DA 3B8QA 5ACKA 3HECA 4AXDA 4BBMA 3PRIA 5LWNA 2I40A 1OKWA 2BTRA 4I1ZA 4GS6A 3TTJA 1SZMA 2XYUA 3V5QA 1G3NA 4CTBA 2NP8A 5C01A 4NFNA 5FTQA 3KREA 2OH4A 2DYLA 4EQUA 4ITJA 5JFSA 3OFMA 3UJGA 4FTTA 4DF3A 3QC4A 5JFWA 1TFFA 4BJJB 3T3UA 4I0RA 3ZDIA 4EOSA 2PMNX 4TKSA 2KTYA 3VHEA 4HGTA 4B99A 3A4PA 5BNJA 4CKIA 5LMKA 3OUKA 4QMQA 5D9HA 2OLCA 3ERKA 3ZMMA 3FMMA 1HOWA 3UYSA 4ANSA 3QHWA 4R78A 3DKGA 4FA2A 4X2FA 4L7FA 5J5SA 1H0WA 2RSVA 1NY3A 5KZ0A 3QQJA 4AQCA 1J7UA 5CI7A 4QP7A 3QQKA 4RJ8A 3IPHA 3COKA 3GU8A 4G6LA 4O0SA 3MTLA 4PL4A 4D4SA 2CLXA 3H0ZA 4J71A 3UBDA 4C3FA 1OL1A 2W5AA 3SV0A 5AAEA 1UWHA 2VWVA 2HZ4A 4ASZA 4QMOA 4S33A 5A4LA 1UNLA 3AT2A 3BLHA 4K2RA 4DDIA 3W2RA 2QO7A 3UVQA 4JG7A 4KIQA 2YLEA 2GS7A 2WMAA 4TWNA 4BTJA 3FI3A 4E4XA 5KBQA 4W4VA 2VWZA 1R0EA 3TV6A 3BZ3A 2R7BA 3P5JC 4EOKA 5FBNC 5AMNA 5E92A 1Y57A 2X4FA 3HEGA 2VTPA 1IR3A 2WIHA 4BCJA 4FKSA 2G2IA 3FQSA 3QUPA 4KIOA 3F66A 3OWLA 4QO9A 5BPYA 3MA3A 4QQTA 1P2AA 4OBOA 5HTBA 4A9YA 4ZSGA 3PUPA 4D4RA 1H01A 4JX7A 3A7GA 4W4WA 4M8TA 4DITA 4XG9A 4K1BA 4GJ3A 4IHPA 3G6HA 4L68A 3SOCA 1PW2A 3TNIA 4BN1A 4CD0A 4YBJA 5JSMA 3LXPA 1XBAA 2AQXA 4AZFA 5EI2A 3UO5A 3DNEA 2W1CA 4QP9A 4R1YA 2OXDA 2Z7QA 3VUIA 3UDTA 3DAKA 5JKGA 3DTCA 3IK3A 5C03A 1OKVA 1VYZA 3JVSA 3EL7A 3IG7A 1MP8A 1YWRA 4BCGA 4GT5A 1ST4A 4IAKA 3NZ0A 3HRFA 2UZOA 2PHKA 4C2WA 5IEXA 5C8NA 4HGSA 2C1BA 4RVKA 4F65A 4EOPA 4AXEA 2XK6A 1I44A 1NA7A 1Q99A 4XBRA 4D2SA 3SG9A 2C6DA 4F08A 1IA9A 2YM8A 3RVGA 3CKXA 3OOMA 5DG5A 4D2WA 3F69A 3PVGA 2W5BA 1MUOA 1YHWA 2PZIA 3VRYA 4BBFA 2C6MA 4FTKA 3UVPA 2OF2A 1CTPE 2O3PA 3PY1A 4E73A 1Y6BA 5JH6A 4OBQA 2HENA 5E8SA 4EH9A 4ENYA 4NW6A 5KCVA 1PXNA 4EL9A 4YP8A 3ZLWA 3HV7A 5HBHA 4DFXE 4H3BA 4AE6A 2YZLA 3P23A 3A60A 1Q8ZA 2QONA 3CR0A 4U80A 4ZTQA 3FYKX 2BRMA 2BR1A 5JN2A 3W0PA 4IZYA 3RM6A 3CEKA 5JZNA 3D7TB 4XRLA 3R1NA 4GMYA 2BDWA 4UXLA 4K6ZA 1GY3A 3F88A 4RLLA 1AD5A 4ANBA 3TV4A 3SVVA 3CCNA 4BC6A 1UU9A 2ETKA 4PDOA 2CGVA 4FEQA 4FVRA 2XB7A 4Z7HA 4X3FB 4RMZA 3V04A 3BWJA 3QQHA 4UWBA 4CG8A 2E9PA 1H28A 1PHKA 1V0BA 3BV2A 4A9TA 5CAQA 4UXQA 3VBYA 4AW0A 5IMXA 4ZOGA 3FXZA 3CJGA 2PUIA 4F63A 2Y8OA 1FPUA 2BMCA 5CT7A 5C26A 3A7FA 3NLBA 2YM5A 3RAWA 4X3FA 2HW7A 2XK7A 3LQ8A 5GINE 3NYXA 4K33A 3W8LA 3CC6A 4AXFA 2DQ7X 2BZIB 4TTHB 1M7QA 4IM0A 3KRRA 1BI8A 4QPAA 5EW3A 4AG8A 1WMKA 4CRLA 4UMRA 5J7HA 5FQDC 5IUHA 5HNGA 3O23A 4R7IA 3LFDA 4PWNA 2R3NA 5M4UA 1H8FA 5AIRA 3V5TA 5CZIA 5L2IA 5CQWA 2OIDA 1W84A 4QMSA 4X3JA 4ZTNA 1YOLA 4YZBA 3WZJA 2XEYA 4UMUA 4A4OA 5E7RA 5BVOA 3V5LA 3KC3A 5G6VA 3D0EA 2QCSA 3NUSA 1CKPA 2NRYA 3EYHA 3V01A 4E5AX 5FG8A 3ZOSA 4HJOA 5K0KA 4I0TA 3Q96A 5DOSA 4FZAB 4JBVA 4ZSLA 2JAVA 2X7OA 2YN8A 1WBSA 3IO7A 3ACJA 4IJPA 3R9NA 4HCUA 3RNIA 3VBQA 3PIXA 3BWFA 1XHAA 2FH9A 3AD5A 3FMLA 4K8AA 3DY7A 4D2VA 3BELA 2FYSA 4XMOA 4CT1A 5EI6A 4FJVA 4TZRA 3HV5A 4BIEA 4H3QA 4I41A 3TUDA 4YTHA 4BKYA 3W8QA 3TT0A 3ZRKA 3CBLA 5BMSA 3GBZA 4LGGA 4FR4A 2BAJA 2RG6A 1CMKE 4K77A 3ROYA 2QKRA 5IA1A 5C4KA 5AV3A 3QFVA 1IASA 1G8JA 3BHTA 4D4YA 4JX3A 5A4EA 1KV2A 2C5OA 4I4FA 4MNFA 3QX2A 3VJNA 5HU9A 2BUJA 5JK3A 1UKHA 3IGOA 3K3IA 3KRXA 5FGKA 3TACA 3I81A 1YQJA 4OTPA 5AP2A 4EH3A 2R3FA 4U3ZA 3PJ8A 2A0CX 3P9JA 4M69A 2NNWB 5BMMA 2CCIA 3UYTA 2ITOA 4QMMA 5HI2A 3OW4A 3GB2A 2VX1A 3HMPA 3T9IA 3MDYA 4GKIA 1BMKA 2C3LA 4EHZA 1UU3A 4FTNA 2BCJA 2OJGA 4LMNA 2C6LA 5IISA 1GIIA 2QC6A 5KNJA 4BBEA 2W96B 2X6EA 3GI3A 3ORZA 3P78A 5A4TA 2YWPA 2C3JA 5F4NA 4WRSA 4OTGA 5HBJA 3UGCA 1SNUA 4AZSA 2R3GA 4RG0A 3R63A 4I93A 2VTAA 3FQHA 2IN6A 4CZUA 3C7QA 2W99B 5G1XA 1K9AA 2H96A 3VN9A 3GT8A 2G15A 1Q61A 3NWWA 4KAOA 5GZ8A 4FTOA 3IQ7A 4C57A 2X1NA 4DHJA 2YIXA 4IMYA 4UB7A 3FZTA 4ONAA 3NEWA 2BZJA 4ZJJA 4LMUA 5J1WA 4QP1A 2XIYA 3SDJA 5L6OA 2CGUA 2WQMA 3FDNA 4D0WA 2XK8A 4WSYA 5IA0A 1G8AA 1YXUA 2X2LA 4RWJA 3O50A 4DTKA 4FT5A 4DFUA 1XWSA 4YO4A 2OIBA 1Y8YA 2UV2A 1XQZA 2UW7A 4G6NA 3NS9A 3GC7A 3FBVA 4WNKA 3ZBFA 4IAFA 4DHZA 3RM7A 5E9EA 4G34A 4ZLYA 4J98A 5JFVA 5A14A 3OY1A 4ZMEA 3AD4A 1KE5A 1JAMA 2UZBA 3GU5A 3HP2A 3IW8A 3MH1A 4P5QA 5CASA 2BROA 3HYHA 4DH5A 3R8UA 5BV3A 3AC1A 2QO9A 2QU5A 4I6FA 5GIPE 3H0YA 4C4GA 3TTIA 4R3PA 1OL6A 2YISA 4O0XA 4XYFA 3KVWA 4ANLA 4BHNA 3MWUA 5EHLA 3HDMA 3DKCA 1WVXA 5DLSA 2JD5A 4NFMA 4IVCA 2UVZA 2F4JA 4D0XA 5LMBA 5DVRA 4ZTRA 2WMSA 2CKQA 5LWMA 4YZDA 1QPJA 5DRBA 4EC8A 3TUCA 3B2WA 3ZH8A 5EG3A 1MQ4A 5EQYA 2ZDTA 4HYSA 2PVRA 4AXCA 2UW3A 2BKZA 3IDBA 3MY0A 3NGAA 3PSBA 4QP4A 4NKSA 3TKIA 4EQCA 4IAZA 4YGAA 3E8CA 5F9EA 1W8CA 4DH7A 1DAYA 3RAIA 2X9EA 4GUBA 5M56A 1YWVA 4FIFA 3TZ7A 2W4KA 2WTKB 3N4UA 3FMJA 2JLDA 4LV5A 3PP1A 4RVTA 4ZP5A 5AP5A 3FAAA 5HG7A 5EDQA 3U4WA 5BVDA 2LAVA 5KUPA 5CEQA 5HVJA 4ACGA 4IACA 3JUHA 3FY0A 3NUPA 3R9RA 4M84A 3H9RA 4O96A 5HX6A 3NUAA 2I6LA 2B9IA 1O6LA 3KMMA 3LQ5A 5CU3A 5AR4A 4BDEA 2J0IA 4B6LA 4X21A 5FXQA 4ALVA 5ETIA 5FTGA 3II5A 3IDPA 4NT4A 3LXLA 4HNIA 3ENMA 2RIOA 1SYKA 4PRJA 3O96A 4I6QA 4QYGA 3VUKA 5FXSA 4E4NA 3QX4A 3EQCA 4UZDA 2ZV8A 2BZKB 3O17A 4G16A 3PPZA 3WI6A 3FC1X 3TNWA 1KUTA 5AM6A 3EKKA 4X2JA 3GC9A 5AUXA 3PLAE 5KMOA 3WF6A 2VTMA 4JT3A 5FP6A 5GJGA 4YC3A 4FKGA 3COHA 3QBNA 3LOKA 5AJQA 4M97A 3O0GA 4R3CA 4FRFA 4BGGA 4PNIA 3R8PA 4JMQA 4EBVA 5CALA 1TZDA 2UZLA 4CZTA 1PXIA 3ZS5A 4L9IA 4FKQA 3UNJA 1Z5MA 2BVAA 5H8GA 4F9WA 4USDA 2OZOA 4O7TA 4PDYA 4Y83A 3LFNA 4X6RA 3OOGA 3FZRA 3DGKA 5A4CA 4DC2A 4A9RA 3MB7A 4PMPA 2ZFYA 4KD1A 3VBVA 3F61A 5BUJA 3DJ7A 3LLTA 4JLCA 3NUUA 4LGDA 4FC0A 4CSVA 4L7SA 3PDTA 3Q5IA 4QTCA 3DDQA 3QWKA 4FL1A 5KKRB 3N4VA 5I9YA 2X81A 4WRGA 2C6OA 5BX0A 3ZSHA 2O8YA 3D2KA 4GSBA 4APPA 1UWJA 3ODZX 2QOBA 4ZTLA 1WAKA 4G3CA 4CFNA 4LOQA 3F7WA 2OJIA 3R28A 2JFLA 2R3IA 4I24A 4LI5A 3EN5A 2XM8A 4QMXA 4V0GB 5DGZA 5M07A 4ZY5A 1J91A 3K5VA 3V5WA 4FV7A 4C35A 4E7WA 4AGUA 4A7CA 3AC2A 2FSOX 2XZSA 3I5ZA 4ZSJA 3FE3A 3TMOA 4QT1A 3Q6WA 4RT7A 4ITIA 2OJ9A 2YM3A 1NT2A 1E1VA 2ONLA 2B53A 3HV4A 3MFSA 3OTUA 5FEQA 4RIYB 3IW7A 4AF3A 1R39A 4EYMA 5L2TA 4HZRA 4HVSA 4HPTE 1KE9A 5EM8A 1DI9A 3EIDA 4FSTA 4GFOA 1YXTA 3RZBA 4EZ7A 3OP5A 4ZLOA 3G9NA 4AS0A 4E5WA 1H4LA 2ONLC 4F6SA 2VO7A 4ALWA 4U97A 4FIHA 4DFBA 4TN6A 4FT7A 3KGAA 4RIYA 3EL8A 3LCTA 4MH7A 5L8KA 4GL9A 3VBTA 3HV3A 2YIYA 3EFKA 3LFEA 4MVFA 5AR8A 3JY9A 5KBRA 5ETCA 4U9AA 2CKEA 4BGHA 4H05A 2ITXA 3F5GA 4UWCA 3DK7A 1UU7A 3W16A 2QKWB 4BWPA 4DGLC 3MPAA 3VW8A 4I3ZA 2NPQA 4FV0A 3GGFA 4IB5A 4L43A 3NW6A 4MQ1A 5CTPA 4QPMA 2J5EA 4MWIA 3IW5A 4CEGA 4FUYA 4FL3A 4IWDA 4RIXB 4FG8A 2XP2A 2UZWE