3KF7A

Crystal structure of human p38alpha complexed with a triazolopyrimidine compound
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Continued exploration of the triazolopyridine scaffold as a platform for p38 MAP kinase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 337
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kf7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kf7A01
4UYNA 5LVNA 3ET7A 2JKKA 2W5AA 4G3CA 2UW4A 4WUAA 4B99A 4QP2A 2PMNX 4ASEA 4AU8A 3QX2A 3EN5A 2PVLA 3SRVA 4O7TA 4DFUA 4BDCA 3QZFA 4OTGA 3V5PA 2YM6A 3G0EA 3HRBA 5ACBC 3CTQA 2VO0A 4TRLA 1CKIA 4NIFB 4PDPA 4W8EA 3FY2A 4O0YA 4JQEA 4HVDA 2XK9A 4O6LA 5AX9A 2IPXA 2PUNA 2JC6A 5HE1A 4QQTA 2W1IA 3RWQA 4MNEA 4PTGA 4AT3A 1MP8A 2FH9A 2YIYA 2HY0A 3BYUA 3FKOA 4YP8A 3UZPA 4ENXA 5BVFA 1UKIA 3U9NA 4IM3A 3DDQA 3HDNA 4J1RA 3QRKA 2VZ6A 3LOKA 3K3JA 5CEQA 3PP1A 4LL5A 4FKGA 2OSCA 3RNIA 4U44A 5K0KA 2UZBA 3MVMA 4WBBB 3L8SA 3F3ZA 4YJRA 5J1VA 4GFGA 2YDJA 4QYGA 4O81A 4FV4A 4FTRA 3UG1A 4JR3A 2XNBA 1NA7A 1T45A 2E9PA 3MFSA 3UVQA 4DH1A 4YR8A 2ITPA 5EQYA 4IWDA 3K2LA 5FD2A 2C6KA 5KE0A 1UWJA 5A6OA 2XBAA 2HXQA 4FSYA 2GDOA 3LFSA 4FG9A 1E1XA 2YIQA 3OW3A 4L7SA 3T9TA 5CT0A 2QG7A 3EYHA 3LW0A 4QNYA 5EW3A 5BYYA 5DT0A 5M4UA 4K11A 4O7NA 4OT6A 1U54A 3U55A 4BBFA 2GPHA 3GGFA 2I6LA 4ZXTA 3UQGA 4PMSA 3VUIA 3R0TA 3UPXA 3ZUUA 4QYHA 5D9HA 4IB1A 2HY81 3POZA 4JR7A 4ANSA 4DHFA 1P4FA 3VUKA 4R3CA 2BVAA 1IAHA 3NIZA 3UGCA 1CDKA 1U4DA 3O96A 4EK4A 5E92A 2B53A 1PXKA 5BQ0A 2PMIA 4UXLA 3DLZA 4II5A 2Y7JA 5J87A 3V51A 2ITQA 5JFXA 1NVRA 4DC2A 3DBQA 4CT2A 2F2UA 3KF7A 4JDKA 5B0XA 3A61A 4CFVA 4CTBA 2ZJWA 4PMMA 4QTCA 3S3IA 3FJQE 1GJOA 1FPUA 3O51A 2H96A 4JXFA 5FDXA 3FQEA 3AMYA 4ASXA 2WQOA 2OKRA 3DFCB 3RALA 3A7HA 2CCIA 2PZIA 3BZ3A 4KIQA 4KKGA 3F2NA 3VN9A 3NW6A 3W2CA 4ZZOA 2Z8CA 1PW2A 2XK4A 1KV1A 4FTMA 5FP5A 5TT7A 4A9RA 5L2TA 3N4VA 3A60A 3KMWA 3DU8A 4GKHA 5HIBA 3GC9A 2XYNA 1BUHA 2VWBA 4MEDA 2VX3A 4RFZA 4TN6A 3EQBA 3MY5A 3SXSA 4E6QA 4UMQA 2BZIB 3I4BA 4GU9A 2I0YA 3WIGA 4IVDA 4BTMA 4MQ2A 2G2HA 3K3IA 5H8GA 4G3EA 1HCKA 3QQLA 4XOYA 4ZZMA 4AE6A 5AP2A 3I79A 4AS0A 3U6JA 4R1YA 3MH3A 2C0TA 3QTUA 4I0TA 2H34A 3UIUA 4EBVA 4M15A 2YM8A 5DE2A 5CENA 3RHKA 3HECA 2X81A 5KHWA 2C1BA 4FNYA 4U45A 3U51A 3GCQA 4FL2A 4XLVA 2BDWA 1H8FA 1YOJA 3PA5A 4FKRA 4OTFA 4HYSA 4CQGA 4GG5A 4RPVA 4I41A 3IDPA 1SVEA 5IDNA 3SHEA 2QQ7A 2VV9A 4GS6A 3HGKA 4Y5QA 4FC0A 4XYFA 3TKHA 2VU3A 1YOLA 2GHLA 2OIDA 4GK3A 4K9YA 2IN6A 5EI6A 4Q9ZA 4XG9A 3KCFA 4Y73A 4DEBA 4HVHA 4Z7HA 1TQMA 2YAKA 3IDBA 4B8LA 4GMYA 3N4TA 2QOOA 3ACKA 3LM5A 4PL5A 4IVAA 1GIHA 5KX8A 5CSWA 3DDPA 4OTQA 2Y4IB 5CVFA 1GOLA 5ANKA 3OUNB 4ZK5A 4EJNA 1OKWA 4FYNA 2HENA 2O65A 3CGOA 5AR7A 4J53A 2YZAA 4NEUA 4DGLC 4U97A 2BDJA 4J98A 3PRIA 3VAPA 4CMUA 2XEYA 3L8VA 3PWDA 1O9UA 2UZUE 2PVRA 3FLZA 4X3FB 3ZFYA 1E1VA 3TI1A 3P1AA 3BHUA 4QYEA 4CRLA 2X4ZA 2OJJA 5H9BA 3TTJA 5DWRA 2ERKA 5D41A 5HGIA 5HTCA 3JVSA 5F95A 3IOPA 1KE5A 5AP4A 4FG8A 1FGIA 4KB8A 1GY3A 2XIYA 3ELJA 4EK6A 5HORA 4QQ5A 4JNWA 5AP5A 3MWUA 4FICA 2XM8A 4S2ZA 5D7VA 3PJ8A 4DEHA 2JKOA 4DFZE 2XIXA 4WO5A 5DOSA 4F08A 1VJYA 3SC1A 1BI8A 4RZVA 2JBPA 4JIAA 3D7TA 2PZRA 4F6UA 1YQJA 3M1SA 4MBJA 3UIBA 4FIGA 4FV6A 4M97A 3WZEA 2C6EA 4BRXA 4BYIA 3FZPA 3QD3A 4S30A 4WT6A 5I3OA 3AC5A 4RQVA 5HU9A 4TYHA 2VAGA 4M7IA 4AN3A 4XP2A 5JZJA 4QRCA 2UVZA 3B2TA 3COIA 3DKCA 2R7IA 4K8AA 4V0GB 5DG5A 3SW4A 4BTFA 4C3FA 3HUCA 4KS7A 4NM5A 4FZFB 4N6ZA 4MD8E 5LVOA 4AZFA 4MK0A 2CGVA 4D2VA 3NNUA 1W0XC 5LARA 2WTVA 4CCUA 3V3VA 1Z9XA 3AMAA 2VWUA 4PP9A 3N51A 4OTIA 4WRGA 4YHTA 5E8XA 3RI1A 4EZ3A 4BGHA 4F9YA 1YI3A 5AUVA 2IW8A 4YJTA 4YHJA 2R3IA 3FZRA 2O5KA 2W9ZB 2R3KA 3C7QA 4FTUA 4QMZA 3QWJA 4D0WA 3ZM9A 4J7BA 4K0YA 1DAWA 4W4XA 3MESA 1ZAOA 1H1SA 1ZYDA 2E2BA 5HCYA 1ZXEA 3UVRA 2BUJA 4FIFA 2VTTA 3W8QA 4QP8A 3RPYA 3R9OA 3CQEA 2BROA 3F66A 1LPUA 4U40A 3LCDA 3C0GA 5BVKA 3ZBXA 1PXOA 3OWPA 3TIZA 3G90X 4BDGA 2SRCA 3OUKA 4RWLA 3GI3A 1U59A 1W98A 2VGPA 5JGDA 4FSQA 4ZTLA 3PXFA 5HOAA 3NPCA 3RAKA 1GIJA 3KMMA 4FNZA 1XBBA 3MBLA 4PDSA 3PIZA 1Q97A 4S31A 4ZLOA 3FLNC 1Q5KA 4LV5A 3RINA 4PDOA 1REJA 3GU8A 4H3QA 2YLEA 3VS0A 1JLUE 3FUPA 3R9DA 5L8JA 5HG9A 1ZARA 2R3GA 4EH4A 1BX6A 3VBTA 4BIDA 1OL1A 4QTEA 1YWVA 4FEXA 5JRSA 2PYWA 3KRLA 5HE3A 4FOCA 3IW5A 4C02A 3FMHA 4R7BA 3W55A 5GIOE 4HJOA 4L45A 3F3VA 4EH8A 5F94A 4IE9A 4LG4A 3BBWA 2C68A 3EN7A 2ZV8A 5AFVA 1Y6BA 4ERKA 3QQKA 2WTJA 3MTFA 4YTIA 2QOLA 3NUUA 4FZAB 2WOUA 3GCUA 5AR8A 1ZLTA 3UBDA 3EB0A 3ZO2A 5LWNA 3A7JA 2W1EA 2XK7A 1F0QA 2XKFA 3ROCA 3ZRKA 3ZSGA 2EXCX 5JGAA 1FQ1B 2W4OA 2ZDTA 4R3RA 2Z2WA 3GBZA 3C5UA 3CPBA 4BIEA 2Z7QA 4WG5A 1JKTA 2RFDA 3R2YA 5CAOA 4GG7A 2P3GX 3P7AA 1ZOGA 3SA0A 4F7NA 2C1AA 5EDPA 4A4OA 1NXKA 5G1XA 3SQQA 3AD6A 3MVJA 5ANGA 5DVRA 1SZMA 4ZSEA 2X9FA 4R5YA 3AXWA 3F5PA 3DA6A 4EOKA 3F3TA 3OY1A 1Q8TA 3OEZA 3QKKA 2RIOA 3EQPA 2UW0A 3OWLA 3Q60A 5GZ8A 3NUNA 4TZRA 2XNOA 2OFUA 2PVFA 3COKA 4XX9A 4JQ7A 3C4XA 3R7GA 2WELA 4O1PA 5BMMA 4BDFA 3RZFA 5E8VA 1XKKA 5HVJA 1XBAA 4ANOA 2XJ1A 2XK3A 3CY3A 2ZMDA 4IW0A 4XLIA 3TNWA 5E9EA 1PMNA 3QQGA 5DA3A 5DEYA 4GUBA 3CIKA 3LCOA 3MVHA 2EU9A 3LXLA 3R9NA 4IADA 3PY3A 2WEIA 4AW0A 2OG8A 4DG3E 1G8SA 4PL3A 4K33A 3EFJA 2ZM3A 4RLLA 5BVDA 3A2CA 3I5ZA 1W82A 3BHYA 4DAWA 4IBMA 3HUBA 3EWHA 2I0HA 4FKJA 5TKDA 4C3RA 4RG0A 2ZB1A 3PIYA 3QRJA 1WBWA 3RKBA 4MVFA 3MJ2A 4P5ZA 1H27A 4JG6A 4QP9A 5IKWA 1CSNA 1XH6A 2QU6A 5AA8A 4EOPA 2FYSA 5KMOA 3A7FA 3P9JA 1HCLA 2VN9A 4BCKA 3C0IA 2OK1A 3OF0A 4W4YA 3LFQA 2UZTA 5EKNA 3O0GA 1W8CA 3RZBA 3TNIA 2VTSA 4FZ6A 4PTEA 4WOVA 3V6RA 4FUXA 4E26A 4EEVA 3UIXA 4EOOA 1A48A 3DV3A 3L9PA 3QXPA 2CKEA 3FBVA 4I0RA 4E93A 2PTKA 4X6QC 4L43A 4TW9A 5ANJA 3HL7A 3AC1A 1OVEA 1PKDA 4M66A 4E5BA 5KUPA 2J4ZA 4LUEA 4MX9A 3M2WA 3LMHA 4KBCA 4WIHA 5CSXA 4J8MA 2C6MA 5M53A 2C6IA 5DHJA 1JNKA 1YXXA 2BRHA 3QA8A 3R1YA 4U9AA 5AR4A 4DH3A 3T3VA 3TTIA 4ZJVA 3DBEA 3VBWA 4EQCA 2KULA 3REPA 3Q96A 5CTPA 3V5JA 1JKSA 2OH4A 3NR9A 3GENA 1OUYA 4BDIA 3VBYA 3LMIA 3ZSHA 4CYJA 4EH7A 2XEZA 4PPAA 5IG1A 3FZ1A 3QL8A 1P4OA 5H3QA 5TF9A 1GNGA 2EVAA 3KN6A 4AE9A 4BYJA 4RIXA 4U79A 2QU5A 4I5HA 3TZ7A 5A4TA 4JRNA 5CSPA 1KUTA 3O71A 2WQBA 3LPBA 4YURA 3KULB 3R28A 5M07A 5GJDA 2FUMA 1Q4LA 5FRIA 3BYVA 3OP5A 2VO7A 3RPSA 3KA0A 2NRUA 4CFUA 4EH3A 3DZOA 5CY3A 2R3MA 1A06A 3IW4A 3VS3A 4CFXA 4YNEA 4MXXA 4EYMA 3DNDA 4ZTSA 2QOQA 4EOQA 3EMGA 2ITTA 4TYEA 2GNJA 2BHEA 2G15A 5BYZA 3L9LA 3IDCA 4HYUA 2QOCA 1YDSE 4M8TA 3MH0A 4LV8A 4N0SA 4IB0A 4NTTA 4S33A 4ZSGA 5B2KA 4EK3A 4EONA 1UU3A 2WOTA 3SGCA 2HAKA 2PZYA 4EOLA 3SRVB 3BYOA 3V8WA 3MH1A 4I3ZA 1UV5A 2CLXA 2R7BA 3R63A 4K2RA 5HG7A 4FT5A 4EHEA 1YRPA 4FTJA 4ITHA 3V5TA 3ZRLA 4DGOA 3NIEA 4HZSA 4HPUE 2YM5A 4ASZA 4D2RA 3LXKA 2UW7A 3QALE 3NVKI 4QYFA 4I22A 4IWPA 3QCQA 3TV7A 3EKKA 3II5A 2WIHA 3CR0A 4MNEB 5JK3A 2CNUA 4FEVA 4OAVB 4XOZA 4UMRA 4G2FA 3ZBFA 2UW3A 3O8PA 4ITJA 2BRMA 3VUTA 4O86A 5ANDA 2JDSA 5HNGA 3VRYA 4DEDA 3QHRA 3LCTA 2VTNA 3BI6A 3QHWA 4JI9A 2VNYA 2R3PA 5CALA 3TXOA 3ZEWA 5DMZA 3F2AA 2XRUA 4GIHA 4NZWB 5KKRC 4GK4A 4DLJA 4Y95A 1PXLA 4CZYB 3NEWA 3I6WA 4I1ZA 5FM2A 3SLSA 4D4RA 5CAUA 1U54B 3MFUA 4XUFA 3V6SA 3DBFA 1ZYCA 3ZZWA 4RVMA 3R83A 2Y4PA 1T46A 2OWBA 5AMNA 4AGCA 1OPJA 3Q2MA 2Q0NA 4NFMA 2WMRA 3ZLWA 4DTAA 3AC2A 3NRMA 3O8UA 3Q9WA 2PMOX 4ORKA 4G6NA 4AA5A 2YLFA 3CEKA 4FL1A 3DJ5A 3HZTA 4BCMA 2R0IA 3QUPA 5A9UA 4RVKA 4QT1A 2GHGA 2GQGA 4BBMA 5AV4A 3VC4A 4F0FA 1CKJA 3PLSA 4A7CA 3W2PA 3WILA 4TTHB 5GJFA 2HZ0A 5CAQA 4HGTA 3ZXZA 2WKMA 3KGAA 4PMTA 4X6RA 4K18A 4MAOA 2G2FA 2CMWA 1YXTA 3E87A 4C2VA 5I5ZA 3PXQA 5HTIA 5KMLA 2W99B 2Y4IC 3E8NA 2Z7SA 4CNHA 4BIBA 2R3JA 4ANNA 4TYIA 4D2SA 4FK6A 3BU5A 2CCHA 4BTKA 5EOLA 2F49A 5E8ZA 3HEGA 2FVDA 4FSZA 3HV7A 2BZJA 3BLHA 3MPTA 2CN5A 2E9VA 4EZ7A 3H9RA 3KXGA 4ZTHA 4X3FC 2QO9A 3EQHA 4JBPA 2B9JA 3AC8A 4C4GA 3QC9A 2J0LA 3EIDA 2RG6A 4KABA 1K3AA 5DGZA 3O7LB 3VBQA 4CYIA 4CKIA 2XYUA 5H2UA 4FEUA 4ZS4A 1WVWA 3V5LA 2J0JA 3DKGA 3PSCA 1PXPA 5EFQA 5C27A 3PE1A 1H28A 1JSVA 2W96B 3OS3A 4TT7A 4XG7A 4D2WA 4DGGA 2QO2A 4FSMA 1MQBA 4TYJA 4NU1A 3IGGA 5HG5A 3BGZA 3PVWA 1NW1A 3KRWA 2WTKC 3OTUA 5BNJA 5D1JA 3RCJA 4BTJA 5JEBA 4AX8A 2I40A 3I1AA 3QTRA 4GT5A 2BRBA 3ETAA 3A8WA 3Q6WA 1IA8A 1GZOA 2QOKA 4EJ7A 3A62A 1WCCA 3KC3A 3T8OA 4WNPA 1TQIA 2FSLX 3R1NA 2OLCA 3O8TA 2YCSA 3GXLA 4KWPA 4E8AA 5BUJA 4FGRA 4FL3A 2UZDA 5J5TA 5L4QA 5CF8A 4YZ9A 3EYGA 4IFGA 3BPRA 3FXWA 3AT3A 4ASDA 1OZ1A 4K77A 4NK9A 2FB8A 3IPHA 3CP9A 2XNNA 4UB7A 4Y85A 4D1SA 5M4FA 4BC6A 5CU2A 5D7AA 3BE2A 4U0IA 5CI6A 4JIKA 4O2ZA 3DFAA 1YHWA 3QD2B 3FYKX 4QQJA 2P2IA 4AW1A 3T3UA 4RIYA 5C4KA 3NW5A 5HQ0A 5FTGA 5FG8A 1S9IA 3D2KA 4NJDA 5EKOA 4IAAA 3ZZEA 4EQMA 1Z5MA 3QCYA 4KBKA 3ORIA 4F9WA 1H0VA 2X7FA 5IQDA 1YWRA 3QWKA 5IQEA 4DCAA 2X1NA 4L7FA 4O83A 3LFAA 2QR7A 3OBJA 3RM7A 1ZMWA 5HLNA 2YHVA 3A7IA 1G3NA 3JUHA 3NVMB 3VBVA 1PXIA 3CD3A 4W4WA 5C1QB 5CU0A 3IS5A 2NPQA 3NUYA 3OXIA 3LAUA 3JYAA 3QRIA 2OICA 3KQ7A 1B38A 4BDKA 3AQVA 1H1PA 3E88A 3HV3A 4M13A 3UC3A 1UU8A 5TR6A 4DT9A 4X2KA 3VBXA 3FY0A 5AV2A 4E1ZA 3LJ1A 2VO3A 1XBCA 3NDMA 4KRDA 5IH4A 3BELA 2GNHA 3DTCA 3GVUA 3ZOSA 3GEQA 5KMIA 2J50A 3MA3A 4AQCA 2OIBA 2HZNA 3GOPA 4TXCA 5C03A 4F6SA 3BIZA 4TYHB 4YTCA 2PUIA 4EC9A 3BX5A 1M52A 4AZTA 3FHRA 3UVPA 4ZY6A 2GHMA 4U81A 3NUXA 5CNNA 1KE9A 3FXXA 4FVQA 5HIDA 4DFXE 2B9HA 4FV5A 2HK5A 3ZC5A 4BZNA 3S2PA 1QPJA 3D9VA 3GC8A 4FYOA 5ANIA 3R8VA 4B8MA 3KRJA 4A9YA 2UZNA 2WMBA 3ZM4A 4NM0A 1OL2A 3HNGA 2PWLA 4PNIA 4U43A 1R39A 3AD5A 2Q0BA 5K4JA 2JDVA 2ETMA 5AR5A 4ZSAA 3D5VA 1WAKA 4KS8A 1OPKA 4FV2A 4BR3A 2JDOA 2PUUA 3BKBA 3WZKA 4IQ6A 5FEDA 1YI6A 3R2BA 4C33A 3AG9A 2R2PA 1Y6AA 3P7CA 4ZOGA 4QTBA 4XG2A 3BLRA 4ITIA 1OI9A 3F88A 3BBTB 4FKPA 4I94A 3CKWA 5E1SA 4L3JA 3SV0A 3UYSA 3VW8A 4E5WA 5AEPA 1JPAA 4XG3A 1MQ4A 3PZEA 3FL4A 4FKTA 3BV2A 5CI7A 2X9EA 4F1OA 3C5IA 4F7JA 4ZLZA 3CS9A 4JBQA 3MH2A 4U42A 5E8TA 2HW7A 2YEXA 4BHZA 1SVHA 2UVXA 3LE6A 4FIJA 2REIA 5HX6A 1U5QA 5KHXA 3DJ6A 5LMBA 2QC6A 4JS8A 1R1WA 4HW7A 4DA5A 5M08A 4QPAA 3BHHA 4G9RA 4M0YA 2ZDUA 3F2RA 4MH7A 4E5AX 5E8YA 3OCGA 1YXSA 5IA3A 4UEUA 4BCJA 4CT1A 1GZKA 3A4PA 3DAKA 3UO4A 5M57A 3DXQA 4RT7A 3PPKA 3NYVA 3R04A 5J79A 3U6IA 2VGOA 4QP4A 5AM7A 3FSKA 5CEOA 3AC4A 2CSNA 2O64A 4Y5HA 2ZOQA 4U6RA 4G5PA 2BRGA 1OKYA 4FTKA 3E7OA 3C4EA 2YM7A 4IX5A 1W7HA 2J7TA 5ETFA 3UC4A 3IKAA 3ZFXA 3LFBA 3WF6A 5LWMA 3R7UA 1XH5A 4IJPA 2IVVA 5CXHA 5IQHA 3OVVA 5IMXA 4G5JA 3QRUA 3QZHA 3W16A 1QPDA 2WTDA 2PPQA 3GP0A 5KMKA 3TUBA 2PMLX 1JOWB 3R7EA 2WTIA 3ANRA 4C7TA 4O82A 2C6TA 4YC6A 5K3YA 3R1SA 5HZNA 1AD5A 3ITZA 1PJKA 2XF0A 2ZV7A 1M2QA 2RFNA 1WZYA 2A27A 4F1TA 3P78A 5EYMA 5BVWA 4EOSA 3QC4A 5I9UA 5BMSA 1XWSA 4IM2A 4OR5A 4DG2E 3C4FA 1RQQA 4RWIA 1JSUA 5IA5A 1TVOA 2VTRA 2OO8X 2YM3A 1WBOA 2J6MA 5GHVA 1Q99A 3F5UA 3OOGA 5KKRB 3JPVA 1ZMVA 4MXAA 3TNQB 4QMWA 5J9ZA 3R7VA 3AMBA 5LVLA 1IEPA 3PJCA 4FT3A 1B39A 3RTPA 1ND4A 5M55A 3P4KA 5C8KA 3LHJA 3Q4CA 4NUSA 1FBNA 3I0OA 3K5VA 3F5GA 3UIMA 4BICA 5T6KA 3VJNA 3IW7A 4TWPA 3FHIA 4KBAA 2EXMA 2GU8A 2WNTA 4BI1A 5HU3A 3MSSA 2OI4X 4GUEA 4IB5A 5HCXA 4O27B 3DK3A 2ZAZA 5HEZA 5KNJA 4EUTA 2GTNA 4G3FA 2B52A 2V55A 3ORLA 4ALVA 5A4EA 3PJ1A 2C47A 3OHTA 3CD8A 1OPLA 3CPCA 2G01A 3EFKA 4W9XA 2F7ZE 4YZBA 3FI8A 5BUIA 4U7ZA 5IEXA 4FV8A 5GZAA 4U5JA 3UOJA 3FWQA 1J3HA 1RW8A 3D4QA 3D5UA 5E90A 1YXVA 3ZHPC 3ZH8A 2ZM1A 2HCKA 2CHLA 1SYKA 5IEYA 4LMNA 4HYIA 3C13A 2XIRA 2FA2A 1E9HA 5D10A 3DBCA 3U4UA 3L9MA 3KY2A 4L9IA 5E8UA 2W1CA 3DZQA 4XG4A 3QAME 4O6EA 3FV8A 4S32A 1PRYA 2QOBA 2WQEA 3S00A 3WIKA 5CVHA 1IG1A 5CANA 3FLYA 4BFMA 5I9WA 4JL9A 2XM9A 4FA2A 4FE2A 3DTWA 4I4FA 2I0VA 3BV3A 3ZDUA 3R9RA 3QLFA 3E8EA 4U3YA 2VD5A 1M7NA 3F5XA 4L42A 4DFBA 4YBKA 3MB6A 3E63A 4X7QA 5HBEA 1OITA 2F9GA 3E8CA 1OUKA 2ITWA 4CVAA 5K4IA 4XV2A 3CE3A 2WTKB 2OFVA 1Q8ZA 5AUUA 4E3CA 2XIZA 5AAFA 2X6EA 4FNWA 1S9JA 3K54A 4AGUA 4RIXB 3AOXA 1IA9A 5KBRA 2PVNA 2X8EA 4HNFA 4EC8A 4IWOA 4ZP5A 4O7LA 3ALNA 5CAPA 1OIRA 2HWOA 3TZ8A 2GNFA 4HNIA 2E9UA 2V62A 3HVCA 5HICA 3WBLA 4IEBA 3G6GA 4C59A 4O0XA 4MD9E 2W5BA 4FIHA 2W9FB 5K0XA 3HAVA 4RFMA 4CD0A 2YAAA 4RMZA 4O22A 4D2PA 5IMEA 3CLYA 2W1DA 4J95A 2CGWA 4F09A 2YIRA 3AD4A 2O63A 2ITZA 4DTBA 4FF8A 4IX6A 3VUHA 4BB4A 4M69A 3U9CA 5E1EA 1ATPE 4C61A 4Z7GA 4L6QA 4YNOA 4QMUA 4NTSA 1GIIA 4U41A 3W33A 3HMNA 3Q3BA 4M14A 2IO6A 2YISA 3WYYA 5DBXA 5J5SA 4AN2A 3OY3A 4EYJA 4FSNA 3A7GA 4AZSA 4LL0A 3E62A 2KTYA 4YMJA 5JMSA 2W1ZA 2R3NA 4PUZA 4YJUA 3DAJA 4AZVA 4YSJA 4RC4A 5C8MA 3U54A 4AGWA 4IZYA 2XA4A 4DGNA 5AV1A 4ZLYA 2C0OA 2BFYA 3PVGA 2QONA 3FMNA 3HRCA 4G34A 4XHKB 4XV3A 2B1PA 1PHKA 3ZC6A 3LLTA 2FSOX 3ZLXA 2WMAA 2ZV9A 1MRUA 4XBUA 3QTXA 5EH0A 5EM7A 3ZO1A 1PXMA 2BTSA 3G0FA 3DKFA 3MV5A 4YC3A 2R0UA 4PWNA 3R8ZA 4AF3A 5L3AA 2UW6A 1J7IA 4WG3A 4O0VA 3NWWA 4IAKA 5I4NA 4BL1A 3OCSA 4CLJA 2XNEA 3OWJA 2NNWB 5F4NA 3BEAA 3P86A 1R3CA 1XJDA 4QMTA 2UW8A 3FZTA 3H0ZA 4KSPA 5CQWA 5FWKK 3POOA 1FINA 5HO8A 5KO1A 5CEKA 1KE6A 3PY1A 4O84A 4FTLA 4ZTQA 3F82A 2BRNA 1H1WA 2C30A 2W1GA 3SDJA 3W2OA 4YZNA 5EI8A 3RAWA 4DFNA 4NCTA 3KKVA 3H10A 3FC2A 4F9BA 3PJ2A 3DQXA 4M67A 1H07A 2PU8A 3LMGA 4DH7A 3CTHA 3MDYA 3FI3A 3ZTXA 4PMPA 4E7WA 5J95A 2BHHA 3EQDA 2R4BA 2QLUA 2BKKA 4FGBA 4O0WA 4A9SA 4F65A 5AIKA 4DF3A 2OH0E 3OCTA 2WPAA 3RJCA 5TO8A 4LYNA 1SVGA 3PXYA 5A4LA 5K5NA 1G8AA 2HELA 1P14A 4IDVA 2YWVA 3SOCA 4F4PA 1XH7A 2R3QA 3GU5A 2DUVA 3IOKA 4QYYA 3QYZA 3NAXA 4WSQA 3ZFMA 2GQSA 3LFFA 2C6OA 3RGFA 2PE1A 2UZVA 3G2FA 3MY1A 4O7ZA 4W9WA 1UA2A 5EYKA 3ORTA 4TY1A 3HMMA 3UG2A 3WE4A 4QMYA 4M68A 4DITA 3R73A 2W06A 4OT5A 4RJ3A 4EORA 3ORMA 3TCPA 5HKMA 2OXYA 4M12A 5LCKA 2QLQA 1QMZA 4FVPA 4I6FA 5GINE 4C4EA 3OT8A 1ZZLA 4IAIA 4OUCA 5HLPA 3ENMA 2HW6A 5H8BA 2B9FA 5JSMA 3KREA 5I9ZA 3EL7A 2J9MA 2PZPA 4PNKA 2IZTA 1H01A 5HBHA 4IACA 2C5YA 4C8BA 2YCFA 4O7SA 3CJFA 4G6LA 5EHYA 4L52A 2A19B 4HGLA 2WIPA 4CXAA 2C5OA 1Z57A 2X4FA 5LOHA 4LM5A 3R1QA 5M44A 1VZOA 5IA0A 4JDJA 3W2RA 3TT0A 4F70A 1OGUA 3EQGA 5FTOA 3QLGA 3UO5A 4BKYA 4RA5A 4C2WA 5AWMA 4E4XA 3TG1A 5IH5A 3E93A 4CMTA 3ZLSA 3I81A 1YWNA 1ZYSA 4YZDA 3DPKA 4GT3A 4C36A 4A4XA 3QRTA 2RFSA 3QFVA 1H24A 3VS4A 2HWPA 3ORXA 1MRYA 3VVHA 1RE8A 1ZMUA 4QMQA 1YKRA 4R77A 4C37A 4D4YA 3WF9A 3EN4A 4I0SA 3R7YA 4UV0A 1H1QA 5IA2A 4FSUA 3DOGA 1BI7A 4QMXA 3UPZA 3BLQA 5EM6A 2WO6A 4D28A 3ZUTA 3NUAA 2QOHA 3Q4UA 2QO7A 4FV0A 4C4FA 4OBQA 1Q24A 3LXPA 4FIEA 3TIYA 2FSMX 2J2IB 3KL8A 4IFCA 4I23A 5FXQA 3E3BX 5ICPA 4XS2A 4IMYA 1ZYJA 2GMXA 4ZJIA 2JAVA 3EFLA 3Q9XA 4IAFA 4OBPA 3PPJA 3WZUA 5HTBA 3IONA 3R8PA 1J7LA 5JFSA 4UWYA 3L8XA 4EUUA 3RWPA 3Q4ZA 2F7XE 4CLIA 5KCVA 2B4SB 3PVBA 4A4LA 2BZKB 3ZRMA 5CXZA 2YFXA 3H4JA 4O0RA 4AA0A 3R7OA 3HMPA 5CU3A 3VIDA 3ZO4A 1FMKA 1ERKA 4O21A 4X0MA 3S95A 4DFYA 2Y6OA 1XR1A 4DCEA 2RG5A 4QMOA 3JS2A 2VWZA 4E4NA 5L8LA 4PY1A 2CDZA 1J1BA 2W4KA 1APME 3G15A 4RGJA 4FT9A 4FTCA 4A07A 5AUXA 3OEFX 5AP6A 3OG7A 4X2NA 2JAMA 2Z02A 4EH9A 1YDRE 3JY0A 4A06A 1M17A 5A54A 3MVLA 4LMUA 5AIRA 4GJ3A 4FOBA 4UALA 3UMXA 4YLKA 2J5FA 4ACGA 4EK5A 4RX7A 3L1SA 2O8YA 1DI8A 2OJGA 2CKPA 2GNGA 4TWNA 3QF9A 3UJGA 3W2QA 3ZS5A 2DYLA 4D9UA 1XH8A 4N57A 4FEWA 2ITOA 3D94A 4LI5A 3KVWA 4MCVA 4L44A 3EOCA 2OZOA 4BWPA 4DYMA 2C69A 2WZJA 4TPTA 2LGCA 3V01A 1PXNA 4IXPA 4FTTA 3QTSA 2GFSA 4GVJA 2ITVA 3KK8A 4BDJA 5HNBA 4CGAA 5CLPA 1VYWA 3LFCA 3U6HA 2IG7A 4LUDA 2XKDA 3VS6A 1DAYA 3Q32A 2G1TA 4AWIA 1B6CB 4NSTA 5DI1A 4CZUA 3KXHA 4WUNA 5DRDA 3U4WA 4BVUA 5FBNC 2C4GA 2OU7A 3HMOA 2VTMA 2X2LA 3S4QA 4NH1A 4RJ5A 3IQ7A 5F1ZA 5AA9A 2QOFA 4GYGA 4MKCA 3UMWA 4JAIA 3EQFA 1OL5A 2Z60A 4DG0E 4TKSA 2WMSA 5EYDA 1BMKA 3MTLA 3GFEA 4D1XA 4F9CA 5C9CA 4YJSA 5L6OA 2PVYA 3HLLA 2ERZE 1VEBA 4HCTA 4I6QA 5H8EA 2WEVA 4I4EA 3SKCA 5J8IA 4CG8A 5IPJA 3FLSA 2YITA 3NLBA 4GEOA 2V5QA 1CKPA 4NFNA 3FE3A 3QA0A 4MF0A 5CZHA 3RK9A 4L46A 4WA9A 2W5HA 2BIYA 1LP4A 2WTCA 4GH2A 1PKGA 2PY3A 1ZWSA 3BU3A 3BHVA 3LCSA 2PE0A 3PXZA 5K5XA 3UZTA 4CKJA 4G6OA 4EH6A 2J0IA 4EI4A 2XCKA 4LOPA 4B9DA 3W18A 4WD5A 5DLSA 3TL8A 5K9IA 3RP9A 1ZOEA 4G16A 3QKLA 2CJMA 2JIIA 3MFRA 3ODYX 3P5KA 3UP2A 5DT3A 4CZTA 2VWXA 4HGSA 4QTAA 3D5WA 4R6VA 5HE0A 3G51A 4EKKA 4F9AA 2RGPA 5ACKA 3OW4A 3IW6A 3I7CA 3PZHA 4GJ2A 5M4IA 1UU9A 3WF8A 2RFEA 1XHAA 3FMLA 3FMJA 3O2MA 3QCXA 4NW5A 4PPBA 4DINA 4LRKA 4ZY4A 3S0OA 1Q61A 1FOTA 1OM1A 2VTPA 3FPMA 3R21A 5L2SA 4K1BA 3Q9ZA 3FMDA 5E7RA 2XZSA 4IAYA 5EK7A 5EOBA 2P33A 4M0ZA 3EL8A 3OT3A 5AUWA 4LGDA 2WMVA 3CC6A 3D7ZA 5LXMA 2B55A 4FTNA 1KSWA 3NCGA 5HVKA 2JFMA 4ENYA 3FXZA 5AV0A 3PE2A 1WVYA 1WBTA 3CCNA 4MYGA 3NYNA 4ONAA 5E8SA 5CEMA 2BFXA 2QNJA 3KXNA 3NW7A 4IX4A 4KD1A 2R3LA 3F61A 1R78A 2QG5A 5DN3A 2XNMA 4USDA 4WBOA 3O23A 2YIXA 4PL4A 2UZLA 1SNXA 2CKOA 4PP7A 4M84A 4A9UA 4YU2A 4FTOA 1UNLA 2ZM4A 2QHNA 5KMMA 4S34A 3DK6A 3BE9A 4Y72A 4FKVA 3OZ6A 1URCA 5FGKA 3W1FA 3EQIA 1LEZA 1YOMA 3Q04A 4GK2A 2IVUA 5KZ0A 3TACA 4E4LA 4E4MA 4EK8A 4ACMA 2ETKA 3PVUA 3C0HA 4YSMA 4DTKA 3D83A 3BWJA 4NW6A 3DAEA 3W8LA 4GFMA 2ZB0A 4FT7A 2OJ9A 4ZMEA 3A4OX 2PL0A 3VF9A 3DK7A 4RQKA 3IG7A 2BMCA 5AJQA 3JVRA 3VQHA 5IQGA 4J96A 1OMWA 1PY5A 4ZAUA 2F57A 4X21A 4N70A 3LZBA 1TQPA 2VTAA 3Q52A 2VTOA 3K5UA 3R00A 3PLAE 2OBJA 3H9OA 4MD7E 3SX9A 2C6LA 4YLJA 4RIWA 5LVMA 2JLDA 4ANQA 3OTVA 3KXMA 3NUPA 4RWKA 3O7LD 2W4JA 4FK3A 5CU6A 5BVOA 3IW8A 4AFJA 4BDBA 2QR8A 4XBRA 5HD7A 5IISA 3TZMA 4QPMA 2OJFE 3NYXA 3AT4A 2YJRA 4J52A 3A8XA 5JN2A 3OFMA 4ANLA 4UZDA 4IX3A 5DPVA 4EQUA 5HX8A 3NNXA 4FBXA 2Z7RA 4RJ7A 3FI2A 1ZZ2A 2GCDA 5FTQA 4H1JA 3UDBA 3QQFA 3ZSIA 4PQNA 4YO6A 3QUEA 5EDRA 5IU2A 2XMYA 4CV9A 1SNUA 1XH4A 5DFPA 3UTOA 5HNIX 2IZSA 3TKUA 3KU2A 4BCOA 2IW6A 3SOAA 4BCIA 3DJ7A 5IQIA 1H0WA 3FKLA 3PG3A 4H58A 4HPTE 3VUGA 3UNKA 3WOWA 3ORZA 3KCKA 5DRBA 3EN9A 1WBVA 3QUDA 4F99A 4UMUA 5A14A 4JG8A 4O7RA 2B0QA 3QGWA 4RJ4A 1Q8YA 4YPDA 4FTIA 5CSHA 5IA4A 4OTWA 4ERWA 1V0BA 2F7EE 3RNYA 3EHAA 3KRRA 5IF1A 4EWQA 2QCSA 1G5SA 4M3QA 3PG1A 4I5MA 4MXOA 3P23A 5HVYA 3FDNA 3WARA 4ZSJA 2XRWA 4RVTA 4O2PA 4C0TA 2R64A 3D7TB 3QZIA 3QYWA 4FKUA 5HHWA 3SXRA 4D4SA 4N6YA 2EB2A 3PWYA 3MJ1A 3F7WA 3NGAA 4OGRA 2R5TA 3GCVA 2WMQA 3KF4A 3NZ0A 3COMA 4BDEA 1Q8UA 2V22A 3AGMA 4H05A 3F7ZA 1YHSA 5ETIA 4EOMA 3DNEA 5LQFA 4L00A 2QODA 2OF2A 4IM0A 1Q3WA 5E91A 4A9TA 4I20A 4O96A 3QTWA 3TWJA 4BDAA 4KIKA 4PDYA 3OWKA 3KXZA 4RWJA 4FZDB 3PDTA 4MHAA 5AUYA 1M2PA 1OECA 2OZAA 4MQ1A 1CMKE 2WHBA 4M69B 3C4ZA 3WF5A 1JAMA 4XMOA 4HZRA 1BL7A 2BIKB 3PIXA 5KMJA 1L3RE 1W84A 4QP7A 3VHKA 3SVVA 3ATSA 3L8PA 2UZOA 5FM3A 2XNPA 4TWCA 3C1XA 5GNKA 4AZEA 1ZRZA 4FIIA 3LVPA 2VTLA 4ID7A 5BPYA 1JSTA 3NAYA 3I0QA 4QNAA 2QKRA 3P7BA 4RSSA 2GSFA 3TV6A 4HVIA 3ODZX 4D1ZA 3FMMA 4AW5A 2GS6A 5JT2A 2OGVA 4MBLA 3LCKA 2R3HA 3PUPA 4P5QA 1ZY5A 3OD6X 4U3ZA 3TUCA 2J0MB 4G1WA 5FDPA 3BRBA 3DB6A 4GFOA 3KN5A 1KE7A 5DIAA 1O6LA 4GIIA 4CMOA 3LKMA 4O7WA 2GFCA 4EOIA 4FKIA 2V0DA 4RLKA 4G9CA 2XP2A 3MYGA 5CF4A 1Y91A 4PV0A 1YHVA 2C0IA 4I92A 4Q5EA 5BVEA 3GUBA 3UQCA 1PMEA 2ONLA 4KIPA 4GRBA 5DR6A 3CGFA 3ZYAA 2V7AA 3LQ8A 3UE4A 1OBGA 2PE2A 4UYAA 1AQ1A 2QURA 1Y57A 3D14A 2WMUA 2W05A 3H0YA 3F3UA 3M42A 3O17A 2VNWA 4KA3A 4PPCA 1DI9A 5JZNA 4D9TA 4HVGA 5IQCA 4GSBA 4E6AA 3UO6A 5FBOA 4EH2A 3HP2A 4FKLA 4CQEA 4I93A 1V0OA 4OTRA 4BI0A 4AOTA 3RPVA 1K9AA 4WRSA 1UWHA 3R30A 4FKQA 4RC2A 2YERA 2BALA 4GL9A 5EQEA 3HV5A 2ZMCA 5A46A 2A4LA 2E9NA 5T3QA 5LMKA 5HO6A 4H39A 4CRSA 3N4UA 4C58A 3UYTA 4ACCA 3RVGA 3T9IA 5JFWA 4ZMFA 4D5KA 4UX9A 4AW2A 1Q62A 2P2HA 3DB8A 4FODA 4P4CA 4GV1A 4Y8DA 4F6WA 1J7UA 2Z7LA 4FSRA 5M06A 1CM8A 5CX9A 3QD0A 2RL5A 3KRXA 4FSTA 4DEAA 2Y9QA 4ACHA 5LCJA 3E8DA 3KK9A 2EXEA 4OLIA 3OMVA 4ZS0A 4JBVA 5F20A 4BF2A 4FZ7A 4OW8A 4JT3A 4Y83A 3Q5IA 2YJSA 3AC3A 3PTGA 4RVLA 1VR2A 3N9XA 4JAJA 4RA4A 3ZLYA 4ZJJA 1BL6A 1R0EA 3EQRA 3HKOA 3RCDA 4CTCA 5JH6A 4KRCA 5KZIA 4WNKA 4USEA 3B8RA 3Q6UA 2PZ5A 3H9FA 5GIPE 2WAJA 3SG8A 3VS5A 4FSWA 3FQSA 4NM3A 1YI4A 2WMXA 1WMKA 4FVRA 4MWHA 4QD6A 3IO7A 3C4CA 4UY9A 3WZJA 4TL0A 3BCEA 4E6CA 1K2PA 4O1OA 3DY7A 2CNVA 4C34A 4QO9A 3PA3A 3ZCLA 3CBLA 5IUIA 4JVGA 3AT2A 4I5PA 4CFWA 4WSYA 3ZDIA 3O50A 4AOJA 3ORPA 2BPMA 5L2IA 3FYJX 2PSQA 4RZWA 3EZVA 3SW7A 2EWAA 3PXRA 4CCBA 1YDTE 4FI1A 4IH8A 4MF1A 4C4IA 4F1MA 5JQ5A 4QMSA 1U46A 5I3RA 3MY0A 2PVJA 2NO3A 2W7XA 3MB7A 1JBPE 5BYLA 1JVPP 3MIAA 4PX6A 2NRYA 3GU4A 3I6UA 5EG3A 2QD9A 3ANQA 4P90A 4BI2A 4MXZA 5FUTA 2QI8A 5AV3A 2QOIA 3VUMA 3BQRA 3RAIA 2C3IB 3R8UA 4QPSA 4J8NA 4LFIA 1H4LA 3P0MA 2XKEA 4Y46A 4XP0A 5TOZA 1OIUA 1P2AA 3UOKA 4BDDA 3V8TA 3G6HA 5HESA 3TDVA 4O91A 3GC7A 4QTDA 4P2KA 4YZCA 4FX3A 3P08A 3MS9A 1J91A 4L01A 5CVGA 4C35A 3HAMA 4N4SA 2PK9A 4ZTRA 5HCZA 2WFYA 3SG9A 2C5NA 3QQUA 5A4CA 4AT4A 4O7VA 1OIYA 4YJPA 2I7QA 3FEGA 3VRZA 4QMNA 3LM0A 2GNIA 5EYCA 2H6DA 4KKEA 4FEQA 4HYHA 1IR3A 1NVSA 3CQWA 2YM4A 2BDFA 4Z16A 2X39A 5A6NA 3RM6A 4TYGA 5FXRA 2RSVA 1JKKA 4OAUC 1KE8A 5CAVA 2ESMA 4ACDA 1BLXA 4IC8A 4TWOA 4AZWA 4HOKA 5HG8A 4MXCA 3ENHA 5C8NA 5M4CA 4YPSA 3LLAA 3ALOA 2B54A 2XJ2A 2ITXA 5DYJA 4C38A 3LQ5A 3RHXA 4B4LA 3DBDA 2VRXA 3G9NA 4FUYA 3QU0A 5AAGA 3F6XA 5A4QA 2IWIA 3VULA 4RRVA 2YWPA 2ONLC 4USFA 4EWHA 4IZ5A 1YW2A 4CFMA 5E8WA 2OXDA 4I21A 2RKUA 3H3CA 5G6VA 2B9IA 2VWIA 4ARKA 2RF9A 2IVTA 3FL5A 2OXXA 3TEIA 2H8HA 4BCQA 4DGMA 2J0KA 5AP7A 4UXQA 3QKMA 4YO4A 2YCQA 4B7TA 1GZNA 4BY9E 4UMPA 4V01A 1YVJA 3GQIA 1CTPE 2HZ4A 2XCHA 2IZUA 3D0EA 2HIWA 3DCVA 3DT1A 3EFWA 5B7VA 3E3PA 5CF6A 2WTWA 2VTHA 4RX8A 4F7LA 3BHTA 3I5NA 4APPA 4LOOA 5CNOA 3WI6A 4BHNA 4DLIA 5EQPA 5CYIA 5LMKC 4DBNA 2VWYA 2W1FA 4RJ8A 1OKVA 5ANEA 4YJOA 4YTFA 2ZV2A 4Q5HA 4F63A 3ATTA 3QTIA 3GCPA 4GW8A 4YC8A 2EUFB 4IVCA 3E64A 3QXOA 3R9HA 3RBWA 2W17A 4X3JA 3RMFA 4E6DA 3CJGA 3HMIA 3ULIA 4BGGA 3VS2A 5I0BA 2IVSA 2Y8OA 5ETCA 4FV1A 1XQZA 2FO0A 4BBEA 1AGWA 2VWWA 3FC1X 3VWAA 2BZHB 2UW9A 3UP7A 5CEPA 2EB3A 1KV2A 4O0TA 2Y6MA 3DXPA 1LR4A 4O38A 2XNGA 5HBJA 5FXSA 4NIFA 1BYGA 4MBIA 4BKZA 5CEIA 4OTHA 2C6DA 2AUHA 5FEQA 2J5EA 1WBNA 3LJ0A 4IWQA 4K6ZA 5AP3A 3CSVA 4JG7A 3HX4A 2XB7A 4NJ3A 4XG6A 2BAKA 4UBAA 2YABA 2JKQA 3FZOA 4QOXA 5M09A 2O2UA 2X7OA 3TUDA 2H9VA 4NL0A 1FVVA 2VUWA 1Q3DA 3IGOA 2R3RA 1JQHA 3FKNA 1H26A 3NYOA 3VQUA 3BQCA 4EOJA 3UOLA 3S1HA 2X2MA 2YIWA 5JFVA 4E73A 2X6DA 3DS6A 4JBOA 4JX7A 5GJGA 3LXNA 3THBA 3V5QA 3CQUA 4D2TA 5JQ8A 4JOAA 4G17A 2WU7A 2PUPA 1YXUA 2HYYA 2X8IA 3PSBA 3DXNA 5EW9A 4FKWA 3VS1A 4UWBA 3M11A 4QMVA 4EHZA 3F3WA 2C5VA 1DM2A 4YJNA 4B0GA 3EZRA 3FZSA 3MPMA 4UN0C 4XV1A 4APCA 5BVNA 4HCUA 2G9XA 3GOKA 3LJ2A 3ULZA 1UKHA 2HOGA 2VO6A 4P7EA 2YDIA 2JDTA 2AC3A 1NY3A 1I44A 3VW6A 4FT0A 2XH5A 3KMUA 4IHPA 5E4HA 3C9WA 5CU4A 5EM8A 3FMKA 2P55A 4D55A 4CSVA 2PVHA 5AX3A 4EHVA 1SM2A 5C26A 3TDWA 3QQHA 1DS5A 2YA9A 2YDKA 3PY0A 1H25A 4BZDA 3P79A 3WYXA 4DH5A 4EH5A 5M56A 1QCFA 2WQNA 3DGKA 3PYYA 2WMTA 4OTPA 3Q4TA 1MUOA 4U80A 4KUJA 4FKOA 2I1MA 4ALWA 3UQFA 1QL6A 3PA4A 4XJ0A 4O0SA 4XRJA 4I6HA 4YTHA 1OB3A 4IDTA 5HLWA 4H3PA 4IZAA 4R8QA 5GZ9A 2AYPA 4AGDA 4FV3A 3W2SA 4KAOA 3FLWA 3UODA 3GT8A 4RC3A 2O0UA 4XEYA 5F9EA 4GU6A 3F69A 5AR3A 4AN9A 3ZMMA 4C57A 2A0CX 4Z55A 5BUEA 4U8ZA 3E5AA 1U5RA 1NT2A 3HP5A 3GC0A 3I60A 2AC5A 2IW9A 4G31A 1H08A 3B8QA 3HA8A 2JIVA 5DR2A 4KNBA 4C62A 3TJDA 4F64A 2BILB 3QZGA 5HI2A 5B2LA 4BN1A 4BCFA 1V0PA 1LEWA 4DEEA 2XIKA 2PVMA 4RIWB 4RIOA 4E20A 5I9XA 3ZONA 4DEGA 2J90A 4R7IA 5D12A 3V04A 3RAHA 2Q83A 4RFYA 2NP8A 4DBXA 2WMWA 4WNMA 3PFQA 1F3MC 3LFEA 4QMMA 4YBJA 1OKZA 4WNOA 1OL6A 4CFFA 4IZ7A 4F7SA 3NMUF 4RIYB 1PYXA 3JY9A 3TJCA 3CTJA 3FSFA 3KVXA 3VNTA 4DFLA 1PXJA 1IAJA 2WB8A 2CLQA 1OL7A 2O3PA 2CN8A 4Q9SA 5EHLA 2VTQA 5EM5A 4FNXA 3D2IA 4Q2AA 3LFDA 2GQRA 3GU6A 4L8MA 3OXZA 4ZIMA 1KOBA 3R02A 4D5HA 3HRFA 3VHEA 3U87A 4XCUA 1FMOE 4ZTMA 4O7YA 3AGLA 1M2RA 3HYHA 4J71A 2CPKE 3D5XA 4RX5A 2E9OA 4AFEA 1UU7A 5CASA 4AACA 4QMLA 3G33A 2ITNA 3PJ3A 4BWXA 3R22A 5IQFA 3PXKA 5AP1A 3MIYA 2FSTX 4FMQA 4YJQA 3KFAA 4EL9A 2PULA 4LRMA 3DLSA 1PYEA 3MA6A 4EHGA 2IJMA 3R01A 5IQAA 2B7AA 3QTZA 3R8MA 2UUEA 3Q9YA 3L9NA 5ANOA 1Y8GA 4BZOA 4Z3VA 2BAJA 4LRJA 3OBGA 1QPEA 3MN3A 3EN6A 4X3FA 3ACJA 4MWIA 4IVBA 5DT4A 2W1HA 4NT4A 5EHOA 5FP6A 2OW3A 4ZEGA 4F0IA 2X2KA 5CSVA 4IIRA 4DT8A 2JBOA 1JKLA 4OBOA 4B6LA 4BCGA 1FVRA 4AA4A 4DEIA 4ZTNA 2W0JA 4AT5A 2P0CA 3JR1A 3EJ1A 4YHFA 5DH3A 2VWVA 3GU7A 4GVAA 3TM0A 3EH9A 1WBSA 3BGPA 4XRLA 1XH9A 5J9LA 4KIKB 4BWKA 3TKIA 4AUAA 4NCTC 5JRQA 4NYEA 4H1MA 1VYZA 2OZAB 2ITUA 4AOIA 1TKIA 4O0UA 3NCZA 1WVXA 3BWFA 3MPAA 4IB3A 1UVRA 4BCNA 1UNGA 5HIEA 3OC1A 4JRVA 4UWCA 5IA1A 3ZEPA 4BKJA 4CV8A 4QMPA 2OJIA 5AAEA 3PSDA 4IJ9A 2OIQA 3ORKA 1WFCA 4L68A 3ORNA 4ALUA 3FAAA 2WXVA 3CY2A 4V0GA 1R0PA 2C5XA 2JITA 4J97A 2I0EA 4I24A 4L3LA 1RJBA 4PF4A 2WD1A 3PPZA 1GAGA 1REKA 3TNHA 5L8KA 3PP0A 4AG8A 4W8DA 3VF8A 3VO3A 3OXTA 4CG9A 3HA6A 5C01A 3MI9A 5HO7A 4JLCA 4XH6A 5A3XA 2GS2A 3ZO3A 4YJVA 3BGQA 1QPCA 2VTIA 5LJJA 4QP6A 4QQCA 4D0XA 3RPRA 2LAVA 2DWBA 4AP7A 4HGEA 3DQWA 3LQ3A 4X2FA 1XO2B 1A9UA 2ACXA 4FTAA 5D11A 2JKMA 3GCSA 4QP3A 1O6KA 4KKHA 5ITAA 3G9LX 4FV9A 2QKWB 4WG4A 3F9NA 3U8WA 2P4IA 3HDMA 1GZ8A 4L67A 4X2JA 2X8DA 5CWZA 2ETRA 2QHMA 3LIJA 4IC7A 4XP3A 4NWMA 5AUZA 3RPOA 5J1WA 5IQBA 5L6WL 4YGAA 2HXLA 4QP1A 4NKSA 1JWHA 4DH8A 5AM6A 4RBLA 4C4HA 3ID6C 3KXXA 3WF7A 4WHZA 2X0GA 4I6BA 2PHKA 5CF5A 4JQ8A 2C3KA 2VX1A 3QBNA 5IZFA 2PVKA 2BTRA 5FQDC 3HV6A 5JGBA 2DQ7X 3BYSA 2BR1A 1PMVA 2BAQA 2YCRA 3Q5ZA 3C4WA 5EW8A 4R3PA 3GB2A 4YLLA 1Y8YA 4R5SA 2CKQA 3QGYA 4W4VA 3G5DA 3MW1A 3TZ9A 5LVPA 2YACA 3IK3A 1F5QA 1PF8A 3JXWA 5AP0A 5LMAA 2C3LA 3SD0A 3SAYA 5I9VA 4R78A 3IECA 3H30A 5CT7A 5L6PA 3DKOA 5JKGA 3TV4A 2ZVAA 1UNHA 1V1KA 2VX0A 3CKXA 4GCJA 3SXFA 3UNZA 4EKLA 1EH4A 2WQMA 3QQJA 4FG7A 4BCPA 4FR4A 4RJ6A 5BX0A 3R8LA 2UZWE 1OIQA 3C50A 2R3OA 4R1VA 2R3FA 5CS6A 2UV2A 1I09A 4C4JA 2JGZA 2JIUA 5FLFA 4V04A 2R9SA 1X8BA 1HOWA 1MRVA 2IZRA 3E7VA 5L2QA 3V5WA 4ANBA 2QVSE 3MFTA 1O6YA 3TN8A 2GNLA 2XKCA 5IUGA 4MXYA 3NS9A 2GTMA 3FPQA 5T68A 3C51A 5DNRA 5DR9A 1STCE 2WU6A 1ZY4A 3BU6A 1WBPA 3OCBA 4CEGA 4C3PA 5IH6A 1NVQA 1H00A 3NNWA 1URWA 2A1AB 5ETAA 4V05A 3R71A 4JJRA 4G3GA 5IUHA 5AR2A 2XS0A 1RDQE 5IDPA 4I5CA 4ZSLA 3UZRA 3GNIB 2C3JA 2XK8A 4YZMA 1M14A 4LGHA 4EZ5A 1ZOHA 4XG8A 2JDRA 5J7BA 4DE4A 1LUFA 3ZXTA 3GFWA 5KMNA 1H1RA 5TE0A 2YN8A 5AUTA 1M7QA 4XNEA 3VS7A 3HV4A 2XJ0A 3NSZA 4NM7A 3ROYA 4HVSA 5I9YA 3RK5A 3BEGA 3KB7A 1W83A 2UW5A 2Y0AA 4MTAA 5FEEA 4ZY5A 4FKSA 1P5EA 3I7BA 4H3BA 5KBQA 5M51A 2F2CB 4HCVA 2HZIA 5HD4A 2FGIA 3NX8A 5J9YA 1J1CA 3WZDA 2VTJA 2A2AA 3E92A 4YUQA 4KINA 4IAZA 5HE2A 4IANA 2GS7A 3B2WA 3EKNA 3TNPC 4GT4A 4KSQA 3Q53A 2DS1A 4XV9A 4MNFA 3ZU7A 3COHA 3VUDA 1FGKA 5J7HA 3UOHA 2UVYA 4G3DA 1IASA 3CXWA 1Q8WA 1ZYLA 4Z9LA 3FQHA 2WGJA 5CZIA 3A99A 3NUSA 2XK6A 3KEXA 3QTQA 3LFNA 2UZEA 1FVTA 2XBJA 2F4JA 1PMUA 3OROA 1KOAA 5IEVA 4JDHA 1L8TA 3ERKA 4GKIA 4LOQA 4DN5A 2BCJA 4GYIA 4X2GA 4BCHA 4H36A 4OTDA 3ZUVA 5EDQA 3FI4A 5L2WA 3EQCA 3GQLA 1KWPA 3QCSA 3FMEA 4L3PA 3D15A 3OOMA 4J99A 2JEDA 4LGGA 4RX9A 4TNBA 3UNJA 2CGXA 2CNQA 3Q2JA 4D4VA 2ZYBA 2V7OA 4LQMA 4AXAA 4EBWA 2JFLA 2ITYA 2XVDA 4PRJA 3MGYA 5CQUA 3W32A 5EI2A 3WE8A 3W10A 3R6XA 4BDHA 3PRFA 4JDIA 2X7GA 4FV7A 3RK7A 4CFNA 3R7IA 4JX3A 2JD5A 4FTQA 2J51A 4D58A 3QD4A 3BYMA 3QX4A 1Q41A 2BKZA 4CKRA 3KULA 5B2MA 2YZLA 4NKAA 2XUUA 1BKXA 3VJOA 3FLQA 2G2IA 4WKQA 4F0GA 5AADA 2CGUA 4UMTA 4KIOA 1IRKA 1SMHA 4UZHA 4AAAA 3NNVA 4ZZNA 4TNDA 4L53A 5C4LA 4PTCA 4ANMA 5DEWA 2OF4A 4R7HA 3V8SA 4BGQA 1OBDA
chains in the Genus database with same CATH superfamily
4UYNA 5LVNA 3ET7A 2JKKA 2W5AA 4G3CA 2UW4A 4WUAA 4B99A 4QP2A 2PMNX 4ASEA 4AU8A 3QX2A 3EN5A 2PVLA 3SRVA 4O7TA 4DFUA 4BDCA 3QZFA 4OTGA 3V5PA 2YM6A 3G0EA 3HRBA 5ACBC 3CTQA 2VO0A 4TRLA 1CKIA 4NIFB 4PDPA 4W8EA 3FY2A 4O0YA 4JQEA 4HVDA 2XK9A 4O6LA 5AX9A 2IPXA 2PUNA 2JC6A 5HE1A 4QQTA 2W1IA 3RWQA 4MNEA 4PTGA 4AT3A 1MP8A 2FH9A 2YIYA 2HY0A 3BYUA 3FKOA 4YP8A 3UZPA 4ENXA 5BVFA 1UKIA 3U9NA 4IM3A 3DDQA 3HDNA 4J1RA 3QRKA 2VZ6A 3LOKA 3K3JA 5CEQA 3PP1A 4LL5A 4FKGA 2OSCA 3RNIA 4U44A 5K0KA 2UZBA 3MVMA 4WBBB 3L8SA 3F3ZA 4YJRA 5J1VA 4GFGA 2YDJA 4QYGA 4O81A 4FV4A 1TZDA 4FTRA 4JR3A 2XNBA 1NA7A 1T45A 2E9PA 3MFSA 3UG1A 3UVQA 4DH1A 2ITPA 4YR8A 4IWDA 3K2LA 5EQYA 5FD2A 2C6KA 5KE0A 1UWJA 5A6OA 2XBAA 2HXQA 4FSYA 2GDOA 3LFSA 4FG9A 1E1XA 2YIQA 3OW3A 4L7SA 3T9TA 5CT0A 2QG7A 3EYHA 3LW0A 4QNYA 5EW3A 5BYYA 5DT0A 5M4UA 4K11A 4O7NA 4OT6A 1U54A 3U55A 4BBFA 2GPHA 3GGFA 2I6LA 4ZXTA 3UQGA 4PMSA 3VUIA 3R0TA 3UPXA 3ZUUA 4QYHA 5D9HA 4IB1A 2HY81 3POZA 4JR7A 4ANSA 4DHFA 1P4FA 3VUKA 4R3CA 2BVAA 1IAHA 3NIZA 3UGCA 1CDKA 1U4DA 3O96A 4EK4A 5E92A 2B53A 1PXKA 5BQ0A 2PMIA 4UXLA 3DLZA 4II5A 2Y7JA 5J87A 3V51A 2ITQA 5JFXA 1NVRA 4DC2A 3DBQA 4CT2A 2F2UA 3KF7A 4JDKA 5B0XA 3A61A 4CFVA 4CTBA 2ZJWA 4PMMA 4QTCA 3S3IA 3FJQE 1GJOA 1FPUA 3O51A 2H96A 4JXFA 5FDXA 3FQEA 3AMYA 4ASXA 2WQOA 2OKRA 3DFCB 3RALA 3A7HA 2CCIA 2PZIA 3BZ3A 4KIQA 4KKGA 1W2FA 3F2NA 3NW6A 3W2CA 4ZZOA 2Z8CA 1PW2A 2XK4A 1KV1A 4FTMA 5FP5A 5TT7A 4A9RA 5L2TA 3N4VA 3A60A 3KMWA 3DU8A 4GKHA 5HIBA 3GC9A 2XYNA 1BUHA 2VWBA 4MEDA 2VX3A 4RFZA 4TN6A 3EQBA 3MY5A 3SXSA 4E6QA 4UMQA 2BZIB 3I4BA 4GU9A 2I0YA 3WIGA 4IVDA 4BTMA 4MQ2A 2G2HA 3K3IA 5H8GA 4G3EA 1HCKA 3QQLA 4XOYA 4ZZMA 4AE6A 5AP2A 3I79A 4AS0A 3U6JA 4R1YA 3MH3A 2C0TA 3QTUA 4I0TA 2H34A 3UIUA 4EBVA 4M15A 2YM8A 5DE2A 5CENA 3RHKA 3HECA 2X81A 5KHWA 2C1BA 4FNYA 4U45A 3U51A 3GCQA 4FL2A 4XLVA 2BDWA 1H8FA 1YOJA 3PA5A 4FKRA 4OTFA 4HYSA 4CQGA 4GG5A 4RPVA 4I41A 3IDPA 1SVEA 5IDNA 3SHEA 2QQ7A 2VV9A 4GS6A 3HGKA 4Y5QA 4FC0A 4XYFA 3TKHA 2VU3A 1YOLA 2GHLA 2OIDA 4GK3A 4K9YA 2IN6A 5EI6A 4Q9ZA 4XG9A 3KCFA 4Y73A 4DEBA 4HVHA 4Z7HA 1TQMA 2YAKA 3IDBA 4B8LA 4GMYA 3N4TA 2QOOA 3ACKA 3LM5A 4PL5A 4IVAA 1GIHA 5KX8A 5CSWA 3DDPA 4OTQA 2Y4IB 5CVFA 1GOLA 5ANKA 3OUNB 4ZK5A 4EJNA 3VN9A 1OKWA 4FYNA 2HENA 2O65A 3CGOA 5AR7A 4J53A 2YZAA 4NEUA 4DGLC 4U97A 2BDJA 4J98A 3PRIA 3VAPA 4CMUA 2XEYA 3L8VA 3PWDA 1O9UA 2UZUE 2PVRA 3FLZA 4X3FB 3ZFYA 1E1VA 3TI1A 3P1AA 3BHUA 4QYEA 4CRLA 2X4ZA 2OJJA 5H9BA 3TTJA 5DWRA 2ERKA 5D41A 5HGIA 5HTCA 3JVSA 5F95A 3IOPA 1KE5A 5AP4A 4FG8A 1FGIA 4KB8A 1GY3A 2XIYA 3ELJA 4EK6A 5HORA 4QQ5A 4JNWA 5AP5A 3MWUA 4FICA 2XM8A 4S2ZA 5D7VA 3PJ8A 4DEHA 2JKOA 4DFZE 2XIXA 4WO5A 5DOSA 4F08A 1VJYA 3SC1A 1BI8A 4RZVA 2JBPA 4JIAA 3D7TA 2PZRA 4F6UA 1YQJA 3M1SA 4MBJA 3UIBA 4FIGA 4FV6A 4M97A 3WZEA 2C6EA 4BRXA 4BYIA 3FZPA 3QD3A 4S30A 4WT6A 5I3OA 3AC5A 4RQVA 5HU9A 4TYHA 2VAGA 4M7IA 4AN3A 4XP2A 5JZJA 4QRCA 2UVZA 2X0PA 3B2TA 3COIA 3DKCA 2R7IA 4K8AA 4V0GB 5DG5A 3SW4A 4BTFA 4C3FA 3HUCA 4KS7A 4NM5A 4FZFB 4N6ZA 4MD8E 5LVOA 4AZFA 4MK0A 2CGVA 4D2VA 3NNUA 1W0XC 5LARA 2WTVA 4CCUA 3V3VA 1Z9XA 3AMAA 2VWUA 4PP9A 3N51A 4OTIA 4WRGA 4YHTA 5E8XA 3RI1A 4EZ3A 4BGHA 4F9YA 1YI3A 5AUVA 2IW8A 4YJTA 4YHJA 2R3IA 3FZRA 2O5KA 2W9ZB 2R3KA 3C7QA 4FTUA 4QMZA 1G8KA 3QWJA 4D0WA 3ZM9A 4J7BA 4K0YA 1DAWA 4W4XA 3MESA 1ZAOA 1H1SA 1ZYDA 2E2BA 5HCYA 1ZXEA 3UVRA 2BUJA 4FIFA 2VTTA 3W8QA 4QP8A 3RPYA 3R9OA 3CQEA 2BROA 3F66A 1LPUA 4U40A 3LCDA 3C0GA 5BVKA 3ZBXA 1PXOA 3OWPA 3TIZA 3G90X 4BDGA 2SRCA 3OUKA 4RWLA 3GI3A 1U59A 1W98A 2VGPA 5JGDA 4FSQA 4ZTLA 3PXFA 5HOAA 3NPCA 3RAKA 1GIJA 3KMMA 4FNZA 1XBBA 3MBLA 4PDSA 3PIZA 1Q97A 4S31A 4ZLOA 3FLNC 1Q5KA 4LV5A 3RINA 4PDOA 1REJA 3GU8A 4H3QA 2YLEA 3VS0A 1JLUE 3FUPA 3R9DA 4DDGA 5L8JA 5HG9A 1ZARA 2R3GA 4EH4A 1BX6A 3VBTA 4BIDA 1OL1A 4QTEA 1YWVA 4FEXA 5JRSA 2PYWA 3KRLA 5HE3A 4FOCA 3IW5A 4C02A 3FMHA 4R7BA 3W55A 5GIOE 4HJOA 4L45A 3F3VA 4EH8A 5F94A 4IE9A 4LG4A 3BBWA 2C68A 3EN7A 2ZV8A 5AFVA 1Y6BA 4ERKA 3QQKA 2WTJA 3MTFA 4YTIA 2QOLA 3NUUA 4FZAB 2WOUA 3GCUA 5AR8A 1ZLTA 3UBDA 3EB0A 3ZO2A 5LWNA 3A7JA 2W1EA 2XK7A 1F0QA 2XKFA 3ROCA 3ZRKA 3ZSGA 2EXCX 5JGAA 1FQ1B 2W4OA 2ZDTA 4R3RA 2Z2WA 3GBZA 3C5UA 3CPBA 3NFGB 4BIEA 2Z7QA 4WG5A 1JKTA 2RFDA 3R2YA 5CAOA 4GG7A 2P3GX 3P7AA 1ZOGA 3SA0A 4F7NA 2C1AA 5EDPA 4A4OA 1NXKA 5G1XA 3SQQA 3AD6A 3MVJA 5ANGA 5DVRA 1SZMA 4ZSEA 2X9FA 4R5YA 3AXWA 3F5PA 3DA6A 4EOKA 3F3TA 3OY1A 1Q8TA 3OEZA 3QKKA 2RIOA 3EQPA 2UW0A 3OWLA 3Q60A 5GZ8A 3NUNA 4TZRA 2XNOA 2OFUA 2PVFA 3COKA 4XX9A 4JQ7A 3C4XA 3R7GA 2WELA 4O1PA 5BMMA 4BDFA 3RZFA 5E8VA 1XKKA 5HVJA 1XBAA 4ANOA 2XJ1A 2XK3A 3CY3A 2ZMDA 4IW0A 4XLIA 3TNWA 5E9EA 1PMNA 3QQGA 5DA3A 5DEYA 4GUBA 3CIKA 3LCOA 3MVHA 2EU9A 3LXLA 3R9NA 4IADA 3PY3A 2WEIA 4AW0A 2OG8A 4DG3E 1G8SA 4PL3A 4K33A 3EFJA 2ZM3A 4RLLA 5BVDA 3A2CA 3I5ZA 1W82A 3BHYA 4DAWA 4IBMA 3HUBA 3EWHA 2I0HA 4FKJA 5TKDA 4C3RA 4RG0A 2ZB1A 3PIYA 3QRJA 1WBWA 3RKBA 4MVFA 3MJ2A 4P5ZA 1H27A 4JG6A 4QP9A 5IKWA 1CSNA 1XH6A 2QU6A 5AA8A 4EOPA 2FYSA 5KMOA 3A7FA 3P9JA 1HCLA 2VN9A 4BCKA 3C0IA 2OK1A 3OF0A 4W4YA 3LFQA 2UZTA 5EKNA 3O0GA 1W8CA 3RZBA 3TNIA 2VTSA 4FZ6A 4PTEA 4WOVA 3V6RA 4FUXA 4E26A 4EEVA 3UIXA 4EOOA 1A48A 3DV3A 3L9PA 3QXPA 2CKEA 3FBVA 4I0RA 4E93A 2PTKA 4X6QC 4L43A 4TW9A 5ANJA 3HL7A 3AC1A 1OVEA 1PKDA 1ST4A 4M66A 4E5BA 5KUPA 2J4ZA 4LUEA 4MX9A 3M2WA 3LMHA 4KBCA 4WIHA 5CSXA 4J8MA 2C6MA 5M53A 2C6IA 5DHJA 1JNKA 1YXXA 2BRHA 3QA8A 3R1YA 4U9AA 5AR4A 4DH3A 3T3VA 3TTIA 4ZJVA 3DBEA 3VBWA 4EQCA 2KULA 3REPA 3Q96A 5CTPA 3V5JA 1JKSA 2OH4A 3NR9A 3GENA 1OUYA 4BDIA 3VBYA 3LMIA 3ZSHA 4CYJA 4EH7A 2XEZA 4PPAA 5IG1A 3FZ1A 3QL8A 1P4OA 5H3QA 5TF9A 1GNGA 2EVAA 3KN6A 4AE9A 4BYJA 4RIXA 4U79A 2QU5A 4I5HA 3TZ7A 5A4TA 4JRNA 5CSPA 1KUTA 3O71A 2XANA 2WQBA 3LPBA 4YURA 3KULB 3R28A 5M07A 5GJDA 2FUMA 3W0OA 1Q4LA 5FRIA 3BYVA 3OP5A 2VO7A 3RPSA 3KA0A 2NRUA 4CFUA 4EH3A 3DZOA 5CY3A 2R3MA 1A06A 3IW4A 3VS3A 4CFXA 4YNEA 4MXXA 4EYMA 3DNDA 4ZTSA 2QOQA 4EOQA 3VONA 3EMGA 2ITTA 4TYEA 2GNJA 2BHEA 2G15A 5BYZA 3L9LA 3IDCA 4HYUA 2QOCA 1YDSE 4M8TA 3MH0A 4LV8A 4N0SA 4IB0A 4NTTA 4S33A 4ZSGA 5B2KA 4EK3A 4EONA 1UU3A 2WOTA 3SGCA 2HAKA 2PZYA 4EOLA 3SRVB 3BYOA 3V8WA 3MH1A 4I3ZA 1UV5A 2CLXA 2R7BA 3R63A 4K2RA 5HG7A 4FT5A 4EHEA 1YRPA 4FTJA 4ITHA 3V5TA 3ZRLA 4DGOA 3NIEA 4HZSA 4HPUE 2YM5A 4ASZA 4D2RA 3LXKA 2UW7A 3QALE 3NVKI 4QYFA 4I22A 4IWPA 3QCQA 3TV7A 3EKKA 3II5A 2WIHA 3CR0A 4MNEB 5JK3A 2CNUA 4FEVA 4OAVB 4XOZA 4UMRA 4G2FA 3ZBFA 2UW3A 3O8PA 2ZFYA 4ITJA 2BRMA 3VUTA 4O86A 5ANDA 2JDSA 5HNGA 3VRYA 4DEDA 3QHRA 3LCTA 2VTNA 3BI6A 3QHWA 3PUFC 4JI9A 2VNYA 2R3PA 5CALA 3TXOA 3ZEWA 5DMZA 3F2AA 2XRUA 4GIHA 4NZWB 5KKRC 4GK4A 4DLJA 4LDTA 4Y95A 4O4BB 1PXLA 4CZYB 3NEWA 3I6WA 4I1ZA 5FM2A 3SLSA 4D4RA 5CAUA 1U54B 3MFUA 4XUFA 3V6SA 3DBFA 1ZYCA 3ZZWA 4RVMA 3R83A 2Y4PA 1T46A 2OWBA 5AMNA 4AGCA 1OPJA 3Q2MA 2Q0NA 4NFMA 2WMRA 3ZLWA 4DTAA 3AC2A 3NRMA 3O8UA 3Q9WA 2PMOX 4ORKA 4G6NA 4AA5A 2YLFA 3CEKA 4FL1A 3DJ5A 3HZTA 4BCMA 2R0IA 3QUPA 5A9UA 4RVKA 4QT1A 2GHGA 2GQGA 4BBMA 5AV4A 3VC4A 4F0FA 1CKJA 3PLSA 4A7CA 3W2PA 3WILA 4TTHB 5GJFA 2HZ0A 5CAQA 4HGTA 3ZXZA 2WKMA 3KGAA 4PMTA 4X6RA 4K18A 4MAOA 2G2FA 2CMWA 1YXTA 3E87A 4C2VA 5I5ZA 3PXQA 5HTIA 5KMLA 2W99B 2Y4IC 3E8NA 2Z7SA 4CNHA 4BIBA 2R3JA 4ANNA 4TYIA 4D2SA 4FK6A 3BU5A 2CCHA 4BTKA 5EOLA 2F49A 5E8ZA 3HEGA 2FVDA 3TMOA 4FSZA 3HV7A 2BZJA 3BLHA 3MPTA 2CN5A 2E9VA 4EZ7A 3H9RA 3KXGA 4ZTHA 4X3FC 2QO9A 3EQHA 4JBPA 2B9JA 3AC8A 4C4GA 3QC9A 2J0LA 3EIDA 2RG6A 3TYKA 4KABA 1K3AA 5DGZA 3O7LB 3VBQA 4CYIA 4CKIA 2XYUA 5H2UA 4FEUA 4ZS4A 1WVWA 3V5LA 2J0JA 3DKGA 3PSCA 1PXPA 5EFQA 5C27A 3PE1A 1H28A 1JSVA 2W96B 3OS3A 4TT7A 4XG7A 4D2WA 4DGGA 2QO2A 4FSMA 1MQBA 4TYJA 4NU1A 3IGGA 5HG5A 3BGZA 3PVWA 1NW1A 3KRWA 2WTKC 3OTUA 5BNJA 5D1JA 3RCJA 4BTJA 5JEBA 4AX8A 2I40A 3I1AA 3QTRA 4GT5A 2BRBA 3ETAA 3A8WA 3Q6WA 1IA8A 1GZOA 2QOKA 4EJ7A 3A62A 1WCCA 3KC3A 3T8OA 4WNPA 1TQIA 3W0RA 2FSLX 3R1NA 2OLCA 3O8TA 2YCSA 3GXLA 4KWPA 4E8AA 5BUJA 4FGRA 4FL3A 2UZDA 5J5TA 5L4QA 5CF8A 4YZ9A 3EYGA 4IFGA 3BPRA 3FXWA 3AT3A 4ASDA 4AXFA 1OZ1A 4K77A 4NK9A 2FB8A 3IPHA 3CP9A 2XNNA 4UB7A 4Y85A 4D1SA 5M4FA 4BC6A 5CU2A 5D7AA 3BE2A 4U0IA 5CI6A 4JIKA 4O2ZA 3DFAA 1YHWA 3QD2B 3FYKX 4QQJA 2P2IA 4AXCA 4AW1A 3T3UA 4RIYA 5C4KA 3NW5A 5HQ0A 5FTGA 5FG8A 1S9IA 3D2KA 4NJDA 5EKOA 4IAAA 3ZZEA 4EQMA 1Z5MA 3QCYA 4KBKA 3ORIA 4F9WA 2AEGA 1H0VA 2X7FA 5IQDA 1YWRA 3QWKA 5IQEA 4DCAA 2X1NA 4L7FA 1G8JA 3LFAA 2QR7A 3OBJA 3RM7A 4O83A 1ZMWA 5HLNA 2YHVA 3A7IA 1G3NA 3JUHA 3NVMB 3VBVA 1PXIA 3CD3A 4W4WA 5C1QB 5CU0A 3IS5A 2NPQA 3NUYA 3OXIA 3LAUA 3JYAA 3QRIA 2OICA 3KQ7A 1B38A 4BDKA 3AQVA 1H1PA 3E88A 3HV3A 4M13A 3UC3A 1UU8A 5TR6A 4DT9A 4X2KA 3VBXA 3FY0A 5AV2A 4E1ZA 3LJ1A 2VO3A 1XBCA 3NDMA 4KRDA 5IH4A 3AKJA 3BELA 2GNHA 3DTCA 3GVUA 3ZOSA 3GEQA 5KMIA 2J50A 3MA3A 4AQCA 2OIBA 2HZNA 3GOPA 4TXCA 5C03A 4F6SA 3BIZA 4TYHB 4YTCA 2PUIA 4EC9A 3BX5A 1M52A 4AZTA 3FHRA 3UVPA 4ZY6A 2GHMA 4U81A 3NUXA 5CNNA 1KE9A 3FXXA 4FVQA 5HIDA 4DFXE 2B9HA 4FV5A 2HK5A 3ZC5A 4BZNA 3S2PA 1QPJA 3D9VA 3GC8A 4FYOA 5ANIA 3R8VA 4B8MA 3KRJA 4A9YA 2UZNA 2WMBA 3ZM4A 4NM0A 1OL2A 3HNGA 2PWLA 4PNIA 4U43A 1R39A 3AD5A 2Q0BA 5K4JA 2JDVA 2ETMA 5AR5A 4ZSAA 3D5VA 1WAKA 4KS8A 1OPKA 4FV2A 4BR3A 2JDOA 2PUUA 3BKBA 3WZKA 4IQ6A 5FEDA 1YI6A 3R2BA 4C33A 3AG9A 2R2PA 1Y6AA 3P7CA 4ZOGA 4QTBA 4XG2A 3BLRA 4ITIA 1OI9A 3F88A 3BBTB 4FKPA 4I94A 3CKWA 5E1SA 4L3JA 3SV0A 3UYSA 3VW8A 4E5WA 5AEPA 1JPAA 4XG3A 1MQ4A 3PZEA 3FL4A 4FKTA 3BV2A 5CI7A 2X9EA 4F1OA 3C5IA 4F7JA 4ZLZA 3CS9A 4JBQA 3MH2A 4O4EA 4U42A 5E8TA 2HW7A 2YEXA 4BHZA 1SVHA 2UVXA 3LE6A 4FIJA 2REIA 5HX6A 1U5QA 5KHXA 4DHJA 3DJ6A 5LMBA 2QC6A 4JS8A 1R1WA 4HW7A 4DA5A 5M08A 4QPAA 3BHHA 4G9RA 4M0YA 2ZDUA 3F2RA 4MH7A 4E5AX 5E8YA 3OCGA 1YXSA 5IA3A 4UEUA 4BCJA 4CT1A 1GZKA 3A4PA 3DAKA 3UO4A 5M57A 3DXQA 4RT7A 3PPKA 3NYVA 4AQKA 3R04A 5J79A 3U6IA 2VGOA 4QP4A 5AM7A 3FSKA 5CEOA 3AC4A 2CSNA 2O64A 4Y5HA 2ZOQA 4U6RA 4G5PA 2BRGA 1OKYA 4FTKA 3E7OA 3C4EA 2YM7A 4IX5A 1W7HA 2J7TA 5ETFA 3UC4A 3IKAA 3ZFXA 3LFBA 3WF6A 5LWMA 3R7UA 1XH5A 4IJPA 2IVVA 5CXHA 5IQHA 3OVVA 5IMXA 4G5JA 3QRUA 3QZHA 3W16A 1QPDA 2WTDA 2PPQA 3GP0A 5KMKA 3TUBA 2PMLX 1JOWB 3R7EA 2WTIA 3ANRA 4C7TA 4O82A 2C6TA 4YC6A 5K3YA 3R1SA 5HZNA 1AD5A 3ITZA 1PJKA 2XF0A 2ZV7A 1M2QA 2RFNA 1WZYA 2A27A 4F1TA 3P78A 5EYMA 5BVWA 4EOSA 3QC4A 5I9UA 5BMSA 1XWSA 4IM2A 4OR5A 4DG2E 3C4FA 1RQQA 4RWIA 1JSUA 5IA5A 1TVOA 2VTRA 2OO8X 2YM3A 1WBOA 2J6MA 5GHVA 1Q99A 3BL7A 3F5UA 3OOGA 5KKRB 3JPVA 1ZMVA 4MXAA 3TNQB 4QMWA 5J9ZA 3R7VA 3AMBA 5LVLA 1IEPA 3PJCA 4FT3A 1B39A 3RTPA 1ND4A 5M55A 3P4KA 5C8KA 3LHJA 3Q4CA 4NUSA 1FBNA 3I0OA 3K5VA 3F5GA 3UDTA 3UIMA 4BICA 5T6KA 3VJNA 3IW7A 4TWPA 3FHIA 4KBAA 2EXMA 2GU8A 2WNTA 4BI1A 5HU3A 3MSSA 2OI4X 4GUEA 4IB5A 5HCXA 4O27B 3DK3A 2ZAZA 5HEZA 5KNJA 4EUTA 2GTNA 4G3FA 2B52A 2V55A 3ORLA 4ALVA 5A4EA 3PJ1A 2C47A 3OHTA 3CD8A 1OPLA 3CPCA 2G01A 3EFKA 4W9XA 2F7ZE 4YZBA 3FI8A 5BUIA 4U7ZA 5IEXA 4FV8A 5GZAA 4U5JA 3UOJA 3FWQA 1J3HA 1RW8A 3D4QA 3D5UA 5E90A 1YXVA 3ZHPC 4JMQA 3ZH8A 2ZM1A 2HCKA 2CHLA 1SYKA 5IEYA 4LMNA 4HYIA 3C13A 2XIRA 2FA2A 1E9HA 5D10A 3DBCA 3U4UA 3L9MA 4QEBA 3KY2A 4L9IA 5E8UA 2W1CA 3DZQA 4XG4A 3QAME 4O6EA 3FV8A 4S32A 1PRYA 2QOBA 2WQEA 3S00A 3WIKA 5CVHA 1IG1A 5CANA 3FLYA 4BFMA 5I9WA 4JL9A 2XM9A 4FA2A 4FE2A 3DTWA 4I4FA 2I0VA 3BV3A 3ZDUA 3R9RA 3QLFA 3E8EA 4U3YA 2VD5A 1M7NA 3F5XA 4L42A 4DFBA 4YBKA 3MB6A 3E63A 4X7QA 5HBEA 1OITA 2F9GA 3E8CA 4AAYA 1OUKA 2ITWA 4CVAA 5K4IA 4XV2A 3CE3A 2WTKB 2OFVA 1Q8ZA 5AUUA 4E3CA 2XIZA 4I6LA 5AAFA 2X6EA 4FNWA 1S9JA 3K54A 4AGUA 4RIXB 3AOXA 1IA9A 5KBRA 2PVNA 2X8EA 4HNFA 4EC8A 4IWOA 4ZP5A 4O7LA 3ALNA 5CAPA 1OIRA 2HWOA 3TZ8A 2GNFA 4HNIA 3UDSA 2E9UA 2V62A 3HVCA 5HICA 3WBLA 4IEBA 3G6GA 4C59A 4O0XA 4MD9E 2W5BA 4FIHA 2W9FB 5K0XA 3HAVA 4RFMA 4CD0A 2YAAA 4RMZA 4O22A 4D2PA 5IMEA 3CLYA 2W1DA 4J95A 2CGWA 4F09A 2YIRA 3AD4A 2O63A 2ITZA 4DTBA 4FF8A 4IX6A 3VUHA 4BB4A 4M69A 3U9CA 5E1EA 1ATPE 4C61A 4Z7GA 4L6QA 4YNOA 4QMUA 4NTSA 1GIIA 4U41A 3W33A 3HMNA 3Q3BA 4M14A 2IO6A 2YISA 3WYYA 5DBXA 5J5SA 4AN2A 2XAMA 3OY3A 4EYJA 4FSNA 3A7GA 4AZSA 4LL0A 3E62A 2KTYA 4YMJA 5JMSA 2W1ZA 2R3NA 4PUZA 4YJUA 3DAJA 4AZVA 4YSJA 4RC4A 5C8MA 3U54A 4AGWA 4IZYA 2XA4A 4DGNA 5AV1A 4ZLYA 2C0OA 2BFYA 3PVGA 2QONA 3FMNA 3HRCA 4G34A 4XHKB 4XV3A 2B1PA 1PHKA 3ZC6A 3LLTA 2FSOX 3ZLXA 2WMAA 2ZV9A 1MRUA 4XBUA 3QTXA 5EH0A 5EM7A 3ZO1A 1PXMA 2BTSA 3G0FA 3DKFA 3MV5A 4YC3A 2R0UA 4PWNA 3R8ZA 4AF3A 2XALA 5L3AA 2UW6A 1J7IA 4WG3A 4O0VA 3NWWA 4IAKA 5I4NA 4BL1A 3OCSA 4CLJA 2XNEA 3OWJA 2NNWB 5F4NA 3BEAA 3P86A 1R3CA 1XJDA 4QMTA 2UW8A 3FZTA 3H0ZA 4KSPA 5CQWA 5FWKK 3POOA 1FINA 5HO8A 5KO1A 4QDEA 5CEKA 1KE6A 3PY1A 4O84A 4FTLA 4ZTQA 3F82A 2BRNA 1H1WA 2C30A 2W1GA 3SDJA 3W2OA 4YZNA 5EI8A 3RAWA 4DFNA 4NCTA 3KKVA 3H10A 4BJJA 3FC2A 4F9BA 3PJ2A 3DQXA 1W2DA 4M67A 1H07A 2PU8A 3LMGA 4DH7A 3CTHA 3MDYA 1XMMA 3FI3A 3ZTXA 4PMPA 4E7WA 5J95A 2BHHA 3EQDA 2R4BA 2QLUA 2BKKA 4FGBA 4O0WA 4A9SA 4F65A 5AIKA 4DF3A 2OH0E 1TFFA 3OCTA 2WPAA 3RJCA 5TO8A 4LYNA 3W0QA 1SVGA 3PXYA 5A4LA 5K5NA 1G8AA 2HELA 1P14A 4IDVA 2YWVA 3SOCA 4F4PA 1XH7A 2R3QA 3GU5A 2DUVA 3IOKA 4QYYA 3QYZA 3NAXA 4WSQA 3ZFMA 2GQSA 3LFFA 2C6OA 3RGFA 2PE1A 2UZVA 3G2FA 3MY1A 4O7ZA 4W9WA 1UA2A 5EYKA 3ORTA 4TY1A 3HMMA 3UG2A 3WE4A 4QMYA 4M68A 4DITA 3R73A 2W06A 4OT5A 4RJ3A 4EORA 3ORMA 3TCPA 5HKMA 2OXYA 4M12A 5LCKA 2QLQA 1QMZA 4FVPA 4I6FA 5GINE 4C4EA 3OT8A 1ZZLA 4IAIA 4OUCA 5HLPA 3ENMA 2HW6A 5H8BA 2B9FA 5JSMA 3KREA 5I9ZA 3EL7A 2J9MA 2PZPA 4PNKA 2IZTA 1H01A 5HBHA 4IACA 2C5YA 4C8BA 2YCFA 4O7SA 3CJFA 4G6LA 5EHYA 4L52A 2A19B 4HGLA 2WIPA 4CXAA 2C5OA 1Z57A 2X4FA 5LOHA 4LM5A 3R1QA 5M44A 1VZOA 5IA0A 4JDJA 3W2RA 3TT0A 4F70A 1OGUA 3EQGA 5FTOA 3QLGA 3UO5A 4BKYA 4RA5A 4C2WA 5AWMA 4E4XA 3TG1A 5IH5A 3E93A 4CMTA 3ZLSA 3I81A 1YWNA 1ZYSA 4YZDA 3DPKA 4GT3A 4C36A 4A4XA 3QRTA 2RFSA 3QFVA 1H24A 3VS4A