5AEPA

Novel pyrrole carboxamide inhibitors of jak2 as potential treatment of myeloproliferative disorders
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
292
structure length
287
Chain Sequence
DPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Novel Pyrrole Carboxamide Inhibitors of Jak2 as Potential Treatment of Myeloproliferative Disorders.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 287
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5aepA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5aepA01
4FL2A 5JZJA 2XNPA 2XEZA 1JBPE 2ZAZA 3OOMA 4QP3A 3EQBA 3IDBA 4JQ8A 4FTTA 3FL5A 2CLXA 4XMOA 3A7IA 3DXNA 4FEUA 2IZTA 3CY2A 4BKYA 4JBVA 2PSQA 3E5AA 4YTFA 3LXLA 5HVKA 2B53A 3G6GA 3VJNA 3RNYA 3KXGA 4HVSA 3K3IA 3DU8A 4OTIA 2VTHA 4E5AX 3NMUF 2CCIA 4O96A 5FEQA 4L9IA 5JSMA 3FLZA 4EH9A 3VS2A 1DI8A 2WOUA 4AFJA 2OJIA 5B7VA 2ITTA 1NVRA 2GPHA 3A7GA 4JXFA 4II5A 2UZDA 3RINA 3LJ2A 4Y85A 2PZ5A 2XKFA 3R7IA 5AAFA 3WI6A 3ORZA 4AW0A 1YHWA 3A2CA 1M7NA 3MH1A 4JS8A 4GG5A 2P4IA 3MBLA 4AX8A 3SXFA 5DT0A 1YOJA 2C68A 3Q53A 3W1FA 5EQPA 5IQIA 3KCKA 3UO6A 4MX9A 4AN3A 3BELA 1OBDA 4D2PA 4RIXA 4YUQA 3N4UA 1Y8YA 5LXMA 1CMKE 5FDPA 4HYHA 3FLQA 4B99A 3MFRA 2BIKB 2XNGA 5HORA 4ERKA 2W1CA 1XBBA 3ENHA 4KWPA 3ZLSA 1NY3A 2VO0A 3O7LD 3VBQA 2ITOA 2XKCA 1WFCA 4FF8A 4O7LA 2IPXA 5I0BA 3FI4A 3GC7A 4PTCA 3EIDA 1Q3WA 3NVMB 3FXXA 2W5HA 3CP9A 3UOHA 2YCQA 3F5XA 5CU3A 5DHJA 4QMLA 2EWAA 1NVQA 1XH8A 4FKPA 5FWKK 4MD9E 4YSMA 4G9RA 3PWDA 3PJ3A 3LXKA 3K2LA 4S32A 5CF5A 4C2WA 4WO5A 4CFVA 3D5XA 3QA0A 2JAVA 4DYMA 3F3VA 4HJOA 3FZSA 1QPDA 3EN4A 3BGQA 5K4IA 3QRUA 3OEFX 5F1ZA 3NCZA 2ITXA 4X2GA 5J95A 3U51A 3RHXA 3C1XA 4UV0A 3OWLA 1FMOE 3FMEA 5L2QA 2PZYA 4QTBA 2PVNA 4N57A 3UYTA 4EHEA 4FTMA 2G15A 2WQEA 4GH2A 3O50A 3AMBA 2C3IB 4M97A 3LLAA 3UE4A 3BYVA 2J5EA 2BAQA 5AV3A 1V0OA 2IVSA 3VRZA 4BCGA 3NUAA 5IQGA 2X81A 4L52A 4WIHA 3DCVA 2W7XA 4LV5A 4XG2A 3SDJA 1NA7A 3MIAA 3R9OA 3R22A 3RPOA 4IADA 5C8KA 2UW7A 4FKGA 5L3AA 4XG4A 2REIA 5EQYA 2AC5A 4BIDA 2WMTA 3R00A 3A7FA 3FMHA 2O8YA 5H8BA 1H0VA 3VW6A 1SVEA 3E62A 4JAJA 4RVLA 3FV8A 4R7HA 3QX4A 1YOMA 4ZS0A 3ZSIA 2RFDA 2WD1A 3E8NA 3MVHA 3CLYA 4RFZA 4DGNA 3P7CA 4F6SA 3M2WA 3OBGA 2WOTA 4MD7E 2PULA 1YI3A 2EUFB 2X7FA 4R7IA 4AA4A 4AT3A 3F5GA 4QQCA 3R2BA 4OTPA 4HCVA 4E5BA 3COHA 4IFGA 1R0EA 5M06A 1Y91A 3TCPA 3UZRA 5E9EA 4Z16A 4D2RA 5ACKA 4C34A 1TQIA 3R83A 4IWPA 4A9TA 4IACA 2CHLA 3KN5A 2XJ2A 3DKGA 2QOIA 3PLSA 3NDMA 5JFVA 4BDAA 3OUKA 1WBSA 3ACJA 3MGYA 2VTPA 3NGAA 5CEIA 4A4OA 1J7UA 3TTIA 4A4XA 4M7IA 4U45A 3LFAA 1Q62A 5FLFA 4J8MA 5ETCA 5IISA 2OICA 3PSDA 3S00A 1GZ8A 3BBTB 1OBGA 2EXCX 5LARA 4YJRA 1U59A 4DEEA 5CZIA 4I4EA 3O8UA 3H0ZA 2JITA 4FT0A 4IXPA 4P4CA 3IW6A 2ZV2A 4BTMA 1E1XA 2BZIB 3EB0A 4CTBA 4F6WA 3OBJA 5GINE 2VZ6A 3RNIA 4EC9A 3FI8A 4QTDA 4GW8A 4YHJA 4Y72A 4ITIA 1ZY4A 4MXYA 2VWIA 4DN5A 1WCCA 2GNHA 3UO5A 3EZRA 1ZAOA 2W1GA 2JC6A 3R6XA 5E8TA 2OKRA 1W8CA 4FBXA 3RAHA 3NVKI 5K0KA 4R3PA 1F0QA 5LWNA 4UBAA 5BQ0A 3BKBA 4CVAA 3A99A 2PZIA 2Y7JA 2XM9A 4QMVA 4U80A 4U0IA 3PJ2A 3GU7A 1JKLA 4MWIA 4RX9A 3N51A 5FQDC 5HCXA 2BILB 3OD6X 4H58A 3TV7A 2JKMA 3FJQE 4JR3A 3NUPA 4UZDA 3TTJA 3HMNA 3QHWA 5FTOA 3EQCA 3V6SA 2QVSE 5TE0A 2WHBA 2CKPA 3F3ZA 3I5NA 3BE2A 4GUBA 3DS6A 3LFFA 4L68A 5CAOA 2P2IA 2WMAA 3ANRA 3F61A 4U40A 2XNMA 2X0GA 4AG8A 1X8BA 4RIWA 5JMSA 2BUJA 1YDRE 4L44A 4PPCA 3C5UA 3NNUA 2QOHA 2IWIA 3AC8A 3VO3A 5CSPA 3TUDA 5L6PA 2IVVA 2RSVA 2PMIA 3HMMA 2O65A 3OVVA 1Z9XA 1LEWA 4QTAA 4DCAA 3HUBA 3ZOSA 3NRMA 4E20A 4FK3A 2YACA 5D1JA 2RG5A 3VUGA 3QKLA 4RWJA 4DLJA 2JBPA 3UDBA 2FSLX 4AE6A 5AV2A 5HU9A 1GOLA 2R3QA 3R9NA 4FZ7A 2QHMA 4BTKA 4J53A 3LM5A 2UV2A 3ITZA 2FH9A 3LXNA 5BVDA 4RVMA 4X6QC 2C3LA 3PY3A 5I9VA 2EXMA 3FZTA 3CTJA 4K18A 5L4QA 1OPLA 3ANQA 3FPQA 3E8CA 5DH3A 1MP8A 4TYIA 5AR8A 3V8SA 2QG5A 2BRBA 4D2WA 3R8LA 2PU8A 3VS0A 2R3NA 3O71A 3RGFA 4RC4A 4EH3A 2XIYA 3PXKA 3M1SA 4R1YA 3KA0A 3KFAA 4YJTA 4FICA 1JKTA 2HK5A 3WIGA 3RK5A 1OKWA 1W83A 2YWPA 4WRGA 2VTSA 2BKZA 3NYOA 4HGLA 4TWPA 3ZSHA 4BCFA 2VO6A 3I79A 1R39A 4L42A 3VAPA 3HV6A 5K0XA 4QMQA 3GCQA 3O2MA 4GK3A 3G0FA 2C5VA 4XEYA 3BX5A 4FSRA 3F3WA 4EZ7A 4M0ZA 3R1NA 5KO1A 1Q8TA 4KRDA 4O0YA 3ZMMA 2B7AA 3DT1A 4BICA 2LGCA 3TM0A 4QTCA 2W1DA 1UKHA 1ZZLA 5HIEA 4N6YA 3HDNA 2JFMA 4MVFA 4C38A 1M52A 3SV0A 5BX0A 2C6DA 3I5ZA 3RVGA 4NM3A 4FT9A 5CY3A 5EFQA 3OTUA 4EWQA 4LM5A 2RFEA 2YM7A 4BIEA 5C27A 5M56A 3L1SA 4IQ6A 5JFSA 1MQBA 3BI6A 4FIFA 4G6OA 3ZO4A 1Z5MA 4O81A 4EI4A 4WA9A 4AW2A 1SVHA 3HA8A 5IQHA 4D2TA 1PXMA 2ZM3A 1WVYA 2XP2A 2W1FA 2WZJA 4XX9A 3IOPA 2O63A 2BDJA 3CKXA 4QP4A 4PL5A 1UWHA 4BB4A 2GNIA 2E9PA 4ZZMA 3E64A 3VJOA 2ITYA 3G90X 4YJSA 4FTNA 4IE9A 5BVKA 3H3CA 4E7WA 3SG9A 1YHSA 1OECA 4HZSA 1Q8WA 3RJCA 5DIAA 4HVDA 2Z02A 4UMQA 5LMBA 3KMUA 2XIKA 4GUEA 3MS9A 2HXLA 1J7IA 2PVRA 4UWBA 5IA2A 3LPBA 3TDVA 4E6AA 3BQRA 2C0OA 3KXXA 1Q3DA 3D7ZA 4N0SA 3W33A 1HOWA 4RQVA 4WBOA 5A4LA 3Q2JA 3CJGA 2PMOX 3Q04A 3ZONA 3MB6A 4YNOA 5AX3A 2A2AA 1ZRZA 4KIOA 3SC1A 3H4JA 4O22A 2ESMA 3HV3A 4KNBA 3AGLA 4JBPA 3ORKA 4NWMA 4PWNA 2YIQA 2XIXA 5HE2A 3DZQA 4JQEA 4BDKA 3VS7A 2ACXA 5M55A 1P14A 2UW5A 4JQ7A 4YC6A 4YJUA 4LMUA 4C59A 2NPQA 4I94A 4C3FA 1PMUA 2YJRA 2Z2WA 4G1WA 5C03A 4O86A 4FKOA 3P79A 4E6DA 5EM8A 4FZFB 4I20A 2UW8A 2WPAA 3QCSA 5HG5A 3TEIA 2Y8OA 4EH7A 4LOOA 4EOIA 4CLIA 4O7TA 3KN6A 3WZJA 4MXXA 3Q5IA 4DEAA 4QPMA 4ZXTA 3DQXA 3FKOA 3KB7A 4ORKA 4YBJA 5J9YA 2DS1A 2R3LA 1OKVA 3QGWA 4XLVA 1K2PA 3BPRA 4OBOA 4IM3A 5AMNA 3VUTA 4R5YA 4AW5A 3FDNA 3PLAE 3PRIA 5KKRC 2V7OA 1BKXA 5HO6A 3U87A 5A4CA 2IZSA 4HYUA 3V01A 2OXYA 1WBVA 2IVTA 2QC6A 4UN0C 2JBOA 2ZV8A 4JDHA 4W4XA 1L8TA 3QFVA 2OZAA 1SZMA 4IB1A 2VUWA 2HZ4A 5DI1A 4FSYA 2VTJA 5KKRB 4JAIA 3WF6A 4CZYB 4QMZA 3M42A 4ASXA 3FAAA 1O6LA 4HYIA 5TKDA 5CANA 5CNNA 4ZTQA 4AGWA 4DHFA 4JG7A 4RJ3A 2Y4PA 4MNEA 3FC2A 4RIWB 2UZTA 5AUXA 2JIVA 3MFTA 1P5EA 1UWJA 3UP7A 4E6CA 4LG4A 4XOZA 2VAGA 1BMKA 5BYZA 3MV5A 3TNHA 2YCFA 3NX8A 1ZMUA 2BALA 3W8LA 1KOBA 3QA8A 4BVUA 3F82A 3OG7A 5FM2A 5IUGA 4IIRA 3K5UA 2VTNA 4S31A 5CI6A 4K6ZA 4BCOA 4DITA 1H1SA 3IKAA 4ZSJA 4CKRA 3TKIA 2QO9A 2C4GA 4EUTA 5CNOA 1W0XC 3UBDA 3NAXA 3JVSA 3CQWA 2HW6A 1OL5A 4NIFB 4FTUA 3VNTA 2YLFA 4IZ7A 4F0GA 2P0CA 3T3UA 4JBOA 1F3MC 2UVXA 2FA2A 2UZNA 3PSBA 5CQUA 5CEMA 4DFBA 3QXPA 3VWAA 2VD5A 2CGXA 4OTQA 3ULZA 4BYIA 2OWBA 3KL8A 3MY5A 3EZVA 5AP2A 2VWVA 2QHNA 1J91A 4G6NA 3VBXA 2QOKA 1H07A 2J90A 5DPVA 3ALNA 4FSNA 2Y9QA 1Y6BA 4QRCA 4EK8A 2HY81 5M53A 3R02A 4PMPA 5DGZA 3R9DA 2VTOA 4RQKA 3G5DA 5CVHA 4E4MA 2HCKA 4IZYA 4XBRA 5JQ5A 5DT3A 1Q8ZA 4FTJA 3T9TA 5EM6A 3ATSA 2XIZA 1GZOA 1S9JA 5AP1A 5HLPA 3OXZA 4BRXA 5JKGA 3FEGA 3GP0A 4L3LA 4WRSA 4C35A 4D2SA 4I41A 5LVOA 1GNGA 4YTIA 4IAAA 3KCFA 1YVJA 2BRGA 5AP4A 2ZYBA 3MN3A 5E92A 4FSTA 3MWUA 5FP5A 3U54A 4FV9A 2OG8A 2QOBA 2WGJA 4OTFA 4ZIMA 4R78A 3HECA 4MYGA 3HP5A 3R7GA 4FSUA 3FYKX 4GFOA 5GHVA 4TT7A 5KHXA 1VYWA 3L9NA 4C4GA 3FMNA 4R8QA 4EH2A 4AZEA 4QP2A 5CZHA 3P0MA 3PIXA 3V8WA 5CF8A 5K3YA 4PDOA 4G34A 4E8AA 4BWKA 1KOAA 4QMUA 4ANQA 5DNRA 2HY0A 2J0JA 2KTYA 4TWNA 4CYJA 3F2RA 3TV6A 5DN3A 3DKOA 4IANA 4AZTA 3V04A 3DKCA 3MY0A 3F9NA 5J87A 5CWZA 3LFSA 3OW4A 5J5TA 3MFSA 1OL6A 3AG9A 2QO2A 5JFXA 5HCYA 1OB3A 1YRPA 4YO4A 4W4YA 5M4UA 4GCJA 2UUEA 3G33A 4AZVA 4K0YA 5DWRA 3WE8A 4F63A 3L8SA 4D9UA 1RE8A 2YM8A 4C3PA 1CSNA 4YPSA 4GRBA 2UZEA 3JY0A 2R9SA 4QOXA 1JQHA 4YU2A 3E92A 5AR5A 4W8EA 5J9ZA 2X4ZA 3AD4A 1ZMWA 3LXPA 3A7JA 3EWHA 5C26A 4NH1A 1WBWA 3TWJA 4HW7A 3QU0A 4M14A 5FXRA 3UVPA 1DI9A 2ERZE 2B9FA 2W9ZB 3BBWA 3NPCA 1IRKA 3PTGA 4OTRA 3ZCLA 1TQMA 4ASDA 3DK6A 4UWYA 4BDDA 1YXUA 3FZPA 5M09A 4V01A 5D7VA 5DOSA 2BHEA 4IWDA 3Q9XA 4KIPA 4M8TA 2H6DA 5GJFA 3F69A 3QRTA 4C4FA 2BTRA 5EOBA 2Y4IC 5TOZA 2WIHA 1ZWSA 2J0KA 3BGPA 4FKSA 4QQ5A 3R7YA 2XM8A 2UZWE 3JVRA 3RCDA 4L3JA 3ROCA 3DFCB 1TVOA 4FIJA 4YJOA 5AR4A 1NW1A 4C0TA 2GSFA 3GXLA 5AR2A 3JYAA 1SMHA 3BHHA 5EDQA 4C61A 4O21A 5EYDA 4BZOA 3FZRA 4GFGA 4MBIA 4H1JA 5D10A 4BDEA 5IEVA 2PUUA 5DEWA 1AGWA 4PY1A 4RC2A 2WAJA 3FMJA 2X7OA 2ZM1A 5KMKA 4JRNA 5DLSA 4F99A 4HVGA 2GHLA 3NW7A 3FMMA 3NUSA 4JIAA 5M51A 3LQ8A 2B52A 3QC9A 4ONAA 4WD5A 5J8IA 2WKMA 1H1PA 5LVLA 4MNEB 3KKVA 2JLDA 4BDJA 2VV9A 3QUEA 3V5QA 3PP1A 3F7WA 5FBOA 3R7EA 3HP2A 3FLNC 2LAVA 4ACCA 5IH6A 4L53A 2QLUA 3SXRA 5L8JA 5AP6A 3PG1A 3T8OA 1CKJA 2C6LA 5CU2A 1H00A 2PMNX 2HAKA 2R3MA 5ETIA 4FSMA 1PW2A 5L2SA 3KF4A 4NTSA 4YHTA 4FYOA 4U44A 4BDHA 2YABA 4DLIA 4APPA 5FXQA 2GQRA 2J2IB 3KRXA 1REJA 4CRSA 5AUYA 3ZRLA 4ZTHA 1GZNA 3NIEA 4UX9A 3NIZA 2B9JA 1LP4A 3D2KA 3HUCA 4XS2A 4FYNA 2W4KA 4DT9A 3MPMA 5E4HA 1O6YA 1XHAA 1ZOEA 2XYUA 3EQFA 3MJ1A 4ZP5A 3UNJA 4O1OA 2OSCA 2XRUA 3LVPA 5L6OA 3WZKA 5I4NA 3G15A 5KMNA 5IMXA 5EI2A 3DJ6A 3UOLA 3VUKA 2WB8A 4IB3A 4BI1A 3GOPA 4UYNA 5A9UA 1WBOA 1IA8A 4RA5A 4U81A 5TT7A 4M84A 4C7TA 5JT2A 4DH1A 3PA3A 3SW7A 4HGTA 2OJJA 2VWXA 4ACGA 4JIKA 4KD1A 5HEZA 2QCSA 3IGGA 3DNEA 4O2PA 1OI9A 2X2LA 4ZY6A 5KHWA 1YI6A 3PVGA 5KMLA 4MQ1A 3MESA 5CT0A 4L43A 5IA4A 3LMHA 4KS7A 2W99B 3ZEPA 4F0FA 3OC1A 5ITAA 3B8RA 4DFUA 4H1MA 2VX0A 1BL7A 4V04A 3WZDA 4D58A 4X3FA 3U8WA 2PL0A 3B8QA 3MTLA 4W9WA 4ACHA 4GL9A 4H39A 4IX6A 2PHKA 4DTAA 4AA5A 4OBPA 3PA4A 3LZBA 4UY9A 1K9AA 4M12A 1H4LA 2F7XE 3QTSA 4AE9A 2VGPA 2PVMA 2PVLA 4HYSA 1E1VA 2CN5A 3W2CA 1WBTA 2R3OA 4BYJA 2RL5A 3K54A 3QZGA 3RCJA 3VUDA 5DVRA 3CD8A 3NS9A 4AP7A 4RWKA 4PMMA 3IONA 4FTLA 4PNIA 4FTKA 3D0EA 3R9HA 3TIZA 5LVNA 2ZV9A 3WYYA 3GQIA 2C5OA 3W55A 4ZS4A 2CCHA 4AOTA 4U3YA 3D5VA 4EH5A 2C30A 5D9HA 2WQMA 3ZH8A 3RPSA 3QALE 3THBA 4D4SA 1W82A 3FBVA 4N4SA 1G5SA 1Q8UA 4ZMEA 2FYSA 2OH4A 3GBZA 4HCUA 4FIIA 4I3ZA 1FVRA 4GK4A 3VS1A 1G8AA 5I9ZA 1GIHA 1YKRA 4MXCA 4XG8A 3HDMA 3WARA 1PY5A 4J97A 5GNKA 5HQ0A 4FV2A 1OGUA 2R3PA 3G9NA 3OTVA 4GVAA 5EW9A 2JKKA 2ZDUA 3F5PA 4RJ7A 4FVRA 2DQ7X 4ACDA 1R0PA 4IJ9A 4KB8A 4DG0E 3FKLA 4I1ZA 3LQ5A 4GT5A 3GC8A 3FE3A 4F9YA 5HBJA 2PTKA 3Q52A 4EL9A 2QU6A 3TN8A 1XH7A 3L9LA 5AA8A 1H08A 4RMZA 4U6RA 1PXPA 1UU3A 3OW3A 4RLKA 4FEXA 2XJ1A 4DEBA 4J99A 1DAYA 3R8UA 4C36A 3TXOA 4P5ZA 3TACA 3QWKA 3FMLA 4EH8A 4I5PA 5AR3A 4TXCA 2GFSA 3I60A 2W1IA 4FKJA 4JDJA 4XP2A 3QBNA 4IX4A 5KMJA 3DDQA 1OPKA 2X8DA 3H0YA 2IVUA 4LV8A 5CU6A 3RWPA 1PF8A 3Q4CA 3Q4UA 4B6LA 2GTMA 4CCBA 2XCHA 2Z7RA 5CAUA 4QMPA 4DT8A 2AUHA 5HTCA 4CV8A 3LOKA 3SOAA 3EQIA 2HZNA 4IWOA 4DGGA 2PK9A 4AT4A 3H9RA 4C57A 1KE8A 2DUVA 4EH4A 4ASZA 3OT8A 4JT3A 2YIWA 4DC2A 5KCVA 1OITA 4ZAUA 5AV1A 5HOAA 1YWNA 2VTLA 5EYKA 4OT6A 2OW3A 3EFLA 4CKIA 1IAHA 3BU6A 3P78A 1Z57A 3PXZA 5I9XA 3GU5A 5AEPA 2YCRA 4KSQA 3MFUA 2JGZA 3BCEA 3O8TA 3PUPA 3TL8A 2YA9A 2VRXA 3QZFA 4IAZA 4QMOA 2IZUA 3VRYA 1XQZA 4ENXA 3DQWA 3ZLXA 5J79A 3U9CA 4AU8A 3R8MA 5EG3A 2GNJA 2CSNA 2V5QA 3FZOA 1XR1A 5HNGA 2UVYA 4LYNA 2VTQA 4BGQA 2C6EA 2QOLA 3HRBA 5HO7A 5AR7A 5AP7A 4P7EA 2VNWA 4RC3A 2BZJA 1MRYA 1FINA 4D4VA 4FV6A 4UMRA 3ZLYA 3SGCA 4XRLA 4DA5A 3ZYAA 3RAIA 1YOLA 4MKCA 2PUNA 5ANEA 2GU8A 5C8MA 2IZRA 4LRJA 4D5KA 4RRVA 3AC1A 3DA6A 4D9TA 5IU2A 5M08A 3OY1A 2VTAA 3BZ3A 4FK6A 2OK1A 1R3CA 1U5RA 2W9FB 3UOKA 2V7AA 3LE6A 5LVMA 3KMMA 3Q9ZA 4FI1A 4BCMA 3N9XA 2XNNA 3QQHA 3ZSGA 4FE2A 1H24A 3DB8A 3QQKA 2BR1A 2VTMA 5K4JA 2C1BA 1KE5A 4YPDA 2A27A 4IB0A 4EUUA 3DZOA 4DG2E 4U43A 4AN2A 2CMWA 3BHUA 1SNXA 3LCDA 2R7IA 3OP5A 4KAOA 1U4DA 2CLQA 1WVWA 1UU7A 3GVUA 3KULB 1U54A 3LFEA 4YBKA 3ZUUA 1UU9A 5EW3A 2UVZA 1FGIA 2ZV7A 3FYJX 3L9MA 1R78A 3V51A 3ORNA 4KIKB 4QPAA 4UMUA 4FV0A 1OL1A 2WMRA 1MRVA 4W4VA 4ZZOA 4QMWA 4QQJA 5IA3A 4H36A 2IG7A 4CG9A 1J7LA 2JAMA 3QXOA 4GVJA 3GC0A 4BHNA 4J96A 2W5BA 3UIMA 4X3FC 3OEZA 2ITVA 4UXLA 4FIGA 3ZUTA 1XH6A 2OIQA 4O0WA 5E1SA 4GG7A 2AYPA 4QPSA 3HAMA 4LRMA 5DFPA 5L2IA 3MI9A 2WMQA 2YM5A 4DH7A 3IG7A 4FNYA 4X3FB 4YLKA 4A9YA 2HOGA 5T6KA 3LJ1A 3EMGA 4TYJA 3ZUVA 3KREA 3PPKA 5L8KA 3MSSA 4A06A 2B4SB 1UU8A 4TYEA 5F20A 5J7HA 2ETRA 2EB3A 4KA3A 1ZOHA 2SRCA 5C8NA 3SXSA 4KUJA 5F94A 4O38A 4Y83A 1P2AA 4WNKA 5HIBA 1NVSA 3MA6A 2CNVA 4GKHA 3RK7A 3F2NA 5DR2A 4DGOA 1JVPP 2ITWA 1SM2A 3RZBA 4MBLA 5I3OA 2OIDA 4C4IA 4IAFA 4CMTA 4OW8A 3PA5A 1UNLA 3H9OA 4HNIA 2ITPA 5E8XA 2OIBA 4GU9A 3KGAA 4EOQA 2A1AB 3O0GA 2C1AA 5BUEA 4O27B 3HV4A 4AF3A 3P08A 3CSVA 3QD3A 3E3BX 2OXDA 3ZO2A 3LJ0A 3PE2A 4KS8A 3OMVA 4NM0A 1PHKA 3G6HA 2JDVA 3SA0A 2PE1A 3TJDA 4R3CA 2BFXA 3R1QA 1ND4A 4NU1A 3WILA 2IO6A 4ZSAA 3LMIA 3F88A 4C2VA 3Q9WA 4O84A 4RX5A 4AAAA 4I0TA 5CSVA 2QLQA 4AW1A 1YHVA 2VWWA 3ETAA 4ID7A 4PDYA 1YDSE 3GFEA 3AGMA 4PMTA 5AUTA 3DXQA 3DV3A 3CR0A 1OIYA 3AC5A 3TI1A 3F3TA 3KQ7A 2PUPA 2BAKA 5DMZA 3AD5A 2BAJA 2OGVA 3R2YA 1DS5A 3UPXA 5HD7A 4XV2A 3TZMA 4O7WA 4C4EA 3LCTA 2C6IA 2F2UA 2WQOA 2ZDTA 4NIFA 1EH4A 3QLFA 5EHYA 3TNIA 4DH5A 4E73A 3DXPA 3ACKA 4IW0A 3RZFA 3DBQA 2W1ZA 4K1BA 3F5UA 1SVGA 3LFQA 1IG1A 5DYJA 5AUUA 2C5NA 2X8IA 5J1WA 3Q96A 4QMXA 1JLUE 4FKRA 5CF6A 4D0WA 3MA3A 3ZM9A 3IO7A 4TYHA 1BL6A 5BVNA 2R64A 3MB7A 3F7ZA 3GEQA 3W2PA 3QX2A 5ANGA 2GS6A 4BFMA 3VF8A 1SYKA 3FHIA 3MDYA 4B8LA 2BROA 3PSCA 2ZJWA 3IPHA 2R3RA 4FZAB 3ZZEA 3GU8A 2ITNA 3W10A 3UMXA 2XH5A 4NK9A 4XOYA 4PNKA 4P90A 3TNWA 3O51A 3S4QA 5KMOA 3D94A 4MXAA 4EQCA 2G2FA 3C13A 4BCJA 5IQEA 4Y5HA 2C6OA 4L00A 1JSTA 2OH0E 2G01A 3LAUA 4K33A 4FV7A 1VYZA 4TWOA 2QI8A 3PG3A 3DNDA 3K5VA 1L3RE 3F2AA 5HGIA 3P9JA 2NO3A 5A4QA 4XG3A 3E8DA 2XK4A 4EBVA 1ZXEA 3QQFA 3QTRA 3F3UA 4P5QA 3PVWA 4M67A 3A60A 3UGCA 4M68A 4XG6A 1H1RA 3TNPC 3QTQA 1ZZ2A 3AXWA 4O6EA 4QD6A 4OBQA 4G3GA 5DR6A 5AUWA 1GAGA 4M66A 3BYUA 2YDIA 1JPAA 3UO4A 5AADA 5F9EA 2CNUA 4FIHA 2ZM4A 4RWLA 3D14A 3VVHA 4GJ2A 4C37A 4F1OA 4N70A 2QOCA 2NRUA 5J7BA 4XG9A 4EQUA 1QPEA 4AOIA 3EOCA 3R9RA 3Q4TA 5A14A 5C01A 4B9DA 4S2ZA 5TO8A 4BL1A 5E7RA 4BTFA 1LR4A 3MTFA 4CQEA 3JR1A 1M17A 3OS3A 1U54B 4GT4A 4YZMA 1OUYA 5IKWA 4AZSA 4F9AA 5I9WA 2B0QA 3N4VA 4HCTA 2EXEA 5KE0A 1M2PA 1RW8A 3QF9A 3MY1A 5AV0A 2VTTA 2C0TA 3S1HA 4L7SA 4DTKA 3HYHA 2A19B 4O2ZA 5IQCA 1ZARA 4G3CA 3IW8A 2OJGA 1M2QA 4F7SA 2CGWA 5B2LA 4TTHB 1GY3A 3FMDA 3NUYA 4F64A 4H3PA 5LJJA 4MBJA 4NSTA 2EVAA 4FSWA 5M4FA 4FGRA 4RJ4A 2HZIA 4MF1A 2ITQA 4AXAA 3RPRA 2X6DA 4FKWA 2FGIA 2XEYA 4IVDA 5BMSA 3UIBA 5KUPA 4YZCA 4E3CA 4YJVA 4FNXA 3WF8A 3CCNA 4QMNA 3OHTA 4HGEA 4OUCA 3GFWA 5K5XA 3NYVA 2YERA 5AM7A 5FRIA 3UQGA 1PXLA 4UMPA 4PV0A 5CEKA 4EYJA 1M2RA 1HCLA 2I0HA 4AA0A 4RZWA 3HVCA 3QL8A 3WBLA 4HPUE 4I5CA 1OL2A 3IDCA 3LIJA 2OBJA 4CRLA 4DBNA 3FMKA 3RAWA 5K9IA 4RIOA 1ZYDA 1STCE 4I92A 5BYYA 2QONA 2H96A 4OTWA 3UQCA 3TIYA 4JRVA 3KVXA 3Q3BA 3POOA 5M57A 3Q32A 2WELA 3R1YA 3QTUA 4IZAA 4L6QA 1JAMA 5EI6A 4AZWA 1FOTA 2BVAA 2V55A 4GS6A 3TZ8A 3NYXA 4AQCA 3CIKA 4XV1A 4AGUA 5BYLA 2WNTA 4I0SA 3JXWA 4FSQA 3F66A 4ZTSA 2UZVA 1PKGA 4DGLC 4FMQA 3G51A 3SOCA 3KU2A 2J4ZA 3FI2A 3RM6A 2J0IA 4USDA 5FG8A 5KMMA 4APCA 2HIWA 2XKEA 3RHKA 3EKKA 4L01A 4NCTA 2VTRA 4CYIA 4FSZA 4KIQA 5L6WL 1OPJA 3PY1A 5I9UA 4AN9A 3GU6A 3LCKA 5G6VA 4JX7A 3ODYX 4EKKA 5JGAA 4FT5A 3S3IA 3PVBA 2YEXA 4NFMA 4B0GA 3S2PA 3CKWA 5GZ9A 1KE6A 2O3PA 5A3XA 4BBEA 5KNJA 1XBAA 3JPVA 4XH6A 5CAVA 3GNIB 3QYWA 1GJOA 2HZ0A 3V6RA 5HTIA 5CAQA 4YURA 2GDOA 5CXZA 1P4FA 1OZ1A 2YISA 4I6QA 4HNFA 4CMUA 4EYMA 2XK9A 3UMWA 4XP0A 3NW6A 4CZUA 3L8VA 4D5HA 1YXVA 3RP9A 3HMOA 5FTQA 4LL5A 3COMA 3C4CA 4K2RA 5FUTA 2J50A 3NUXA 4JDKA 4M69A 2PUIA 4FNWA 5HBEA 2B54A 4U79A 4TYHB 4LGGA 1KV1A 4F9WA 1F5QA 1ZYJA 2YHVA 3FQSA 2CN8A 4XHKB 3R7VA 1B6CB 2XYNA 2YAAA 3REPA 3PPJA 5HE1A 3F6XA 2B1PA 4IM0A 4MXZA 4J71A 2BZHB 4WNMA 1V0BA 5D12A 4O1PA 4O91A 3Q4ZA 4UWCA 3W8QA 5B2MA 3IOKA 2WTDA 5FEEA 2E9UA 4BDGA 3UPZA 5T68A 3CE3A 4XP3A 4JDIA 3EQDA 3QZIA 3ENMA 4RJ6A 3COIA 4V05A 3ORIA 3RTPA 3ZTXA 3UQFA 4ZJVA 3NWWA 3O23A 2NNWB 1PYXA 3O7LB 3QRIA 3QHRA 2YM4A 3KRLA 5G1XA 3KK8A 4E4LA 5F4NA 5JQ8A 4ZJIA 1PKDA 3KXHA 4FKQA 3BQCA 2X2KA 3R73A 4ASEA 2X6EA 4RX7A 3T3VA 5LCJA 3DGKA 2ZOQA 3C0IA 5CSXA 3TUCA 2WMBA 3ERKA 2VWYA 3WIKA 2B9HA 4UEUA 1REKA 4QMSA 3C9WA 5D11A 2E9NA 5AIKA 2C47A 2QNJA 3A7HA 3HZTA 2R3FA 4WG4A 4QP7A 1QCFA 2BMCA 2UW4A 4X2KA 5AP5A 4FNZA 3NNVA 4FG7A 4FTRA 3COKA 3OY3A 1ZYSA 5DRDA 4RGJA 4Z9LA 2WEVA 2CGVA 5EYCA 2IW9A 4GYGA 2CKOA 5HNBA 3E7VA 2BRNA 3G0EA 5HVYA 4TNDA 2GNLA 4JLCA 4YJPA 4ZZNA 2J0MB 5IA5A 1J1BA 3MH3A 4YLJA 4W4WA 2OZOA 3EYHA 5IA0A 2EB2A 4F7NA 2AC3A 1GIJA 3FXZA 1LEZA 4DFXE 1URWA 4BI0A 1V1KA 3ROYA 3P7BA 3PXYA 4I5MA 5E91A 3R71A 3CGFA 4MWHA 1MQ4A 1MUOA 4Q5HA 3DTWA 2ETMA 4FKUA 5EKOA 1I44A 3MPAA 5IUIA 3NCGA 3SG8A 4DINA 4LGHA 2R5TA 4EEVA 4C8BA 4QMTA 2BDFA 2I6LA 2FSMX 5CVFA 1OIQA 3DK3A 3VBVA 5EKNA 3JY9A 1DAWA 3I6UA 4I93A 4XV3A 3PYYA 4B7TA 4DCEA 3DJ7A 5A4EA 3QYZA 5FXSA 3R8ZA 3OXIA 3DFAA 1UVRA 5H2UA 1MRUA 3BEGA 4Y5QA 3PXFA 5BUJA 3ORLA 1W98A 4JVGA 1YI4A 2XK8A 1J1CA 4DE4A 3NW5A 4PL3A 3UNKA 1PMVA 2W06A 1RJBA 1OL7A 1V0PA 2PVJA 3PXRA 3PIZA 2OI4X 3POZA 3R7OA 2OF2A 4J52A 2Z60A 3BRBA 3U9NA 3ODZX 4BDIA 2GNFA 3L8PA 5GZ8A 2R0UA 4CFXA 5BNJA 5C1QB 1G3NA 3EQPA 1JOWB 1H28A 2YIRA 1PXIA 4I6FA 4X2JA 5BVOA 3TJCA 4GEOA 3ZBFA 2PE2A 2DYLA 4FEQA 3RBWA 3I7CA 4ZLZA 4NW6A 3JUHA 5EM5A 1IASA 3C4EA 4HVHA 5DBXA 4FZDB 3BHYA 5A46A 3WE4A 3FC1X 3I7BA 2O0UA 5EOLA 1H8FA 4YZNA 2Z7LA 5HIDA 4DFLA 2XK7A 4EHGA 2WFYA 4EOLA 2ERKA 5JRSA 4LI5A 2O64A 4E26A 5IDPA 5ICPA 5JZNA 2WO6A 4RZVA 2WMUA 3BGZA 3GCUA 4NCTC 4USEA 4BCIA 4IBMA 1OUKA 3Q6UA 1UKIA 3E93A 4J98A 2WMSA 3VC4A 4FA2A 2CKQA 3SLSA 4DH8A 3HRCA 5L2TA 2WU6A 2QD9A 4EHVA 5HG7A 5EDPA 4A9SA 1OKYA 4DEIA 1WZYA 3RPVA 4EBWA 3UIUA 4ZTMA 5IQAA 3C5IA 4HPTE 3TDWA 2CJMA 4PDPA 5J9LA 5CXHA 4RJ5A 5E8UA 3EKNA 1XKKA 3GB2A 5CEQA 4RFMA 3BLQA 3VUMA 3UNZA 5J5SA 1JSVA 3UG2A 3RAKA 5HLNA 5HLWA 3HL7A 4LQMA 5FGKA 2BIYA 3WZUA 4EH6A 2RKUA 3KXNA 4BHZA 2E9OA 3OCTA 4IAYA 3EFKA 3EN6A 4LFIA 2B9IA 3OCSA 3JS2A 4WG3A 3ULIA 4IMYA 1JKKA 3R04A 4F70A 3RI1A 3LLTA 2R7BA 1VZOA 1PXNA 3BU5A 3NSZA 4J8NA 3P7AA 4QQTA 4USFA 2R3KA 3KULA 4PPBA 4R5SA 3BIZA 4M13A 2H34A 2KULA 4X21A 4EZ3A 5AA9A 2P3GX 2OFVA 2QKWB 4FG9A 2XBJA 1OVEA 4M69B 4PUZA 4YLLA 4KIKA 3WF5A 1JWHA 4WOVA 4YJNA 3UIXA 3UZTA 5CYIA 3NUUA 3O17A 1CKIA 4F9CA 3AT4A 4WUNA 2PY3A 3DK7A 2A4LA 4NT4A 3VF9A 3CTQA 4ZLYA 1VR2A 4GV1A 3SAYA 1H25A 3C50A 4IC7A 2G9XA 2UW9A 2UZBA 1RDQE 3DAEA 3EL7A 5JH6A 1KE7A 2YDKA 4FT7A 4EK5A 2ZMCA 5M07A 2QKRA 3BYSA 2PE0A 2PVFA 3V5WA 4BKJA 3CEKA 1Q97A 2W96B 4BCPA 4BTJA 1OMWA 2BFYA 4U41A 3AOXA 1BYGA 1A9UA 4O0VA 4QYHA 1YWVA 4DEHA 2XNOA 2XNBA 3AD6A 4ZSGA 4GFMA 2BPMA 3TZ9A 4FKLA 3PIYA 4PL4A 4XJ0A 1NT2A 4K11A 5HD4A 3AMYA 2ZB0A 1KWPA 5CVGA 4ALUA 2IJMA 3QTIA 3UZPA 5IQFA 4CNHA 4RBLA 4D1SA 3MIYA 2H9VA 2BKKA 4Z3VA 5HCZA 5K5NA 4G31A 4RG0A 4BGGA 3GUBA 1I09A 4FTOA 4LUEA 4DEDA 3UC4A 1WBPA 2YWVA 4ZTNA 4S33A 1PXJA 3FXWA 1H01A 2WTKC 3TV4A 4EOOA 4GT3A 4OGRA 3N4TA 4FKVA 3RM7A 3C4ZA 2OJFE 3QD0A 4YTCA 5GIPE 4JBQA 1R1WA 2WTKB 3R0TA 2GNGA 5LMKA 4M3QA 4L8MA 1U46A 4J1RA 2X4FA 3ATTA 1T45A 5I3RA 4ANBA 5FM3A 4DFNA 3MJ2A 4TN6A 1P4OA 4YGAA 4CLJA 5EQEA 2J51A 2QURA 4YJQA 5AM6A 3FWQA 1W84A 1LUFA 3HV7A 1Q8YA 5M44A 3H9FA 3LW0A 1PXKA 5H9BA 2FO0A 3FPMA 4IJPA 4MH7A 5AWMA 4ALVA 4F1MA 3TZ7A 1FBNA 4IB5A 1SNUA 3P23A 4U3ZA 3PJ1A 3OXTA 2QOQA 3C51A 2V62A 3KF7A 4E1ZA 3O8PA 5HICA 3OF0A 4A9RA 3ZZWA 3P5KA 2C6MA 3EN5A 3FKNA 4L3PA 4KBCA 2RFNA 3M11A 4D1XA 5EHLA 1WAKA 3QTWA 3RWQA 3VN9A 2J9MA 3ZXTA 3PY0A 4R7BA 3HMIA 2PZRA 5BUIA 4C3RA 4I4FA 3D5UA 3VS5A 4CFMA 5JRQA 3W2SA 3VHKA 5CEOA 4RA4A 3PVUA 4D4RA 4PQNA 5ACBC 2J6MA 2W4JA 4BF2A 3ORMA 3R01A 4BCHA 5IZFA 3EQHA 3VQHA 4JL9A 3W16A 4IX3A 2BRMA 3PDTA 2V22A 2XA4A 4FOBA 3SRVA 3II5A 4YC8A 4BBMA 2R0IA 3QWJA 3D7TA 2GQSA 2RFSA 4QYGA 1IR3A 2I7QA 4H3QA 4W9XA 1JKSA 5M4IA 4XLIA 4O0RA 3QCQA 4DFZE 2RIOA 4QYYA 4NL0A 2R3JA 2YDJA 5FDXA 3DBEA 5EH0A 2HWPA 3P1AA 4D2VA 2PYWA 4IDVA 2ZVAA 3HEGA 2W05A 2JKQA 3PPZA 4GIIA 5A6NA 3D2IA 4F7LA 1XJDA 3ORXA 3DTCA 3BYOA 4RFYA 3B2TA 3QKMA 4RSSA 3WZEA 4QMMA 3EFWA 4IVCA 4BDFA 4DEGA 4CEGA 4G6LA 4IM2A 3QZHA 4RIYA 4DF3A 5T3QA 4W8DA 2OF4A 3ZFXA 5DE2A 5LWMA 4FV3A 2C3JA 5CI7A 1A48A 1PJKA 3ZEWA 4CMOA 4A07A 2WTIA 5JGDA 2UZOA 1AD5A 3NZ0A 4QO9A 4FR4A 4C62A 4AZFA 1H27A 3QGYA 4I6HA 4BIBA 2YAKA 3Q9YA 5HTBA 4G3DA 2W0JA 5DG5A 3AMAA 4CTCA 3OWPA 2V0DA 4JOAA 3MYGA 4NM7A 4V0GB 4BCQA 1Q5KA 1LPUA 3P86A 5KBRA 4CQGA 3HA6A 4NYEA 4NTTA 5L2WA 2JIUA 3LFDA 5E8WA 4PP7A 3W2RA 2WTWA 4YHFA 2QR7A 4G5JA 2C69A 2BHHA 2IW6A 2WIPA 3IK3A 4P2KA 3UC3A 4CFNA 4YZ9A 5HU3A 2VN9A 3DBDA 3DDPA 3KK9A 3IECA 1ERKA 4KKHA 4O7YA 3C0GA 4MAOA 5AJQA 3IDPA 2VX1A 2VO3A 3QRJA 3OCBA 3QQUA 4PX6A 5HX8A 4EOSA 4G3EA 2X9FA 4NJDA 4MQ2A 5HG8A 1WMKA 4O0XA 4ACMA 2F7EE 3E8EA 4BBFA 2QQ7A 4EWHA 2X7GA 4Q2AA 4I0RA 4EJNA 2YJSA 4ANOA 4RVTA 1PRYA 4FKIA 4NW5A 2OXXA 3VS6A 4KBKA 4ENYA 5JK3A 2A0CX 1OIRA 2G2HA 2ITZA 2JDSA 4FTAA 1PXOA 4R1VA 3ZRMA 3DAJA 4A7CA 5E8SA 5EDRA 5GJGA 4FOCA 4EK6A 5E8VA 4D28A 4UB7A 1HCKA 3TKUA 3QQLA 3ZDIA 2JDRA 5IDNA 4Y46A 4MTAA 2WTVA 5AIRA 4CSVA 3DLZA 4LRKA 4E5WA 2I0EA 4FUXA 4O7RA 1ZYLA 2FUMA 1S9IA 3U4UA 3NAYA 3BHTA 3CXWA 4CV9A 4WBBB 3UJGA 5AP0A 1B39A 2Z7SA 4CFUA 3FLWA 3E7OA 5LMAA 2GHMA 4IHPA 4ARKA 4NKSA 3PZHA 2CNQA 4O82A 3A4OX 3Q60A 3GT8A 4F08A 4RT7A 4RX8A 5ANJA 5KMIA 1FGKA 3HV5A 3BHVA 4FV1A 4X2NA 4ZMFA 4ANMA 1Y6AA 4X3JA 3S0OA 4WHZA 3BWFA 4ANSA 4O7SA 3KRJA 5LMKC 3IW7A 4WSYA 4G2FA 3FSKA 3QLGA 2XF0A 3W18A 1YW2A 3KMWA 2WMWA 5DR9A 4CCUA 3CY3A 1OM1A 4HOKA 5BPYA 3LMGA 3A8WA 4XNEA 3A4PA 3GU4A 4FZ6A 3VQUA 2HWOA 2XK3A 2ZMDA 4D1ZA 3CC6A 4LUDA 4ZK5A 3A62A 4S30A 5JGBA 4K8AA 4M15A 3KXMA 4IAIA 4QNAA 3UP2A 5HE0A 3AC2A 1H26A 4FTIA 4FV4A 1QMZA 4PPAA 2R3IA 4O0TA 3PWYA 2VWUA 3SW4A 3CQEA 5CASA 2XIRA 1URCA 4TPTA 4KABA 2WMXA 1ZMVA 3HAVA 3ALOA 3DKFA 5IG1A 3FY0A 4AWIA 4XRJA 2IN6A 2QG7A 5H8GA 1O9UA 2UW6A 4FL1A 4RLLA 4XYFA 4EC8A 3DAKA 3CD3A 3UVQA 5EK7A 4EHZA 2OU7A 1OKZA 2W4OA 4OT5A 2PZPA 2XCKA 4DFYA 5A6OA 5IH5A 3R28A 1Y57A 5LCKA 3KY2A 4WNOA 4UYAA 3AQVA 4PMSA 4F09A 2WXVA 4IC8A 4QYEA 4WUAA 4ZY4A 1M7QA 4RIXB 4AACA 5BVWA 4FUYA 1PYEA 3LFBA 4ZJJA 4HVIA 3SRVB 3D7TB 3MH0A 2XK6A 3C4WA 1VEBA 2XRWA 4MXOA 3OUNB 5FP6A 5DT4A 3DOGA 2IW8A 3SHEA 4FG8A 2Z7QA 4Y95A 2GQGA 5JEBA 4YZDA 4DTBA 3VBTA 4F7JA 5L8LA 4ANLA 5C4LA 5E8YA 1PMNA 3LFCA 1YDTE 2P2HA 4YR8A 3TT0A 1BI8A 3FY2A 1UNHA 2R3GA 1FQ1B 4XBUA 4H3BA 3QCXA 5KX8A 3ID6C 4ZTRA 1YXSA 1ZY5A 3OZ6A 2VGOA 4GIHA 4XCUA 3V5TA 2YM6A 4NZWB 5CAPA 3QTXA 2BCJA 1OIUA 4IEBA 4RIYB 2O2UA 4TL0A 3B2WA 3UVRA 4NKAA 3Q5ZA 3UYSA 4AFEA 4CGAA 1PMEA 4FTCA 4O0UA 5F95A 4CFFA 1E9HA 4YC3A 3EN9A 3GCVA 4FL3A 2GMXA 4X7QA 5HESA 4JX3A 2GFCA 2P55A 3BV2A 3MVMA 5EI8A 1XO2B 2PVHA 2WTCA 4UXQA 5D7AA 5ETAA 4EOPA 2YCSA 1BI7A 3D9VA 4EONA 5LQFA 4MK0A 2HYYA 5BVFA 3ZM4A 3KEXA 2ITUA 3IW5A 3CS9A 3BYMA 4EOJA 3EHAA 2GTNA 3CJFA 2R4BA 2RF9A 2XKDA 1W7HA 4EOKA 5CSWA 4FV8A 2BTSA 5E8ZA 4C58A 4OTDA 3EFJA 2R2PA 3ZC6A 5H8EA 3TKHA 5DRBA 1ATPE 2CPKE 2JFLA 3HMPA 4FC0A 3RK9A 3O96A 5FTGA 2WEIA 4I21A 4DBXA 1BUHA 4AOJA 2UZUE 4G5PA 5AAGA 4EQMA 3BLHA 5KBQA 2Y6OA 4KRCA 4QP9A 4WNPA 4YTHA 4ZTLA 5FEDA 4BN1A 3EJ1A 2FSOX 4G3FA 4FIEA 2CGUA 1O6KA 3SKCA 4LOPA 1XH5A 3C0HA 2JEDA 4N6ZA 4Z7GA 2F9GA 2YITA 1JNKA 1KSWA 2G2IA 2XBAA 3AC4A 4YNEA 5JN2A 1CDKA 3ZLWA 4A9UA 4YZBA 5LVPA 4O83A 3QQGA 3FQEA 1DM2A 3MPTA 4KINA 4O0SA 4BZNA 2F4JA 1KV2A 3VBYA 3IS5A 2HXQA 4AUAA 1APME 2Q0BA 2C6TA 5M4CA 3QQJA 4M0YA 3ZXZA 5FD2A 1Q4LA 3GCSA 1ZLTA 3FLYA 5IQBA 5AAEA 2VO7A 4EKLA 2QOOA 3FI3A 4ZSLA 3E87A 5ETFA 3D4QA 5HI2A 5EYMA 3FUPA 4RJ8A 4YP8A 3H30A 3NLBA 4AS0A 2XS0A 3QRKA 2CKEA 3BE9A 2VWZA 2HENA 4R3RA 4WT6A 3ZHPC 4I23A 2X1NA 3QUDA 5AFVA 2XB7A 3G9LX 1GIIA 2O5KA 2PWLA 3C4FA 3I0OA 4D4YA 4ANNA 5E1EA 4GJ3A 3GQLA 3K3JA 5H3QA 4GKIA 3VW8A 3RKBA 3OCGA 2I40A 1CKPA 3E3PA 4BDCA 5I5ZA 1IA9A 4LGDA 3R30A 1RQQA 3LCSA 5AUZA 4RVKA 3R8VA 3NEWA 3LFNA 4QYFA 3PRFA 4NFNA 4FKTA 4I5HA 5ANKA 3VIDA 3ZO3A 1BX6A 4B4LA 4J95A 3LKMA 2C5YA 3I1AA 4Y8DA 4E4NA 2J0LA 4CKJA 4ZSEA 3R1SA 3AT2A 5DA3A 4FEVA 5FBNC 3DBFA 4Y73A 5HX6A 1FMKA 3PP0A 5E90A 5CQWA 5ANOA 5AV4A 4CT1A 3OOGA 5CT7A 4ITHA 5IH4A 3IW4A 3U6IA 5CS6A 2FVDA 4OLIA 1YXTA 4YSJA 4Z7HA 3TUBA 3EH9A 3Q2MA 4IFCA 3AC3A 1JSUA 5HHWA 5IUHA 4J7BA 4AT5A 2YZAA 4BDBA 2R3HA 1FVTA 3WF9A 5HE3A 5HNIX 1UNGA 5JFWA 3MVLA 5CALA 2NRYA 4TYGA 3BWJA 3BLRA 4IH8A 4K9YA 5I9YA 3EQGA 2F49A 4CD0A 3VHEA 2JDOA 2YLEA 5ANDA 5B0XA 3WYXA 3KVWA 3NR9A 2XUUA 2HW7A 3I81A 4F1TA 4C33A 2UW0A 3U55A 2EU9A 3LM0A 2QU5A 2Y0AA 2PMLX 4HZRA 5CX9A 1K3AA 3C4XA 3OWKA 3ZFYA 4AGDA 1KE9A 4DG3E 4Q9SA 4PDSA 3TNQB 1NXKA 4JG8A 4S34A 3EL8A 4OAVB 3ZFMA 3QC4A 4GYIA 4WKQA 3CQUA 2QOFA 3H10A 2ONLA 3ZC5A 2BDWA 3QTZA 3VUHA 3U4WA 4MNFA 4ZOGA 3UOJA 2E9VA 4R6VA 4XUFA 3V5LA 4PF4A 4ALWA 4R77A 2YIXA 3ZRKA 3CPCA 3NYNA 2GHGA 4BC6A 2PVYA 4QNYA 2JKOA 4QP1A 5BMMA 4GU6A 4BCKA 3PJCA 3HRFA 4NJ3A 3DBCA 4FVPA 4MHAA 4BZDA 3BEAA 3ZS5A 4RWIA 2WU7A 2YM3A 3VUIA 2RG6A 2VWBA 2W17A 4E6QA 2UZLA 5C9CA 2WQBA 4D0XA 5IMEA 1XBCA 3OWJA 3OFMA 2OO8X 3RPYA 4GMYA 4JI9A 1YXXA 2BZKB 3ZU7A 2F2CB 3IQ7A 4JR7A 4NUSA 5KZIA 3ZO1A 4CFWA 5IF1A 3D5WA 4Z55A 4FGBA 4U8ZA 2Q0NA 5CSHA 4DH3A 5CEPA 2WQNA 2VU3A 2UW3A 3MW1A 3QAME 3PJ8A 3DB6A 4FX3A 4YMJA 4FEWA 1XH4A 3P4KA 3UG1A 4EORA 3NNXA 4U7ZA 3D15A 3FZ1A 1QL6A 4IVAA 2FSTX 4OTGA 4L46A 4EJ7A 4F65A 4EZ5A 5KZ0A 4GK2A 4C4JA 4MF0A 4LL0A 4X0MA 5CU0A 4WG5A 3KC3A 3UODA 4D55A 1YWRA 4XV9A 4EK4A 2Z8CA 4A4LA 5HG9A 4JJRA 3DLSA 5B2KA 5D41A 3V5PA 2XZSA 5TR6A 3VULA 4CZTA 1T46A 2DWBA 2ETKA 3W2QA 2GCDA 5AUVA 3R21A 1ZYCA 4TY1A 4LOQA 4G16A 2F7ZE 2VX3A 4TRLA 5HVJA 4BWPA 4CT2A 4Q9ZA 4I6BA 3PE1A 4WSQA 4Q5EA 4F9BA 4G9CA 2P33A 2HELA 1WVXA 2VNYA 5EM7A 1FPUA 2QR8A 3CGOA 3GCPA 3U6HA 2PPQA 3EYGA 2C3KA 2VTIA 2W1HA 5CU4A 3KRWA 4FT3A 5AP3A 3MVJA 4MEDA 2JIIA 4TW9A 1QPCA 3SQQA 2JDTA 2X8EA 4KBAA 3OT3A 4FV5A 4U97A 3I0QA 4E93A 4IDTA 5J1VA 2OLCA 4I22A 3L9PA 4G17A 4BY9E 1J3HA 3ZBXA 1KUTA 3GOKA 3Q6WA 3QCYA 5AX9A 1UV5A 2C5XA 3EQRA 4YO6A 3R8PA 3L8XA 3CPBA 4PTEA 1UA2A 4DGMA 3TG1A 4IWQA 3FSFA 3CTHA 5HO8A 4CG8A 3W2OA 3CBLA 2CDZA 3EN7A 5C4KA 2GS2A 4BCNA 1Q24A 4RPVA 4KKEA 3ELJA 3V8TA 1H1QA 4ZEGA 3ET7A 5ANIA 2W5AA 5EW8A 2QODA 3QD2B 4U9AA 4B8MA 3KRRA 3MH2A 1QPJA 5CLPA 4BWXA 3WOWA 3D83A 4JG6A 4X2FA 4ZLOA 5IPJA 4HGSA 4UALA 4OR5A 4BKZA 1A06A 1Y8GA 2XMYA 4TWCA 4ERWA 3FHRA 4MCVA 3FL4A 4KKGA 4XG7A 3R63A 1B38A 5A54A 2C0IA 4C02A 3U6JA 2X2MA 5HZNA 1TQPA 3SD0A 3VBWA 4AGCA 2YFXA 3DPKA 4QP8A 3VS4A 1ZOGA 3PXQA 2Y4IB 4K77A 3BU3A 4H05A 2ZB1A 1GZKA 1CTPE 1WBNA 2FB8A 4BGHA 4O7VA 2J5FA 2OFUA 3GGFA 3BV3A 2E2BA 5GJDA 2XNEA 4QMYA 4O7ZA 3A8XA 3A61A 2XJ0A 2OZAB 4L67A 4X6RA 2Y6MA 4E4XA 4BR3A 1VJYA 5LOHA 5IEXA 5IQDA 4QTEA 3IGOA 5CTPA 3I6WA 3HLLA 5TF9A 3RALA 4CXAA 3HKOA 3GENA 3T9IA 4V0GA 5IA1A 4NM5A 1U5QA 3WF7A 3E63A 5BVEA 3SVVA 2YZLA 4GSBA 1BLXA 4UZHA 4EOMA 3OROA 5CENA 5DEYA 1G8SA 4FVQA 3KXZA 3ZDUA 3QD4A 1AQ1A 3LHJA 4DAWA 3S95A 2I1MA 3NUNA 1FVVA 4OTHA 4IX5A 4QP6A 4UMTA 3GI3A 4TZRA 3SX9A 3G2FA 2C6KA 2ONLC 3C7QA 4JNWA 4LMNA 4PTGA 2Q83A 1TKIA 3ORPA 1XWSA 3I4BA 4L45A 2YIYA 5HKMA 4O7NA 1M14A 1H1WA 4L7FA 3FQHA 4QT1A 1Q61A 2I0YA 2PVKA 4MD8E 3FLSA 4PP9A 2OJ9A 4ITJA 4FTQA 4NEUA 4KSPA 4IAKA 1CM8A 3QUPA 4C4HA 2J7TA 1IEPA 2JD5A 2X9EA 2QO7A 4PRJA 2XVDA 3NNWA 3QKKA 2YN8A 3R7UA 4ZY5A 3W32A 4I24A 3HGKA 2X39A 4IVBA 1Q41A 3ORTA 2BRHA 3E88A 3GC9A 1YQJA 2GS7A 3HX4A 2W1EA 2WTJA 5EHOA 3DY7A 1XH9A 4IZ5A 2H8HA 4EK3A 2I0VA 1IAJA 3RMFA 3LQ3A 4TNBA 5HBHA 3VS3A 4O6LA 3V5JA 4U5JA 4F0IA 2G1TA 4U42A 1Q99A 4F4PA 4TKSA 5GIOE 2B55A 5GZAA 1H0WA 2RGPA 3AT3A 2NP8A 5CF4A 2F57A 4OAUC 5A4TA 3LCOA 4BI2A 3HNGA 5IEYA 4FODA 3PZEA 4F6UA 3DJ5A 2WMVA 3UTOA 3PFQA 3V3VA
chains in the Genus database with same CATH superfamily
4FL2A 2IEWA 5JZJA 2XNPA 2XEZA 1JBPE 2ZAZA 3OOMA 4QP3A 3EQBA 3IDBA 4JQ8A 4FTTA 4LDTA 3FL5A 2CLXA 4XMOA 3A7IA 3DXNA 4FEUA 2IZTA 3CY2A 4BKYA 3AKJA 4JBVA 2PSQA 3E5AA 4YTFA 3LXLA 5HVKA 2B53A 3G6GA 3VJNA 3RNYA 3KXGA 4HVSA 3K3IA 3DU8A 4OTIA 2VTHA 4E5AX 3NMUF 2CCIA 4O96A 5FEQA 4L9IA 5JSMA 3FLZA 4EH9A 3VS2A 1DI8A 2WOUA 4AFJA 2OJIA 5B7VA 2ITTA 1NVRA 2GPHA 3A7GA 4JXFA 4II5A 2UZDA 4QDVA 3RINA 3LJ2A 4Y85A 2PZ5A 2XKFA 3R7IA 5AAFA 3WI6A 3ORZA 4AW0A 1YHWA 3A2CA 1M7NA 3MH1A 4JS8A 4GG5A 2P4IA 3MBLA 4AX8A 3SXFA 5DT0A 1YOJA 2C68A 3Q53A 3W1FA 5EQPA 5IQIA 3KCKA 3UO6A 4MX9A 4AN3A 3BELA 1OBDA 4D2PA 4RIXA 4YUQA 3N4UA 1Y8YA 5LXMA 1CMKE 5FDPA 4HYHA 3FLQA 4B99A 3MFRA 2BIKB 2XNGA 5HORA 4ERKA 2W1CA 1XBBA 3ENHA 2IF8A 4KWPA 1NY3A 2VO0A 3O7LD 3VBQA 3ZLSA 2ITOA 2XKCA 1WFCA 4FF8A 4O7LA 2IPXA 5I0BA 3FI4A 3GC7A 4PTCA 3EIDA 1Q3WA 3NVMB 3FXXA 2W5HA 3CP9A 3UOHA 2YCQA 3F5XA 5CU3A 5DHJA 4QMLA 2EWAA 1NVQA 1XH8A 4FKPA 5FWKK 4MD9E 4YSMA 4G9RA 3PWDA 3PJ3A 3LXKA 3K2LA 4S32A 5CF5A 4C2WA 4WO5A 4CFVA 3D5XA 3QA0A 2JAVA 4DYMA 3F3VA 4HJOA 3FZSA 1QPDA 3EN4A 3BGQA 5K4IA 3QRUA 3OEFX 5F1ZA 3NCZA 2ITXA 4X2GA 5J95A 3U51A 3RHXA 3C1XA 4UV0A 3OWLA 1FMOE 3FMEA 5L2QA 2PZYA 4QTBA 2PVNA 4N57A 3UYTA 4EHEA 4FTMA 2G15A 2WQEA 4GH2A 3O50A 3AMBA 2C3IB 4M97A 3LLAA 3UE4A 3BYVA 2J5EA 2BAQA 5AV3A 1V0OA 2AQXA 2IVSA 3VRZA 4BCGA 3NUAA 5IQGA 2X81A 4L52A 4FRFA 4WIHA 3DCVA 2W7XA 4LV5A 4XG2A 3SDJA 4AXDA 1NA7A 3MIAA 3R9OA 3R22A 3RPOA 4IADA 5C8KA 2UW7A 4FKGA 5L3AA 4XG4A 2REIA 5EQYA 2AC5A 4BIDA 2WMTA 3R00A 3A7FA 3FMHA 2O8YA 5H8BA 4DHZA 1H0VA 3VW6A 1SVEA 3E62A 4JAJA 1G8KA 4RVLA 3PFYA 3FV8A 4R7HA 3QX4A 1YOMA 4ZS0A 3ZSIA 2RFDA 2WD1A 3E8NA 3MVHA 3CLYA 4RFZA 4DGNA 3P7CA 4F6SA 3M2WA 3OBGA 2WOTA 4MD7E 2PULA 1YI3A 2EUFB 2X7FA 4R7IA 4AA4A 4AT3A 3F5GA 4QQCA 3R2BA 4OTPA 4HCVA 4E5BA 3COHA 4IFGA 1R0EA 5M06A 1Y91A 3TCPA 3UZRA 5E9EA 4Z16A 4D2RA 5ACKA 4C34A 1TQIA 3R83A 4IWPA 4A9TA 4IACA 2CHLA 3KN5A 2XJ2A 3DKGA 2QOIA 3PLSA 3NDMA 5JFVA 4BDAA 3OUKA 1WBSA 3ACJA 3MGYA 2VTPA 3NGAA 5CEIA 4A4OA 1J7UA 3TTIA 4A4XA 4M7IA 4U45A 3LFAA 1Q62A 5FLFA 4J8MA 5ETCA 5IISA 2OICA 3PSDA 1VLRA 3S00A 1GZ8A 3BBTB 1OBGA 2EXCX 5LARA 4YJRA 1U59A 4DEEA 5CZIA 4I4EA 3O8UA 3H0ZA 2JITA 4FT0A 4IXPA 2XANA 4P4CA 3IW6A 2ZV2A 4BTMA 1E1XA 2BZIB 3EB0A 4CTBA 4F6WA 3OBJA 5GINE 3W0RA 2VZ6A 3RNIA 4EC9A 3FI8A 4QTDA 4GW8A 4YHJA 4Y72A 4ITIA 1ZY4A 4MXYA 2VWIA 4DN5A 1WCCA 2GNHA 3UO5A 3EZRA 1ZAOA 2W1GA 2JC6A 3R6XA 5E8TA 2OKRA 1W8CA 4FBXA 3RAHA 3NVKI 5K0KA 4R3PA 1F0QA 5LWNA 4UBAA 5BQ0A 3BKBA 4CVAA 3A99A 2PZIA 2Y7JA 2XM9A 4QMVA 4U80A 4U0IA 3PJ2A 3GU7A 1JKLA 4MWIA 4RX9A 3N51A 5FQDC 5HCXA 2BILB 3OD6X 4H58A 3TV7A 2JKMA 3FJQE 4JR3A 3NUPA 4UZDA 3TTJA 3HMNA 3QHWA 5FTOA 3EQCA 3V6SA 2QVSE 5TE0A 2WHBA 2CKPA 3F3ZA 3I5NA 3BE2A 4GUBA 3DS6A 3LFFA 4L68A 5CAOA 2P2IA 2WMAA 3ANRA 3F61A 4U40A 2XNMA 2X0GA 4AG8A 1X8BA 4RIWA 5JMSA 2BUJA 1YDRE 4L44A 4PPCA 3C5UA 3NNUA 2QOHA 2IWIA 3AC8A 3VO3A 5CSPA 3TUDA 5L6PA 2IVVA 2RSVA 2PMIA 3HMMA 2O65A 3OVVA 1Z9XA 1LEWA 4QTAA 4DCAA 3HUBA 3ZOSA 3NRMA 3PUFC 4E20A 4FK3A 2YACA 5D1JA 2RG5A 3VUGA 3QKLA 4RWJA 4DLJA 2JBPA 3UDBA 2FSLX 4AE6A 5AV2A 4BJJA 5HU9A 1GOLA 2R3QA 3R9NA 4FZ7A 2QHMA 4BTKA 4J53A 3LM5A 2UV2A 3ITZA 2FH9A 3LXNA 5BVDA 4RVMA 4X6QC 2C3LA 3PY3A 5I9VA 2EXMA 3FZTA 3CTJA 4K18A 5L4QA 1OPLA 3ANQA 3FPQA 3E8CA 5DH3A 1MP8A 4TYIA 5AR8A 3V8SA 2QG5A 2BRBA 4D2WA 3R8LA 2PU8A 3VS0A 2R3NA 3O71A 3RGFA 4RC4A 4EH3A 2XIYA 3PXKA 3M1SA 4R1YA 3KA0A 3KFAA 4YJTA 4FICA 1JKTA 2HK5A 3WIGA 3RK5A 1OKWA 1W83A 2YWPA 4WRGA 2VTSA 2BKZA 3NYOA 4HGLA 4TWPA 3ZSHA 4BCFA 2VO6A 3I79A 1R39A 4L42A 3VAPA 3HV6A 5K0XA 4QMQA 3GCQA 3O2MA 4GK3A 3G0FA 2C5VA 4XEYA 3BX5A 4FSRA 3F3WA 4EZ7A 4M0ZA 3R1NA 5KO1A 1Q8TA 4KRDA 4O0YA 3ZMMA 2B7AA 3DT1A 4BICA 2LGCA 3TM0A 4QTCA 2W1DA 1UKHA 1W2DA 1ZZLA 5HIEA 4N6YA 3HDNA 2JFMA 4MVFA 4C38A 1M52A 3SV0A 5BX0A 2C6DA 3I5ZA 3RVGA 4NM3A 4FT9A 5CY3A 1W2FA 5EFQA 3OTUA 4EWQA 3W0PA 4LM5A 2RFEA 2YM7A 4BIEA 5C27A 5M56A 3L1SA 4IQ6A 5JFSA 1MQBA 3BI6A 4FIFA 4G6OA 3ZO4A 4AXEA 1Z5MA 4O81A 4EI4A 4WA9A 4AW2A 1SVHA 3HA8A 5IQHA 4D2TA 1PXMA 2ZM3A 1WVYA 2XP2A 2W1FA 2WZJA 4XX9A 3IOPA 2O63A 2BDJA 3CKXA 4QP4A 4PL5A 1UWHA 4BB4A 2GNIA 2E9PA 4ZZMA 3E64A 3VJOA 2ITYA 3G90X 4YJSA 4FTNA 4IE9A 5BVKA 3H3CA 4E7WA 3SG9A 1YHSA 1OECA 4HZSA 1Q8WA 3RJCA 5DIAA 4O4DA 4HVDA 2Z02A 4UMQA 5LMBA 3KMUA 2XIKA 4GUEA 3MS9A 2HXLA 1J7IA 2PVRA 4UWBA 5IA2A 3LPBA 3TDVA 4E6AA 3BQRA 2C0OA 3KXXA 1Q3DA 3D7ZA 4N0SA 3W33A 1HOWA 4RQVA 4WBOA 5A4LA 3Q2JA 3CJGA 2PMOX 3Q04A 3ZONA 3MB6A 4YNOA 5AX3A 2A2AA 1ZRZA 4KIOA 3SC1A 3H4JA 4O22A 2ESMA 3HV3A 4KNBA 3AGLA 4JBPA 3ORKA 4NWMA 4PWNA 2YIQA 2XIXA 5HE2A 3DZQA 4JQEA 4BDKA 3VS7A 2ACXA 3ML1A 5M55A 1P14A 2UW5A 4JQ7A 4YC6A 4YJUA 4LMUA 4C59A 2NPQA 4I94A 4C3FA 1PMUA 2YJRA 2Z2WA 4G1WA 5C03A 4O86A 4FKOA 3P79A 4E6DA 5EM8A 4FZFB 4I20A 2UW8A 2WPAA 3QCSA 5HG5A 3TEIA 2Y8OA 4EH7A 4LOOA 4EOIA 4CLIA 4O7TA 3KN6A 3WZJA 4MXXA 3Q5IA 4DEAA 4QPMA 4ZXTA 3DQXA 3FKOA 3KB7A 4ORKA 4YBJA 5J9YA 2DS1A 2R3LA 1OKVA 3QGWA 4XLVA 1K2PA 3BPRA 4OBOA 4IM3A 5AMNA 3VUTA 4R5YA 4AW5A 3FDNA 3PLAE 3PRIA 5KKRC 2V7OA 1BKXA 5HO6A 3U87A 3AKKA 5A4CA 2IZSA 4HYUA 3V01A 2OXYA 1WBVA 2IVTA 2QC6A 4UN0C 2JBOA 2ZV8A 4JDHA 4W4XA 1L8TA 3QFVA 2OZAA 1SZMA 4IB1A 2VUWA 2HZ4A 5DI1A 4FSYA 2VTJA 5KKRB 4JAIA 3WF6A 4CZYB 4QMZA 3M42A 4ASXA 3FAAA 1O6LA 4HYIA 5TKDA 5CANA 5CNNA 4ZTQA 4AGWA 4DHFA 4JG7A 4RJ3A 2Y4PA 4MNEA 3FC2A 4RIWB 2UZTA 5AUXA 2JIVA 3MFTA 1P5EA 1UWJA 3UP7A 4E6CA 4LG4A 4XOZA 2VAGA 1BMKA 5BYZA 3MV5A 3TNHA 2YCFA 3NX8A 1ZMUA 2BALA 3W8LA 1KOBA 3QA8A 4BVUA 3F82A 3OG7A 5FM2A 5IUGA 4IIRA 3K5UA 2VTNA 4S31A 5CI6A 4K6ZA 4BCOA 4DITA 1H1SA 3IKAA 4ZSJA 4CKRA 4BJJB 3TKIA 2QO9A 2C4GA 4EUTA 5CNOA 1W0XC 3UBDA 3NAXA 3JVSA 3CQWA 2HW6A 1OL5A 4NIFB 4FTUA 3VNTA 2YLFA 4IZ7A 4F0GA 2P0CA 3T3UA 4JBOA 1F3MC 2UVXA 2FA2A 2UZNA 3PSBA 5CQUA 5CEMA 4DFBA 3QXPA 3VWAA 2VD5A 2CGXA 4OTQA 3ULZA 4BYIA 2OWBA 3KL8A 3MY5A 3EZVA 5AP2A 2VWVA 2QHNA 1J91A 4G6NA 3VBXA 2QOKA 1H07A 2J90A 5DPVA 3ALNA 4FSNA 2Y9QA 1Y6BA 4QRCA 4EK8A 2HY81 5M53A 3R02A 4PMPA 5DGZA 3R9DA 2VTOA 4RQKA 3G5DA 5CVHA 4E4MA 2HCKA 4IZYA 4XBRA 5JQ5A 5DT3A 1Q8ZA 4FTJA 3T9TA 5EM6A 3ATSA 2XIZA 1GZOA 1S9JA 5AP1A 5HLPA 3OXZA 4BRXA 5JKGA 3FEGA 3GP0A 4L3LA 4WRSA 4C35A 4D2SA 4I41A 5LVOA 1GNGA 4YTIA 4IAAA 3KCFA 1YVJA 2BRGA 5AP4A 2ZYBA 3MN3A 5E92A 4FSTA 3MWUA 5FP5A 3U54A 4FV9A 2OG8A 2QOBA 2WGJA 4OTFA 4ZIMA 4R78A 3HECA 4MYGA 3HP5A 3R7GA 4FSUA 3FYKX 4GFOA 5GHVA 4TT7A 5KHXA 1VYWA 3L9NA 4C4GA 3FMNA 4R8QA 4EH2A 4AZEA 4QP2A 5CZHA 3P0MA 3PIXA 3V8WA 5CF8A 5K3YA 4PDOA 4G34A 4E8AA 4BWKA 1KOAA 4QMUA 4ANQA 5DNRA 2HY0A 2J0JA 2KTYA 4TWNA 4CYJA 3F2RA 3TV6A 5DN3A 3DKOA 4IANA 4AZTA 3V04A 3DKCA 3MY0A 3F9NA 5J87A 5CWZA 3LFSA 3OW4A 5J5TA 3MFSA 1OL6A 3AG9A 2QO2A 5JFXA 5HCYA 1OB3A 1YRPA 4YO4A 4W4YA 5M4UA 4DDGA 4GCJA 2UUEA 3G33A 4AZVA 4K0YA 5DWRA 3WE8A 4F63A 3L8SA 4D9UA 1RE8A 2YM8A 4C3PA 1CSNA 4YPSA 4GRBA 2UZEA 3JY0A 2R9SA 4QOXA 1JQHA 4YU2A 3E92A 5AR5A 4W8EA 5J9ZA 2X4ZA 3AD4A 1ZMWA 3LXPA 3A7JA 3EWHA 5C26A 4NH1A 1WBWA 3TWJA 4HW7A 3QU0A 4M14A 5FXRA 3UVPA 1DI9A 2ERZE 2B9FA 2W9ZB 3BBWA 3NPCA 1IRKA 3PTGA 4OTRA 3ZCLA 1TQMA 4ASDA 3DK6A 4UWYA 4BDDA 1YXUA 3FZPA 5M09A 4V01A 5D7VA 5DOSA 2BHEA 4IWDA 3Q9XA 4KIPA 4M8TA 2H6DA 5GJFA 3F69A 3QRTA 4C4FA 2BTRA 5EOBA 2Y4IC 5TOZA 2WIHA 1ZWSA 2J0KA 3BGPA 4FKSA 4QQ5A 3R7YA 2XM8A 2UZWE 3JVRA 3RCDA 4L3JA 3ROCA 3DFCB 1TVOA 4FIJA 4YJOA 5AR4A 1NW1A 4C0TA 2GSFA 3GXLA 5AR2A 3JYAA 1SMHA 3BHHA 5EDQA 4C61A 4O21A 5EYDA 4BZOA 3FZRA 4GFGA 4MBIA 4H1JA 5D10A 4BDEA 5IEVA 2PUUA 5DEWA 1AGWA 4PY1A 4RC2A 2WAJA 3FMJA 2X7OA 2ZM1A 5KMKA 4JRNA 5DLSA 4F99A 4HVGA 2GHLA 3NW7A 3FMMA 3NUSA 4JIAA 5M51A 3LQ8A 2B52A 3QC9A 4ONAA 4WD5A 5J8IA 2WKMA 1H1PA 5LVLA 4MNEB 3KKVA 2JLDA 4BDJA 2VV9A 3QUEA 3V5QA 3PP1A 3F7WA 5FBOA 3R7EA 4JMQA 3HP2A 3FLNC 2LAVA 4ACCA 5IH6A 4L53A 2QLUA 3SXRA 5L8JA 3BLAA 5AP6A 3PG1A 3T8OA 1CKJA 2C6LA 5CU2A 1H00A 2PMNX 2HAKA 2R3MA 5ETIA 4FSMA 1PW2A 5L2SA 3KF4A 4NTSA 4YHTA 4FYOA 4U44A 4BDHA 2YABA 4DLIA 4APPA 5FXQA 2GQRA 2J2IB 3KRXA 1REJA 4CRSA 5AUYA 3ZRLA 4ZTHA 1GZNA 3NIEA 4UX9A 3NIZA 2B9JA 1LP4A 3D2KA 3HUCA 4XS2A 4FYNA 2W4KA 4DT9A 4AXCA 3MPMA 5E4HA 1O6YA 1XHAA 1ZOEA 2XYUA 3EQFA 3MJ1A 4ZP5A 3UNJA 4O1OA 2OSCA 2XRUA 3LVPA 5L6OA 3WZKA 5I4NA 3G15A 5KMNA 5IMXA 5EI2A 3DJ6A 3UOLA 3VUKA 2WB8A 4IB3A 4BI1A 3GOPA 4UYNA 5A9UA 1WBOA 1IA8A 4RA5A 4U81A 5TT7A 4M84A 4C7TA 5JT2A 4DH1A 3PA3A 3SW7A 4HGTA 2OJJA 2VWXA 4ACGA 4JIKA 4KD1A 5HEZA 2QCSA 3IGGA 3DNEA 4O2PA 1OI9A 2X2LA 4ZY6A 5KHWA 1YI6A 3PVGA 5KMLA 4MQ1A 3MESA 5CT0A 4L43A 5IA4A 3LMHA 4KS7A 2W99B 3ZEPA 4F0FA 4FJVA 3OC1A 5ITAA 3B8RA 4DFUA 4H1MA 2VX0A 1BL7A 4V04A 3WZDA 4D58A 4X3FA 3W0QA 3U8WA 2PL0A 3B8QA 3MTLA 4W9WA 4ACHA 4GL9A 4H39A 4IX6A 2PHKA 4DTAA 4AA5A 4OBPA 3PA4A 3LZBA 4UY9A 1K9AA 4M12A 1H4LA 2F7XE 3QTSA 4AE9A 2VGPA 2PVMA 2PVLA 4HYSA 1E1VA 2CN5A 3W2CA 1WBTA 4O4BB 2R3OA 4BYJA 2RL5A 3K54A 3QZGA 3RCJA 3VUDA 5DVRA 3CD8A 3NS9A 4AP7A 4RWKA 4PMMA 3IONA 4FTLA 4PNIA 4FTKA 3D0EA 3R9HA 3TIZA 5LVNA 2ZV9A 3WYYA 3GQIA 2C5OA 3W55A 4ZS4A 2CCHA 4AOTA 4U3YA 3D5VA 4EH5A 2C30A 5D9HA 4QEBA 2WQMA 3ZH8A 3RPSA 3QALE 3THBA 4D4SA 1W82A 3FBVA 4N4SA 1G5SA 1Q8UA 4ZMEA 2FYSA 2OH4A 3GBZA 4HCUA 4FIIA 4I3ZA 1FVRA 4GK4A 3VS1A 1G8AA 5I9ZA 1GIHA 1YKRA 4MXCA 4XG8A 3HDMA 3WARA 1PY5A 4J97A 5GNKA 5HQ0A 4FV2A 1OGUA 2R3PA 3G9NA 3OTVA 4GVAA 5EW9A 2JKKA 2ZDUA 3F5PA 4RJ7A 4FVRA 2DQ7X 4ACDA 1R0PA 4IJ9A 4KB8A 4DG0E 3FKLA 4I1ZA 3LQ5A 4GT5A 3GC8A 3FE3A 4F9YA 5HBJA 2PTKA 3Q52A 4EL9A 2QU6A 3TN8A 1XH7A 3L9LA 5AA8A 1H08A 4RMZA 4U6RA 1PXPA 1UU3A 3OW3A 4RLKA 4FEXA 2XJ1A 4DEBA 4J99A 1DAYA 3R8UA 4C36A 3TXOA 4P5ZA 3TACA 3QWKA 3FMLA 4EH8A 4I5PA 5AR3A 4TXCA 2GFSA 3I60A 2W1IA 4FKJA 4JDJA 4XP2A 3QBNA 4IX4A 5KMJA 3DDQA 1OPKA 2X8DA 3H0YA 2IVUA 4LV8A 5CU6A 3RWPA 1PF8A 3Q4CA 3Q4UA 4B6LA 2GTMA 4CCBA 2XCHA 2Z7RA 5CAUA 4QMPA 4DT8A 2AUHA 5HTCA 4CV8A 3LOKA 3SOAA 3EQIA 2HZNA 4IWOA 4DGGA 2PK9A 4AT4A 3H9RA 4C57A 1KE8A 2DUVA 4EH4A 4ASZA 3OT8A 4JT3A 2YIWA 4DC2A 5KCVA 1OITA 4ZAUA 5AV1A 5HOAA 1YWNA 2VTLA 5EYKA 4OT6A 2OW3A 3EFLA 4CKIA 1IAHA 3BU6A 3P78A 1Z57A 3PXZA 5I9XA 3GU5A 5AEPA 2YCRA 4KSQA 3MFUA 1W2CA 2JGZA 3BCEA 3O8TA 3PUPA 3TL8A 2YA9A 2VRXA 3QZFA 4DHJA 4IAZA 4QMOA 2IZUA 3VRYA 1XQZA 4ENXA 3DQWA 3ZLXA 5J79A 3U9CA 4AU8A 3R8MA 5EG3A 2GNJA 2CSNA 2V5QA 3FZOA 1XR1A 5HNGA 2UVYA 4LYNA 2VTQA 4BGQA 2C6EA 2QOLA 3HRBA 5HO7A 5AR7A 5AP7A 4P7EA 2VNWA 4RC3A 2BZJA 1MRYA 1FINA 4D4VA 4FV6A 4UMRA 3ZLYA 3SGCA 4XRLA 4DA5A 3ZYAA 3RAIA 1YOLA 4MKCA 2PUNA 5ANEA 2GU8A 5C8MA 2IZRA 4LRJA 4D5KA 4RRVA 3AC1A 3DA6A 4D9TA 5IU2A 5M08A 3OY1A 2VTAA 3BZ3A 4FK6A 2OK1A 1R3CA 1U5RA 2W9FB 3UOKA 2V7AA 3LE6A 5LVMA 3KMMA 3Q9ZA 4FI1A 4BCMA 3N9XA 2XNNA 3QQHA 3ZSGA 4FE2A 1H24A 3DB8A 3QQKA 2BR1A 2VTMA 5K4JA 2C1BA 1KE5A 4YPDA 2A27A 4IB0A 4EUUA 3DZOA 4DG2E 3UDSA 4U43A 4AN2A 2CMWA 3BHUA 1SNXA 3LCDA 2R7IA 3OP5A 4KAOA 1U4DA 2CLQA 1WVWA 1UU7A 3GVUA 3KULB 1U54A 3LFEA 4YBKA 3ZUUA 1UU9A 5EW3A 2UVZA 1FGIA 2ZV7A 3FYJX 3L9MA 1R78A 3V51A 3ORNA 4KIKB 4QPAA 4UMUA 4FV0A 1OL1A 2WMRA 1MRVA 4W4VA 4ZZOA 4QMWA 4QQJA 5IA3A 4H36A 2IG7A 4CG9A 1J7LA 2JAMA 3QXOA 4GVJA 3GC0A 4BHNA 4J96A 2W5BA 3UIMA 4X3FC 3OEZA 2ITVA 4UXLA 4FIGA 3ZUTA 1XH6A 2OIQA 4O0WA 5E1SA 4GG7A 2AYPA 4QPSA 3HAMA 4LRMA 5DFPA 5L2IA 3MI9A 2WMQA 2YM5A 4DH7A 3IG7A 4FNYA 4X3FB 4YLKA 4A9YA 2HOGA 5T6KA 3LJ1A 3EMGA 4TYJA 3ZUVA 3KREA 3PPKA 5L8KA 3MSSA 4A06A 2B4SB 1UU8A 4TYEA 5F20A 5J7HA 2ETRA 2EB3A 4KA3A 1ZOHA 2SRCA 5C8NA 3SXSA 4KUJA 5F94A 4O38A 4Y83A 1P2AA 4WNKA 5HIBA 1NVSA 3MA6A 2CNVA 4GKHA 3RK7A 3F2NA 5DR2A 4DGOA 1JVPP 2ITWA 4O4CA 1SM2A 3RZBA 4MBLA 5I3OA 2OIDA 4C4IA 4IAFA 4CMTA 4OW8A 3PA5A 1UNLA 3H9OA 4HNIA 2ITPA 5E8XA 2OIBA 4GU9A 3KGAA 4EOQA 2A1AB 3O0GA 2C1AA 5BUEA 4O27B 3HV4A 4AF3A 3P08A 3CSVA 3QD3A 3E3BX 2OXDA 3ZO2A 3LJ0A 3PE2A 4KS8A 3OMVA 4NM0A 1PHKA 3G6HA 2JDVA 3SA0A 2PE1A 3TJDA 4R3CA 2BFXA 3R1QA 1ND4A 4NU1A 3WILA 2IO6A 4ZSAA 3LMIA 3F88A 4C2VA 3Q9WA 4O84A 4RX5A 4AAAA 4I0TA 3UDTA 5CSVA 2QLQA 4AW1A 1YHVA 2VWWA 3ETAA 4ID7A 4PDYA 1YDSE 3GFEA 3AGMA 4PMTA 5AUTA 3DXQA 3DV3A 3CR0A 1OIYA 3AC5A 3TI1A 3F3TA 3KQ7A 2PUPA 2BAKA 5DMZA 3AD5A 2BAJA 2OGVA 3R2YA 1DS5A 3UPXA 5HD7A 4XV2A 3TZMA 4O7WA 4C4EA 1G8JA 3LCTA 2C6IA 2F2UA 2WQOA 2ZDTA 4NIFA 1EH4A 3QLFA 5EHYA 3TNIA 4DH5A 4E73A 3DXPA 3ACKA 4IW0A 3RZFA 3DBQA 2W1ZA 4K1BA 3F5UA 1SVGA 3LFQA 1IG1A 5DYJA 5AUUA 2C5NA 2X8IA 5J1WA 3Q96A 4QMXA 1JLUE 4FKRA 5CF6A 4D0WA 3MA3A 3ZM9A 3IO7A 4TYHA 1BL6A 5BVNA 2R64A 3MB7A 3F7ZA 3GEQA 3W2PA 3QX2A 5ANGA 2GS6A 4BFMA 3VF8A 1SYKA 3FHIA 3MDYA 4B8LA 2BROA 3PSCA 2ZJWA 3IPHA 2R3RA 4FZAB 3ZZEA 3GU8A 2ITNA 3W10A 3UMXA 2XH5A 4NK9A 4XOYA 4PNKA 4P90A 3TNWA 3O51A 3S4QA 5KMOA 3D94A 4MXAA 4EQCA 2G2FA 3C13A 4BCJA 5IQEA 4Y5HA 2C6OA 4L00A 1JSTA 2OH0E 2G01A 3LAUA 4K33A 4FV7A 1VYZA 4TWOA 2QI8A 3PG3A 3DNDA 3K5VA 1L3RE 3F2AA 5HGIA 3P9JA 2NO3A 5A4QA 4XG3A 3E8DA 2XK4A 4EBVA 1ZXEA 3QQFA 3QTRA 3F3UA 4P5QA 3PVWA 4M67A 3A60A 4DDIA 3UGCA 4M68A 4XG6A 1H1RA 3TNPC 3QTQA 1ZZ2A 3AXWA 4O6EA 4QD6A 4OBQA 4G3GA 5DR6A 5AUWA 1GAGA 4M66A 3BYUA 2YDIA 1JPAA 3UO4A 5AADA 5F9EA 2CNUA 4FIHA 2ZM4A 4RWLA 3D14A 3VVHA 4GJ2A 4C37A 4AXFA 4F1OA 4N70A 2QOCA 2NRUA 5J7BA 4XG9A 4EQUA 1QPEA 4AOIA 3EOCA 3R9RA 3Q4TA 5A14A 5C01A 4B9DA 4S2ZA 5TO8A 4BL1A 5E7RA 4BTFA 1LR4A 3MTFA 4CQEA 3JR1A 1M17A 3OS3A 1U54B 4GT4A 4YZMA 1OUYA 5IKWA 4AZSA 4F9AA 5I9WA 2B0QA 3N4VA 4HCTA 2EXEA 5KE0A 1M2PA 1RW8A 3QF9A 3MY1A 5AV0A 2VTTA 2C0TA 3S1HA 4L7SA 4DTKA 3W0NA 3HYHA 2A19B 4O2ZA 5IQCA 1ZARA 4G3CA 3IW8A 2OJGA 1M2QA 4F7SA 2CGWA 5B2LA 4TTHB 1GY3A 3FMDA 3NUYA 4F64A 4H3PA 5LJJA 4MBJA 4NSTA 2EVAA 4FSWA 5M4FA 4FGRA 4RJ4A 2HZIA 4MF1A 2ITQA 4AXAA 3RPRA 2X6DA 4FKWA 2FGIA 2XEYA 4IVDA 5BMSA 3UIBA 5KUPA 4YZCA 1TFFA 4E3CA 4YJVA 4FNXA 3WF8A 3CCNA 4QMNA 3OHTA 4HGEA 4OUCA 3GFWA 5K5XA 3NYVA 2YERA 5AM7A 5FRIA 3UQGA 1PXLA 4UMPA 4PV0A 5CEKA 4EYJA 1M2RA 1HCLA 2I0HA 4AA0A 4RZWA 3HVCA 3QL8A 3WBLA 4HPUE