5AEPA

Novel pyrrole carboxamide inhibitors of jak2 as potential treatment of myeloproliferative disorders
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
292
structure length
287
Chain Sequence
DPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Pyrrole Carboxamide Inhibitors of Jak2 as Potential Treatment of Myeloproliferative Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE JAK2
total genus 99
structure length 287
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5aepA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5aepA01
4II5A 3AD4A 3ITZA 2B55A 2R3PA 4J53A 4D5KA 3LQ3A 3POOA 3AC2A 3SLSA 5ETCA 3LOKA 1CKIA 4YZDA 4CFNA 3QUDA 4BCMA 3HRBA 4BY9E 2Y7JA 3O51A 5BX0A 2BVAA 4ACMA 4IFCA 3K54A 3SG9A 4IB3A 1H1RA 3F5PA 1WVWA 3QZIA 3H9OA 4I6BA 4MQ2A 4DEEA 4RC3A 1V0BA 3EHAA 3ZTXA 3RM6A 2GHGA 3TV6A 4USFA 3OOGA 4KA3A 1ZARA 4LL5A 3F61A 4OBQA 3UPXA 4KIKB 5EFQA 2FH9A 1H01A 5LVOA 4GL9A 4XBUA 2YFXA 4QTAA 3NUYA 3R63A 3KVWA 4TYHA 3ETAA 5BYZA 4UWCA 4EQMA 3R28A 4IACA 2R3OA 1E1VA 4USEA 2WEVA 3A4PA 1NVSA 1SMHA 4OW8A 3VBVA 4O82A 3SRVA 3MFRA 3QGWA 2GHMA 4DF3A 3PA5A 2UV2A 4NCTC 4A9YA 2ITTA 4I4FA 4PDSA 4QQTA 5I9VA 3UP2A 5ETIA 1JSVA 2PMIA 1W7HA 4RWIA 2O65A 1UKIA 3D2IA 1JKTA 1OIRA 3Q52A 4X21A 5A3XA 2ZV7A 2VRXA 4FVRA 2XK4A 2XEZA 3QTIA 2GCDA 4JL9A 4B4LA 4C38A 3MPAA 3EKNA 4PRJA 3NGAA 4KKHA 3BHUA 5LCJA 3C7QA 3V5LA 4K0YA 4BDAA 1YDTE 2OU7A 3IECA 3DK3A 5HTIA 3R8LA 1BKXA 4O38A 5D7AA 5AP7A 4C62A 3C50A 4CVAA 3UJGA 1H4LA 2NP8A 3D94A 3MV5A 4XG7A 1M52A 4LMUA 3PPZA 3R7EA 2VTOA 1TQPA 3PXZA 3BZ3A 3RPSA 3SXSA 4BDKA 5JSMA 4IB5A 4YJUA 3F69A 4C36A 4ITJA 5EYKA 2CJMA 2W4OA 2C6LA 2OZAB 5AIKA 1YHWA 5FTQA 1V1KA 4RFZA 5E92A 3ENMA 3FQHA 3P1AA 5D9HA 5HO8A 2RL5A 2JBPA 3NIEA 2WXVA 2VTHA 2VX1A 2C4GA 2QURA 3AGLA 4S2ZA 1JVPP 5AR5A 3EN6A 4F7SA 4FTMA 1E9HA 5HVKA 2VTPA 2XZSA 2JFMA 4UN0C 4LG4A 3TCPA 5AP1A 3QYWA 3V04A 2CKQA 2WTKB 4O91A 4EUUA 5HTCA 5CU4A 1Q8UA 2PHKA 3MPMA 5CQWA 5G6VA 1H25A 4AFJA 2UZUE 1R3CA 3IOPA 4G31A 4ZTHA 4NFMA 2OJJA 3WOWA 5I9ZA 4M14A 2PE2A 5ANIA 2PMOX 4GCJA 4D1ZA 4LGGA 5CU2A 3UMWA 2BKKA 3A7IA 4U80A 1LR4A 3NMUF 4KSQA 1P4OA 4DG0E 2C68A 3L8SA 2GS7A 3C4XA 1H24A 3D15A 4K2RA 3ODZX 3G9NA 2QLQA 4EUTA 2REIA 4C59A 1J1BA 1G5SA 3EN4A 2XIYA 4UWBA 1J7UA 5AA9A 4BF2A 4ZLZA 4MXZA 3QFVA 3E88A 3CJFA 3CPBA 3MWUA 2C1AA 3JPVA 3KA0A 2C3LA 2PSQA 3DPKA 4EC8A 5HU9A 4LI5A 4F6WA 4JQ8A 4C34A 4HYHA 5HCYA 1MRUA 2WMQA 3BHYA 3BWJA 3FJQE 5CVHA 4XP0A 4WRGA 4RIOA 3W2CA 5HX6A 4M0YA 3ANQA 3AT3A 4QMOA 3FXZA 2JDVA 2A4LA 5HBEA 4C4FA 4MD9E 3R6XA 4FVQA 4EJ7A 4EOKA 3F3UA 4FL3A 2ESMA 4EHZA 1PJKA 5J1VA 2ZDTA 2QOFA 4FV0A 4F7NA 5LWMA 3GU6A 4IVCA 1WBVA 1JQHA 2QOBA 4C3FA 2R5TA 4NZWB 3NNWA 1XH6A 1LEWA 3EQPA 4V01A 5BVNA 3RCDA 2YM4A 5HE0A 4RX9A 3BBTB 3DBCA 2F7ZE 4I22A 5CY3A 3BBWA 2A27A 4FZ6A 2J4ZA 4QMNA 3QLGA 1AD5A 2XJ0A 3GBZA 3TN8A 5HTBA 5K4IA 3U6JA 2ITZA 4U81A 5C8KA 5FDPA 3BPRA 2PULA 5J9LA 1UNLA 2C0IA 4EOMA 2YHVA 2ZM3A 4EKKA 5BUIA 1J1CA 4GUBA 3PPKA 2EUFB 3BELA 1VJYA 1PXLA 4IHPA 4O0XA 3NYOA 4NFNA 4AP7A 4QP6A 3ANRA 3AC5A 3EYHA 4GSBA 4B99A 4D2WA 3G6GA 1U54B 3VUHA 3E7OA 3GQLA 5HVYA 2JBOA 4AA5A 3UQFA 3FZOA 4CFWA 3ZO2A 2E9NA 3QALE 2UW7A 2VO7A 3FBVA 4WSQA 4M97A 4NIFB 4YJPA 5JGBA 3DU8A 3BGPA 2FO0A 3FXWA 4RVLA 3DXQA 4U79A 3SKCA 5HE1A 4NM3A 4FTRA 4FZDB 3TZMA 3JR1A 5DYJA 5CSWA 4E26A 4PUZA 4UYNA 4DBXA 5M08A 3ZFMA 4QMUA 4EK3A 3E92A 3P7BA 2GS6A 5AAEA 3FXXA 3P5KA 3WF9A 4BRXA 4N57A 3LFFA 4BI0A 4NT4A 4R7IA 4ZSEA 4U5JA 1FOTA 4IMYA 3TNIA 3VBXA 3T9IA 4D1SA 2ZV9A 4Z9LA 4FNYA 1GZKA 2VTIA 2ITQA 3UG1A 4U6RA 4A9SA 3EL7A 2BTSA 3UPZA 4GKIA 3SD0A 2WTVA 4ZJIA 4DGGA 4PWNA 5L6OA 4Y46A 2WNTA 3RVGA 3D2KA 4FOCA 2HY0A 4NH1A 3C5IA 2ZV2A 4RVMA 4MEDA 4EH2A 3ZU7A 3OVVA 4CFUA 3R8MA 1PXPA 3DXNA 4KABA 3FMHA 4M15A 4AT4A 2VN9A 3A4OX 4FIHA 3MIAA 4G9RA 5L4QA 2WKMA 1VZOA 4RJ4A 5HNBA 4RC2A 2R7BA 2XB7A 3KXNA 4H3PA 4I41A 3L9PA 4PL3A 1T46A 4JR7A 4DGOA 4L8MA 4FV9A 2WO6A 3HA6A 4ENYA 5M57A 1M7QA 5AAFA 3I5ZA 4UWYA 4MNEA 4FC0A 3OF0A 1OPJA 5E9EA 5DA3A 1ZYSA 3OBGA 4IAKA 4F65A 3RPVA 4JRNA 5HLPA 4FSQA 1PKGA 4WG4A 3TI1A 1J3HA 3CQUA 4JAJA 3NEWA 2GNLA 5CAPA 4M69B 1PF8A 5HORA 2C6KA 3BQCA 4XOYA 5DRDA 5AWMA 2JLDA 5HCXA 2X9FA 4QP7A 5E1EA 2VTNA 4BCOA 2HWOA 3C0GA 4JG7A 2W5AA 1NW1A 1KE7A 1H08A 1OL5A 2C69A 5AEPA 4OTFA 5K0KA 1LP4A 2QOLA 4WNMA 3FI3A 4FV6A 4OTIA 2IW8A 2QI8A 3D7TB 3PJ1A 4FIJA 2R7IA 3CR0A 3KN5A 1GIHA 4LOPA 4AF3A 5GJDA 2ZYBA 3Q5ZA 4R1YA 4B8MA 3NUUA 5AUXA 5IPJA 4QP1A 4I0SA 3RNYA 4ZTSA 2X8IA 4FV1A 4BDBA 4KSPA 5ACBC 1OITA 3MBLA 4AOJA 2OZOA 1H1QA 4DLJA 5A6NA 1QL6A 4ALWA 2W96B 2P55A 4UBAA 4XCUA 4XBRA 3BU6A 4CLIA 1RDQE 3WZUA 4YHTA 3HKOA 4QMMA 4XP2A 4FSRA 2XNPA 5TF9A 4J96A 4Y95A 3FEGA 1IRKA 2F7EE 2QHMA 5DRBA 5AMNA 5L2WA 5CEMA 4KIOA 5HVJA 4DH5A 4DFLA 4DGMA 2W0JA 4IAIA 3VRYA 5IF1A 4RVKA 3HV7A 3PSBA 2X39A 5T3QA 3QKKA 3RPRA 4M13A 4EEVA 3PYYA 1P4FA 3MH3A 4I5CA 5ETFA 4G3CA 2OH0E 1ZMUA 2YITA 5F20A 4ZZOA 4NSTA 4Z16A 3TXOA 3H9RA 4R1VA 1Y8GA 3BEGA 4AX8A 3KRLA 3FKNA 2B1PA 3KFAA 4MCVA 2C1BA 2QO2A 2OIDA 1YOMA 4XG2A 3KY2A 3TJCA 4RX7A 2OJGA 3LFEA 4PTCA 1ZMVA 2I0EA 3AMBA 4TWNA 3CJGA 3TNHA 5IA3A 2I6LA 2BAKA 4G6OA 4D2RA 4HYIA 4DEIA 2PMNX 5HCZA 4H39A 2UVYA 4IH8A 3ZFYA 3A8WA 3O8TA 3I0OA 3PJ2A 3WYXA 3FMMA 4DH1A 4FUYA 3OUNB 4UXQA 4EHEA 3DNEA 4R3RA 2VNYA 4L52A 4ONAA 4KIPA 4NYEA 4AUAA 4DTBA 3Q32A 4FV8A 4RJ5A 5DG5A 3ZC6A 5IQDA 4NTSA 2Z7SA 4WG5A 2YCFA 1PYXA 5AP2A 2J5FA 4YPDA 3VS7A 4O96A 3G2FA 1M2RA 3NCGA 3R8UA 4MXYA 4ZJJA 4GJ2A 4BDJA 3QD4A 2XCKA 1AGWA 4TYGA 4EZ5A 4ZY4A 1MQBA 2F2UA 3A7HA 2W1IA 5KMJA 1PXMA 3EL8A 1H1WA 2OXYA 5JZJA 3DFAA 3ORPA 3KULB 4X2FA 5M4UA 1XBBA 3MESA 1S9JA 4J8NA 1U59A 2WELA 4IJ9A 5JEBA 4YMJA 4A9TA 2IG7A 1GOLA 1Q8TA 4H36A 4TL0A 4L43A 4F64A 2IN6A 4H05A 3NVMB 1APME 4BBMA 3AGMA 3PIYA 2RIOA 2WTKC 2VV9A 5E4HA 2OWBA 2B9FA 4EH9A 2XK6A 3W2RA 4EZ3A 1QPDA 2W1CA 3N9XA 5EM8A 4HPUE 1Q8ZA 3ZHPC 4PDYA 2IWIA 3HLLA 4YTFA 1TQIA 1F3MC 4ANNA 4O86A 4AW1A 5FD2A 4RLKA 2V55A 4IX4A 4D58A 5AAGA 3LFDA 4WUNA 1SM2A 2E9VA 3A99A 3GCVA 3IW7A 4FTIA 4F4PA 4TWOA 4EQUA 2JKQA 5HLWA 3HV6A 4RWLA 4P7EA 2W1ZA 4C4IA 3R7GA 4V0GA 3CXWA 4P5QA 4U44A 3AMAA 2W4JA 5BMMA 3L8PA 4E4NA 4G34A 2QOOA 2FUMA 1SZMA 4TKSA 4F99A 4ACHA 3GOKA 1A48A 5HLNA 3LMHA 2VWBA 3L8XA 3Q04A 3HA8A 4K33A 3QCQA 1ZYCA 3SV0A 2QQ7A 3HV5A 3IW4A 3JUHA 4FKVA 4I5PA 3R83A 5KCVA 3FMDA 4GG7A 1XKKA 3D14A 4GFMA 2VWIA 5B2KA 4CKJA 3R9HA 1YOLA 5C8NA 3FKOA 4MAOA 3FL4A 3ATTA 4JJRA 2QG5A 4M84A 2XVDA 2Z02A 3KCKA 4FKOA 3PXKA 3V6SA 5KKRB 4BDHA 4JBQA 5A9UA 4AZWA 4JBPA 5AJQA 5M06A 4AU8A 2YLFA 2VTTA 4JR3A 2WMBA 5FP6A 1YXXA 2PUIA 4BIEA 4MF0A 2QU6A 3ROCA 2XNMA 3TG1A 5E91A 3UG2A 2X8DA 4LQMA 3HUCA 2X2LA 3G5DA 4AZSA 5I9WA 3AC8A 3AC3A 5A46A 3QTQA 4Y8DA 4Y5HA 2BFYA 2WMAA 5E8ZA 5AX9A 4U42A 3VUMA 4ASEA 4ZAUA 4AN9A 3QCXA 5EDPA 1OKZA 4GW8A 3EFWA 1Z57A 5LMBA 3MFUA 4C35A 5HHWA 1YXTA 4X2GA 5H8EA 2JEDA 3PZEA 3ORZA 4F9CA 3W2OA 3LKMA 5AR8A 1M14A 2VGOA 5L3AA 4DITA 3EN5A 3HDNA 3VUTA 3NUNA 5LVNA 1BUHA 4RMZA 3ZLYA 1ZOGA 4IVAA 4QYYA 3OCGA 5C4KA 3E3PA 3A7FA 4L01A 5EDRA 4YP8A 4EK4A 2XIRA 4IEBA 4FIEA 2W1GA 4IFGA 1WBSA 5L2QA 3MJ2A 4FG8A 4I92A 4EOQA 2ETRA 5BVFA 3COMA 4BYJA 4QOXA 3KREA 3M2WA 3G51A 3SRVB 2WMWA 2WQBA 2WMXA 2HENA 2J90A 2BRMA 3F82A 5CI7A 5EDQA 4FV3A 1IG1A 3QZHA 2YEXA 1VEBA 1PW2A 2HK5A 4FODA 2C5XA 3LJ2A 2PU8A 3JXWA 3DAKA 3NUAA 2PVMA 5K5XA 4UMRA 3ZMMA 4X2JA 2C6TA 3CC6A 3D5VA 4G5JA 3BX5A 5D12A 3EIDA 5FTOA 3ZLSA 2XP2A 1R39A 3SVVA 1RQQA 5DGZA 3BYMA 4NTTA 3CD3A 2QVSE 4W9XA 3RK7A 3OZ6A 4CFVA 3COIA 2PVHA 4IE9A 4PMMA 2GNHA 3ZCLA 5M56A 4AAAA 3EZVA 4P2KA 4RJ6A 1WVYA 5CAVA 3ZBXA 3EQBA 1Y6AA 5CQUA 3WILA 3CBLA 5ITAA 1BL6A 4ARKA 3DKOA 4GG5A 4O7ZA 4MX9A 2ZVAA 4XS2A 2ITVA 5CXZA 4YJNA 3C5UA 3K3IA 4U45A 5CNNA 5FQDC 1YI3A 3TJDA 2I7QA 4HGEA 4R77A 3LFBA 5KKRC 3LVPA 3VS0A 2CDZA 2J0IA 2C5NA 4QYGA 5IUIA 2UZLA 2RG6A 5F1ZA 1KOAA 3A7GA 3EFJA 1IASA 1XR1A 3ZSIA 1FMOE 1B39A 2H6DA 4BCPA 3EN7A 3ZH8A 3ACKA 3U8WA 2YCSA 3SXRA 2WTCA 3DQWA 3C4WA 5K5NA 2CN5A 5AP6A 5J79A 3I6UA 2WQMA 1FVVA 1OL6A 4JS8A 5BVOA 4O84A 2FSLX 3BV2A 3FL5A 5DEWA 5EYDA 4DG3E 5EK7A 3WIKA 4OT6A 3PPJA 3OMVA 5E7RA 2XCHA 4YC3A 3ULZA 3GU4A 1JKLA 4OR5A 4E6DA 3E7VA 3U6HA 2CGXA 2YDKA 5FEEA 3U6IA 4R7BA 4NEUA 1GZ8A 2IW9A 3S2PA 4ZLYA 5DI1A 4EH6A 3QLFA 4F9AA 2OGVA 4F1TA 4J97A 4FL1A 4EH8A 5AR7A 4UMTA 4AW2A 4BCHA 4HVHA 1WBOA 3DZOA 4XG9A 4LV5A 3RBWA 5HO6A 5JGDA 3ELJA 2CHLA 2E9PA 5EOBA 4GMYA 4A07A 5I9XA 4I1ZA 3MVHA 4X6RA 1YKRA 4ZTLA 3RINA 4UEUA 1U46A 4BTKA 4OAUC 3RNIA 5AV1A 4DINA 3CQEA 2O0UA 4K9YA 4C02A 3Q9ZA 3UIBA 5TOZA 4UYAA 5GHVA 4F9YA 2WTWA 3FZ1A 4FTLA 3BU5A 4QQJA 2YWPA 2HZ0A 3W16A 3UOKA 4AGWA 2JDTA 1Y91A 4ZXTA 4O7NA 2WHBA 4R5SA 5JFSA 3R2BA 4MBIA 5GZ9A 1K3AA 3GB2A 4ID7A 1F0QA 4FK6A 4RGJA 3UO5A 5HO7A 1YI6A 2YIRA 5M44A 3LW0A 3ORMA 4LFIA 4M3QA 4C2VA 4U3YA 1H0WA 3P79A 3FMJA 2FGIA 4GT3A 4L67A 4YHJA 3DFCB 3UIMA 1Q3DA 5EI2A 1KSWA 4ERKA 5AUUA 3JY0A 4U7ZA 2XK7A 5CU3A 3DZQA 3KMWA 4FG9A 4XRJA 1SYKA 3DV3A 5C8MA 4CRSA 5ANJA 3VUIA 4G9CA 4RVTA 2X9EA 5K9IA 4JVGA 3S95A 3EQDA 3Q96A 3UOLA 4AT3A 3C4EA 4RPVA 2YZAA 5IA5A 4QMVA 4X2NA 4KIKA 2V5QA 1NT2A 1OBDA 3U9CA 3A2CA 3NUSA 5CSPA 4QMPA 4KINA 2PMLX 3QCYA 3TT0A 1R1WA 2IVUA 2Q0NA 3VW6A 3ZM4A 2EXCX 3FC2A 1JOWB 3OEFX 5DBXA 2PVYA 2ERZE 4H3QA 5HU3A 2J0KA 1UU3A 2PVJA 3NRMA 4BCKA 4BKJA 2JDOA 3DCVA 3PJ8A 4WD5A 5DT0A 1U5QA 4BCFA 4ZZNA 5LOHA 1WZYA 5HNGA 3FYJX 3ERKA 3ZBFA 2OZAA 4XP3A 5LQFA 4JG8A 4O0TA 3KF4A 2I0HA 2BHHA 2E2BA 3ACJA 3KKVA 5CT0A 5EKOA 2PY3A 2Q83A 3EQHA 2XUUA 5TT7A 2J50A 3H10A 4D4YA 2HCKA 3EQGA 4QP9A 3F3TA 1MUOA 4DLIA 1W98A 4ZY5A 3CGFA 4WNOA 3CSVA 2XS0A 4LRMA 3E8NA 4E4MA 2UW8A 2VO3A 2ZOQA 5CS6A 4F7JA 4L9IA 4DT8A 3GENA 2OXXA 2O63A 5CU6A 3PWDA 5AUVA 2OI4X 1VYWA 4XNEA 3B8QA 1KE9A 4K77A 4Y5QA 5BQ0A 1Q24A 2WEIA 4MYGA 4YZCA 2BPMA 4BKYA 1KWPA 3LXNA 1BL7A 1U4DA 4ALUA 5L2SA 3W2PA 4F6SA 2B54A 2RFEA 3VWAA 3VJNA 4MWIA 4NM0A 3JVRA 4JIAA 3TTJA 3OY3A 2B9JA 3O17A 4DA5A 3MW1A 1Q41A 1W82A 1IR3A 2EVAA 3V3VA 4MVFA 1CMKE 2ITWA 3RAIA 2YIXA 3QHWA 2X1NA 1GZOA 2WOTA 3GCQA 5IH6A 4HNIA 4EYJA 1YHVA 3OS3A 4Z7GA 5HIBA 3MH1A 4ZJVA 2JITA 2OICA 3ZRKA 3P7CA 3F3VA 3OCTA 4YTHA 3ID6C 5KO1A 5CEPA 3K3JA 3GNIB 5DEYA 5M4IA 4BGQA 3LAUA 4YO6A 1URWA 4DEDA 3DAJA 4G5PA 4MNEB 5GZ8A 2QOQA 2OXDA 3U54A 3MDYA 3PIXA 4QYEA 5HG9A 4CZUA 2OO8X 4R7HA 4IVBA 4UALA 4UX9A 5IDNA 5DT3A 4DYMA 3VQHA 2ERKA 2B0QA 3QRIA 3BE9A 4NCTA 3BI6A 4BVUA 2J0MB 3WE4A 2UUEA 3L9NA 2JIUA 3FKLA 2YCRA 3PVBA 3ZDUA 4HGLA 5CAOA 2PL0A 5GZAA 5GNKA 3OTVA 5J5TA 1QCFA 3RK5A 1BI7A 1H26A 2YWVA 5IA1A 3P0MA 3HMIA 5AV0A 1JLUE 5T6KA 4Z55A 3QQLA 5FTGA 5DN3A 4ZY6A 3ZFXA 5EKNA 3HAMA 3FLNC 5K0XA 1ZRZA 4GK4A 4IAAA 2XNEA 3HZTA 4JNWA 3G6HA 1DAYA 3C13A 3R8PA 5L8KA 3N4TA 4IZAA 4LUEA 3U51A 3OWJA 3WIGA 4YZBA 1G3NA 4AN2A 4IDTA 2C5OA 4DGLC 2C6EA 1KV2A 3IPHA 2C5YA 3E87A 5CANA 3LLTA 4D5HA 3FZSA 3LFNA 3QCSA 4DTAA 2R0UA 3NW5A 4D2SA 4ZMFA 2YM5A 3MIYA 2E9UA 4AS0A 5HBJA 4L45A 1UWJA 3R1NA 2ZM4A 2R3KA 4IAYA 3OXZA 5L2IA 3E62A 3S1HA 2Y0AA 5KBQA 4C4GA 4O7YA 4RIXA 2RFDA 3LFCA 5M4FA 3FZTA 4BDDA 3Q53A 5E8SA 3COHA 4M67A 5KMMA 4TYHB 5JK3A 2GU8A 3IDPA 2RFSA 3UO4A 3PXYA 4FE2A 1L3RE 4ACGA 2R3JA 1JBPE 3KQ7A 3KRRA 2ZMDA 3DK7A 3ORKA 4OAVB 4YBKA 5KMLA 2R3RA 1K2PA 2VTRA 3F88A 5JGAA 2BMCA 3GP0A 3DY7A 4GIHA 3FHIA 2IJMA 3KRWA 3ZC5A 4YLLA 2GNFA 2YM6A 3KEXA 1OUKA 4J52A 4TPTA 4NM7A 5KNJA 2XBAA 1YXUA 2AC3A 4XG4A 3RPYA 3BHTA 4K18A 2ETMA 5EQPA 3TDWA 3GC8A 2BAQA 2PUNA 4RQKA 2J0JA 2DQ7X 5J7BA 3SQQA 3TUDA 4GVAA 2XK3A 2XEYA 2W99B 4HYUA 4I23A 3VN9A 2C0TA 2Y6MA 3WBLA 5DR6A 4EQCA 3R2YA 3DKFA 3G90X 4LGDA 3WARA 4HCTA 3DBEA 4J7BA 3U87A 3O2MA 5EM6A 4TW9A 4PTEA 3TIYA 5BMSA 4CFFA 3K2LA 5C27A 3GUBA 5CXHA 4GK2A 5IUHA 5HIDA 2WMUA 1OKVA 4CEGA 3BIZA 4CG8A 3NYNA 4GK3A 4A4OA 5L6WL 4BDFA 2BDFA 1KE8A 4AZTA 1Q99A 4AA4A 3WF5A 3QZGA 1DM2A 3FQEA 3B8RA 2GTMA 4JBVA 4FSNA 4E5BA 4RZWA 1PYEA 4EONA 4ZTMA 2OG8A 2BRBA 3QD2B 3D7TA 4O0YA 4RA5A 2IZTA 3KULA 4ZIMA 3ZXTA 1Q62A 4BC6A 2WU6A 1JKSA 3UP7A 1DAWA 4L3LA 1CDKA 5CU0A 4G17A 4RWKA 4AXAA 3R7OA 5EG3A 4FTTA 4BHZA 3LM0A 5IG1A 1UU9A 2IPXA 3FV8A 4PQNA 4PMTA 4YSMA 4ZLOA 1ZZLA 3IKAA 3SC1A 4O7TA 5BYLA 3JYAA 4L00A 3CTQA 3KVXA 3PWYA 3R01A 1Q8WA 2AC5A 2BROA 2V7OA 3DTWA 3QTWA 4JOAA 1FQ1B 1H1SA 2R2PA 2IO6A 4JAIA 2CGUA 3I4BA 4C37A 1KE5A 3UNKA 1PXKA 3QA8A 4YSJA 4J99A 4ZP5A 4GS6A 2A2AA 2JAMA 5CZHA 4ANSA 2Z60A 3GFWA 4QMTA 3W2SA 4PP7A 4F6UA 5CAUA 4I4EA 2CKOA 1WBPA 3BEAA 3DB8A 4O2ZA 5AV4A 3DJ6A 1UV5A 3LCTA 4GYIA 3DBFA 3O8PA 4PPCA 4WT6A 5AUZA 4IQ6A 3DT1A 3POZA 3LXPA 2OH4A 3R9NA 2V0DA 2Y4IB 2ZMCA 2UVZA 3TTIA 3AG9A 3OWLA 1UVRA 3E93A 5IA4A 4E20A 3N4VA 3CQWA 2BZHB 2R3QA 3ZONA 5CZIA 3TNPC 4UMPA 4KKEA 4C57A 1YOJA 3MB7A 3TWJA 4ZSGA 4BGHA 4LRKA 3W8LA 3L9MA 3QBNA 4M7IA 4KKGA 1SVGA 1YDSE 5FLFA 1R0EA 3BQRA 4DEAA 3DXPA 3I79A 2ITUA 1U5RA 2HW7A 3FLWA 1JSUA 2BHEA 3PG3A 4GFOA 4BDCA 1PMUA 1CTPE 5I9UA 3V5QA 3HMMA 3Q4TA 3R02A 5FUTA 1IA9A 2IZSA 3EFLA 5I0BA 4BKZA 4L68A 4RX8A 4A9RA 4GYGA 4OLIA 3CEKA 3PA3A 3UDBA 5M53A 4LOOA 4YJVA 2WZJA 3OT8A 2UZNA 4W4XA 5HE2A 3OROA 2X81A 2VWVA 3R7VA 2W1DA 4QYFA 3HAVA 2CGVA 1XQZA 2WMTA 4MXAA 5CF8A 2G2FA 2P2HA 4C4JA 1OMWA 1XH5A 4AGUA 2BKZA 4P5ZA 3GGFA 4ZTQA 3F7ZA 4DEHA 3D5XA 2W4KA 3GCUA 2QU5A 4AW0A 3MY1A 1XH8A 3ZEPA 2BZKB 2CN8A 5AR4A 2G9XA 4JQ7A 3R8VA 2BRHA 3PVWA 1FBNA 1TKIA 5FM2A 4ZS4A 1H1PA 4YHFA 2VU3A 3MJ1A 4P90A 5CTPA 4QTEA 4UMUA 4XMOA 2C6DA 5LJJA 4ZSJA 3FMEA 3SGCA 3DNDA 1B38A 3LXLA 5C4LA 2XK9A 4RIYA 5FDXA 3MVMA 3EZRA 3V51A 3VBQA 4C58A 3QXOA 4KRDA 3ZXZA 5KMKA 4BIBA 2F2CB 4C8BA 3VIDA 5CEIA 4FTAA 4JLCA 5I9YA 4TYJA 4DN5A 5FBOA 4TT7A 2YDJA 3DJ7A 4XV1A 3QA0A 2IZRA 4RSSA 5DLSA 4FA2A 1WMKA 2UZEA 2WQEA 3UVPA 2R64A 3VUDA 5JN2A 1CKJA 4F08A 2W9FB 1M7NA 3PTGA 3CD8A 1Q5KA 3HL7A 3BYUA 1ZZ2A 5JQ5A 4C3RA 1KV1A 4ANLA 2GMXA 2HZ4A 4G2FA 4BCQA 3LMGA 5AP4A 4E8AA 4YURA 1G8SA 1R78A 1URCA 4S31A 3UYSA 2BILB 4IJPA 3GC7A 4K1BA 4L46A 4XOZA 3UIUA 2PUUA 4AOTA 4ENXA 3EFKA 3II5A 1OPLA 4UZDA 5AP3A 4CSVA 4E5AX 4W4VA 3IDCA 3MGYA 5EYCA 2G01A 4P4CA 5CENA 2WFYA 2WMSA 5D7VA 5H9BA 3ZSGA 3PE1A 3LQ8A 1W84A 1UA2A 1HCLA 2OK1A 3BHHA 3DOGA 4GH2A 4C3PA 4LM5A 4W8EA 2YAKA 3DTCA 3OOMA 3RALA 3WF7A 4AFEA 4PNIA 4WHZA 1OIQA 4EK8A 1DI8A 5HX8A 1OGUA 4LL0A 4FGRA 4CMUA 4FT0A 4E73A 1MQ4A 2R0IA 3FI2A 2QCSA 4G3FA 2YIQA 4CV8A 5KMIA 5BVEA 4ORKA 1S9IA 4GUEA 1TVOA 3W10A 4APCA 4EOSA 5GIPE 3GT8A 4ANBA 2HELA 1V0PA 3NYXA 5HOAA 3NSZA 2QO9A 2UW5A 4FTOA 4U43A 5AP5A 1YRPA 2JD5A 2XNBA 3NAYA 4KBKA 2RGPA 5E8TA 1YWRA 2XM8A 1BLXA 4EWQA 4FKIA 3QHRA 5CAQA 4DH7A 4BB4A 4S33A 4KNBA 5GIOE 3PLSA 3OC1A 3M1SA 1ZYLA 3LJ0A 4EHVA 3BV3A 3DJ5A 4OTQA 4AT5A 1W83A 4FNXA 5E1SA 4MH7A 2BFXA 2R3HA 5A4QA 5H8GA 3SW7A 4O83A 3U4UA 4F0GA 2WIPA 2OW3A 4FV7A 5IU2A 2PVNA 4TRLA 3R30A 4RQVA 4YJTA 4ASDA 5DH3A 3QX4A 4EZ7A 2EU9A 2HY81 1KE6A 4S30A 1PMEA 2CPKE 3AMYA 2ZV8A 4IADA 4QT1A 4BCIA 5IQEA 5BYYA 3IG7A 4DAWA 3TACA 4BDIA 4IDVA 5IQAA 2OF4A 3RCJA 4BI1A 3PP1A 4ANMA 2GFCA 1RW8A 2C3JA 3QL8A 3UNZA 4FV4A 3UZTA 4DE4A 3F3WA 4YC8A 4YR8A 2J9MA 3EQCA 3UVRA 4D9TA 4I0RA 3K5UA 3QRKA 4XJ0A 3U9NA 4CRLA 4HVDA 3I0QA 4HGSA 4QD6A 5ANKA 3VJOA 5IMXA 2P2IA 4FSMA 3NWWA 4MBLA 3TZ9A 5H3QA 1XO2B 4AZVA 1MRVA 2BUJA 2ZM1A 4J71A 5CASA 4IWPA 3S00A 2JDRA 3UZRA 3NW6A 4IWOA 3QRJA 3Q6WA 3OCSA 1YQJA 2EWAA 4G6NA 5DNRA 5J9YA 5IH4A 1ZOEA 2YM3A 3IQ7A 4DT9A 3RJCA 5CNOA 3PY0A 4GVJA 1Y57A 4L44A 2DUVA 4JX3A 4DH3A 3ZS5A 4EK6A 2OIQA 3F6XA 4CCUA 5F9EA 2ONLA 4BYIA 4EWHA 4EOLA 5DR2A 1CSNA 3VQUA 4MQ1A 3AOXA 4GFGA 5CSHA 1NY3A 4RIXB 5CVGA 1O6KA 4YLKA 2E9OA 3HV4A 2HXLA 4HZRA 3FLSA 2NNWB 5JH6A 4BTFA 5J5SA 3IDBA 4FSUA 3ZO1A 4X2KA 4CZTA 2CKPA 5AFVA 4JDJA 1UNHA 3KRXA 4CCBA 5IA0A 1ND4A 2Y6OA 3TZ8A 3P23A 4QO9A 5TE0A 1RE8A 4ZK5A 4FVPA 4N6ZA 3TKUA 3Q4CA 2PVLA 3VVHA 2C0OA 4BTMA 4FBXA 4F0FA 5DPVA 2XKCA 4IZYA 3C4FA 2W7XA 4I3ZA 2Y4IC 1JSTA 3OEZA 4QPAA 4B9DA 3FI8A 1BI8A 2QOHA 3HMNA 5J95A 2QKWB 4IIRA 3WI6A 5CEKA 2JC6A 1F5QA 4FZAB 3DS6A 3LCDA 5M55A 4OTGA 3LFAA 4EYMA 4IWDA 5DMZA 3L1SA 3NX8A 4DFYA 1OVEA 2PZIA 2RG5A 3SA0A 4ITIA 4APPA 1YWVA 3L8VA 5CX9A 2ITNA 3UMXA 3HMOA 2Y9QA 1U54A 3W33A 3G15A 1P2AA 4FYNA 3DGKA 3DKCA 2GQGA 4RRVA 1PXNA 2VTMA 4G6LA 5D10A 3B2WA 2CCHA 3NNUA 2PWLA 2A19B 5B0XA 3NNXA 3O7LB 5EHLA 3RZFA 3LJ1A 4O2PA 3LXKA 4JQEA 3HGKA 4GT5A 3I7CA 3Q4UA 4ZZMA 5HD7A 4PDOA 3KXGA 4MXCA 4FV5A 5AP0A 4DCEA 4ERWA 2YDIA 4FKWA 2QODA 3KN6A 3AC1A 3MS9A 1JPAA 3MFSA 5CEOA 4BZOA 3F9NA 2FA2A 2GQSA 5FEQA 3Q9XA 5EH0A 2Z7LA 4FIIA 1O6LA 4D9UA 4U8ZA 5EYMA 3THBA 4ASZA 4USDA 4ZOGA 4E6CA 3KCFA 4MK0A 4YLJA 3EH9A 2G2HA 2GHLA 3ROYA 5DFPA 2X2KA 5IQGA 2PVFA 5HKMA 1XWSA 4JRVA 4TTHB 2VX3A 3RHKA 3OW4A 4HW7A 4IZ5A 5L8LA 5CI6A 3GXLA 3ZLWA 3KU2A 4Q9SA 3QTRA 4XG8A 3V5JA 4CT1A 5KZ0A 4RJ8A 4WUAA 5C9CA 5EHYA 3A7JA 4EH3A 3NPCA 4FKUA 3E63A 4O0RA 4BWPA 5AA8A 3H30A 3GVUA 4TYIA 1YXSA 4ZS0A 1XH4A 2J2IB 4EHGA 4YZNA 3VS4A 2NPQA 3KF7A 5EHOA 5EM5A 3UGCA 3S0OA 4EBWA 2BDWA 4AWIA 2B53A 1AQ1A 4QMYA 3QRUA 3MA3A 4OBPA 4FYOA 1YXVA 4EI4A 2X4FA 5BPYA 2B4SB 1ZWSA 4EH4A 4EOIA 3T8OA 5CSXA 1FINA 5ICPA 2YIWA 3CLYA 3EJ1A 4FIFA 1REKA 3FZRA 3SXFA 2X6EA 1J7LA 1PRYA 1A06A 4KS8A 2OF2A 3R0TA 4LMNA 2IVSA 2JKOA 3NZ0A 4QTDA 3I5NA 4BR3A 2QD9A 3PFQA 3BHVA 3RWQA 2C6OA 1OM1A 3R7IA 4AA0A 3P78A 5A4CA 3PDTA 3F7WA 1H07A 2OJFE 5K4JA 2R3IA 5FXRA 2UZTA 3ORIA 3SW4A 4CKRA 2YCQA 4FEQA 1L8TA 3ENHA 2XK8A 1GZNA 4FTNA 4YGAA 3GU8A 3ZRLA 4QP3A 2GFSA 2EB2A 3O7LD 4JIKA 4XEYA 5LMAA 2J51A 3DDQA 4B7TA 2XMYA 4AOIA 4TN6A 3NDMA 4LRJA 4NKAA 3ZEWA 1STCE 5HESA 4C4HA 5FRIA 2Z7RA 3REPA 4TWPA 3IOKA 4IVDA 3NVKI 3H4JA 5JQ8A 4HNFA 5AIRA 4YO4A 3ZZEA 5A14A 5EI6A 5E90A 1G8AA 5I5ZA 3TKHA 4QMZA 4CXAA 2ONLC 4M69A 1PMVA 3R21A 3QTZA 4PMPA 1Q61A 2Z7QA 4PP9A 3HEGA 4EC9A 5JRQA 1CKPA 3PRFA 4OTHA 4E6AA 1NA7A 2NO3A 5JFXA 4AZEA 2GS2A 2GTNA 3PZHA 2XKEA 2VTJA 5JZNA 4X3FA 4OTWA 3TUBA 3AD5A 5IMEA 1ATPE 3GCSA 1H28A 1NVQA 4TNBA 4M66A 3KL8A 2W1HA 2NRYA 4CMTA 2JIVA 2VO0A 5J7HA 4M68A 3HX4A 1GIJA 1OKYA 2QLUA 5DT4A 4FTCA 4JBOA 1XH9A 2C6IA 3HYHA 1IAHA 1Q97A 4MNFA 3DQXA 5H8BA 4FT9A 4BZDA 4R78A 1DI9A 3QRTA 2WD1A 2HAKA 3ORTA 3PXRA 3R9OA 2IW6A 2FVDA 5ETAA 2CNVA 2G1TA 3LCOA 5DHJA 3P7AA 3A60A 4XRLA 3DKGA 4Y83A 4QMLA 3FDNA 5HGIA 3RAKA 3PIZA 3ZLXA 1Q3WA 4O0UA 5IUGA 4YTIA 1SVHA 2Y4PA 4AN3A 2WAJA 2H8HA 1J91A 2PZYA 4FT7A 3VS6A 4OGRA 1FVTA 5HIEA 3FI4A 4KUJA 1UU8A 2QNJA 3BU3A 2BIKB 4AG8A 4BL1A 2FSMX 3COKA 4JX7A 4CQGA 4F9WA 2VWYA 4H3BA 4I5MA 1YW2A 5HI2A 2VTSA 2WQOA 4LUDA 4O1OA 5M09A 4FTJA 4XG3A 3MB6A 5FBNC 4FGBA 3ZO4A 4EH5A 3VS3A 3O8UA 3PP0A 4YTCA 1GJOA 3C1XA 3F3ZA 3K5VA 1XHAA 3KK8A 3KXZA 2WGJA 2YAAA 2IZUA 3Q5IA 1OBGA 3QUEA 3VNTA 3VC4A 2VTQA 4WKQA 3IS5A 4QQCA 2VWZA 4KBAA 5KHXA 3N4UA 3MH0A 3RHXA 3S3IA 3EKKA 2VZ6A 3FMLA 4AZFA 3MVJA 3W8QA 4BFMA 3OBJA 4CYJA 3ET7A 5CSVA 4EORA 3KXHA 2C6MA 2CKEA 3UIXA 1XBAA 2KTYA 4IX3A 4B6LA 4GU9A 4D0WA 1RJBA 4NWMA 2VWUA 5H2UA 4G1WA 4BBEA 2RKUA 4ZTRA 4E1ZA 3BGZA 3I7BA 1OPKA 4MD8E 4FKQA 3M42A 3LIJA 4FKPA 3PRIA 5AX3A 4FNZA 2QKRA 3RMFA 2V7AA 4HJOA 5JFVA 1W0XC 4MBJA 3LZBA 1ZOHA 4NIFA 2YN8A 2R9SA 3KMUA 4WSYA 3BKBA 4O0SA 4RIWA 1ERKA 2VO6A 3OCBA 4Z7HA 4CZYB 2P33A 4DG2E 5HNIX 2XH5A 2XJ2A 4HPTE 5M4CA 3FLYA 3UQCA 3UQGA 1PXIA 2Q0BA 2UZWE 4LOQA 4GT4A 3DAEA 3VS2A 1UU7A 4FG7A 3EWHA 4KRCA 3ATSA 1BX6A 2X7FA 5KE0A 5LWNA 4DFXE 4QMXA 1XH7A 4YC6A 2X2MA 2V22A 4XV3A 3MTFA 3PUPA 3QF9A 5C1QB 4CT2A 1WBWA 3TV7A 3D5UA 4FR4A 1IEPA 4GV1A 4I94A 4EJNA 5ANOA 2OBJA 4YZMA 3UC3A 4FSZA 4LYNA 4O6LA 3UE4A 2H9VA 2R3FA 4MWHA 3V5PA 1SNUA 3MSSA 1Z5MA 3UO6A 3F5GA 1LEZA 2OKRA 4I0TA 5CLPA 4ZTNA 3V6RA 4YU2A 2XIZA 3TIZA 3TNWA 1TQMA 3ZRMA 4FKRA 4IAFA 2B9IA 2DS1A 2IVVA 3VW8A 4OBOA 4HVIA 3GC0A 1OL2A 3NR9A 5BVDA 3PXQA 2H96A 3IW8A 4I6QA 4RBLA 4XYFA 3MVLA 3VULA 2CNUA 1OIYA 4BICA 4XV2A 4IB1A 2H34A 3WZEA 4D4VA 3N51A 4NM5A 1SVEA 2O3PA 3C51A 2XM9A 2XJ1A 2BRNA 2CLQA 4DFBA 1E1XA 3ORXA 4QTCA 3W32A 4C7TA 5BUEA 3CP9A 1FGKA 3NUXA 3SOAA 4Z3VA 3PY1A 4BCGA 3EOCA 4N70A 2UW3A 3CGOA 5EM7A 2W9ZB 2VAGA 2VUWA 4G3GA 4I6HA 4KAOA 5TO8A 3T9TA 3F66A 4D0XA 1ZMWA 2WQNA 4DGNA 3TV4A 5KMNA 4D2PA 3V5WA 2ZJWA 2X4ZA 4FZ7A 4OTDA 2QOIA 1I44A 1O6YA 1OIUA 1OL1A 1SNXA 1ZXEA 4FICA 2ETKA 3HMPA 3QQJA 2CNQA 5JMSA 4NKSA 4WG3A 4RFMA 1UWHA 3PSDA 3R04A 5HE3A 4CTCA 1ZYDA 2BTRA 3LE6A 3WF8A 4ANQA 4EOOA 5IISA 4UXLA 3QYZA 4QP2A 5HG7A 4U3ZA 2XA4A 5DWRA 3VF8A 3QZFA 5IQHA 4D28A 5HEZA 5IKWA 2EXEA 4WA9A 2FSOX 4NW6A 3RK9A 2UW6A 3H0ZA 4D55A 4F09A 3QC4A 4E6QA 3WYYA 4ZSLA 5C03A 5ANDA 5AM7A 4A7CA 1IA8A 5IH5A 4EOJA 3B2TA 4UV0A 3PJCA 3DLZA 3BRBA 3QTXA 2GNIA 3KB7A 5LARA 4CGAA 2PVRA 4FSTA 3P08A 1WCCA 5EW8A 4Y85A 5FP5A 3OT3A 4BZNA 1Q8YA 4R8QA 4RIWB 4DFUA 3VO3A 5AM6A 3ZUTA 4YBJA 4HOKA 4JT3A 3IONA 3UODA 4PTGA 3MYGA 2Y8OA 3ZYAA 4F9BA 2X7GA 3MFTA 4MXXA 2OFUA 4N6YA 5CF6A 3ZSHA 4GU6A 4D1XA 2C47A 2OJIA 4QQ5A 3P4KA 3D7ZA 4YNOA 4S34A 4D4RA 3L9LA 2HZIA 1EH4A 1PXOA 3E8CA 4IZ7A 4D2VA 5IEXA 2YABA 4X3FB 4KD1A 4QNAA 2BAJA 5IZFA 4R3CA 3CS9A 3O0GA 3R1QA 3T3VA 3VBTA 4HGTA 3UOHA 5KHWA 5L6PA 5LVMA 3H0YA 2JGZA 1M2PA 3MI9A 4F70A 2W06A 2QONA 3G0FA 3OUKA 4CFMA 3QD0A 1BYGA 2X7OA 4RIYB 3RPOA 1QPJA 2BR1A 2JIIA 2PZPA 3BGQA 4UMQA 3E8DA 5LVPA 2UW4A 2W1FA 3FY2A 1J7IA 1OB3A 1NVRA 4GJ3A 1I09A 3NAXA 3GOPA 3QGYA 4YUQA 5CVFA 3R1SA 5GINE 2AUHA 5KBRA 3PSCA 2CGWA 2FSTX 1VR2A 2BRGA 2OJ9A 4EK5A 5KZIA 3DBQA 3R71A 3QWKA 3ORLA 4IANA 3MY0A 4FTUA 2A1AB 4WNKA 4H58A 1H27A 3EN9A 2PUPA 4FSWA 4CYIA 4FEXA 4FKJA 2OSCA 2PZ5A 3O50A 1FPUA 5ACKA 5B7VA 4BCJA 3OWKA 2BDJA 5DE2A 3AQVA 3V8SA 4BIDA 4FEWA 5JRSA 3IW5A 3DB6A 4G3DA 3G0EA 4YPSA 4MXOA 4GIIA 4Q5EA 3V8WA 1YI4A 3AXWA 4FMQA 1WBTA 1HCKA 5KUPA 3E3BX 5FXSA 3O23A 4QMSA 2F49A 3OD6X 4YNEA 4O6EA 1ZYJA 3QXPA 1ZY4A 4TXCA 3KMMA 3C0IA 3CE3A 3GFEA 3BLQA 4H1JA 5E8WA 5HG5A 4EKLA 4FIGA 4FTKA 2GDOA 2R3MA 1OI9A 5J1WA 1DS5A 3LCKA 3QTSA 3QU0A 2PE1A 4FI1A 4FKLA 2XNNA 5F94A 4RX5A 4PNKA 4Q2AA 4E4LA 4L6QA 2CCIA 4EBVA 5AV2A 3SG8A 1P5EA 4X3JA 4IW0A 3PJ3A 4XLIA 3QC9A 4PMSA 4NL0A 2WPAA 3QQKA 3OXIA 4BDEA 4CKIA 3VAPA 4BDGA 3O96A 2OFVA 5AUTA 1Y8YA 3H3CA 3OTUA 3ZM9A 1Y6BA 1WVXA 2R3NA 4XUFA 3A61A 4FTQA 5E8VA 1Z9XA 3SAYA 1H8FA 2PK9A 3FC1X 2B7AA 1QPEA 1UKHA 2VTAA 5IQIA 2Z2WA 4W9WA 3FSKA 5AUYA 5C01A 4QP4A 4FEVA 2NRUA 1R0PA 4R5YA 4MTAA 5CALA 3MTLA 3BWFA 3CTJA 3PVUA 3R22A 2I0VA 2YM7A 2YZLA 3GU5A 3OP5A 4KBCA 4UB7A 2RSVA 3GC9A 4IC7A 4M12A 2I40A 3G33A 5AR2A 3ZUUA 4C0TA 5LMKC 4O0WA 3QTUA 4RFYA 5HICA 4EOPA 2F4JA 3FY0A 5D11A 2HW6A 3ZOSA 4CNHA 2JKMA 3SDJA 3LHJA 3NIZA 4IBMA 5CEQA 4W4YA 5L2TA 2V62A 3Q2JA 2GQRA 2VNWA 2PE0A 5DR9A 2F9GA 4PY1A 3WZJA 2EB3A 4BHNA 3HECA 3U55A 4Q5HA 4ALVA 4J1RA 3TZ7A 2ZB1A 3F2RA 2WTJA 1WAKA 4B0GA 1NXKA 3OG7A 2F7XE 4Y73A 4RG0A 4UZHA 2BCJA 2YIYA 2O64A 3C4CA 2LAVA 3VBWA 3FQSA 3PG1A 3S4QA 2HIWA 3HNGA 4FF8A 1IAJA 4DFNA 2J6MA 4DC2A 4FUXA 3UYTA 3ZZWA 3CY2A 3ALNA 5TKDA 3IGGA 2J7TA 4QPMA 3VBYA 3FZPA 4JDIA 4HZSA 2W17A 3P86A 2VX0A 1PMNA 2G15A 4NJ3A 1WFCA 5IA2A 2PYWA 2XNGA 3EQIA 2C30A 4CLJA 3DK6A 3AC4A 2G2IA 3D0EA 3F2NA 3FE3A 3FMKA 5GJGA 4CMOA 5A4TA 4QP8A 5HD4A 3HUBA 3WF6A 2HZNA 4OT5A 3RAWA 5BVWA 2I1MA 3EB0A 4AE6A 3R00A 4FEUA 3QD3A 4E4XA 4Q9ZA 1YWNA 3D4QA 3M11A 4A4LA 3PA4A 3JVSA 3I81A 1T45A 4U41A 2ZB0A 1MRYA 4O22A 3RM7A 5FEDA 2BZJA 3FMNA 2XYUA 1GAGA 2O8YA 3LCSA 4I24A 4WO5A 2QG7A 4F1OA 1PY5A 3W1FA 4FX3A 4A9UA 2GSFA 5LMKA 5I3OA 4MKCA 2WB8A 4WBBB 5I3RA 2HXQA 5D1JA 2UZOA 1VYZA 4IXPA 5L8JA 5HZNA 4LGHA 4L42A 2UZBA 4O1PA 4R6VA 4JDKA 4H1MA 4M8TA 1QPCA 3FSFA 3C4ZA 5E8XA 3HRFA 1K9AA 4PL4A 3VS5A 3Q9WA 2BIYA 3MH2A 4KB8A 4EH7A 4BCNA 5JKGA 2P4IA 2PPQA 4XX9A 3R7UA 4JI9A 2B9HA 2BZIB 5IEVA 4UY9A 4MD7E 1OECA 4D4SA 1WBNA 2CSNA 4X3FC 5DOSA 3GEQA 1FMKA 3KGAA 4RT7A 4XHKB 1X8BA 3ODYX 4RLLA 3TNQB 2F57A 2VD5A 2YLEA 3BYSA 4XLVA 5AV3A 4HVGA 4CFXA 2OLCA 3NUPA 4CTBA 2RF9A 4HYSA 4IM3A 4XG6A 3MA6A 3QKMA 5ANGA 4ITHA 4IM2A 3VF9A 2YA9A 4QMQA 2XKFA 3RKBA 4BWKA 1W8CA 3TM0A 5AUWA 4TY1A 5EW9A 3SHEA 5IQCA 4C33A 5B2MA 4QTBA 4CV9A 5A4LA 1JWHA 2I0YA 2Z8CA 3BE2A 4L3PA 4X7QA 4BI2A 4DCAA 2WMRA 3LM5A 2KULA 1GY3A 2QOKA 4O7RA 3GCPA 4OUCA 4DH8A 4RJ7A 2B52A 3KC3A 3KXXA 1KUTA 2WTDA 4GEOA 1UNGA 5BVKA 3UOJA 2XIKA 5EW3A 3HP5A 3IW6A 4KIQA 4X0MA 3R8ZA 4AGDA 3IO7A 5T68A 4A06A 2R4BA 3NYVA 2WU7A 4E5WA 3QAME 2FYSA 2X0GA 1HOWA 2QHNA 3GI3A 5E8UA 3RGFA 3W2QA 4IAZA 3RWPA 5JFWA 1YVJA 4LV8A 2P3GX 1JKKA 2RFNA 5M07A 4D2TA 3GU7A 5FXQA 3LMIA 2XKDA 3RTPA 3DDPA 4I21A 3OWPA 3TEIA 3NS9A 3PXFA 3ZUVA 4AE9A 5KX8A 3LLAA 4ACCA 1KOBA 2XF0A 1GIIA 4I20A 3OFMA 3FLQA 1FVRA 4X6QC 3PE2A 2A0CX 3NLBA 4FKGA 3BYOA 4FT3A 4WBOA 4EL9A 5CF4A 5CF5A 4FNWA 3OXTA 4TNDA 3D5WA 1QMZA 3FYKX 2WOUA 3BYVA 3QKLA 4J95A 4ZEGA 5IEYA 4E3CA 4CG9A 5G1XA 3V8TA 4A4XA 4HVSA 5LVLA 4FKTA 5IQBA 2X8EA 2YJSA 4RJ3A 2J5EA 2LGCA 4PX6A 4I5HA 4JDHA 3DLSA 4O7LA 1A9UA 4JXFA 3Q2MA 5FGKA 4U40A 2GNJA 2PZRA 4W8DA 4NW5A 3QX2A 3CY3A 3DBDA 3HP2A 1REJA 4IC8A 4XH6A 2P0CA 3MPTA 5AR3A 3F2AA 1M17A 4U0IA 3W18A 3C9WA 5J9ZA 1ZY5A 3TL8A 5DIAA 4IM0A 3TKIA 3UBDA 2AYPA 3QQUA 4ANOA 5DVRA 1B6CB 3G9LX 5E8YA 3WZKA 3OW3A 1MP8A 4K11A 3JY9A 4DFZE 2HYYA 3UC4A 2QC6A 4S32A 4RZVA 4HCVA 3R73A 4FT5A 3LQ5A 4F7LA 4MF1A 4I6FA 3E64A 3OHTA 4QMWA 3VRZA 4O7WA 5I4NA 1YHSA 2UW9A 4RWJA 4J8MA 3RI1A 4WRSA 3A8XA 1XJDA 4TZRA 3I6WA 4YJOA 1LPUA 2JKKA 3EMGA 4C4EA 1V0OA 1JNKA 2XNOA 3LFQA 2CMWA 4NJDA 4YJQA 1JAMA 4IB0A 4IWQA 2W5BA 4B8LA 3Q9YA 5A4EA 2XRUA 5M51A 2GPHA 4HCUA 5ANEA 2HOGA 1YDRE 2VWWA 4O27B 3RZBA 3KK9A 4C2WA 2W05A 5HQ0A 3TDVA 1XBCA 1ZAOA 2DWBA 5D41A 3WZDA 4I93A 4K6ZA 4KWPA 5CYIA 3F5XA 5FM3A 3QQFA 5BNJA 3BCEA 3UZPA 4YJSA 4E7WA 3AT2A 4FL2A 4V04A 4BWXA 1BMKA 5LCKA 1Q4LA 3IK3A 3ZO3A 4DBNA 5KMOA 4PPAA 3H9FA 5IDPA 2BALA 3F5UA 4PL5A 2QO7A 3HDMA 2WMVA 4QRCA 4AACA 4FV2A 5EQYA 4L7FA 3CPCA 3NCZA 2WTIA 4PPBA 3O71A 3UVQA 4F0IA 3FAAA 4MHAA 3AD6A 4CD0A 4O81A 2ITPA 3FPQA 4V0GB 1GNGA 2UW0A 3NW7A 3QUPA 3P9JA 3MY5A 4RC4A 4YZ9A 5J87A 3VHEA 2YISA 3ALOA 1H00A 2UZVA 2VTLA 4N0SA 2QOCA 1ZLTA 3Q6UA 4FSYA 5GJFA 5A54A 2R3LA 5EI8A 3OY1A 4DEBA 1PKDA 4BTJA 4DEGA 4WOVA 3LFSA 3UNJA 3HV3A 3QWJA 4V05A 3FPMA 2ITXA 2C5VA 4NK9A 3CIKA 3D83A 4Y72A 2YERA 3ULIA 3I60A 1LUFA 4N4SA 3V01A 1P14A 4TWCA 4OTPA 2WIHA 4GRBA 2ITOA 3SOCA 4O7SA 3KXMA 3U4WA 4C61A 3A62A 2O2UA 3FUPA 4U9AA 2UZDA 3Q3BA 5CT7A 5TR6A 2XYNA 2YJRA 4OTRA 3W55A 1FGIA 4PDPA 4O7VA 2CLXA 3E5AA 3ZDIA 4CQEA 2ZDUA 1M2QA 1OKWA 3VUKA 4FOBA 3UTOA 4BN1A 3HVCA 3CKWA 4KS7A 2SRCA 3R9DA 2JFLA 5B2LA 5A6OA 3BLRA 2ACXA 4QYHA 2EXMA 4ASXA 1PXJA 2C3KA 5IQFA 4JG6A 2IVTA 1H0VA 2JAVA 1OUYA 4WIHA 5CWZA 5HBHA 3KRJA 3R9RA 3Q4ZA 4L3JA 2J0LA 3DA6A 5K3YA 5JT2A 1CM8A 1OZ1A 4QNYA 4O0VA 4FKSA 3PVGA 3R1YA 3RAHA 4F1MA 4NU1A 2ITYA 5F4NA 3QQGA 3VS1A 4YJRA 3D9VA 3PLAE 3PY3A 2XIXA 2XBJA 3LPBA 4L53A 3RP9A 3AT4A 2FB8A 2R3GA 4PF4A 5C26A 2VGPA 3FHRA 3HRCA 2PTKA 3CCNA 4K8AA 2DYLA 2YM8A 4FK3A 3EQFA 2QR8A 3VUGA 5HG8A 3SX9A 4NUSA 5J8IA 2VWXA 3T3UA 3V5TA 3CKXA 4IX5A 4BGGA 3WE8A 4PV0A 5F95A 3EQRA 3FWQA 4GKHA 4G16A 3Q60A 4WNPA 2JDSA 3FLZA 3QQHA 5EQEA 3IGOA 2UVXA 2YACA 4DTKA 4ZSAA 3TUCA 2X6DA 1O9UA 2PVKA 4O21A 5LXMA 4ZMEA 5FG8A 4M0ZA 3CTHA 3GQIA 4RA4A 3I1AA 4L7SA 4W4WA 4AGCA 4XV9A 5FWKK 2XRWA 3JS2A 2GNGA 3ORNA 5EOLA 4FZFB 4G3EA 5BUJA 3EYGA 4U97A 1OL7A 1PHKA 3NNVA 4IX6A 4J98A 4TYEA 3VHKA 4F63A 2ZAZA 2O5KA 2QR7A 4E93A 3R7YA 5AADA 2HWPA 4R3PA 4BBFA 3MN3A 4ACDA 3E8EA 2OIBA 4QPSA 3BLHA 4AQCA 2W5HA 4AW5A 3C0HA 2C3IB 2W1EA 4DHFA
chains in the Genus database with same CATH superfamily
4II5A 3AD4A 3ITZA 2B55A 2R3PA 4J53A 4D5KA 3LQ3A 3POOA 3AC2A 3SLSA 5ETCA 3LOKA 1CKIA 4YZDA 4CFNA 3QUDA 4BCMA 3HRBA 4BY9E 2Y7JA 3O51A 5BX0A 2BVAA 4ACMA 4IFCA 3K54A 3SG9A 4IB3A 1H1RA 3F5PA 1WVWA 3QZIA 3H9OA 4I6BA 4MQ2A 4DEEA 4RC3A 1V0BA 3EHAA 3ZTXA 3RM6A 1TFFA 2GHGA 3TV6A 4USFA 3OOGA 4KA3A 1ZARA 4LL5A 3F61A 4OBQA 3UPXA 4KIKB 5EFQA 2FH9A 1H01A 5LVOA 4GL9A 4XBUA 2YFXA 4QTAA 3NUYA 3R63A 3KVWA 4TYHA 3ETAA 5BYZA 4UWCA 4EQMA 3R28A 4IACA 2R3OA 1E1VA 4USEA 2WEVA 3A4PA 1NVSA 1SMHA 4OW8A 3VBVA 4O82A 3SRVA 3MFRA 3QGWA 2GHMA 4DF3A 3PA5A 2UV2A 4NCTC 4A9YA 2ITTA 4I4FA 4PDSA 4QQTA 5I9VA 3UP2A 5ETIA 1JSVA 2PMIA 1W7HA 4RWIA 2O65A 1UKIA 3D2IA 1JKTA 1OIRA 3Q52A 4X21A 5A3XA 2ZV7A 2VRXA 4FVRA 2XK4A 2XEZA 3QTIA 2GCDA 4JL9A 4B4LA 4C38A 3MPAA 3EKNA 4PRJA 3NGAA 4KKHA 3BHUA 5LCJA 3C7QA 3V5LA 4K0YA 4BDAA 1YDTE 2OU7A 3IECA 3DK3A 5HTIA 3R8LA 1BKXA 4O38A 5D7AA 5AP7A 4C62A 3C50A 4CVAA 3UJGA 1H4LA 2NP8A 3D94A 3MV5A 4XG7A 1M52A 4LMUA 3PPZA 3R7EA 2VTOA 1TQPA 3PXZA 3BZ3A 3RPSA 3SXSA 4BDKA 5JSMA 4IB5A 4YJUA 3F69A 4C36A 4ITJA 5EYKA 2CJMA 2W4OA 2C6LA 2OZAB 5AIKA 1YHWA 5FTQA 1V1KA 4RFZA 5E92A 3ENMA 3FQHA 3P1AA 5D9HA 5HO8A 3UDTA 2RL5A 2JBPA 3NIEA 2WXVA 2VTHA 2VX1A 2C4GA 2QURA 3AGLA 4S2ZA 1JVPP 5AR5A 3EN6A 4F7SA 4FTMA 1E9HA 5HVKA 2VTPA 2XZSA 2JFMA 4UN0C 4LG4A 3TCPA 5AP1A 3QYWA 3V04A 2CKQA 2WTKB 4O91A 4EUUA 5HTCA 5CU4A 1Q8UA 2PHKA 3MPMA 5CQWA 5G6VA 1H25A 4AFJA 2UZUE 1R3CA 3IOPA 4G31A 4ZTHA 4NFMA 2OJJA 3WOWA 5I9ZA 4M14A 2PE2A 5ANIA 2PMOX 4GCJA 4D1ZA 4LGGA 5CU2A 3UMWA 2BKKA 3A7IA 4U80A 1LR4A 3NMUF 4KSQA 1P4OA 4DG0E 2C68A 3L8SA 2GS7A 3C4XA 1H24A 3D15A 4K2RA 3ODZX 3G9NA 2QLQA 4EUTA 2REIA 4C59A 1J1BA 1G5SA 3EN4A 2XIYA 4UWBA 1J7UA 5AA9A 4BF2A 4ZLZA 4MXZA 3QFVA 3E88A 3CJFA 3CPBA 3MWUA 2C1AA 3JPVA 3KA0A 2C3LA 2PSQA 3DPKA 4EC8A 5HU9A 2X0PA 4LI5A 4F6WA 4JQ8A 4C34A 4HYHA 5HCYA 1MRUA 2WMQA 3BHYA 3BWJA 3FJQE 5CVHA 4XP0A 4WRGA 4RIOA 3W2CA 5HX6A 4M0YA 3ANQA 3AT3A 4QMOA 3FXZA 2JDVA 2A4LA 5HBEA 4C4FA 4MD9E 3R6XA 4FVQA 4EJ7A 4EOKA 3F3UA 4FL3A 2ESMA 4EHZA 1PJKA 5J1VA 2ZDTA 2QOFA 4FV0A 4F7NA 5LWMA 3GU6A 4IVCA 1WBVA 1JQHA 2QOBA 4C3FA 2R5TA 4NZWB 3NNWA 1XH6A 1LEWA 3EQPA 4V01A 5BVNA 3RCDA 2YM4A 5HE0A 4RX9A 3BBTB 3DBCA 2F7ZE 4I22A 5CY3A 3BBWA 2A27A 2XARA 4FZ6A 2J4ZA 4QMNA 3QLGA 1AD5A 2XJ0A 3GBZA 3TN8A 5HTBA 5K4IA 3U6JA 2ITZA 4U81A 5C8KA 5FDPA 3BPRA 2PULA 5J9LA 1UNLA 2C0IA 4EOMA 2YHVA 2ZM3A 4EKKA 5BUIA 1J1CA 4GUBA 3PPKA 2EUFB 3BELA 1VJYA 1PXLA 4IHPA 4O0XA 3NYOA 4NFNA 4AP7A 4QP6A 3ANRA 3AC5A 3EYHA 4GSBA 4B99A 4D2WA 3G6GA 1U54B 3VUHA 3E7OA 3GQLA 5HVYA 2JBOA 4AA5A 3UQFA 3FZOA 4CFWA 3ZO2A 2E9NA 3QALE 2UW7A 2VO7A 3FBVA 4WSQA 4M97A 4NIFB 4YJPA 5JGBA 3DU8A 3BGPA 2FO0A 3FXWA 4RVLA 3DXQA 4U79A 3SKCA 5HE1A 4NM3A 4FTRA 4FZDB 3TZMA 3JR1A 5DYJA 5CSWA 4E26A 4PUZA 4UYNA 4DBXA 4O4EA 5M08A 3ZFMA 4QMUA 4EK3A 3E92A 3P7BA 2GS6A 5AAEA 3FXXA 3P5KA 3WF9A 4BRXA 4N57A 3LFFA 4BI0A 4NT4A 4R7IA 4ZSEA 4U5JA 1FOTA 4IMYA 3O5AA 3TNIA 3VBXA 3T9IA 4D1SA 2ZV9A 4Z9LA 4FNYA 1GZKA 2VTIA 4DDIA 2ITQA 3UG1A 4U6RA 4A9SA 3EL7A 2BTSA 3UPZA 4GKIA 3SD0A 2WTVA 4ZJIA 4DGGA 4PWNA 5L6OA 4Y46A 2WNTA 4AXFA 3RVGA 3D2KA 4FOCA 2HY0A 4NH1A 3C5IA 2ZV2A 4RVMA 4MEDA 4EH2A 3ZU7A 3OVVA 4CFUA 3R8MA 1PXPA 3DXNA 4KABA 3FMHA 4M15A 4AT4A 2VN9A 3A4OX 4FIHA 3MIAA 4G9RA 5L4QA 2WKMA 1VZOA 4RJ4A 4QDEA 5HNBA 4RC2A 2R7BA 2XB7A 3KXNA 4H3PA 4I41A 3L9PA 4PL3A 1T46A 4JR7A 4DGOA 4L8MA 4FV9A 2WO6A 3HA6A 4ENYA 5M57A 1M7QA 5AAFA 3I5ZA 4UWYA 4MNEA 4FC0A 3OF0A 1OPJA 5E9EA 5DA3A 1ZYSA 3OBGA 4IAKA 4F65A 3RPVA 4JRNA 5HLPA 4FSQA 1PKGA 4WG4A 3TI1A 1J3HA 3CQUA 4JAJA 3NEWA 2GNLA 5CAPA 4M69B 1PF8A 5HORA 2C6KA 3BQCA 4XOYA 5DRDA 5AWMA 2JLDA 5HCXA 2X9FA 4QP7A 5E1EA 2VTNA 4BCOA 2HWOA 3C0GA 4JG7A 2W5AA 1NW1A 1KE7A 1H08A 1OL5A 2C69A 5AEPA 4OTFA 5K0KA 1LP4A 2QOLA 4WNMA 3FI3A 4FV6A 4OTIA 2IW8A 2QI8A 3D7TB 3PJ1A 4FIJA 2R7IA 3CR0A 3KN5A 1GIHA 4LOPA 4AF3A 5GJDA 2ZYBA 3Q5ZA 4R1YA 4B8MA 3NUUA 5AUXA 5IPJA 4QP1A 4I0SA 3RNYA 4ZTSA 2X8IA 4FV1A 4BDBA 4KSPA 5ACBC 1OITA 3MBLA 4AOJA 2OZOA 1H1QA 4DLJA 5A6NA 1QL6A 1OGYA 4ALWA 2W96B 1W2DA 2P55A 4UBAA 4XCUA 4XBRA 3BU6A 4CLIA 1RDQE 3WZUA 4YHTA 3HKOA 4QMMA 4XP2A 4FSRA 2XNPA 5TF9A 4J96A 4Y95A 3FEGA 1IRKA 2F7EE 2QHMA 5DRBA 5AMNA 5L2WA 5CEMA 4KIOA 5HVJA 4DH5A 4DFLA 4DGMA 2W0JA 4IAIA 3VRYA 5IF1A 4RVKA 3HV7A 3PSBA 2X39A 5T3QA 3QKKA 3RPRA 4M13A 4EEVA 3PYYA 1P4FA 3MH3A 4I5CA 5ETFA 4G3CA 2OH0E 1ZMUA 2YITA 5F20A 4ZZOA 4NSTA 4Z16A 3TXOA 3H9RA 4R1VA 1Y8GA 3BEGA 4AX8A 3KRLA 3FKNA 2B1PA 3KFAA 4MCVA 2C1BA 2QO2A 2OIDA 1YOMA 4XG2A 3KY2A 3TJCA 4RX7A 2OJGA 3LFEA 4PTCA 3W0PA 1ZMVA 2I0EA 3AMBA 4TWNA 3CJGA 3TNHA 5IA3A 2I6LA 2BAKA 4G6OA 4D2RA 4HYIA 4DEIA 2PMNX 5HCZA 4H39A 2UVYA 4IH8A 3ZFYA 3A8WA 3O8TA 3I0OA 3PJ2A 3WYXA 3FMMA 4DH1A 4FUYA 3OUNB 4UXQA 4EHEA 3DNEA 4R3RA 2VNYA 4L52A 4ONAA 4KIPA 4NYEA 4AUAA 4DTBA 3Q32A 4FV8A 4RJ5A 5DG5A 3ZC6A 5IQDA 4NTSA 2Z7SA 4WG5A 2YCFA 1PYXA 5AP2A 2J5FA 4YPDA 3VS7A 4O96A 3G2FA 1M2RA 3NCGA 3R8UA 4MXYA 4ZJJA 4GJ2A 4BDJA 3QD4A 2XCKA 1AGWA 4TYGA 4EZ5A 4ZY4A 1MQBA 2F2UA 3A7HA 2W1IA 5KMJA 1PXMA 3EL8A 1H1WA 2OXYA 5JZJA 3DFAA 3ORPA 3KULB 4X2FA 5M4UA 1XBBA 3MESA 1S9JA 4J8NA 1U59A 2WELA 4IJ9A 5JEBA 4YMJA 4A9TA 2IG7A 1GOLA 1Q8TA 4H36A 4TL0A 4L43A 4F64A 2IN6A 4H05A 3NVMB 1APME 4BBMA 3AGMA 3PIYA 2RIOA 2WTKC 2VV9A 5E4HA 2OWBA 2B9FA 4EH9A 2XK6A 3W2RA 4EZ3A 1QPDA 2W1CA 3N9XA 5EM8A 4HPUE 1Q8ZA 3ZHPC 4PDYA 2IWIA 3HLLA 4YTFA 1TQIA 1F3MC 4ANNA 4O86A 4AW1A 5FD2A 4RLKA 2V55A 4IX4A 4D58A 5AAGA 3LFDA 4WUNA 1SM2A 2E9VA 3A99A 3GCVA 3IW7A 4FTIA 4F4PA 4TWOA 4EQUA 2JKQA 5HLWA 3HV6A 4RWLA 4P7EA 2W1ZA 4C4IA 3R7GA 4V0GA 3CXWA 4P5QA 4U44A 3AMAA 2W4JA 5BMMA 3L8PA 2X0QA 4G34A 4E4NA 2QOOA 2FUMA 1SZMA 4TKSA 4F99A 4ACHA 3GOKA 1A48A 5HLNA 3LMHA 2VWBA 3L8XA 3Q04A 3HA8A 4K33A 2ZFYA 3QCQA 1ZYCA 3SV0A 2QQ7A 3HV5A 3IW4A 3JUHA 4FKVA 4I5PA 3R83A 5KCVA 3FMDA 4GG7A 1XKKA 3D14A 4GFMA 2VWIA 5B2KA 4CKJA 3R9HA 1YOLA 5C8NA 3FKOA 4MAOA 3FL4A 3ATTA 4JJRA 2QG5A 4M84A 1G8KA 2XVDA 2Z02A 3KCKA 4FKOA 3PXKA 3V6SA 5KKRB 4BDHA 4JBQA 5A9UA 4AZWA 4JBPA 5AJQA 5M06A 4AU8A 2YLFA 2VTTA 4JR3A 2WMBA 5FP6A 1YXXA 2PUIA 4BIEA 4MF0A 1TZDA 2QU6A 3ROCA 2XNMA 3TG1A 5E91A 3UG2A 2X8DA 4LQMA 3HUCA 2X2LA 3G5DA 4AZSA 5I9WA 3AC8A 3AC3A 5A46A 3QTQA 4Y8DA 4Y5HA 2BFYA 2WMAA 5E8ZA 5AX9A 4U42A 3VUMA 4ASEA 4ZAUA 4AN9A 3QCXA 5EDPA 1OKZA 4AAYA 4GW8A 3EFWA 1Z57A 5LMBA 3MFUA 4C35A 5HHWA 1YXTA 4X2GA 5H8EA 2JEDA 3PZEA 3ORZA 4F9CA 3W2OA 3LKMA 5AR8A 1M14A 2VGOA 5L3AA 4DITA 3EN5A 3HDNA 3VUTA 3NUNA 5LVNA 1BUHA 4RMZA 3ZLYA 1ZOGA 4IVAA 4QYYA 3OCGA 5C4KA 3E3PA 3A7FA 4L01A 5EDRA 4YP8A 4EK4A 2XIRA 4IEBA 4FIEA 2W1GA 4IFGA 1WBSA 5L2QA 3MJ2A 4FG8A 4I92A 4EOQA 2ETRA 5BVFA 3COMA 4BYJA 4QOXA 3KREA 3M2WA 3G51A 3SRVB 2WMWA 2WQBA 2WMXA 2HENA 2J90A 2BRMA 3F82A 5CI7A 5EDQA 4FV3A 1IG1A 3QZHA 2YEXA 1VEBA 1PW2A 2HK5A 4FODA 2C5XA 3LJ2A 2PU8A 3JXWA 3DAKA 3NUAA 2PVMA 5K5XA 4UMRA 3ZMMA 4X2JA 4LDTA 2C6TA 3CC6A 3D5VA 4G5JA 3BX5A 5D12A 3EIDA 5FTOA 3ZLSA 2XP2A 1R39A 3SVVA 1RQQA 5DGZA 3BYMA 4NTTA 3CD3A 2QVSE 4W9XA 3RK7A 3OZ6A 4CFVA 3COIA 2PVHA 4IE9A 4PMMA 2GNHA 3ZCLA 5M56A 4AAAA 3EZVA 4P2KA 4RJ6A 1WVYA 5CAVA 3ZBXA 3EQBA 1Y6AA 5CQUA 3WILA 3CBLA 5ITAA 1BL6A 4ARKA 3DKOA 4GG5A 4O7ZA 4MX9A 2ZVAA 4XS2A 2ITVA 5CXZA 4YJNA 3C5UA 3K3IA 4U45A 5CNNA 5FQDC 1YI3A 3TJDA 2I7QA 4HGEA 4R77A 4JMQA 3LFBA 5KKRC 3LVPA 3VS0A 2CDZA 2J0IA 2C5NA 4QYGA 5IUIA 2UZLA 2RG6A 4O4DA 5F1ZA 1KOAA 3A7GA 3EFJA 1IASA 1XR1A 3ZSIA 1FMOE 1B39A 2H6DA 4BCPA 1XMMA 3EN7A 3ZH8A 3ACKA 3U8WA 2YCSA 3SXRA 2WTCA 3DQWA 3C4WA 5K5NA 2CN5A 5AP6A 5J79A 3I6UA 2WQMA 1FVVA 1OL6A 4JS8A 5BVOA 4LV7A 4O84A 2FSLX 3BV2A 3FL5A 5DEWA 5EYDA 4DG3E 5EK7A 3WIKA 4OT6A 3PPJA 3OMVA 5E7RA 2XCHA 4YC3A 3ULZA 3GU4A 1JKLA 4OR5A 4E6DA 3E7VA 3U6HA 2CGXA 2YDKA 5FEEA 3U6IA 4R7BA 4NEUA 1GZ8A 2IW9A 3S2PA 4ZLYA 5DI1A 4EH6A 3QLFA 1ST0A 4F9AA 2OGVA 4F1TA 4J97A 4FL1A 4EH8A 5AR7A 4UMTA 4AW2A 4BCHA 4HVHA 1WBOA 3DZOA 4XG9A 4LV5A 3RBWA 5HO6A 5JGDA 3ELJA 2CHLA 2E9PA 5EOBA 4GMYA 4A07A 4FJVA 5I9XA 4I1ZA 3MVHA 4X6RA 1YKRA 4ZTLA 3RINA 4UEUA 1U46A 4BTKA 4OAUC 3RNIA 5AV1A 4DINA 3CQEA 2O0UA 4K9YA 4C02A 2AEGA 3Q9ZA 3UIBA 5TOZA 4UYAA 5GHVA 4F9YA 2WTWA 3FZ1A 4FTLA 3BU5A 4QQJA 2YWPA 2HZ0A 3W16A 3UOKA 4AGWA 2JDTA 1Y91A 4ZXTA 4O7NA 2WHBA 4R5SA 5JFSA 3R2BA 4MBIA 5GZ9A 1K3AA 3GB2A 4ID7A 1F0QA 4FK6A 4RGJA 3UO5A 5HO7A 1YI6A 2YIRA 5M44A 3LW0A 3ORMA 4LFIA 4M3QA 4C2VA 4U3YA 1H0WA 3P79A 3FMJA 2FGIA 4GT3A 4L67A 4YHJA 3DFCB 3UIMA 1Q3DA 5EI2A 1KSWA 4ERKA 5AUUA 3JY0A 4U7ZA 2XK7A 5CU3A 3DZQA 3KMWA 4FG9A 4XRJA 1SYKA 3DV3A 5C8MA 4CRSA 5ANJA 3VUIA 4G9CA 4RVTA 2X9EA 5K9IA 4JVGA 3S95A 3EQDA 3Q96A 3UOLA 4AT3A 3C4EA 4RPVA 2YZAA 5IA5A 4QMVA 4X2NA 4KIKA 2V5QA 1NT2A 1OBDA 3U9CA 3A2CA 3NUSA 5CSPA 4QMPA 4KINA 2PMLX 3QCYA 3TT0A 1R1WA 2IVUA 2Q0NA 3VW6A 3ZM4A 2EXCX 3FC2A 1JOWB 3OEFX 5DBXA 2PVYA 2ERZE 4H3QA 5HU3A 2J0KA 1UU3A 2PVJA 3NRMA 4BCKA 4BKJA 2JDOA 3DCVA 3PJ8A 4WD5A 5DT0A 1U5QA 4BCFA 4ZZNA 5LOHA 1WZYA 5HNGA 3FYJX 3ERKA 3ZBFA 2OZAA 4XP3A 5LQFA 4JG8A 4O0TA 3KF4A 2I0HA 2BHHA 2E2BA 3ACJA 3KKVA 5CT0A 5EKOA 2PY3A 2Q83A 3EQHA 2XUUA 5TT7A 2J50A 3H10A 4D4YA 2HCKA 3EQGA 4QP9A 3F3TA 1MUOA 4DLIA 1W98A 4ZY5A 3CGFA 4WNOA 3CSVA 2XS0A 4LRMA 3E8NA 4E4MA 2UW8A 2VO3A 2ZOQA 5CS6A 4F7JA 4L9IA 4DT8A 3GENA 2OXXA 2O63A 5CU6A 3PWDA 5AUVA 2OI4X 1VYWA 4XNEA 3B8QA 1KE9A 4K77A 4Y5QA 5BQ0A 1Q24A 2WEIA 4MYGA 4YZCA 2BPMA 4BKYA 1KWPA 3LXNA 1BL7A 1U4DA 4ALUA 5L2SA 3W2PA 4F6SA 2B54A 2RFEA 3VWAA 3VJNA 4MWIA 4NM0A 3JVRA 4JIAA 3TTJA 3OY3A 2B9JA 3O17A 4DA5A 3MW1A 1Q41A 1W82A 1IR3A 2EVAA 3V3VA 4MVFA 1CMKE 2ITWA 3RAIA 2YIXA 3QHWA 2X1NA 1GZOA 2WOTA 3GCQA 5IH6A 4HNIA 4EYJA 1YHVA 3OS3A 4Z7GA 5HIBA 3MH1A 4ZJVA 3NFFB 2JITA 2OICA 3ZRKA 3P7CA 3F3VA 3OCTA 4YTHA 3ID6C 5KO1A 5CEPA 3K3JA 3GNIB 5DEYA 5M4IA 4BGQA 3LAUA 3KIOC 4YO6A 1URWA 4DEDA 3DAJA 4G5PA 4MNEB 5GZ8A 2QOQA 2OXDA 3U54A 3MDYA 3PIXA 4QYEA 5HG9A 4CZUA 2OO8X 4R7HA 4IVBA 4UALA 4UX9A 5IDNA 5DT3A 4DYMA 3VQHA 2ERKA 2B0QA 3QRIA 3BE9A 4NCTA 3BI6A 4BVUA 2J0MB 3WE4A 2UUEA 3L9NA 2JIUA 3FKLA 2YCRA 3PVBA 3ZDUA 4HGLA 5CAOA 2PL0A 5GZAA 5GNKA 3OTVA 5J5TA 1QCFA 3RK5A 1BI7A 1H26A 2YWVA 5IA1A 3P0MA 3HMIA 5AV0A 1JLUE 5T6KA 4Z55A 3QQLA 5FTGA 5DN3A 4ZY6A 3ZFXA 5EKNA 3HAMA 3FLNC 5K0XA 1ZRZA 4GK4A 4IAAA 2XNEA 3HZTA 4JNWA 3G6HA 1DAYA 3C13A 3R8PA 5L8KA 3N4TA 4IZAA 4LUEA 3U51A 3OWJA 3WIGA 4YZBA 1G3NA 4AN2A 4IDTA 2C5OA 4DGLC 2C6EA 1KV2A 3IPHA 2C5YA 3E87A 5CANA 3LLTA 4D5HA 3FZSA 3LFNA 3QCSA 4DTAA 2R0UA 3NW5A 4D2SA 4ZMFA 2YM5A 3MIYA 2E9UA 4AS0A 5HBJA 4L45A 1UWJA 3R1NA 2ZM4A 2R3KA 4IAYA 3OXZA 5L2IA 3E62A 3S1HA 2Y0AA 5KBQA 4C4GA 4O7YA 4RIXA 2RFDA 3LFCA 5M4FA 3FZTA 4BDDA 3Q53A 5E8SA 3COHA 4M67A 5KMMA 4TYHB 5JK3A 2GU8A 3IDPA 2RFSA 3UO4A 3PXYA 4FE2A 2AQXA 1L3RE 4ACGA 2R3JA 1JBPE 3KQ7A 3PUFC 3KRRA 2ZMDA 3DK7A 3ORKA 4OAVB 4YBKA 5KMLA 2R3RA 1K2PA 2VTRA 3F88A 5JGAA 2BMCA 3GP0A 3DY7A 4GIHA 3FHIA 2IJMA 3KRWA 3ZC5A 4YLLA 2GNFA 2YM6A 3KEXA 1OUKA 4J52A 4TPTA 4NM7A 5KNJA 2XBAA 1YXUA 2AC3A 4XG4A 3RPYA 3BHTA 4K18A 2ETMA 5EQPA 3TDWA 3GC8A 2BAQA 2PUNA 4RQKA 2J0JA 2DQ7X 5J7BA 3SQQA 3TUDA 4GVAA 2XK3A 2XEYA 2W99B 4HYUA 4I23A 3VN9A 2C0TA 2Y6MA 3WBLA 5DR6A 4EQCA 3R2YA 3DKFA 3G90X 4LGDA 3WARA 4AQKA 4HCTA 3DBEA 4J7BA 3U87A 3O2MA 5EM6A 4TW9A 4PTEA 3TIYA 5BMSA 4CFFA 3K2LA 5C27A 3GUBA 5CXHA 4GK2A 5IUHA 5HIDA 2WMUA 1OKVA 4CEGA 3BIZA 4CG8A 3NYNA 4GK3A 4A4OA 5L6WL 4BDFA 2BDFA 1KE8A 4AZTA 1Q99A 4AA4A 3WF5A 3QZGA 1DM2A 3FQEA 3B8RA 2GTMA 4JBVA 4FSNA 4E5BA 4RZWA 1PYEA 4EONA 4ZTMA 2OG8A 2BRBA 3QD2B 3D7TA 4O0YA 4RA5A 2IZTA 3KULA 4ZIMA 3ZXTA 1Q62A 4BC6A 2WU6A 1JKSA 3UP7A 1DAWA 4L3LA 1CDKA 5CU0A 4G17A 4RWKA 4AXAA 3R7OA 5EG3A 4FTTA 4BHZA 3LM0A 5IG1A 1UU9A 2IPXA 3FV8A 4PQNA 4PMTA 4YSMA 4ZLOA 3VONA 1ZZLA 3IKAA 3SC1A 4O7TA 5BYLA 3JYAA 4L00A 3CTQA 3KVXA 3PWYA 3R01A 1Q8WA 2AC5A 2BROA 2V7OA 3DTWA 3QTWA 4JOAA 1FQ1B 1H1SA 2R2PA 2IO6A 4JAIA 2CGUA 3I4BA 4C37A 1KE5A 3UNKA 1PXKA 3QA8A 4YSJA 4J99A 4ZP5A 4GS6A 2A2AA 2JAMA 5CZHA 4ANSA 2Z60A 3GFWA 4QMTA 3W2SA 4PP7A 3BL9A 4F6UA 5CAUA 4I4EA 2CKOA 1WBPA 3BEAA 3DB8A 4O2ZA 5AV4A 3DJ6A 1UV5A 3LCTA 4GYIA 3DBFA 3O8PA 4PPCA 4WT6A 5AUZA 4IQ6A 3DT1A 3POZA 3LXPA 2OH4A 3R9NA 2V0DA 2Y4IB 2ZMCA 2UVZA 3TTIA 3AG9A 3OWLA 1UVRA 3E93A 5IA4A 4E20A 3N4VA 3CQWA 2BZHB 2R3QA 3ZONA 5CZIA 3TNPC 4UMPA 4KKEA 4C57A 1YOJA 3MB7A 3TWJA 4ZSGA 4BGHA 4LRKA 3W8LA 3L9MA 3QBNA 4M7IA 4KKGA 1SVGA 1YDSE 5FLFA 1R0EA 3BQRA 4DEAA 3DXPA 3I79A 2ITUA 1U5RA 2HW7A 3FLWA 1JSUA 2BHEA 3PG3A 4GFOA 4BDCA 1PMUA 1CTPE 5I9UA 3V5QA 3HMMA 3Q4TA 3R02A 5FUTA 1IA9A 2IZSA 3EFLA 5I0BA 4BKZA 4L68A 4RX8A 4A9RA 4GYGA 4OLIA 3CEKA 3PA3A 3UDBA 5M53A 4LOOA 4YJVA 2WZJA 3OT8A 2UZNA 4W4XA 5HE2A 3OROA 2X81A 2VWVA 3R7VA 2W1DA 4QYFA 1G8JA 3HAVA 2CGVA 1XQZA 2WMTA 4MXAA 5CF8A 2G2FA 2P2HA 4C4JA 1OMWA 1XH5A 4AGUA 2BKZA 4P5ZA 3GGFA 4ZTQA 3F7ZA 4DEHA 3D5XA 2W4KA 3GCUA 2QU5A 4AW0A 3MY1A 1XH8A 3ZEPA 2BZKB 2CN8A 5AR4A 2G9XA 4JQ7A 3R8VA 2BRHA 3PVWA 1FBNA 1TKIA 5FM2A 4ZS4A 1H1PA 4YHFA 2VU3A 3MJ1A 4P90A 5CTPA 4QTEA 4UMUA 4XMOA 2C6DA 5LJJA 4ZSJA 3FMEA 3SGCA 3DNDA 1B38A 3LXLA 5C4LA 2XK9A 4RIYA 5FDXA 3MVMA 3EZRA 3V51A 3VBQA 4C58A 3QXOA 4KRDA 3ZXZA 5KMKA 4BIBA 2F2CB 4C8BA 3VIDA 5CEIA 4FTAA 4JLCA 5I9YA 4TYJA 4DN5A 5FBOA 4TT7A 2YDJA 3DJ7A 4XV1A 3QA0A 2IZRA 4RSSA 5DLSA 4FA2A 1WMKA 2UZEA 2WQEA 3UVPA 2R64A 3VUDA 5JN2A 1CKJA 4F08A 2W9FB 1M7NA 3PTGA 3CD8A 1Q5KA 3HL7A 3BYUA 1ZZ2A 5JQ5A 4C3RA 1KV1A 4ANLA 2GMXA 2HZ4A 4G2FA 4BCQA 3LMGA 5AP4A 4E8AA 4YURA 1G8SA 1R78A 1URCA 4S31A 3UYSA 2BILB 4IJPA 3GC7A 4K1BA 4L46A 4XOZA 3UIUA 2PUUA 4AOTA 4ENXA 3EFKA 3II5A 1OPLA 4UZDA 5AP3A 4CSVA 4E5AX 4W4VA 3IDCA 3MGYA 4O4BB 5EYCA 2G01A 4P4CA 5CENA 2WFYA 2WMSA 5D7VA 5H9BA 3ZSGA 3PE1A 3LQ8A 1W84A 1UA2A 1HCLA 2OK1A 3BHHA 3DOGA 4GH2A 4C3PA 4LM5A 4W8EA 2YAKA 3DTCA 3OOMA 3RALA 3WF7A 4AFEA 4PNIA 4WHZA 1OIQA 4EK8A 1DI8A 5HX8A 1OGUA 4LL0A 4FGRA 4CMUA 4FT0A 4E73A 1MQ4A 2R0IA 3FI2A 2QCSA 4G3FA 2YIQA 4CV8A 5KMIA 5BVEA 4ORKA