2QOCA

Human epha3 kinase domain, phosphorylated, amp-pnp bound structure
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
294
structure length
283
Chain Sequence
AKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 283
sequence length 294
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qocA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qocA01
3C0GA 4R7BA 3LQ8A 2IW9A 4EC9A 3A8XA 3KCKA 4ZY6A 5K9IA 1NT2A 5C4LA 4M8TA 3H4JA 4FODA 2DQ7X 2ITWA 3G0FA 3FZPA 2VWUA 5CQUA 1B38A 1YDRE 2GSFA 2JIUA 3P9JA 4KIPA 4ANNA 4D2RA 4ZSEA 4ZMFA 3F3VA 3QZFA 4QP1A 4OBOA 3ZEWA 4WSYA 1NA7A 4BBEA 3W32A 2VX0A 4O1PA 4UMUA 5A14A 5LJJA 2G1TA 2Y4IB 4O7WA 3EZVA 3G5DA 3WBLA 4AOJA 1ZZ2A 1Q62A 4ZZNA 2WTKC 4IC7A 3E8EA 1YHSA 5ICPA 2QOLA 2QQ7A 2E9OA 2P3GX 3MFSA 3V3VA 1YW2A 3HECA 2C6EA 2X81A 4FIGA 4PTEA 4KIOA 4TZRA 2VWBA 4FKSA 3CQEA 3LCDA 4CFMA 3WOWA 2PE2A 3PXYA 4KKHA 3KKVA 3BV3A 5KHWA 4RLKA 3FZOA 3IDBA 4PTCA 1PY5A 5DR6A 5FD2A 3TT0A 1PXPA 5I9WA 1BYGA 3ODYX 3IQ7A 3CLYA 2HCKA 4QPMA 1J1CA 1Y6AA 4RWKA 3M11A 4RMZA 3A7IA 4I0TA 4F1TA 5GZ9A 2GHGA 3D4QA 5L6PA 5HBJA 5AA8A 5AAGA 2C5VA 2GNFA 2ZB1A 2XIRA 4JG7A 3VUTA 3ZEPA 2QLUA 4H39A 3OXIA 2IZSA 3V5JA 4FK3A 4QQJA 2V0DA 2WGJA 4M67A 4C35A 2BHEA 3Q4UA 2EXMA 4F9CA 5JZJA 2CCHA 4FTNA 3QCXA 1NVQA 2CGWA 4P7EA 4RGJA 3O96A 4QT1A 4B8MA 2B4SB 5LVNA 3R71A 2C3IB 3KMUA 4FG8A 4RJ6A 5HIBA 4L45A 4CV8A 2OGVA 3BPRA 2YAKA 4QNYA 2XK3A 2IW8A 3WIKA 3U4WA 3DLSA 1P4OA 4G6NA 3HEGA 1KSWA 2QI8A 2HELA 4IVAA 3EH9A 5BPYA 5J5TA 4FT7A 3ZZWA 4LRMA 3CY2A 3DK6A 3VQHA 3AC4A 4G31A 4DFLA 4AW5A 2PMIA 5AR5A 5A4TA 4YC3A 5C1QB 4YMJA 4FC0A 3OUKA 4ZSJA 4EOSA 4EYMA 3POZA 4D28A 2R4BA 1ZAOA 3SAYA 3PE1A 3JVSA 3ZM4A 5I4NA 5IQDA 3NLBA 4RIXB 2XEYA 3PVBA 1Z5MA 4FT9A 4FL2A 3EN7A 1OIQA 3MV5A 1JSUA 4ZTNA 2ITQA 4PNIA 4YC8A 4IAKA 3K2LA 4U43A 3CY3A 5BVEA 3EQCA 5FTOA 4Q2AA 4GS6A 3TXOA 4U3ZA 3SOAA 3Q4TA 4F65A 4YZCA 4ONAA 2Q0NA 3SXFA 3W33A 5M53A 3GBZA 3NUPA 3QRUA 3VS0A 5FEDA 4F6UA 3IECA 3CEKA 2VUWA 4Z7GA 1JKTA 2BILB 2X2LA 4IC8A 3ZFYA 4ACHA 4D5HA 4J96A 4AUAA 3NUNA 1LEZA 2QKRA 5FLFA 1W98A 4DH1A 2QOQA 4BVUA 2XS0A 3HX4A 3BKBA 4F99A 4V05A 2Z7RA 4NM5A 1GAGA 1Y57A 3P86A 3UZTA 4BHNA 3JPVA 5HG8A 3HRBA 2JAMA 4E5AX 2YM7A 3HV4A 3IW7A 3FZTA 4RVLA 4CFWA 2QD9A 3P78A 2UZNA 3OTUA 5M07A 3CTHA 2CGUA 3OEFX 3TUDA 3OZ6A 4M69B 2YAAA 3C5UA 1BLXA 3Q52A 4X6RA 4XBRA 4DEBA 2VRXA 4UZDA 3FL4A 3QKLA 2PVMA 3LJ2A 1OPKA 3IW8A 4G6OA 1BL6A 3ANRA 3TIZA 4EH8A 4QMSA 1H26A 5BVOA 3QQHA 5K5XA 1YVJA 3MJ2A 4YO4A 3PDTA 2IW6A 4Z7HA 4L53A 5E8TA 3MPTA 4F7NA 3BYUA 1KE6A 3NW6A 4XYFA 3RK5A 5AV4A 3A7FA 1FOTA 4L00A 4Z3VA 4AACA 2ITVA 2BHHA 2OFVA 5EM7A 4FKGA 1ZRZA 3CQWA 1A9UA 4EQUA 3ITZA 5GINE 2XKCA 2GFSA 2Z8CA 3FBVA 3LVPA 2XF0A 4IFGA 5CU3A 5C27A 3UOHA 4UXQA 4UMPA 2XNPA 1PXJA 3VBTA 3DK7A 4TYGA 5B7VA 2C3JA 4QP4A 2PWLA 3GXLA 4IB0A 4PTGA 3CSVA 3E5AA 3O7LD 3FMJA 4J1RA 4NJ3A 3C13A 5F94A 2EVAA 2W0JA 2RF9A 1GOLA 2JDTA 3F88A 1SVHA 3D5WA 3U9CA 3LCOA 4HGLA 2E9VA 2OLCA 1YDSE 3NIEA 2E9UA 4RT7A 4IEBA 2FO0A 4A7CA 4F7LA 3TTJA 3VUIA 2PUUA 3SC1A 5HE3A 3M1SA 3Q2MA 3QGWA 2WOTA 3FLNC 2W4OA 3LE6A 1CM8A 4NZWB 3P1AA 1XBBA 4ASXA 4DGOA 3V8WA 3BHVA 2PVKA 1UWHA 1REKA 3EMGA 5D7VA 4D2VA 1PYXA 4ZTQA 2ITXA 3SDJA 4X3JA 2WZJA 4TYJA 4O1OA 1RW8A 4RVTA 4XV3A 5HNIX 2Y4IC 3UZRA 3MB6A 3DAEA 3BYVA 4JJRA 4YNOA 5CXZA 4ACGA 3TNHA 2Y9QA 1CSNA 2BPMA 5M44A 3KVWA 5AIRA 2OIQA 1OL1A 4BCHA 3NGAA 3QTXA 1UV5A 4L67A 3LFNA 2W1DA 1IRKA 2PY3A 3RJCA 3WF7A 3MJ1A 3UOKA 4MF1A 1OIRA 2PVLA 4X2JA 3RHXA 3PVGA 4J8MA 2C6OA 3ALOA 4MH7A 2W1EA 3I7CA 3ENHA 2XNEA 5E8XA 4AZEA 3S1HA 4AFJA 5KCVA 3MFRA 2YIWA 4D2PA 2WEIA 2BUJA 4D55A 1DM2A 1P5EA 4K0YA 4IE9A 4EH5A 4RJ5A 1J7UA 5L2IA 1OL6A 2XK8A 2F9GA 3HGKA 3UQGA 3TZ9A 5JKGA 4DA5A 5A4EA 4QO9A 3HMPA 5CVFA 3EN4A 3IW4A 3ZC5A 1W7HA 3FEGA 4D1ZA 1W82A 4Y8DA 1YWRA 4RZVA 3L8PA 3R9HA 3W18A 3V5WA 4IM2A 5DT0A 3E92A 3MH1A 2PMNX 3OMVA 3DA6A 4L42A 4G34A 3MFTA 5KZ0A 4LUDA 5LVMA 3A7JA 3DXQA 3FMEA 3G0EA 1H07A 4PRJA 4EH3A 4MX9A 4ANBA 5AUZA 3JR1A 4DINA 3QLGA 2DWBA 4D1XA 4USEA 4I1ZA 4IADA 4YHJA 1H27A 1Q24A 2XNNA 4I94A 4QTEA 4O7ZA 2JC6A 5DI1A 5BVFA 2J0LA 2WMXA 2OI4X 4USFA 1GY3A 5AP7A 2XK6A 3ENMA 4L3LA 2QR8A 4J52A 4FG9A 4ANSA 5HU3A 5AX3A 1M7NA 1PW2A 2GS2A 4AAAA 5L2TA 4QPSA 4E4MA 4K77A 5CY3A 3V04A 2W1HA 3FWQA 5CSVA 5FGKA 4E4XA 4G5PA 5KZIA 5EDRA 3GI3A 3OP5A 3BYMA 1APME 3R8PA 4F63A 4O0RA 5HBEA 1XO2B 3ZO3A 3KVXA 4OTIA 4AW2A 1WBOA 2PMLX 3EFJA 3FLSA 3BYSA 3KXNA 3BE2A 2Z7QA 3MA6A 5A54A 1UU9A 4PMTA 3AGLA 3LQ5A 4NWMA 5HBHA 2RFSA 4DH3A 1SM2A 4U45A 3C0HA 2RFNA 2GNJA 4JG8A 5AR2A 3UODA 3GQIA 5B2MA 3KREA 4PQNA 4PDOA 4XX9A 3V8TA 2GMXA 3KF7A 4C57A 4MYGA 2YDJA 2W9FB 4UMRA 3GC0A 5ETCA 3OWPA 2W1CA 2XKEA 3OEZA 2H96A 1U5QA 1H0WA 3CIKA 5GIOE 5HEZA 5BYLA 5BVKA 2X1NA 5M55A 4CT2A 2JEDA 4FSMA 2X7OA 4KS7A 5AR4A 1XWSA 3DXPA 2GS7A 4HGSA 2VU3A 3Q9ZA 1YDTE 3SRVB 3FZSA 3KN6A 2ZYBA 4B9DA 1PHKA 3V6SA 3NUUA 4I21A 3K3JA 3MIAA 3BHHA 4PUZA 4TWCA 3Q3BA 2V55A 5DRBA 2Y8OA 3QD3A 4EK8A 4JR7A 3N4VA 3RZFA 1HCLA 3AT3A 4QOXA 4K6ZA 4XG2A 5IKWA 3DJ7A 2JBOA 4AU8A 4O7SA 4GT3A 5CEMA 2OF4A 2PZYA 4ACMA 1P2AA 2RSVA 4YPSA 4FV1A 3VS2A 3DFCB 2P0CA 3NDMA 4BDIA 2J5EA 3QTIA 3IDPA 4XJ0A 4FTOA 4N6ZA 3TJCA 2YCSA 4MVFA 4YJUA 2YEXA 3WYXA 4AG8A 2NRUA 3ZM9A 4LOPA 3BGQA 3Q9XA 1R0PA 3KK9A 3VN9A 5LMBA 4QP2A 2PZIA 2WMUA 5FP6A 3TWJA 2ACXA 2ETRA 1RQQA 4EWQA 5HQ0A 3QQLA 4A9RA 4FV7A 5E7RA 2W06A 3CXWA 5I9ZA 2CCIA 3KRJA 4E4NA 3QD2B 4HVIA 2XM9A 3VJNA 4RX5A 3FI3A 3RI1A 3HA8A 4ZAUA 4LL0A 4CV9A 3BQCA 2PVYA 4FKWA 3QA0A 2VWZA 4KABA 4AOTA 2NP8A 3F7ZA 4GL9A 3PWYA 4U81A 2VO0A 1DI9A 4JOAA 3R22A 3NVKI 1O6YA 4G3CA 1M2QA 2R3KA 2X9EA 1JSTA 3VS5A 4YHTA 4Q5EA 2PTKA 3QCSA 3TUCA 1J3HA 1B6CB 3P23A 4G6LA 3BBWA 3PIYA 4NM7A 2J2IB 1WBPA 3QD4A 4FV4A 3KMMA 4IACA 2WD1A 3OFMA 4NM0A 4O22A 4OW8A 2XJ1A 4XP2A 1XBAA 3ZLXA 4AGWA 4ASZA 4IB5A 3BQRA 3QTQA 3W8QA 3QBNA 5IQHA 1ZARA 3KXGA 3RAHA 3TM0A 5GJDA 1XQZA 5J95A 5CNOA 4ERWA 1M7QA 5CWZA 1UWJA 2ZVAA 3Q9YA 4R77A 2BALA 1DAWA 3HUCA 3VBVA 3VHKA 3AC1A 3FMNA 4J71A 3RPOA 4KA3A 4RZWA 3E7OA 3RAKA 5K4JA 5ANDA 4X2NA 4FTRA 3JVRA 3WARA 5CEPA 3DDQA 1PXIA 1SVGA 4BF2A 3BELA 4QPAA 5AMNA 5LMKC 1Z9XA 3UTOA 4L6QA 5HOAA 3QYZA 4BBFA 1LUFA 3OWJA 4GFMA 2I40A 2O65A 3GVUA 3ORPA 1IA9A 1GJOA 4IAAA 3BCEA 4LOQA 4RIXA 3KULB 4YSMA 1NW1A 1XJDA 2GNLA 3R00A 4R7IA 2YM6A 4FSQA 4WNKA 4BZDA 3HLLA 4OTFA 3QF9A 4E6CA 4F6SA 4PDPA 3C51A 1UKHA 5BMSA 1OPLA 4FV3A 5FEQA 5CF4A 4D1SA 4CYIA 3G51A 3EQDA 3F7WA 4FKOA 4JBOA 4PF4A 5K5NA 1VJYA 4CMOA 4CRSA 2IZTA 3EN6A 5HX6A 4TYIA 2XCKA 4QP6A 5DMZA 4ZZMA 2PUIA 1OMWA 1Z57A 4ZTHA 4D2TA 2QG5A 1Y91A 4KIQA 4R5SA 3K5UA 1JBPE 2VD5A 3QYWA 5IDNA 1W8CA 5AP4A 4QMXA 5JZNA 3EL8A 1OPJA 2R3HA 3P5KA 5AP1A 3FYJX 3HV7A 1WVXA 4MKCA 4XV1A 4X2FA 2I0HA 2AC3A 2H8HA 2YDIA 4JQ7A 2J0IA 4TTHB 3P7CA 4U0IA 4UY9A 1Q8YA 3R1YA 4M0YA 4OTPA 4A07A 4YC6A 4PMSA 3HP5A 2EXEA 5HNGA 5EW9A 4LMUA 4KINA 4CFXA 5GNKA 3ZRLA 3NYVA 3CD3A 4JAJA 2YN8A 3NX8A 3OG7A 4KD1A 4TW9A 4DTKA 5DEWA 1OL7A 4Q9ZA 2EU9A 5KKRB 2WTWA 3ZRKA 2PZRA 3QZHA 4MXZA 4D4YA 3BWFA 3BHTA 4LYNA 4D0WA 2CHLA 4LRKA 4O38A 2BAKA 3GC7A 4EH2A 1OECA 5HTBA 2J4ZA 2X4ZA 3CKXA 2ZV7A 2HW7A 3PA5A 4I6QA 2X4FA 4I6BA 4XH6A 4BKZA 3TI1A 4GSBA 3DTCA 3ZLSA 4E6AA 3LHJA 3RK7A 4YTHA 3SV0A 3R7IA 2HYYA 3UIBA 4NKAA 4L7FA 4MHAA 1YI6A 5AWMA 2JDVA 3L8VA 5B2KA 3ZH8A 4CQGA 5KNJA 3UMWA 1LP4A 2F2CB 2R3GA 4HYSA 3RCDA 3ZMMA 4DLJA 4TT7A 4A4OA 2YACA 4J8NA 4O0XA 5BX0A 5IISA 5G6VA 3UC3A 2BDWA 1YHVA 3H9FA 5EDQA 5HIDA 3NEWA 4JXFA 2XIXA 1PF8A 5H3QA 4CTBA 4HVHA 4O82A 3VUKA 3QWJA 4G2FA 1FPUA 4TWNA 4C0TA 5CS6A 2F7EE 3A4OX 3TKUA 3U87A 4CFUA 3ORIA 3KU2A 4NL0A 1L8TA 1TQIA 2W4JA 4F0IA 4FT0A 2J6MA 3MIYA 1TQMA 3DBCA 3GUBA 4FGBA 1OZ1A 1Q4LA 4KBCA 4ZLZA 1WFCA 4XG3A 3VF9A 4CFVA 5FTQA 3LKMA 1BI8A 4FVQA 3CR0A 4GG5A 3UJGA 4RJ8A 5CU4A 2OFUA 3DKGA 1PMEA 3ERKA 3HVCA 5AV1A 4CKJA 5AUYA 1J7LA 2VNYA 4ACCA 1BUHA 4MF0A 1WVYA 3D0EA 4LRJA 3W2PA 5IQEA 4TYHA 1W84A 2VTRA 3OXZA 4PNKA 3D7ZA 4R78A 2VTQA 2WTDA 5JRSA 3E7VA 3NZ0A 3BU3A 3DTWA 5E91A 2ITUA 4XCUA 2WQOA 4BI2A 1VZOA 4I5PA 4HW7A 5BVDA 4FVPA 3ALNA 2YM5A 4IAIA 4CRLA 5EG3A 5LARA 2QHNA 5M08A 2XK7A 4FTCA 2EUFB 4TYEA 4GK2A 3MBLA 5L4QA 3F3UA 3DK3A 3SX9A 3PVUA 5IA4A 3W2RA 4EOLA 1SMHA 3BEAA 4PV0A 4NTTA 2HW6A 4FSWA 3E3BX 3NMUF 4YBKA 2DS1A 2GNIA 2PZ5A 3IONA 3KEXA 1SNXA 3PJ3A 1OL2A 2WOUA 3PZHA 3RP9A 4ZSLA 2QU6A 4MQ2A 5HI2A 1YXTA 2JFMA 3PG3A 4XV2A 4BICA 4JNWA 5GZAA 3NNVA 4GV1A 3EQRA 4QMLA 5HESA 4KKEA 5HNBA 4O0VA 1HOWA 3CTQA 4FNZA 4Z9LA 4ZOGA 3NUSA 1OKVA 2FYSA 4WRSA 4YP8A 2E9PA 4B0GA 2C68A 3HDNA 2WMTA 4XMOA 3COIA 3EFLA 4D2WA 2QOOA 5HD4A 1Y8GA 3B8RA 5KX8A 2JBPA 3FKOA 5TT7A 5CSHA 4GT5A 5CLPA 5L6WL 4IMYA 1XH4A 2EWAA 4CG9A 2VO6A 3NYNA 2RG6A 2JKMA 4UXLA 4IZAA 4E4LA 4AWIA 3MB7A 5J9YA 2XYNA 3LW0A 3PWDA 3QWKA 4RWLA 3CCNA 3QXOA 1MRUA 1P14A 1QMZA 2Y7JA 4QMOA 5HCYA 4XBUA 4K8AA 1IG1A 3L9NA 5DH3A 3RAIA 2YERA 3POOA 3BV2A 3QRTA 4KNBA 4Q5HA 3UOLA 1F3MC 5FTGA 3FLQA 5E8YA 3S0OA 4CFNA 1MQBA 3BE9A 3FMLA 3ORTA 3V6RA 2CNQA 5FWKK 3D9VA 4UMQA 2R3JA 2A4LA 5FG8A 5E8ZA 4A9SA 2REIA 4K9YA 3RPSA 3BZ3A 3C7QA 4LI5A 4U3YA 4I24A 4EK6A 1PXNA 2YCQA 3LFCA 4W8DA 3TZ8A 4I0SA 2I0EA 2BRMA 3KRRA 4NFNA 4C4FA 5BNJA 4FIIA 3U4UA 3ZTXA 4X2KA 4DGNA 4DG0E 4XRJA 3KB7A 3RAWA 4UMTA 4F1MA 5IG1A 2UZUE 4D58A 1H24A 2I1MA 2ZMCA 1FVRA 3PXKA 2BZIB 5FBNC 5TR6A 5JFSA 4RC3A 3SLSA 2BR1A 5BQ0A 5KUPA 3MSSA 1WBNA 3UQCA 4RC2A 2XYUA 1YOJA 3PXRA 5DIAA 3KF4A 4ZJIA 4I92A 2GTMA 4DH8A 4AA4A 4DEHA 5A4CA 4AZTA 2VTAA 3KQ7A 3ZHPC 3R9OA 2C5XA 2C6KA 3NIZA 1YWNA 3GFEA 3W2CA 4X7QA 5FXQA 5KKRC 3FZ1A 4FUYA 4UYNA 1FBNA 3R63A 3BU5A 3NNUA 4QP7A 2G01A 2YCRA 2QLQA 3QFVA 3V5PA 5IA0A 5JQ5A 3TUBA 3SRVA 3PLSA 1H1SA 3U9NA 4NSTA 4I4FA 5DWRA 3Q6UA 4UYAA 2XKFA 4L43A 1ZMVA 1W0XC 4EONA 3VBXA 4AE6A 3SXRA 5EHLA 3ZYAA 3TEIA 3MESA 4L68A 2WHBA 2FSLX 3EFWA 2OBJA 1QL6A 1WMKA 3AD6A 2P55A 4WKQA 2VTPA 3F69A 4F9AA 4JBPA 3GU4A 3ORNA 4ZXTA 3CQUA 3ID6C 3O8UA 2HWOA 2OXYA 3RINA 4ALWA 4BI0A 4DEEA 2VGPA 4JVGA 3FY0A 4I41A 2PULA 5A9UA 3FXXA 4RA5A 1FQ1B 4AX8A 3FC2A 3L8SA 5IMEA 4QP8A 3OCTA 3DBDA 4G9RA 4EUUA 4MBIA 2IWIA 4XEYA 4QQ5A 4WO5A 4L52A 4I6HA 3SQQA 2UZVA 1FINA 3EQHA 3JS2A 5CU0A 4L7SA 5HIEA 4JT3A 4FTJA 5KBRA 5IDPA 5LWMA 4CG8A 4CGAA 2WFYA 3Q60A 2RGPA 3PPJA 3PXQA 4EOQA 5EKNA 3DY7A 3ODZX 4IDVA 2Q0BA 5F20A 3FDNA 1YWVA 1Y8YA 3I60A 3MH3A 2SRCA 4OTQA 3UIMA 4HOKA 1XH9A 2F4JA 1H08A 4TNDA 2YWVA 4IXPA 3PSCA 4QMVA 4JIAA 2CSNA 3R1QA 2FGIA 3GGFA 2VTSA 4FSTA 5E92A 3H0ZA 4BCPA 3SHEA 2YIYA 4O7VA 4XNEA 3HV5A 3NCZA 4HVGA 1Q41A 1ZOHA 2HY0A 3DBFA 5JGAA 3ORZA 3PZEA 3HZTA 4NT4A 1FVVA 2Z7SA 3D7TA 5HU9A 2Y4PA 4BWPA 4Z16A 2UVYA 4XG8A 2B53A 2JDOA 3KRWA 4J99A 5TF9A 3MGYA 4GK3A 4D4RA 4MWIA 4FZFB 1ZXEA 4IAZA 4LGGA 4U80A 2WTVA 1S9JA 3CGOA 5DRDA 4BTJA 3WYYA 1JKKA 4PWNA 2B54A 2FSOX 4MK0A 3TTIA 2CGXA 3WZUA 2ZMDA 4EOOA 5GJGA 4GG7A 4LGDA 2X8DA 3R9RA 5I9YA 3I1AA 2YFXA 3A62A 5F1ZA 3GT8A 3QQFA 2CKEA 2ZDUA 4IX3A 3ROCA 1NVSA 2RIOA 2Y0AA 3UOJA 4DH7A 4AN9A 2WNTA 4FKLA 4E8AA 3KULA 5I5ZA 3MA3A 2XIKA 2BZHB 4IW0A 3N51A 4KB8A 2FSTX 3MTFA 4YJQA 4BTMA 2IPXA 3AC2A 1F5QA 4IFCA 4M14A 2E2BA 3OOMA 5FBOA 1UVRA 5AJQA 3EKNA 4A06A 3HRCA 4IAYA 4BDKA 4DE4A 5LWNA 3R1SA 4C37A 2B7AA 2YM3A 4ANMA 4CLIA 4PP7A 5CF5A 4CXAA 4M68A 4HNIA 3NNXA 5IF1A 4BGGA 5LVPA 3IW5A 4PX6A 3NNWA 3BBTB 2VTNA 2BIKB 2QG7A 4BWKA 5F9EA 4DFUA 2XNBA 1YXUA 4YLJA 2OWBA 3JUHA 4W9WA 4XP3A 5AR3A 4EBVA 4EBWA 3PJ2A 4FA2A 2QU5A 2YABA 2UW6A 4DT9A 4ASDA 2JDSA 2YWPA 3ORKA 2R3MA 2IJMA 3L9MA 4AZWA 3I7BA 4FIHA 3PG1A 4S34A 4E5BA 2BFXA 2PE0A 4GIIA 4ZP5A 4EHZA 5HG9A 2H6DA 4I6FA 5F95A 5FP5A 4ZK5A 2R0IA 5GJFA 3W1FA 2R3RA 2BTSA 4FVRA 5DGZA 4DC2A 4O7LA 2XMYA 3D94A 4BB4A 4A9YA 5BUIA 3DZOA 2C30A 4OBPA 5DT4A 1OGUA 1Q3WA 5L2WA 3DB8A 3R6XA 2BFYA 4FKRA 1U4DA 4RFYA 3ZBXA 2Q83A 3DOGA 3RMFA 1STCE 3JXWA 4OBQA 2OJFE 3PXZA 5JFWA 4NTSA 1OI9A 4GJ2A 3D2KA 4V04A 4QMUA 3VBWA 3QUEA 3FY2A 2VN9A 2OXDA 4X0MA 4PPCA 1Q3DA 3OW4A 2JIIA 3C4CA 5D10A 4FEXA 1CMKE 1H1WA 3AMBA 4FV0A 3QU0A 4G17A 3R7GA 4G3DA 2O3PA 2AYPA 3FQHA 5AUWA 4O7TA 5CZHA 4OUCA 3LPBA 2B9HA 4XLIA 5AP2A 3BWJA 4KSPA 4YJOA 1RE8A 5HE0A 3AT4A 4TYHB 3FHIA 4C4EA 3M42A 4JBQA 1TQPA 3A99A 4KBAA 5FM3A 2P4IA 4XG4A 2WQMA 3IGGA 2X9FA 3PSBA 4CYJA 3HMNA 2J5FA 2QO2A 2UZEA 5IMXA 5J1WA 4BI1A 4IWDA 1K3AA 3KRXA 4FF8A 4JI9A 2P33A 3T8OA 5E4HA 4WNPA 3ZOSA 3LFFA 5ETAA 3G33A 3VAPA 4G3GA 2XVDA 3FPQA 1S9IA 1K9AA 3MI9A 3R8ZA 2OJ9A 1PXKA 3PE2A 5T68A 1WZYA 2XBJA 4HZSA 4ANLA 5K4IA 4IX5A 5C01A 4AFEA 5IH4A 5FUTA 2ZOQA 4JDIA 2YJRA 3GENA 2C6IA 4D0XA 2GCDA 3OWKA 2DUVA 4AT3A 2B9IA 2WMBA 4WG3A 5M06A 2OIDA 5D11A 2OXXA 1YI3A 4I5CA 4W4XA 3EYHA 3PY3A 3I5NA 5ACBC 5EYCA 4IVBA 3LXLA 3DPKA 4BCOA 1H1RA 4QTBA 2NO3A 3KXZA 3AOXA 5EHYA 4IWOA 2OSCA 4Y72A 2JKQA 2VX3A 1GZNA 2XNOA 5IQBA 3V51A 4CFFA 1CDKA 4YZBA 3UYTA 2QONA 3TN8A 4FZ7A 1PMVA 3F6XA 4FG7A 3VS4A 4II5A 5E8SA 5KMNA 5CF6A 1KE5A 4RQKA 4YJNA 2OKRA 4JL9A 5DE2A 1R1WA 5M56A 2GHMA 3AG9A 4GFOA 4U8ZA 4WSQA 4NEUA 4EORA 4XOZA 4EL9A 1NVRA 5AX9A 5AP3A 2F2UA 4R8QA 5DOSA 2UW8A 2W4KA 3QUDA 3ZO4A 2DYLA 1F0QA 2QCSA 3BIZA 4FYNA 3W8LA 5LCJA 3FAAA 2P2HA 3E88A 1GIJA 3QCQA 1KOAA 3FLWA 5L2SA 2HXQA 3QALE 5M4CA 1MQ4A 2JGZA 4X2GA 3FZRA 4EKKA 2QVSE 2BCJA 5HKMA 4RQVA 3VBYA 2Z02A 2R7BA 4UWBA 1OITA 4HVDA 4DF3A 3DT1A 1H28A 4CZYB 4W4YA 5IQAA 5IQIA 3QHWA 4U40A 3S4QA 5IQFA 5TKDA 3UO5A 1Q5KA 3VS6A 2JKKA 4X21A 4AGDA 4IB3A 3PY0A 3COKA 2WMWA 2XJ0A 2PL0A 2OJIA 2XNGA 2WIHA 4LG4A 3A2CA 4XV9A 2ERZE 2QNJA 3S2PA 3EQFA 3VC4A 3GOPA 4PDYA 4MNFA 3VUMA 3PY1A 1Q8WA 3HA6A 5JN2A 2PSQA 4O91A 4IJ9A 4ZJJA 3DBQA 3QAME 3MS9A 4QQCA 2C0TA 2XZSA 4FSRA 5BMMA 3TNQB 1BMKA 5HCZA 5CAOA 4E6QA 3F3ZA 3TG1A 4GEOA 3WZEA 1V1KA 3I0OA 4M3QA 4ZIMA 1P4FA 2O5KA 4IM3A 4QMYA 4RJ3A 3PVWA 5AUXA 1A48A 3ZSIA 2XB7A 3Q96A 3P4KA 3RWQA 4AE9A 4HYHA 4MWHA 3GFWA 4HVSA 4C3FA 2VWXA 4IBMA 3L1SA 4GKIA 3WF8A 1OKWA 4UEUA 3FQSA 2BRGA 3IGOA 4O96A 4R5YA 5I9UA 3UC4A 5HTIA 3UQFA 4A9TA 4KUJA 4DTAA 2ITPA 4MBLA 3MY5A 4M12A 2PPQA 1MRYA 2F57A 4GKHA 4TWPA 4F64A 4RVMA 4FOCA 5ANKA 2C6MA 2UW4A 4IWQA 4R3RA 1T45A 2WIPA 3PTGA 5AM6A 4FEUA 4EOIA 3ORXA 3DZQA 5E1SA 4CZUA 2BKKA 3LLAA 1YXSA 4ZY5A 5AV2A 4DCEA 4QMNA 5A4QA 3DJ6A 3A8WA 4JQEA 4BHZA 4EK3A 4BDAA 3NWWA 4KSQA 3R01A 3BHYA 2PYWA 4RX9A 5J8IA 4FKIA 2X7GA 3HYHA 4U79A 2YM8A 4DEDA 3GCSA 3GNIB 5CSXA 5DG5A 4RIWB 2HAKA 3R9DA 4EWHA 3F3TA 3LJ0A 1M2PA 4Q9SA 5L2QA 2GPHA 4HPTE 3ATTA 3VULA 3OOGA 4LUEA 2CLXA 1U54B 4I5HA 4Z55A 4YTCA 4NJDA 2Z7LA 4FI1A 3AC5A 4QMWA 4APPA 4CTCA 3R2YA 5JGDA 3ZFXA 3ZO2A 4I93A 4NCTC 2ZV9A 1FGIA 2CLQA 3NW5A 4FV9A 1V0OA 3NUAA 1VYWA 4U7ZA 3W55A 4H36A 5H2UA 4A4XA 4MQ1A 4LV5A 4JS8A 2BZKB 4YGAA 4HPUE 3TKIA 4BTFA 2VGOA 5M4UA 1YQJA 1CKIA 5AUTA 4GVJA 3ROYA 3MVHA 4E20A 3EN9A 2ZM1A 4U41A 4O83A 1ZWSA 4U42A 2PVRA 4WG5A 3C4XA 5FDPA 4AGCA 3LXKA 4FX3A 4RIOA 4ACDA 3V5TA 4HGEA 3HMIA 1ZMUA 4ANOA 4EYJA 2CNUA 2X6DA 2YISA 3D7TB 5HVKA 5EQEA 3OHTA 1WCCA 3H9OA 4MBJA 4ZEGA 1ERKA 3UO4A 3BEGA 4IH8A 3VW8A 4FIEA 3ZDUA 4FTMA 3QLFA 4EC8A 4QP9A 3L9PA 2QHMA 4OT6A 2OZAA 4ARKA 5A46A 3QQUA 4D2SA 4QMZA 3ACJA 4G1WA 2A0CX 2HENA 3QTUA 2QOKA 3HP2A 3AD5A 4IX6A 3G6GA 2NRYA 3KK8A 4M97A 3PPKA 4WD5A 3UBDA 3QX4A 4FKPA 5CEKA 3ACKA 3EHAA 3MN3A 2WXVA 2CKPA 3UDBA 4EH4A 1UKIA 2YZLA 2C1BA 3VVHA 4B6LA 4UX9A 4QYGA 4F70A 3GCUA 5ANGA 4YJSA 3W2OA 4C8BA 3P08A 4I0RA 4XG6A 5G1XA 2JAVA 3GU8A 3PA4A 3LFBA 4HCUA 3C9WA 5HGIA 4BCQA 3DBEA 2IVSA 2C3LA 4QTCA 2J51A 3EYGA 3QXPA 1URCA 2QC6A 4FNXA 2BVAA 2XUUA 3CE3A 4G16A 5CEOA 1R78A 2ZV2A 3LLTA 4GIHA 3P79A 5DEYA 4MD9E 3H30A 4G9CA 4M7IA 4OT5A 4QTDA 3V8SA 4APCA 3ORLA 1ND4A 3R30A 3DGKA 2HK5A 4GH2A 4RFZA 4D5KA 1WAKA 1ZYSA 3O2MA 3WF9A 3ZSHA 4DGMA 4IB1A 1H4LA 1CTPE 2EB2A 4O0TA 5EM8A 3PPZA 3F2RA 3VW6A 2X0GA 3FUPA 5BYYA 3NPCA 4EH7A 4GFGA 1LPUA 5J9ZA 2BRHA 3NSZA 2XEZA 4WIHA 3LXNA 3R9NA 2FUMA 2B0QA 2YIQA 2Y6OA 3C50A 1O6KA 1ZYJA 1MRVA 4BCNA 1W83A 4H05A 4O6LA 4FOBA 4IQ6A 4BN1A 3E93A 2UV2A 3PP0A 4DEAA 5CASA 2B52A 2ZAZA 2ZM3A 3G6HA 3LFDA 4H58A 3VNTA 3RZBA 4BIDA 2V62A 4FSYA 5E8VA 3EFKA 3QTZA 2XBAA 5CT7A 3VO3A 3CGFA 2B9JA 2F7XE 3NUXA 2C5OA 3R0TA 2ITTA 4FL1A 3OCGA 3KXXA 4S31A 2RL5A 3CPBA 3WE4A 2VX1A 3Q4ZA 3GCQA 1M52A 4YHFA 2I6LA 4HCTA 4ASEA 4F7SA 2VZ6A 4DYMA 3O50A 4RBLA 5CSWA 1YRPA 4QYHA 3QRKA 4RIYA 1YOMA 3RVGA 4FTAA 3F5GA 2W1IA 3H0YA 5AP6A 4GYIA 3KXMA 2BZJA 4LQMA 4O2PA 5KMOA 5ITAA 3W16A 2GU8A 5AM7A 5M09A 2XM8A 3U6IA 2ZM4A 1R3CA 3F5UA 4FV2A 4AS0A 4BDDA 5KMMA 1KWPA 2P2IA 2XJ2A 3ZU7A 4CKRA 1G8AA 3FJQE 1R0EA 4BR3A 4K1BA 5AP0A 4FZ6A 4E5WA 3FLZA 2YIRA 4PL3A 4GK4A 4RPVA 5CEQA 3ZZEA 2PK9A 4GYGA 2R64A 4EK5A 2ZB0A 5HG7A 3E8NA 1FMOE 2VTHA 4G3FA 4K2RA 5C03A 3SW7A 2UZWE 4R3PA 3N4TA 1JKLA 4MXAA 1U5RA 4FKQA 3BI6A 2KTYA 2UZLA 3HL7A 3PJCA 4FTUA 4ITHA 5EM6A 4BCIA 2CNVA 4NU1A 4GW8A 4R6VA 1AQ1A 4RG0A 4NCTA 2X39A 3P0MA 1KOBA 3LM0A 3UZPA 4EHGA 2ITNA 3GC8A 2OJJA 4YO6A 1XH7A 5AIKA 3OCSA 4GT4A 5HE2A 4J97A 5EH0A 1Q97A 4AZSA 5M4IA 3OT3A 5L8LA 4Y85A 2HZIA 4WT6A 3O7LB 2YDKA 5KMIA 2W1GA 4FT5A 4JX3A 3K3IA 5IUHA 5KO1A 1OUYA 4BDBA 4TL0A 3H9RA 3SVVA 3Q2JA 4EI4A 2FB8A 3MPMA 3QRIA 2CKQA 5IUGA 3QZIA 3OW3A 3HRFA 5IZFA 5M51A 2OH0E 3S00A 4OAVB 4EOPA 1XHAA 5IA3A 3SGCA 2C6DA 4QMMA 3LOKA 3BGPA 2YZAA 4P4CA 5CF8A 3CPCA 5AADA 2QODA 4ID7A 2YA9A 2PZPA 5EQYA 4KAOA 1YXXA 3LQ3A 4FSUA 4W4VA 4RX7A 4DT8A 2C0OA 4EHVA 5JK3A 3F5PA 1RJBA 1XH8A 4F0FA 3I6UA 4QMPA 5CT0A 4EJNA 3D2IA 3BYOA 3TZMA 4XP0A 5FEEA 1PJKA 4EUTA 2JD5A 2XKDA 3TL8A 4QYFA 2JIVA 2GHLA 3GCVA 3IPHA 4JBVA 4F7JA 5J7HA 4YLLA 1SNUA 2WQBA 4L46A 2PUPA 5C9CA 2WO6A 2HXLA 3QZGA 3LMHA 2A2AA 2WMRA 3HMMA 3O51A 3TV4A 2BAQA 3BGZA 4C36A 4DHFA 4AGUA 3MPAA 3Q4CA 2FH9A 2C47A 4ZSAA 4BL1A 3GCPA 5HZNA 4HNFA 2WEVA 5L8KA 5DYJA 2HZ4A 3R7YA 3G90X 3MY0A 1I44A 3WF5A 1H1PA 2OW3A 3OY3A 3ZS5A 3GP0A 4M84A 5A6OA 3TNPC 5CANA 5D7AA 4IHPA 2GTNA 5GIPE 4U6RA 5J7BA 4TPTA 2IG7A 2WPAA 4IVCA 5B0XA 4C62A 4DFZE 4DITA 4FSZA 3PYYA 4F9YA 3C4FA 3ANQA 3GQLA 5ANEA 5H8BA 5EYMA 2NPQA 3OUNB 4D4SA 3KN5A 5IQCA 4ZTLA 2OJGA 3E8DA 4D9TA 3BLHA 2G9XA 3BU6A 4O7RA 4CQEA 5K3YA 1QPEA 3VUGA 2XRWA 4FIFA 2YIXA 3V01A 5L6OA 3Q6WA 3N9XA 4HYUA 4QRCA 4IDTA 3A7GA 1GZ8A 5JH6A 2WQNA 3LAUA 3T3UA 4O86A 3IG7A 3C5IA 3QRJA 5FDXA 2IVTA 1NY3A 1UU7A 3MVLA 1XBCA 3SXSA 2ZV8A 2BROA 4YZMA 5FQDC 1FVTA 4P90A 5C26A 4ERKA 3FMDA 4EQCA 4OTRA 3LFQA 4XRLA 3Q04A 5HD7A 2YM4A 2VTTA 4W9XA 3KL8A 2V7OA 5CTPA 5T6KA 3DKFA 4DGGA 2WMAA 4Y46A 2J0MB 4EZ5A 1LR4A 2X2MA 2QOHA 2VWWA 4PL5A 4YPDA 3UG1A 2GS6A 2IVUA 2WMQA 4PDSA 4UWCA 4BDHA 3OBJA 3VS7A 3RTPA 1JOWB 3RHKA 3D14A 1XH6A 5CZIA 2W7XA 4JQ8A 4WHZA 3QUPA 5DBXA 4CMTA 4O0UA 3AC8A 2X2KA 5DHJA 4BDCA 4FKTA 5AUUA 4EH9A 4RWIA 4J53A 3QKMA 3EZRA 2WTJA 3G9LX 4N70A 5J5SA 5K0XA 4M0ZA 2I0VA 5K0KA 2EXCX 4UALA 1Y6BA 2C6TA 4JIKA 5EI6A 2V7AA 5DR9A 3DQWA 4AZVA 5E90A 5AUVA 5HX8A 3NCGA 2C69A 3DV3A 2NNWB 2WU7A 4B7TA 3KC3A 4L01A 5JSMA 4I4EA 3U6HA 3DAJA 5I9XA 3U6JA 2R0UA 5I3OA 5CSPA 2YLFA 2VO3A 2R3IA 2XK9A 4FGRA 2UVZA 4RIWA 2JLDA 4TRLA 2W96B 5E8WA 3I5ZA 5TOZA 4FV6A 4XG7A 1U54A 4PMMA 3UE4A 2CDZA 3OY1A 4D4VA 4EJ7A 5A6NA 4OTDA 1LEWA 3WZKA 2OZAB 1GIHA 3RM6A 2ITOA 3AXWA 3THBA 2VTOA 4TY1A 4WNOA 3UP2A 4YURA 3LFEA 1BL7A 3ULZA 1WVWA 4XLVA 3NS9A 3UVQA 5IA1A 3OVVA 4YR8A 5CYIA 2I0YA 4K11A 4P5QA 3C4ZA 2W5BA 5HLNA 5AR7A 5J1VA 2PUNA 3C1XA 4OGRA 4BWXA 3DU8A 4M13A 5CAQA 2QR7A 3UP7A 1H25A 4UB7A 4C2VA 3Q53A 5JQ8A 5HE1A 4GJ3A 3JY9A 4GMYA 4N4SA 4LGHA 3PFQA 3RWPA 3UGCA 1AGWA 2B9FA 2VTLA 3FV8A 4HYIA 3CC6A 4FTKA 5HICA 3TDVA 1YHWA 3FMMA 5CAUA 4DN5A 4H1MA 1TVOA 3UPZA 2VO7A 4BCJA 2HWPA 4C02A 2WAJA 3DQXA 2R3PA 2WB8A 2O63A 3FSKA 3VF8A 1PKGA 4AT4A 3G15A 4O7NA 5CX9A 3D5UA 4H3PA 3ZO1A 2R7IA 3KRLA 1JAMA 2VV9A 1IR3A 4MTAA 4BCFA 3A61A 5D41A 1Q8TA 4IAFA 3REPA 3VQUA 4WG4A 3ET7A 2H34A 1Q61A 1H0VA 1OIYA 2IO6A 2LAVA 3R1NA 3FHRA 4A9UA 3LIJA 5TE0A 3QQJA 3T3VA 4CZTA 1XR1A 4KWPA 2QOIA 5IH5A 3KMWA 1B39A 3UPXA 4RA4A 4X3FC 2UW5A 4WA9A 2OICA 4BYIA 4OTGA 3GC9A 4BYJA 4JLCA 5HCXA 2E9NA 3TJDA 2W1ZA 1OUKA 3RNYA 2I7QA 5EW8A 3D83A 5BVNA 1R39A 3FLYA 5IA2A 3BHUA 2HZNA 3EQIA 4NK9A 4AN3A 3DXNA 2QO9A 3E63A 2RKUA 3KFAA 4FV8A 3AQVA 4G5JA 4W8EA 2GNGA 3O8PA 1OL5A 3QCYA 4BDGA 4BY9E 3CP9A 2WTCA 2BDJA 3E8CA 3WE8A 4DFBA 4WRGA 4XG9A 3GU6A 1ZY4A 3C4EA 4OTHA 3Q9WA 4L8MA 2PVHA 4ZTMA 4CCUA 3I4BA 2HY81 3OROA 3VS1A 5HLPA 3MFUA 3HKOA 4FEQA 4HJOA 2CPKE 4LFIA 5CEIA 1KV1A 3R28A 5CI7A 2J9MA 2X8EA 3I6WA 2G2HA 2ETMA 3RGFA 4C34A 3CS9A 2AUHA 3E87A 4TXCA 4LL5A 4EZ3A 3ORMA 4RIYB 4DG3E 3F2NA 4N0SA 5CI6A 2UW3A 4S2ZA 4O0YA 5HG5A 4YJRA 5C8NA 2X7FA 2R9SA 4ITIA 2F49A 3PSDA 1E1XA 3EN5A 4C59A 4IZYA 3VIDA 1VYZA 1JWHA 5ANOA 1JPAA 2BRBA 2OG8A 3NAYA 4FTQA 4HCVA 4Y5HA 3U51A 1XKKA 5DNRA 1GNGA 4BIEA 4JG6A 2W05A 4PPBA 4GUEA 5H8GA 4ALUA 1IA8A 2VWYA 4KRDA 1Q8ZA 3SA0A 2JKOA 3DS6A 3OT8A 4YTIA 4FTIA 4BDFA 2VWVA 1H8FA 3LFSA 2AC5A 2R3QA 2JITA 3OWLA 2CN5A 4BGQA 4DTBA 2FA2A 3E3PA 3QD0A 4XS2A 3EKKA 2XNMA 1REJA 3CD8A 4DEGA 4FZDB 3RM7A 2ERKA 3W2QA 3A60A 2PHKA 3GB2A 4QNAA 4YJVA 5L8JA 3UNKA 4CVAA 2XRUA 4JAIA 3ZDIA 4TNBA 5LXMA 2Z2WA 2ZDTA 1GZOA 1HCKA 3E64A 3DKCA 5ANIA 1VEBA 3EL7A 3ZXZA 2R3OA 4O7YA 4O84A 1RDQE 4QP3A 1J7IA 4S32A 2F7ZE 3ZBFA 1U46A 3LM5A 5IH6A 1TKIA 4AP7A 4CEGA 2BTRA 5HLWA 4L3PA 4ZS0A 1O9UA 1PXLA 1PYEA 1MP8A 4BKYA 4F09A 4LM5A 1OKYA 1UA2A 2C1AA 5D1JA 3AMAA 1ZY5A 3WIGA 3T9IA 1M2RA 3Q32A 5LQFA 5HVJA 2HOGA 3ETAA 4MD8E 5ACKA 4UWYA 1PKDA 3R02A 2J0JA 1WBSA 2A19B 4NKSA 5F4NA 1CKPA 2C0IA 5DR2A 4AA0A 3OBGA 4E73A 2W17A 3UYSA 3IOKA 3C4WA 4KS8A 5IPJA 2IN6A 3A7HA 4PMPA 1PMNA 3WZJA 5KMKA 4O81A 4J7BA 5IQGA 3W2SA 3IO7A 5CNNA 4IWPA 3DJ5A 1XH5A 3HNGA 4YUQA 5HVYA 4YSJA 2UW9A 4MXYA 4E26A 3QKKA 3ZLWA 1SVEA 3K5VA 4FE2A 1YOLA 3ELJA 4RJ7A 2IZUA 3AMYA 4R7HA 3UVRA 4O21A 3GOKA 3P7BA 3PP1A 3R8LA 3L8XA 3RPYA 5J9LA 5EYKA 4C2WA 3FQEA 3QQGA 3QTWA 3SW4A 4S30A 4EK4A 5LVOA 2UW0A 3I81A 3V5LA 2YHVA 1Q99A 1GZKA 4JRVA 2XA4A 1OBGA 2O64A 1PRYA 3E62A 4ANQA 4ZJVA 4F08A 1I09A 1QPDA 2GNHA 4QTAA 3G9NA 3NYOA 4ZLYA 4OTWA 2WTIA 5AAFA 5C8MA 4RFMA 3ZONA 4IIRA 3TACA 4X3FA 2W9ZB 1FMKA 4WOVA 5IU2A 4BKJA 2BRNA 1OVEA 2JFLA 3MTLA 3DB6A 3BX5A 3NW7A 2IVVA 4BRXA 4F9WA 4AOIA 3MVMA 4MXXA 4U44A 4P5ZA 3TV6A 4OAUC 4ZTRA 3LJ1A 3L9LA 2XCHA 3MDYA 4KRCA 3RBWA 4YBJA 4RX8A 4AQCA 3Q5IA 3WI6A 3WILA 4F1OA 1A06A 4V0GB 5CAVA 3RK9A 4BFMA 4DLIA 3NVMB 3TCPA 2GDOA 3F61A 1G3NA 3MH0A 4NW5A 3KXHA 2G2FA 4JDJA 5CQWA 3RPRA 5JFXA 3IW6A 3OC1A 5IEYA 4NYEA 4C4HA 2VNWA 3I79A 4IX4A 5IEXA 2V5QA 3F5XA 3DCVA 5DLSA 2G2IA 3ZFMA 4F6WA 1AD5A 5EDPA 4O2ZA 1KE8A 3ZSGA 4MNEB 2R3FA 3QL8A 3B2WA 4FT3A 4CSVA 4EZ7A 3QTRA 4FKVA 2V22A 4F0GA 1OM1A 3HUBA 3RKBA 1BKXA 4BZNA 3B8QA 4P2KA 4PPAA 4I20A 4AXAA 1DAYA 3QGYA 2QOCA 3RCJA 3HMOA 4NIFA 3W10A 4FV5A 4QYYA 3VUHA 3LXPA 2VTJA 1KUTA 3QC9A 1JVPP 4CKIA 2CGVA 2BMCA 2YITA 4USDA 3UVPA 4Y73A 1J91A 4NW6A 4RJ4A 3NYXA 5CAPA 4K18A 5AR8A 4B99A 5B2LA 2B1PA 2J50A 2VAGA 3MWUA 1FGKA 4C4GA 4RLLA 5DVRA 5EK7A 5M4FA 2O2UA 4ITJA 4O6EA 4TN6A 5EOBA 5CALA 4EHEA 1DI8A 3CTJA 4KIKA 4AA5A 3PJ1A 4R1YA 3UIXA 2UW7A 3F66A 2WMVA 4L44A 5GHVA 3ZLYA 4UV0A 3CJFA 5E1EA 3JYAA 1V0BA 1J1BA 4AZFA 2C6LA 4EEVA 4NUSA 1ZYCA 4XOYA 5KMLA 1OIUA 2OZOA 1PXOA 5FM2A 1O6LA 2QOBA 3PLAE 3DKOA 3R7EA 2O8YA 2ETKA 3I0QA 3RPVA 3EQPA 4B8LA 2W1FA 4C61A 4WBBB 2J0KA 4C3PA 2CN8A 5KMJA 4QMQA 3QTSA 3UMXA 4BGHA 4HZRA 5H8EA 3FKNA 4DEIA 3HV3A 3O17A 4BCKA 3OS3A 4ZLOA 2UVXA 2XH5A 3R8VA 4BCGA 3SD0A 5AFVA 4FMQA 3HDMA 4AT5A 5J79A 2GQRA 1V0PA 2HZ0A 2O0UA 2FSMX 4FKUA 4YNEA 4PL4A 5EOLA 3O71A 5AA9A 3VJOA 4QMTA 4K33A 5CXHA 5AV3A 3VS3A 1WBVA 5LVLA 4BC6A 2C4GA 3KY2A 2UZTA 4W4WA 5EFQA 5IUIA 2OF2A 1JSVA 5L3AA 4N57A 2PVFA 2OIBA 3OXTA 2OO8X 3EJ1A 4G3EA 1K2PA 3TNWA 4DG2E 5EHOA 1IAJA 1OKZA 2C5YA 3PIXA 1M14A 5D9HA 4BTKA 4ZMEA 1UNGA 4YJPA 1DS5A 1E1VA 4C33A 4TWOA 5AV0A 3S95A 3GU5A 4ENXA 4OLIA 5EI8A 2W5HA 4YZNA 2W99B 4NM3A 4IJPA 3RNIA 2OH4A 1H00A 2R2PA 2Y6MA 3O0GA 4IVDA 5CENA 3DDPA 2RFDA 5LMAA 4CLJA 3AC3A 2PE1A 3OCBA 4C4IA 4GU6A 2LGCA 4FBXA 3FL5A 3ULIA 2H9VA 3K54A 4F4PA 4Y83A 3BLRA 2PVNA 1ZZLA 3IS5A 4EKLA 4MXOA 3VHEA 2IZRA 3VUDA 2GQSA 4FZAB 1JLUE 2OK1A 3F9NA 4BZOA 2BKZA 5ETIA 1T46A 5I9VA 4DCAA 4M15A 1JKSA 1YI4A 4B4LA 4M66A 1BX6A 3F3WA 3OD6X 5EI2A 4FR4A 4A4LA 3FSFA 2X8IA 3MYGA 3U55A 5ANJA 1UNHA 3LCSA 2UZBA 5C8KA 2RFEA 4PY1A 3ZXTA 2YCFA 4C58A 2UZOA 3C0IA 4L3JA 5TO8A 1L3RE 4WUAA 2QOFA 2PMOX 2QO7A 3CJGA 3MW1A 4FEWA 1JQHA 1OBDA 1NXKA 1KV2A 2CMWA 1VR2A 3ZRMA 4F9BA 4C4JA 3TV7A 4X6QC 5JRQA 5M57A 3DLZA 3F2AA 5CVGA 4UBAA 5BYZA 4EOKA 3NR9A 2CKOA 2ONLC 4CD0A 5DA3A 4XHKB 3CBLA 1WBWA 2CJMA 2R5TA 2XP2A 4FUXA 4QYEA 5CVHA 4IZ5A 5J87A 5I3RA 4ZZOA 4E7WA 3MH2A 5BUJA 3VRZA 3ZCLA 4FIJA 3PJ8A 5LOHA 1CKJA 4N6YA 4C7TA 2J90A 3R73A 5CU2A 5A3XA 4U5JA 2WKMA 3R7OA 2XK4A 4V01A 3TIYA 5JEBA 4FICA 4MXCA 1GIIA 5H9BA 4AW0A 2YJSA 3V5QA 2A1AB 5I0BA 5EW3A 3QHRA 3O8TA 3FE3A 4CT1A 4EOMA 5AEPA 4DBXA 4I23A 1QCFA 4UN0C 3FMKA 1MUOA 3IK3A 3UO6A 3UNJA 3D15A 4M69A 5KHXA 5E9EA 3HV6A 4ZTSA 4AW1A 4J95A 1URWA 5JGBA 1ZOGA 1ATPE 1EH4A 2VTMA 4J98A 4RWJA 2EB3A 2WTKB 3LMIA 3LCTA 2WU6A 4U97A 3MY1A 5HTCA 3DFAA 4EQMA 5FXSA 3EWHA 3ZUUA 2C5NA 3N4UA 1QPJA 2Z60A 2R3LA 3D5XA 3DNDA 3PUPA 4I3ZA 4MEDA 2VTIA 4I22A 4RSSA 4EH6A 1WBTA 4MCVA 2G15A 3ZC6A 5BUEA 3SG8A 1BI7A 3QX2A 1ZOEA 3EQBA 5EYDA 4BCMA 3BRBA 4DFYA 4I5MA 4QD6A 3FXWA 5EQPA 3H10A 4C3RA 2HIWA 4UZHA 4DFXE 4ORKA 3OF0A 4FNYA 4JX7A 4O0SA 4WBOA 4LMNA 5EKOA 5IA5A 4FYOA 3M2WA 2ZJWA 1IAHA 4MAOA 1U59A 4MD7E 3GU7A 4GUBA 2ITZA 5D12A 4AF3A 3OTVA 5C4KA 5DT3A 2BIYA 4R1VA 5GZ8A 1UU8A 3ZUTA 4OR5A 3R8UA 4ENYA 4E6DA 4O27B 3IDCA 3KGAA 1G5SA 3ZUVA 2OU7A 4YZ9A 3KCFA 3A4PA 4JDHA 4CMUA 2UZDA 1ZYDA 2PVJA 3EB0A 1ZLTA 5FRIA 2WQEA 2J7TA 3NRMA 2WMSA 4KBKA 3LFAA 3FI4A 3FYKX 4GCJA 3IOPA 4JDKA 4WUNA 3SG9A 1H01A 3EOCA 3P7AA 2ITYA 2XIZA 3DAKA 4RC4A 4Y95A 5T3QA 3UG2A 4ZY4A 3II5A 5HO8A 4E93A 4WNMA 4YLKA 3FKLA 4NFMA 3SOCA 3AT2A 2VWIA 3AGMA 5DPVA 3EIDA 3VRYA 2R3NA 3R04A 1PMUA 5BVWA 3R8MA 3LMGA 4E3CA 3T9TA 3QQKA 1UU3A 4O0WA 2B55A 4S33A 3HAMA 3PXFA 4JR3A 1IASA 3COHA 3IKAA 3UIUA 3NAXA 4FL3A 5JFVA 3G2FA 4IZ7A 4U9AA 3U54A 5JMSA 1Q8UA 4NH1A 1KE9A 4C38A 2QKWB 4ZSGA 5DFPA 5HHWA 4X3FB 4D9UA 3R83A 4TKSA 4BIBA 5KBQA 4YJTA 3R21A 4DGLC 3DNEA 2UUEA 3PA3A 3RALA 4FK6A 5KE0A 3VBQA 4DH5A 3FMHA 5LCKA 4CNHA 1KE7A 4BDEA 1QPCA 5IEVA 5LMKA 1PXMA 1SZMA 2BAJA 2KULA 3LZBA 3MVJA 1ZYLA 4L9IA 3WF6A 1SYKA 4HGTA 1IEPA 3Q5ZA 3R7VA 4DBNA 4E1ZA 3F82A 4H3BA 5HO6A 3SKCA 2C3KA 4FKJA 4IANA 5EM5A 3R2BA 3JY0A 3H3CA 4R3CA 4FTTA 3R7UA 3TZ7A 2QURA 3WZDA 3S3IA 2WELA 4YTFA 5AAEA 4FTLA 2A27A 4DFNA 5ETFA 2ONLA 4YU2A 4EOJA 1YKRA 5HORA 3QA8A 3TNIA 4LOOA 4BDJA 3ATSA 3PIZA 2JDRA 3COMA 5CU6A 4NIFB 4CCBA 3VWAA 2GQGA 4GU9A 4RVKA 3TDWA 2RG5A 1OB3A 4H3QA 4DAWA 4ALVA 4GRBA 4H1JA 2PU8A 3FI8A 2FVDA 3B2TA 3O23A 2ESMA 5FXRA 3HAVA 4BBMA 5JT2A 3NUYA 5DN3A 3PRIA 1G8SA 4V0GA 3LCKA 1YXVA 3PRFA 1JNKA 3TKHA 1H1QA 4XUFA 1ZMWA 4YZDA 3FPMA 1M17A 4RRVA 4Y5QA 2BDFA 2W5AA 3FC1X 4PP9A 5A4LA 5HO7A 2YLEA 3AD4A 3D5VA 3FI2A 4KIKB 3BLQA 4LV8A 3KA0A 5E8UA 3UNZA 1UNLA 4QQTA 2GFCA 3U8WA 4KKGA 4ZS4A 4FEVA 4MNEA 4FNWA 4AN2A 1X8BA 3QC4A 4GVAA 3EQGA 3CKWA 4IM0A 4JRNA 1E9HA 5AP5A 2XIYA 4FSNA 2X6EA 3FXZA 3GEQA
chains in the Genus database with same CATH superfamily
3C0GA 4R7BA 3LQ8A 2IW9A 4EC9A 3A8XA 3KCKA 4ZY6A 5K9IA 1NT2A 5C4LA 4M8TA 3H4JA 4FODA 2DQ7X 2ITWA 3G0FA 3FZPA 2VWUA 5CQUA 1B38A 1YDRE 2GSFA 2JIUA 3P9JA 4KIPA 4ANNA 4D2RA 4ZSEA 4ZMFA 3F3VA 3QZFA 4QP1A 4OBOA 3ZEWA 4WSYA 1NA7A 4BBEA 3W32A 2VX0A 4O1PA 4UMUA 5A14A 5LJJA 2G1TA 2Y4IB 4O7WA 3EZVA 3G5DA 3WBLA 4AOJA 1ZZ2A 1Q62A 4ZZNA 2WTKC 4IC7A 3E8EA 1YHSA 5ICPA 2QOLA 2QQ7A 2E9OA 2P3GX 3MFSA 3V3VA 1YW2A 3HECA 2C6EA 2X81A 4FIGA 4PTEA 4KIOA 4TZRA 2VWBA 4FKSA 3CQEA 3LCDA 4CFMA 3WOWA 2PE2A 3PXYA 4KKHA 3KKVA 3BV3A 5KHWA 4RLKA 3FZOA 3IDBA 4PTCA 1PY5A 5DR6A 5FD2A 3TT0A 1PXPA 5I9WA 1BYGA 3ODYX 3IQ7A 3CLYA 3W0PA 2HCKA 4QPMA 1J1CA 1Y6AA 4RWKA 3M11A 4RMZA 3A7IA 4I0TA 4F1TA 5GZ9A 2GHGA 3D4QA 5L6PA 5HBJA 5AA8A 5AAGA 2C5VA 2GNFA 2ZB1A 2XIRA 4DHJA 4JG7A 3VUTA 3ZEPA 2QLUA 4H39A 3OXIA 2IZSA 3PUFC 3V5JA 4FK3A 4QQJA 2V0DA 2WGJA 4M67A 4C35A 2BHEA 3Q4UA 2EXMA 4F9CA 5JZJA 2CCHA 4FTNA 3QCXA 1NVQA 2CGWA 4P7EA 4RGJA 3O96A 4QT1A 4B8MA 2B4SB 5LVNA 3R71A 2C3IB 3KMUA 4FG8A 4RJ6A 5HIBA 4L45A 4CV8A 2OGVA 3BPRA 2YAKA 4QNYA 2XK3A 2IW8A 3WIKA 3U4WA 3DLSA 1OGYA 1P4OA 4G6NA 3HEGA 1KSWA 2QI8A 2HELA 4IVAA 3EH9A 5BPYA 5J5TA 4FT7A 3ZZWA 4LRMA 3CY2A 3DK6A 3VQHA 3AC4A 4G31A 4DFLA 4AW5A 2PMIA 5AR5A 5A4TA 4YC3A 5C1QB 4YMJA 4FC0A 3OUKA 4ZSJA 4EOSA 4EYMA 3POZA 4D28A 2R4BA 1ZAOA 3SAYA 3PE1A 3JVSA 3ZM4A 5I4NA 5IQDA 3NLBA 4RIXB 2XEYA 3PVBA 1Z5MA 4FT9A 4FL2A 3EN7A 1OIQA 3MV5A 1JSUA 4ZTNA 2ITQA 4PNIA 4YC8A 4IAKA 3K2LA 4U43A 3CY3A 5BVEA 2XALA 3EQCA 5FTOA 4Q2AA 4GS6A 3TXOA 4U3ZA 3SOAA 3Q4TA 4F65A 3PFYA 4YZCA 4ONAA 2Q0NA 3SXFA 3W33A 5M53A 3GBZA 3NUPA 3QRUA 3VS0A 5FEDA 4F6UA 3IECA 3CEKA 2VUWA 4Z7GA 1JKTA 2BILB 2X2LA 4IC8A 3ZFYA 4ACHA 4D5HA 4J96A 4AUAA 3NUNA 1LEZA 2QKRA 5FLFA 1W98A 4DH1A 2QOQA 2X0PA 4BVUA 2XS0A 3HX4A 3BKBA 4F99A 4V05A 2Z7RA 2A98A 1GAGA 4NM5A 1Y57A 3P86A 3UZTA 4BHNA 3JPVA 5HG8A 3HRBA 2JAMA 4E5AX 2YM7A 3HV4A 3IW7A 3FZTA 4RVLA 4CFWA 2QD9A 3P78A 2UZNA 3OTUA 5M07A 3CTHA 2CGUA 3OEFX 3TUDA 3OZ6A 4M69B 2YAAA 3C5UA 1BLXA 3Q52A 4X6RA 4XBRA 4DEBA 2VRXA 4UZDA 3FL4A 3QKLA 2PVMA 3LJ2A 1OPKA 3IW8A 4G6OA 1BL6A 3ANRA 3TIZA 4EH8A 4QMSA 1H26A 5BVOA 3QQHA 5K5XA 1YVJA 3MJ2A 4YO4A 3PDTA 2IW6A 4Z7HA 4L53A 4MUQA 5E8TA 3MPTA 4F7NA 3BYUA 1KE6A 3NW6A 4XYFA 3RK5A 5AV4A 3A7FA 1FOTA 4L00A 4Z3VA 4AACA 2ITVA 2BHHA 2OFVA 5EM7A 4FKGA 1ZRZA 3CQWA 1A9UA 4EQUA 1ST0A 3ITZA 5GINE 2XKCA 2GFSA 2Z8CA 3FBVA 3LVPA 2XF0A 4IFGA 5CU3A 5C27A 3UOHA 4UXQA 4UMPA 2XNPA 1PXJA 3VBTA 3DK7A 4TYGA 5B7VA 2C3JA 4QP4A 2PWLA 3GXLA 4IB0A 4PTGA 3CSVA 3E5AA 3O7LD 3FMJA 4J1RA 4NJ3A 3C13A 5F94A 2EVAA 2W0JA 2RF9A 1GOLA 2JDTA 3F88A 1SVHA 3D5WA 3U9CA 3LCOA 4HGLA 2E9VA 2OLCA 1YDSE 3NIEA 2E9UA 4RT7A 4IEBA 2FO0A 4A7CA 4F7LA 2XAOA 3TTJA 3VUIA 3BL7A 2PUUA 3SC1A 5HE3A 3M1SA 3Q2MA 3QGWA 2WOTA 3FLNC 2W4OA 3LE6A 1CM8A 4NZWB 3P1AA 1XBBA 4ASXA 4DGOA 3V8WA 3BHVA 2PVKA 1UWHA 1REKA 3EMGA 5D7VA 4D2VA 1PYXA 4ZTQA 2ITXA 3SDJA 4X3JA 2WZJA 4TYJA 4O1OA 1RW8A 4RVTA 4XV3A 5HNIX 2Y4IC 3UZRA 3MB6A 3DAEA 3BYVA 4JJRA 4YNOA 5CXZA 4ACGA 3TNHA 2Y9QA 1CSNA 2BPMA 5M44A 3KVWA 5AIRA 2OIQA 1OL1A 4BCHA 3NGAA 3QTXA 1UV5A 4L67A 3LFNA 2W1DA 1IRKA 2PY3A 3RJCA 3WF7A 3MJ1A 3UOKA 4MF1A 1OIRA 2PVLA 4X2JA 3RHXA 3PVGA 4J8MA 2C6OA 3ALOA 4MH7A 2W1EA 3I7CA 3ENHA 2XNEA 5E8XA 4AZEA 4BJJB 3S1HA 4AFJA 5KCVA 3MFRA 2YIWA 4D2PA 2WEIA 2BUJA 4D55A 1DM2A 1P5EA 4K0YA 4IE9A 4EH5A 4RJ5A 1J7UA 5L2IA 1OL6A 2XK8A 2F9GA 3W0QA 3HGKA 3UQGA 3TZ9A 5JKGA 4DA5A 5A4EA 4QO9A 3HMPA 5CVFA 3EN4A 3IW4A 3ZC5A 1W7HA 3FEGA 4D1ZA 1W82A 4Y8DA 1YWRA 4RZVA 3L8PA 3R9HA 3W18A 3V5WA 4IM2A 5DT0A 3E92A 3MH1A 2PMNX 3OMVA 3DA6A 4L42A 4G34A 3MFTA 5KZ0A 4LUDA 5LVMA 3A7JA 3AKLA 3DXQA 3FMEA 3G0EA 1H07A 4PRJA 4EH3A 4MX9A 4ANBA 5AUZA 3JR1A 4DINA 3QLGA 2DWBA 4D1XA 4USEA 4I1ZA 4IADA 4YHJA 1H27A 1Q24A 2XNNA 4I94A 4QTEA 4O7ZA 2JC6A 5DI1A 5BVFA 2J0LA 2WMXA 2OI4X 4USFA 1GY3A 5AP7A 2XK6A 3ENMA 4L3LA 2QR8A 4J52A 4FG9A 4ANSA 5HU3A 5AX3A 1M7NA 1PW2A 2GS2A 4AAAA 5L2TA 4QPSA 4E4MA 4K77A 5CY3A 3V04A 2W1HA 3FWQA 5CSVA 4QDEA 5FGKA 4E4XA 4G5PA 5KZIA 5EDRA 2XARA 3GI3A 3OP5A 3BYMA 1APME 3R8PA 4F63A 4O0RA 5HBEA 1XO2B 3ZO3A 3KVXA 4OTIA 4AW2A 1WBOA 2PMLX 3EFJA 3FLSA 3BYSA 3KXNA 3BE2A 2Z7QA 3MA6A 5A54A 1UU9A 4PMTA 3AGLA 3LQ5A 4NWMA 5HBHA 2RFSA 4DH3A 1SM2A 4U45A 3C0HA 2RFNA 2GNJA 4JG8A 5AR2A 3UODA 3GQIA 5B2MA 3KREA 4PQNA 4PDOA 4XX9A 3V8TA 2GMXA 3KF7A 4C57A 4MYGA 2YDJA 2W9FB 4UMRA 3GC0A 5ETCA 3OWPA 2W1CA 2XKEA 3OEZA 2H96A 1U5QA 1H0WA 3CIKA 5GIOE 5HEZA 4AXEA 5BYLA 5BVKA 2X1NA 5M55A 4CT2A 2JEDA 4FSMA 2X7OA 4KS7A 5AR4A 1XWSA 3DXPA 2GS7A 4HGSA 2VU3A 3Q9ZA 1YDTE 3SRVB 3FZSA 3KN6A 2ZYBA 4B9DA 1PHKA 3V6SA 3NUUA 4I21A 3K3JA 3MIAA 3BHHA 4PUZA 4TWCA 3Q3BA 2V55A 5DRBA 2Y8OA 3QD3A 4EK8A 4JR7A 3N4VA 4FJVA 3RZFA 1HCLA 3AT3A 4QOXA 4K6ZA 4XG2A 5IKWA 3DJ7A 2JBOA 4AU8A 4O7SA 4GT3A 5CEMA 2OF4A 2PZYA 4ACMA 1P2AA 2RSVA 4YPSA 4FV1A 3VS2A 3DFCB 2P0CA 3NDMA 3ML1A 4BDIA 2J5EA 3QTIA 3IDPA 4XJ0A 4FTOA 4N6ZA 3TJCA 2YCSA 4MVFA 4YJUA 2YEXA 3WYXA 4AG8A 2NRUA 3ZM9A 4LOPA 3BGQA 3Q9XA 1R0PA 3KK9A 3VN9A 5LMBA 4QP2A 2PZIA 2WMUA 5FP6A 3TWJA 2ACXA 2ETRA 1RQQA 4EWQA 5HQ0A 3QQLA 4A9RA 4FV7A 5E7RA 2W06A 3CXWA 5I9ZA 2CCIA 3KRJA 4E4NA 3QD2B 4HVIA 2XM9A 3VJNA 4RX5A 3FI3A 3RI1A 3HA8A 4ZAUA 4LL0A 4CV9A 3BQCA 2PVYA 4FKWA 3QA0A 2VWZA 4KABA 4AOTA 2NP8A 3F7ZA 4GL9A 3PWYA 4U81A 2VO0A 1DI9A 4JOAA 3R22A 3NVKI 1O6YA 4G3CA 1M2QA 2R3KA 2X9EA 1JSTA 3VS5A 4YHTA 4Q5EA 2PTKA 3QCSA 3TUCA 1J3HA 1B6CB 3P23A 4G6LA 3BBWA 3PIYA 4NM7A 2J2IB 1WBPA 3QD4A 4FV4A 3KMMA 4IACA 2WD1A 3OFMA 4NM0A 4O22A 4OW8A 2XJ1A 4XP2A 1XBAA 3ZLXA 4AGWA 4ASZA 4IB5A 3BQRA 3QTQA 3W8QA 3QBNA 5IQHA 1ZARA 3KXGA 3RAHA 3TM0A 5GJDA 1XQZA 5J95A 5CNOA 4ERWA 1M7QA 5CWZA 1UWJA 2ZVAA 3Q9YA 4R77A 2BALA 1DAWA 3HUCA 3VBVA 3VHKA 3AC1A 3FMNA 4J71A 3RPOA 4KA3A 4RZWA 3E7OA 3RAKA 5K4JA 5ANDA 4X2NA 4FTRA 3JVRA 3WARA 5CEPA 3DDQA 1PXIA 1SVGA 4BF2A 3BELA 4QPAA 5AMNA 5LMKC 1Z9XA 3UTOA 4L6QA 5HOAA 3QYZA 4BBFA 1LUFA 3OWJA 4GFMA 2I40A 2O65A 3GVUA 3ORPA 1IA9A 1GJOA 4IAAA 3BCEA 4LOQA 4RIXA 3KULB 3P5JC 4YSMA 1NW1A 1XJDA 2GNLA 3R00A 4R7IA 2YM6A 4FSQA 4WNKA 4BZDA 3HLLA 4OTFA 3QF9A 4E6CA 4F6SA 4PDPA 3C51A 1UKHA 5BMSA 1OPLA 4FV3A 5FEQA 5CF4A 4D1SA 4CYIA 3G51A 3EQDA 3F7WA 4FKOA 4JBOA 4PF4A 5K5NA 1VJYA 4CMOA 4CRSA 2IZTA 3EN6A 5HX6A 4TYIA 4QEBA 2XCKA 4QP6A 5DMZA 4O4EA 4ZZMA 2PUIA 1OMWA 1Z57A 4ZTHA 4D2TA 2QG5A 1Y91A 4KIQA 4R5SA 3K5UA 1JBPE 3AKJA 2VD5A 3QYWA 5IDNA 1W8CA 5AP4A 4QMXA 5JZNA 3EL8A 1OPJA 2R3HA 3P5KA 5AP1A 3FYJX 3HV7A 1WVXA 4MKCA 4XV1A 4X2FA 2I0HA 2AC3A 2H8HA 2YDIA 4JQ7A 2J0IA 4TTHB 3P7CA 4U0IA 4UY9A 1Q8YA 3R1YA 4M0YA 4OTPA 4A07A 4YC6A 4PMSA 3HP5A 2EXEA 5HNGA 5EW9A 4LMUA 1G8KA 4LV7A 4KINA 4CFXA 5GNKA 3ZRLA 3NYVA 3CD3A 4JAJA 2YN8A 3NX8A 3OG7A 4KD1A 4TW9A 4DTKA 5DEWA 1OL7A 4Q9ZA 2EU9A 5KKRB 2WTWA 3ZRKA 2PZRA 3QZHA 4MXZA 4D4YA 3BWFA 3BHTA 4LYNA 4D0WA 2CHLA 3NFGB 4LRKA 4O38A 2BAKA 3GC7A 4EH2A 1OECA 5HTBA 2J4ZA 2X4ZA 3CKXA 2ZV7A 2HW7A 3PA5A 4I6QA 2X4FA 4I6BA 4XH6A 4BKZA 3TI1A 4GSBA 3DTCA 3ZLSA 4E6AA 3LHJA 3RK7A 4YTHA 3SV0A 3R7IA 2HYYA 3UIBA 4NKAA 4L7FA 4MHAA 1YI6A 5AWMA 2JDVA 3L8VA 5B2KA 3ZH8A 4CQGA 5KNJA 3UMWA 1LP4A 2F2CB 2R3GA 4HYSA 3RCDA 3ZMMA 4DLJA 4TT7A 4A4OA 2YACA 4J8NA 4O0XA 5BX0A 5IISA 5G6VA 3UC3A 2BDWA 1YHVA 3H9FA 5EDQA 5HIDA 3NEWA 4JXFA 2XIXA 1PF8A 5H3QA 4CTBA 4HVHA 4O82A 3VUKA 3QWJA 4G2FA 1FPUA 4TWNA 4C0TA 5CS6A 2F7EE 3A4OX 3TKUA 3U87A 4CFUA 3ORIA 3KU2A 4NL0A 1L8TA 1TQIA 2W4JA 4F0IA 4FT0A 2J6MA 3MIYA 1TQMA 3DBCA 3GUBA 4FGBA 1OZ1A 1Q4LA 4KBCA 4ZLZA 1WFCA 4XG3A 3VF9A 4CFVA 5FTQA 3LKMA 1BI8A 4FVQA 3CR0A 4GG5A 3UJGA 4RJ8A 5CU4A 2OFUA 3DKGA 3UDTA 1PMEA 3ERKA 3HVCA 5AV1A 4CKJA 5AUYA 1J7LA 2VNYA 4ACCA 1BUHA 4MF0A 1WVYA 3D0EA 4LRJA 3W2PA 5IQEA 4TYHA 1W84A 2VTRA 3OXZA 4PNKA 3D7ZA 4R78A 2VTQA 2WTDA 5JRSA 3E7VA 3NZ0A 3BU3A 3DTWA 5E91A 2ITUA 4XCUA 2WQOA 4BI2A 1VZOA 4I5PA 4HW7A 5BVDA 4FVPA 3ALNA 2YM5A 4IAIA 4CRLA 5EG3A 5LARA 2QHNA 5M08A 2XK7A 4FTCA 2EUFB 4TYEA 4GK2A 3MBLA 5L4QA 2ZFYA 3F3UA 3DK3A 3SX9A 4BJJA 3PVUA 5IA4A 3W2RA 4EOLA 1SMHA 3BEAA 4PV0A 4NTTA 2HW6A 4FSWA 3E3BX 3NMUF 4YBKA 2DS1A 2GNIA 2PZ5A 3IONA 3KEXA 1SNXA 3PJ3A 1OL2A 2WOUA 3PZHA 3RP9A 4ZSLA 2QU6A 4MQ2A 5HI2A 1YXTA 2JFMA 3PG3A 4XV2A 4BICA 4JNWA 5GZAA 3NNVA 4GV1A 3EQRA 4QMLA 5HESA 4KKEA 5HNBA 4O0VA 1HOWA 3CTQA 4FNZA 4Z9LA 4ZOGA 3NUSA 1OKVA 2FYSA 4WRSA 4YP8A 2E9PA 4B0GA 4AXFA 2C68A 3HDNA 2WMTA 4XMOA 3COIA 3EFLA 4D2WA 2QOOA 5HD4A 1Y8GA 3B8RA 5KX8A 2JBPA 3FKOA 5TT7A 5CSHA 4GT5A 5CLPA 5L6WL 4IMYA 1XH4A 2EWAA 4CG9A 2VO6A 3NYNA 2RG6A 2JKMA 4UXLA 4IZAA 4E4LA 4AWIA 3MB7A 5J9YA 2XYNA 3LW0A 3PWDA 3QWKA 4RWLA 3CCNA 3QXOA 1MRUA 1P14A 1QMZA 2Y7JA 4QMOA 5HCYA 4XBUA 4K8AA 1IG1A 3L9NA 5DH3A 3RAIA 2YERA 3POOA 3BV2A 3QRTA 4KNBA 4Q5HA 3UOLA 1F3MC 5FTGA 3FLQA 5E8YA 3S0OA 4CFNA 1MQBA 3BE9A 3FMLA 3ORTA 3V6RA 2CNQA 5FWKK 3D9VA 4UMQA 2R3JA 2A4LA 5FG8A 5E8ZA 4A9SA 2REIA 4K9YA 3RPSA 3BZ3A 3C7QA 4LI5A 4U3YA 4I24A 4EK6A 1PXNA 2YCQA 3LFCA 4W8DA 3TZ8A 4I0SA 2I0EA 4DDGA 2BRMA 3KRRA 4NFNA 4C4FA 5BNJA 4FIIA 3U4UA 3ZTXA 4X2KA 4DGNA 1TZDA 4DG0E 4XRJA 3KB7A 3RAWA 4UMTA 4F1MA 5IG1A 2UZUE 4D58A 1H24A 2I1MA 2ZMCA 1FVRA 3PXKA 2BZIB 5FBNC 5TR6A 5JFSA 4RC3A 3SLSA 2BR1A 5BQ0A 5KUPA 3MSSA 1WBNA 3UQCA 4RC2A 2XYUA 1YOJA 3PXRA 5DIAA 3KF4A 4ZJIA 4I92A 2GTMA 4DH8A 4AA4A 4DEHA 5A4CA 4AZTA 2VTAA 3KQ7A 3ZHPC 3R9OA 2C5XA 2C6KA 3NIZA 1YWNA 3GFEA 3W2CA 4X7QA 5FXQA 5KKRC 3FZ1A 4FUYA 4UYNA 1FBNA 3R63A 3BU5A 4DDIA 3NNUA 4QP7A 2G01A 2YCRA 2QLQA 3QFVA 3V5PA 5IA0A 5JQ5A 3TUBA 3SRVA 3PLSA 1H1SA 3U9NA 4NSTA 4I4FA 5DWRA 3Q6UA 4UYAA 2XKFA 4L43A 1ZMVA 1W0XC 4EONA 3VBXA 4AE6A 3SXRA 5EHLA 3ZYAA 3TEIA 3MESA 4L68A 2WHBA 2FSLX 3EFWA 2OBJA 1QL6A 1WMKA 3AD6A 2P55A 4WKQA 2VTPA 3F69A 4F9AA 4JBPA 3GU4A 3ORNA 4ZXTA 3CQUA 3ID6C 3O8UA 2HWOA 2OXYA 3RINA 4ALWA 4BI0A 4DEEA 2VGPA 4JVGA 3FY0A 4I41A 2PULA 5A9UA 3FXXA 4RA5A 1FQ1B 4AX8A 3FC2A 3L8SA 5IMEA 4QP8A 3OCTA 3DBDA 4G9RA 4EUUA 4MBIA 2IWIA 4XEYA 4QQ5A 4WO5A 4L52A 4I6HA 3SQQA 2UZVA 1FINA 3EQHA 3JS2A 5CU0A 4L7SA 5HIEA 2AQXA 4FTJA 4JT3A 3O5AA 3UDZA 5KBRA 5IDPA 5LWMA 4CG8A 4CGAA 2WFYA 3Q60A 2RGPA 3PPJA 3PXQA 4EOQA 5EKNA 3DY7A 3ODZX 4IDVA 2Q0BA 5F20A 3FDNA 1YWVA 1Y8YA 3I60A 3MH3A 2SRCA 4OTQA 3UIMA 4HOKA 1XH9A 2F4JA 1H08A 4TNDA 2YWVA 4IXPA 3PSCA 4QMVA 4JIAA 2CSNA 3R1QA 2FGIA 3GGFA 2VTSA 4FSTA 5E92A 3H0ZA 4BCPA 3SHEA 2YIYA 4O7VA 4XNEA 3HV5A 3NCZA 4HVGA 1Q41A 1ZOHA 2HY0A 3DBFA 5JGAA 3ORZA 3PZEA 3HZTA 4NT4A 1FVVA 2Z7SA 3D7TA 5HU9A 3KIOC 2Y4PA 4BWPA 4Z16A 2UVYA 4XG8A 2B53A 2JDOA 3KRWA 4J99A 5TF9A 3MGYA 4GK3A 4D4RA 4MWIA 4FZFB 1ZXEA 4IAZA 4LGGA 4U80A 2WTVA 1S9JA 3CGOA 5DRDA 4BTJA 3WYYA 1JKKA 4PWNA 2B54A 2FSOX 4MK0A 3TTIA 2CGXA 3WZUA 2ZMDA 4EOOA 5GJGA 4GG7A 4LGDA 2X8DA 3R9RA 5I9YA 3I1AA 2YFXA 3A62A 5F1ZA 3GT8A 3QQFA 2CKEA 2ZDUA 4IX3A 3ROCA 1NVSA 2RIOA 2Y0AA 3UOJA 4DH7A 4AN9A 2WNTA 4FKLA 4E8AA 3KULA 5I5ZA 3MA3A 2XIKA 2X0QA 2BZHB 4IW0A 3N51A 4KB8A 2FSTX 3MTFA 4YJQA 4BTMA 2AEGA 3AC2A 1F5QA 4IFCA 4M14A 2E2BA 3OOMA 5FBOA 1UVRA 5AJQA 3EKNA 4A06A 3HRCA 4IAYA 4BDKA 4DE4A 5LWNA 3R1SA 4C37A 2B7AA 2YM3A 4ANMA 4CLIA 4PP7A 5CF5A 4CXAA 4M68A 4HNIA 3NNXA 5IF1A 4BGGA 5LVPA 3IW5A 4PX6A 3NNWA 3BBTB 2VTNA 2BIKB 2QG7A 4BWKA 5F9EA 4DFUA 2XNBA 1YXUA 4YLJA 2OWBA 3JUHA 4W9WA 4XP3A 5AR3A 4EBVA 4EBWA 3PJ2A 4FA2A 2QU5A 2YABA 2UW6A 1W2DA 4ASDA 4DT9A 2JDSA 2YWPA 3ORKA 2R3MA 2IJMA 3L9MA 4AZWA 3I7BA 4FIHA 3PG1A 4S34A 4E5BA 2BFXA 2PE0A 4GIIA 4ZP5A 4EHZA 5HG9A 2H6DA 4I6FA 5F95A 5FP5A 4ZK5A 2R0IA 5GJFA 3W1FA 2R3RA 2BTSA 4FVRA 5DGZA 4DC2A 4O7LA 2XMYA 3D94A 4BB4A 4A9YA 5BUIA 3DZOA 2C30A 4OBPA 5DT4A 1OGUA 1Q3WA 5L2WA 3DB8A 3R6XA 2BFYA 4FKRA 1U4DA 4RFYA 3ZBXA 2Q83A 3DOGA 3RMFA 1STCE 3JXWA 4OBQA 2OJFE 3PXZA 5JFWA 4NTSA 1OI9A 4GJ2A 3D2KA 4V04A 4QMUA 3VBWA 3QUEA 3FY2A 2VN9A 4AAYA 2OXDA 4X0MA 4PPCA 1Q3DA 3OW4A 2JIIA 3C4CA 5D10A 4FEXA 1CMKE 1H1WA 3AMBA 4FV0A 3QU0A 4G17A 3R7GA 4G3DA 2O3PA 2AYPA 3FQHA 5AUWA 4O7TA 5CZHA 4OUCA 3LPBA 2B9HA 4XLIA 5AP2A 3BWJA 4KSPA 4YJOA 1RE8A 5HE0A 3AT4A 4TYHB 3FHIA 4C4EA 3M42A 4JBQA 1TQPA 3A99A 4KBAA 5FM3A 2P4IA 4XG4A 2WQMA 3IGGA 2X9FA 3PSBA 4CYJA 3HMNA 2J5FA 2QO2A 2UZEA 5IMXA 5J1WA 4BI1A 4IWDA 1K3AA 3KRXA 4FF8A 4JI9A 2P33A 3T8OA 5E4HA 4WNPA 3ZOSA 3LFFA 5ETAA 3G33A 3VAPA 4G3GA 2XVDA 3FPQA 1S9IA 1K9AA 3MI9A 3R8ZA 2OJ9A 1PXKA 3PE2A 5T68A 1WZYA 2XBJA 4HZSA 4ANLA 5K4IA 4IX5A 5C01A 4AFEA 5IH4A 5FUTA 2ZOQA 4JDIA 2YJRA 3GENA 2C6IA 4D0XA 2GCDA 3OWKA 2DUVA 4AT3A 2B9IA 2WMBA 4WG3A 5M06A 2OIDA 5D11A 2OXXA 1YI3A 4I5CA 4W4XA 3EYHA 3PY3A 3I5NA 5BV3A 5ACBC 5EYCA 4IVBA 3LXLA 3DPKA 4BCOA 1H1RA 4QTBA 2NO3A 3KXZA 3AOXA 5EHYA 4IWOA 2OSCA 4Y72A 2JKQA 2VX3A 1GZNA 2XNOA 5IQBA 3V51A 4CFFA 1CDKA 4YZBA 3UYTA 2QONA 3TN8A 4FZ7A 1PMVA 3F6XA 4FG7A 3VS4A 4II5A 5E8SA 5KMNA 5CF6A 1KE5A 4RQKA 4YJNA 2OKRA 4JL9A 5DE2A 1R1WA 1ST4A 5M56A 2GHMA 3AG9A 4GFOA 4U8ZA 4WSQA 4NEUA 4EORA 4XOZA 4EL9A 1NVRA 5AX9A 5AP3A 2F2UA 4R8QA 5DOSA 2UW8A 2W4KA 3QUDA 3ZO4A 2DYLA 1F0QA 2QCSA 3BIZA 4FYNA 3W8LA 5LCJA 3FAAA 2P2HA 3E88A 1GIJA 3QCQA 1KOAA 3FLWA 4JMQA 5L2SA 2HXQA 3QALE 5M4CA 3UDSA 1MQ4A 2JGZA 4X2GA 3FZRA 4EKKA 2QVSE 2BCJA 5HKMA 4RQVA 3VBYA 2Z02A 2R7BA 4UWBA 1OITA 4HVDA 3BL9A 4DF3A 3DT1A 1H28A 4CZYB 4W4YA 5IQAA 5IQIA 3QHWA 4U40A 3S4QA 5IQFA 5TKDA 3UO5A 1Q5KA 3VS6A 2JKKA 4X21A 4AGDA 4IB3A 3PY0A 3COKA 2WMWA 2XJ0A 2PL0A 2OJIA 2XNGA 2WIHA 4LG4A 3A2CA 4XV9A 2ERZE 2QNJA 3S2PA 3EQFA 3VC4A 3GOPA 4PDYA 4MNFA 3VUMA 3PY1A 1Q8WA 3HA6A 5JN2A 2PSQA 4O91A 4IJ9A 4ZJJA 3DBQA 3QAME 3MS9A 4QQCA 2C0TA 2XZSA 4FSRA 5BMMA 3TNQB 1BMKA 5HCZA 5CAOA 4E6QA 3F3ZA 3TG1A 4GEOA 3WZEA 1V1KA 3I0OA 4M3QA 4ZIMA 1P4FA 2O5KA 4IM3A 4QMYA 4RJ3A 3PVWA 5AUXA 1A48A 3ZSIA 2XB7A 3Q96A 3P4KA 3RWQA 4AE9A 4HYHA 4MWHA 3GFWA 4HVSA 2IEWA 4C3FA 2VWXA 4IBMA 3L1SA 4GKIA 3WF8A 1OKWA 4UEUA 3FQSA 2BRGA 3IGOA 4O96A 4R5YA 5I9UA 3UC4A 5HTIA 3UQFA 4A9TA 4KUJA 4DTAA 2ITPA 4MBLA 3MY5A 4M12A 2PPQA 1MRYA 2F57A 4GKHA 4TWPA 4F64A 4RVMA 4FOCA 5ANKA 2C6MA 2UW4A