4XV2A

B-raf kinase v600e oncogenic mutant in complex with dabrafenib
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
272
structure length
247
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGGSILWMAPEVIRPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title RAF inhibitors that evade paradoxical MAPK pathway activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 247
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xv2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xv2A01
3OXIA 4RJ6A 3ZXTA 4CRLA 3ALNA 1OL1A 1CSNA 1J91A 1W0XC 5AR5A 3MI9A 3QZFA 3RP9A 3D94A 2X81A 3H9FA 5ACKA 5CSVA 4FX3A 4DEHA 5A46A 5JFSA 5KO1A 3WF9A 2ETKA 2G2HA 3ODZX 4LGDA 4TXCA 3R30A 4K8AA 5K5XA 3PPKA 2OJ9A 2VUWA 3D7ZA 3KRLA 3LCTA 4CGAA 2EWAA 2XNMA 2R3LA 3TV6A 3KL8A 3WZUA 1E1XA 3QQJA 1UNGA 1FINA 2ZV2A 3KEXA 4DGGA 2X9FA 2Y8OA 2ZVAA 4IWDA 3R9HA 3FLQA 3WILA 2CJMA 4YJOA 4JJRA 3PJ2A 4JXFA 4OGRA 5IKWA 1W7HA 2GTMA 3I0OA 5CT7A 2OXDA 4EQUA 4DFUA 1DI8A 2VX1A 3BRBA 4I0SA 4TW9A 1KUTA 2W1CA 3OWLA 3ENHA 4XV2A 4C2VA 1JSVA 1XH7A 3VS0A 5L4QA 4KS7A 5EFQA 4FVQA 1QPEA 4IX6A 4BYJA 2Y4PA 2OZOA 2QOKA 2Y9QA 5DR2A 3UMXA 4DEIA 2UZVA 1L3RE 2OBJA 3MJ2A 4AX8A 1J7UA 2ONLA 3KMWA 4FE2A 4BRXA 3FZ1A 2HAKA 4HJOA 2QLUA 3NUUA 3AC3A 3M11A 3QGYA 4O0TA 3ZS5A 4ZY5A 5E92A 1MP8A 2UZEA 5EK7A 4E73A 4E8AA 3RPOA 3A7FA 2BIYA 3EWHA 5KMKA 1ZY5A 4IZ7A 2OG8A 3O8TA 3T8OA 3P7CA 2UVZA 1Y6BA 2GNLA 3HX4A 4BWPA 4LG4A 2GCDA 1Z5MA 4FSMA 4D55A 4KABA 3D4QA 2P55A 4AF3A 4F0GA 2CCIA 3D7TA 3Q5IA 4L44A 4MAOA 5EYDA 3ROCA 3H9OA 4L53A 3DZQA 4GT4A 1CMKE 4L3PA 4XG7A 2I0VA 2PZYA 3TIZA 4F63A 4QQTA 4DT8A 3TZ7A 4IC8A 2RGPA 4RLKA 3IW5A 3WOWA 5JSMA 5K5NA 4RJ7A 5I4NA 1H00A 4FZDB 2R3KA 4PRJA 3VWAA 1H01A 4JIAA 2OSCA 3COHA 3C1XA 2QODA 4NTSA 4PMSA 4GK3A 3ORZA 4X3FC 4Y72A 2JC6A 3KXNA 3TNQB 2H34A 2YJSA 4GFMA 4BWKA 3QTUA 4O1OA 5FBNC 2WMXA 1S9IA 3NS9A 3MV5A 3RM7A 1OKWA 2CSNA 5BUEA 2OFUA 4NU1A 2CDZA 4FV4A 4QQCA 3POZA 1H25A 2YA9A 5E90A 4C3RA 4IFGA 5E9EA 1R39A 3QD4A 1FVTA 2PHKA 3NUNA 4N57A 4O0SA 4EONA 3QKLA 3OWKA 1HOWA 1I09A 1OVEA 4YO6A 3VBXA 4DCEA 4FYOA 4FGBA 3ULZA 4A7CA 2FSTX 4G31A 2CKPA 3UPZA 4DA5A 4BDFA 4X3FA 4XV9A 3U54A 4ZMEA 4IVBA 4FIGA 4KWPA 4MWIA 2HZ4A 3TACA 4AGCA 1ZY4A 2YDJA 3WBLA 3RK5A 2BCJA 2BFXA 5HU3A 3IK3A 5LOHA 4IAYA 4EH4A 3HUCA 4BDEA 1WVYA 1DM2A 1OMWA 4U97A 2Z7SA 4MWHA 2VWXA 4F9BA 3AD6A 1FPUA 3F61A 3N51A 4IZYA 3ZRKA 3R1NA 3LVPA 4KBCA 3R9NA 1SYKA 4EC9A 4NM7A 4MNEA 3ZLWA 1BUHA 2PVJA 4O2PA 1UKIA 3GU5A 3IW4A 2REIA 2Z2WA 2XIYA 4UWYA 3GENA 3SX9A 1ZMWA 5CU6A 2PZIA 3R7YA 4D2VA 1YI6A 3OW4A 4U8ZA 4FTTA 3VRYA 1O6LA 5GIPE 3R28A 2JDVA 3QKKA 3GUBA 3MH2A 5HE0A 3V8TA 5JT2A 3R71A 1YI4A 3FZSA 4YNEA 3MH0A 3OUKA 5FM3A 5D11A 3T3VA 4HVGA 1SZMA 1E1VA 4W8EA 4NCTC 5ANOA 4IM0A 4G9RA 4YTCA 3DJ6A 3ZUVA 3CD8A 4DEBA 4DFBA 5BYZA 2W1FA 3LFBA 4AGUA 2C68A 4PPAA 2BHHA 3OW3A 5EQPA 3R63A 3KMUA 3QL8A 4BI1A 2I40A 4A9YA 4XRJA 2G9XA 4S34A 2BVAA 4FSNA 1GAGA 4TKSA 1U4DA 3NUXA 3Q4TA 3QF9A 1OL2A 5DT0A 3GP0A 5L2SA 5A6NA 3FLSA 3WF8A 4BTFA 3ELJA 2C4GA 3OMVA 1KE8A 2IVSA 4L42A 4FODA 5CYIA 5M4CA 3BE9A 3II5A 4GUEA 1PXNA 3MPAA 4FKUA 4FSUA 4KINA 3PE1A 5C27A 4Y85A 3MY5A 4F6SA 5K4JA 2X6DA 2H9VA 3JS2A 4YJSA 2WMQA 4BCJA 2PUNA 4U5JA 4FF8A 3DJ5A 4FTMA 3FZPA 3E88A 5E8WA 2BAQA 3VS4A 5C8NA 3ZDIA 5IEYA 5J87A 4QMLA 3VS7A 1RQQA 3KRWA 3HECA 1TKIA 2HWPA 2XM9A 3KFAA 3TUCA 4QD6A 5A54A 3P23A 4YTIA 5L2IA 2BRMA 3DXQA 1U54A 2HCKA 2J0LA 4DH3A 3Q3BA 4LOOA 3ZUUA 3P5KA 4NL0A 2FH9A 4WOVA 1YHVA 2OU7A 3KXZA 4O6EA 3SVVA 2XYNA 3MH1A 2OIBA 2XKCA 3AC1A 3RK7A 3KVWA 1IASA 4D58A 4RSSA 4EOLA 4YJRA 3R7GA 5CASA 5CEIA 2XNPA 4KKHA 3AD5A 1PRYA 2YLFA 4EH3A 5KUPA 3PIZA 3NW6A 4X6QC 2X2LA 3Q4CA 3CSVA 2R0IA 2C5NA 4USEA 3ATTA 4L3LA 4EZ7A 3LFNA 3EN9A 3S95A 2Y6OA 5L3AA 4EOOA 1BKXA 4UWCA 1PXJA 3VBYA 1RW8A 4HCUA 4F9AA 2ITWA 3DXPA 3SG9A 4RIXB 3DK7A 2R7BA 4FUYA 4RVKA 4XH6A 4BCHA 4V01A 5K0XA 4BDDA 2XK6A 2IPXA 5HOAA 3QZIA 3CR0A 3FY0A 3K54A 2O8YA 5AR3A 4HGTA 3BWFA 3EN4A 4E5WA 2UVYA 3OOMA 2FA2A 5GHVA 1SVHA 5L6WL 1M17A 4FA2A 2ITVA 2XEZA 5CI7A 5J9ZA 4IB0A 5DOSA 1M14A 4E1ZA 2A27A 1GZ8A 4DGMA 2VTMA 3CJGA 3BQCA 1H24A 1U46A 3R02A 3NAYA 4NZWB 4AA0A 3BEGA 4F0FA 4WD5A 3FQEA 4FKWA 4R3CA 3TEIA 3FLNC 4PL3A 3U9CA 5JZNA 2F7EE 2GSFA 3VJOA 3S0OA 3EQFA 5C9CA 3UC4A 1WBOA 5EW3A 3PPJA 2R3GA 2J7TA 5IA4A 2W5BA 3C4ZA 4ZZOA 4IHPA 5TF9A 1WBVA 3L8PA 2RG5A 4K2RA 5EHYA 2BIKB 2XS0A 3ATSA 2F9GA 4KB8A 5IA5A 3ZLYA 2W4JA 4J8NA 3G6GA 1BI7A 3M42A 4B6LA 4BDIA 2IZUA 1MRVA 4F0IA 4FOCA 3FI2A 2JBPA 2VTPA 4GU6A 1GZNA 3ULIA 1O6KA 3W2SA 2WU6A 2C69A 1Q97A 3H0YA 4I92A 3DU8A 4F65A 5CAOA 4ZY4A 1WVXA 5T3QA 4ZAUA 4QTBA 3EH9A 3IDPA 5CVFA 4O82A 4XBRA 3W33A 2C1AA 3E5AA 4A4XA 2QO9A 1KWPA 5E91A 5TOZA 4DBXA 1LEWA 1YOMA 5BVFA 3BV2A 1Q3WA 2XNNA 3P9JA 5LMKC 4PPBA 2CGUA 2QR7A 4DT9A 2WEVA 5ANGA 5ANEA 2SRCA 4L01A 2UVXA 4WBOA 3IOKA 3DJ7A 3A4PA 3F69A 4JLCA 5ANKA 3VUDA 4DTAA 2W1ZA 2VTLA 2WIPA 3G51A 3LQ5A 3U51A 1Y8YA 2R9SA 2ZJWA 2XJ1A 2ZM3A 3Q2MA 3QCYA 2Y6MA 4KAOA 3PY3A 3RK9A 4UYAA 5FTGA 2YWVA 3BZ3A 2Y4IC 4FI1A 5DA3A 4Z7HA 3TZ9A 1OL7A 5I9VA 5DLSA 2KTYA 4YU2A 3HRCA 4DTKA 3MESA 3RM6A 1JBPE 1XR1A 4YHTA 1M7QA 3CE3A 4WNMA 4MXAA 2ESMA 3O17A 4EYMA 3EFJA 4V0GA 3T9TA 3FL5A 4IX5A 4LMUA 5AWMA 4ZXTA 4U7ZA 5LWNA 4BN1A 3BLQA 3BHYA 4CV8A 2B52A 3A8XA 3E92A 3KVXA 4FSTA 3LIJA 4YHFA 4ZS0A 3MY0A 1JAMA 3REPA 3W2QA 5BVNA 3UVPA 3BE2A 3OBGA 3FQSA 5IQDA 4F7SA 3KMMA 5IDPA 4M69A 3F82A 3A7HA 2GDOA 4MBJA 5D41A 4H58A 4PTCA 5EYCA 2R5TA 3PSCA 2OH0E 4W9XA 2W1HA 5CU4A 4DEGA 3BLHA 3LCKA 4ASXA 4RWKA 3KKVA 4FSYA 4U42A 3RPYA 3EYGA 4LRJA 2A1AB 4RG0A 2QQ7A 1Q8ZA 4YBJA 5F94A 5HO7A 4TYEA 2PY3A 4AA4A 4U80A 1V1KA 4TWCA 5BUIA 1H8FA 3FBVA 3MIAA 4I0TA 5L8LA 1YKRA 3BYVA 1B39A 3QX4A 4QTDA 4U81A 4UZDA 3OC1A 2C6LA 1PY5A 4IAZA 2X7OA 3FC2A 4ZSLA 3VUGA 4MD7E 4BCOA 3EKNA 5JQ5A 4NJ3A 2JIUA 1GIHA 2EB3A 5LVLA 1NW1A 4BCMA 3PVGA 4LQMA 4MXCA 1WBPA 4QP7A 4IE9A 2ITYA 2O64A 4TN6A 2VRXA 1KE5A 3IW6A 5J7BA 4G3FA 4DAWA 3HVCA 2DWBA 4FIIA 4N4SA 3R8PA 5AA8A 4H36A 3FKOA 4IVAA 3WF7A 1REKA 2J50A 4DG3E 4ENYA 4UYNA 3HMNA 4F7JA 3HMOA 4YPSA 3O96A 5A4EA 4BL1A 2FSMX 2ZOQA 4I20A 4PDPA 5DR9A 3M1SA 4WIHA 2CCHA 3VBVA 4FSZA 3ZFYA 4EHGA 4R1VA 5E8TA 3QWJA 4IWOA 4DLIA 2X39A 4I0RA 5AUYA 2R64A 3EQCA 4C4EA 4JAJA 2W06A 5GNKA 5AUZA 4RVMA 5TR6A 3T9IA 3UIMA 2H96A 5IH4A 4JX7A 2BZHB 5H2UA 3QZGA 4DINA 4AOIA 3UVRA 2F2UA 5I9UA 3QUPA 4AZWA 4BDJA 3SA0A 4L7SA 2PTKA 3S2PA 1H1PA 2NPQA 3VW6A 3DK3A 1WZYA 1XH8A 4EK5A 1GNGA 4GG5A 4AQCA 5AP5A 3RAIA 3ZUTA 2WMSA 1KV2A 3PXKA 3NRMA 4ZY6A 1Z9XA 4BGHA 5EYKA 5KZIA 4CRSA 4GT3A 4X2FA 2ZDUA 3QD2B 1UKHA 2G1TA 2RKUA 3QTZA 3FXWA 2V7AA 4M66A 3VF9A 5AUXA 3W16A 1KE6A 5CQUA 4ANLA 4EWQA 2Z7LA 5HNGA 3NZ0A 4IJ9A 2PZ5A 3WZJA 3NX8A 5EYMA 3PFQA 4L45A 4IANA 4PV0A 5KKRC 3PG3A 3THBA 5M4FA 3F7WA 5CLPA 3PSBA 2PUIA 3FV8A 5FP5A 1SVEA 4YZMA 2X8EA 3KULA 4K11A 2DQ7X 5HE3A 4JIKA 1OITA 5HE1A 4EOPA 3DGKA 3RPRA 2XUUA 4OBQA 3V6SA 1ZAOA 3WYXA 3EZVA 1RDQE 3F7ZA 3GVUA 1H0VA 4JDKA 4G5JA 1UU9A 2BDWA 3OT8A 3TNPC 3UTOA 3TDWA 2HYYA 3KC3A 4K33A 4AU8A 3QRTA 4Y46A 5AM7A 4E6DA 2GQRA 2ITZA 2OKRA 4LL5A 3UYSA 4PL5A 5HCYA 2C30A 3SOAA 3PSDA 3ET7A 3K3JA 4I6QA 3EOCA 5H3QA 3QYWA 2RFSA 4M0ZA 4AG8A 1NXKA 3VIDA 3ZFXA 4FL3A 5BUJA 1Q8TA 3A4OX 3ORLA 3LHJA 3QD3A 4FTUA 1PJKA 5FXRA 4W8DA 3L8SA 1LP4A 5AUWA 2Z60A 1ND4A 3CKWA 5L6PA 4CKIA 1PXLA 3HKOA 1URCA 2F4JA 3D15A 3FWQA 1OPLA 3DK6A 3UMWA 2XCKA 3HV7A 3G15A 3LMIA 5HBHA 4RX5A 2C5XA 1JLUE 3CY2A 3B8RA 5HGIA 4C62A 1P4OA 2W99B 4XG9A 4OTQA 3F9NA 3D14A 2UZLA 4CFUA 3R01A 4G9CA 3UIUA 4PMTA 5CAQA 4KSQA 2WO6A 4JBVA 3KB7A 2HW6A 5L8KA 4Y8DA 4U43A 4C57A 3P78A 4JBQA 4HOKA 4RPVA 4WRSA 5KX8A 4PY1A 4FNXA 1OBGA 3MSSA 4AN9A 5IEVA 3W18A 4GVJA 4JAIA 3SXFA 4QTEA 2PVYA 1QPCA 2QKRA 3ORIA 3RKBA 4FTJA 2UV2A 3QLGA 3A62A 5AR4A 3EL7A 4CD0A 5JFXA 2VTIA 3GCPA 3P86A 3LMHA 2ITOA 3ZM4A 3QLFA 4I23A 3PIYA 1B6CB 2Z02A 2OLCA 4OBOA 5E8UA 3QCXA 4MQ1A 3UOLA 2JDSA 1PXIA 2W4KA 4D1SA 4ZSJA 3S4QA 3UE4A 3ZBXA 4X2KA 3W55A 2QOHA 4M13A 1Q24A 4Y83A 1K2PA 4QPSA 2GS7A 2OJGA 3LAUA 2YEXA 5DGZA 3AMYA 4ZZMA 4RJ4A 3NAXA 3ORXA 1JVPP 2VGOA 1YRPA 3FSFA 1JWHA 4U0IA 4G5PA 5HE2A 4TL0A 1YXVA 2R0UA 3FJQE 4FKTA 4DH8A 1GY3A 2EXEA 3R0TA 4DG2E 3BHTA 3FY2A 4M84A 5EM6A 4QMXA 4RJ5A 4ZJIA 5M06A 4CG8A 4U40A 4L7FA 3PY0A 2IVVA 1FVVA 5HIBA 1PMVA 3MFRA 3B2WA 4N70A 4P90A 4NEUA 3KXHA 4X21A 4PX6A 4CQEA 2YCFA 5ACBC 4TYHB 5M55A 3NYXA 5H9BA 1Q61A 4CXAA 4F9CA 4CKRA 2JKMA 5HD7A 4MNFA 5HTCA 4BHZA 3MJ1A 3Q4ZA 3R7UA 2WMUA 2UZDA 3QC4A 1ZYSA 4I3ZA 4PNIA 3HV3A 2E2BA 4QP6A 5C8KA 1A48A 2JDOA 4DEAA 3F2RA 4LM5A 4J71A 2CKOA 5AP3A 2UUEA 5LCKA 3IQ7A 4JX3A 1REJA 2C6KA 4GUBA 2PVKA 2WMWA 4MK0A 5FWKK 4M14A 3O23A 3QCQA 2CPKE 4QMYA 3JYAA 4R5SA 4KIKB 2X0GA 3BI6A 2C6OA 3AC5A 3L8VA 3EFKA 4D4SA 4NWMA 4DFXE 3ZH8A 3Q52A 5F1ZA 2VTHA 4PTGA 4AXAA 3P08A 5KMOA 3CY3A 4KIOA 4N6ZA 1S9JA 3LJ0A 4YSJA 1ZYJA 3KCKA 3RALA 1H1SA 4P7EA 4R78A 4U44A 2JDTA 3I7CA 5CVGA 3C5UA 4L43A 4O27B 3F3ZA 1H0WA 4YJNA 2R3HA 3E64A 4FT7A 3K5UA 3TCPA 3TT0A 1G8SA 1KSWA 2BZIB 3FAAA 3MVHA 4XOZA 2IW9A 2JEDA 2VNYA 2ZB0A 5CALA 3DTCA 5IA2A 4G6LA 2PVHA 3BX5A 2VX3A 2VWUA 4ZSGA 2R3FA 3UBDA 4CZUA 3DZOA 5AP1A 3JUHA 3QUDA 1IA9A 2FYSA 2JKKA 4LV8A 5GJGA 1FBNA 4IDTA 1PMEA 2VO7A 5E8SA 1V0OA 2WTDA 3DDQA 5A14A 5KNJA 4RWIA 5JZJA 4AZSA 3DBFA 4ANBA 4ZZNA 5AAGA 5E4HA 3D5XA 1H28A 4GEOA 1FOTA 2YCQA 3TV4A 4RFMA 5BMMA 3LFEA 1W83A 4XP0A 5HVYA 3PP0A 1YWNA 3NR9A 3OUNB 4YLLA 3WIGA 3SHEA 4OW8A 3R1YA 2GNJA 4C59A 1YHWA 3CLYA 3MVLA 5I0BA 3NMUF 4IX3A 4GIIA 2CKQA 4JNWA 4QNAA 1M2RA 4BY9E 1VEBA 3LW0A 4GCJA 3TKIA 2LGCA 3VS2A 2J0MB 2XF0A 2ONLC 3PZEA 5JGDA 3D5WA 3UGCA 4AFJA 5GJFA 3CBLA 3EJ1A 1PMUA 4R3RA 3COKA 3IGGA 3DDPA 2J4ZA 4EK3A 5KHXA 4OTFA 3VBWA 3NPCA 5HBJA 1W98A 3ZO2A 5CZHA 3V5TA 4C02A 4O0YA 3AGLA 3MW1A 3NYOA 4P5ZA 5DI1A 3A2CA 3O71A 4RJ8A 5HORA 2VO6A 3H30A 4HGEA 4O2ZA 3HUBA 3R73A 2KULA 3HV6A 5AR8A 3IPHA 4YP8A 2C0IA 3I5NA 2X4ZA 4BCQA 4M0YA 1WCCA 1YXTA 2H8HA 2YM3A 3H0ZA 5HCXA 5C01A 2PPQA 2YIRA 3VUMA 3Q6UA 4IVDA 3HNGA 4JBOA 3VAPA 4R7IA 4YLKA 2C6IA 4D4RA 3I81A 4H3BA 3ZTXA 2ERKA 2JIIA 4GRBA 5HIEA 1BL6A 1YXXA 3NNXA 4E4NA 4GJ3A 3QQLA 4Z9LA 1GIJA 4JI9A 4RGJA 1TQMA 4RWJA 5E8ZA 3N4TA 4L6QA 3Q04A 4BDHA 4GMYA 4OT5A 3L9LA 3MWUA 5I3RA 1Z57A 3VJNA 4FV9A 4O0XA 4EUUA 3AC4A 3FMLA 4M7IA 3SOCA 4Q5EA 4JRVA 4MD8E 4N6YA 4FYNA 4AT5A 3Q60A 4OTGA 3R8MA 2B4SB 5AP4A 4GKHA 5DT3A 2CKEA 2QO2A 4ENXA 5CENA 3FZOA 2VTSA 5AP2A 4EKLA 4BCIA 5KHWA 5IA3A 3V01A 4FKLA 1UVRA 3LFDA 4PUZA 4O96A 4O0WA 5JGAA 2B9FA 4WG5A 3MVJA 5KMJA 4Q9SA 5FLFA 2WTKB 3GBZA 4DEDA 4DGLC 2BAJA 5DR6A 5DEYA 1BX6A 4NKSA 4MBIA 2OXXA 3NDMA 2CHLA 3QTWA 4FKIA 1QCFA 4TPTA 5EDQA 3UYTA 2YIWA 4DGNA 4YPDA 5LMBA 4LOQA 3QYZA 3HDMA 4IACA 2RSVA 4E4LA 1OIRA 2J0IA 1H1QA 5BQ0A 3EQGA 3WIKA 2GHMA 4HW7A 4QYFA 1OKYA 5CSHA 2YIQA 3DTWA 1UNHA 4ZJJA 3P4KA 2IZTA 4MKCA 1O9UA 5I3OA 3QRJA 2IG7A 5K3YA 4EQMA 4TTHB 5LCJA 4UMUA 2PSQA 1W8CA 4E6AA 3TZMA 1ERKA 4BCPA 2J0KA 3DB8A 3AT2A 4RX9A 5EHLA 3DS6A 4GFGA 3BV3A 3D5VA 4NFNA 4QMZA 4YO4A 4I41A 5AMNA 5FRIA 4DE4A 4CYIA 4IADA 4ZS4A 2GHLA 5IQAA 3UC3A 4AW1A 3DKGA 4I22A 1ZYDA 4IAAA 4QPAA 1V0BA 5L2QA 5HX6A 4BTKA 3R1QA 4D4YA 4XYFA 3C4WA 1XH4A 2YITA 2CLXA 4BI2A 5JRQA 2QOLA 3BU6A 3I4BA 1U5QA 4WO5A 2G01A 4ZLOA 2XM8A 4O7SA 4BBEA 4F09A 5IA1A 3TUBA 5DIAA 3AC8A 1CKIA 1PXOA 4J99A 4QMVA 4YBKA 1FGIA 5EW9A 5GZAA 3NIZA 3DLSA 3WZEA 4CFXA 1K9AA 4FZ7A 1H4LA 5HCZA 5HG5A 4XJ0A 3I1AA 4MXXA 2GMXA 2YERA 3QZHA 5HU9A 3QUEA 5CXZA 3DXNA 5AJQA 5KBRA 3NUSA 4BIBA 3I7BA 5JRSA 4E93A 1RE8A 2WELA 3N4UA 3RCJA 1NY3A 3R22A 4AACA 3EMGA 3HYHA 3PXYA 2I0EA 4MXZA 3NNWA 1APME 3BYOA 3F3UA 3MIYA 3VS6A 5CF5A 5AUVA 5F4NA 2ETMA 3OY3A 4PF4A 3E8DA 1XBCA 3CJFA 2C5VA 4D5HA 4S31A 2VU3A 4YUQA 3V5PA 2Q0BA 3DB6A 3BGQA 3OXTA 3GCQA 3DKOA 3PWDA 4QRCA 4O0VA 2E9UA 1YWVA 4LGGA 3VF8A 3QTSA 5AV3A 3FMHA 4RVLA 5CEQA 4CFVA 4DLJA 2PU8A 1XO2B 2V0DA 3PXRA 3PXQA 4DFNA 3SW4A 3UZRA 5EH0A 4X2JA 2UW6A 5GINE 2PK9A 3O51A 2ZDTA 1TQPA 2V5QA 4GG7A 5HNIX 5AUTA 3KF4A 4XMOA 3VS3A 2J51A 3GQIA 4EQCA 4BB4A 3ZO3A 3DKFA 3P7AA 1PW2A 3W2RA 3RVGA 3SQQA 2FGIA 2ACXA 2DUVA 4LYNA 3E8EA 4UY9A 5GIOE 4F4PA 4ANOA 1J1CA 2XKFA 3BGZA 5ITAA 5HO8A 4OTRA 3U9NA 5CF6A 4ZLZA 5CEOA 4RBLA 4EHEA 4D2WA 2XKDA 3EB0A 5LMAA 4ZEGA 4Y5QA 2FVDA 4AW5A 4D2TA 4W4WA 4J7BA 2JFMA 4IM3A 3P1AA 1ZYCA 5HTBA 2XVDA 2B7AA 3MPMA 4R8QA 4I21A 4ANMA 4ITJA 3FMMA 2YLEA 3KF7A 4A06A 4G2FA 1K3AA 4U45A 4XP2A 5EI8A 4RC2A 4WNKA 3TXOA 5HLWA 5EKOA 4O7LA 3QTRA 5FDPA 3FHIA 5B0XA 2P33A 5J5TA 1UU7A 2PL0A 4RLLA 1R1WA 5DE2A 4EH8A 4MCVA 3HDNA 3C0IA 3GGFA 4E5AX 5E1SA 4YR8A 4O7NA 1OL6A 2XMYA 4ITHA 3GCVA 2E9NA 2NRYA 4HYHA 4YC3A 5BVKA 1XHAA 3TJCA 4F70A 3ZSIA 3DBDA 3LE6A 2YHVA 4XG4A 4CNHA 3MYGA 3OF0A 4O0UA 1SNUA 4FV5A 3CPCA 4LUDA 2JKOA 3ORTA 4FK6A 4XG8A 4HCVA 2V7OA 1YI3A 3BCEA 4IWPA 2YCRA 4TYJA 4WG4A 1J1BA 4E7WA 3FI8A 3NSZA 1KOBA 1XJDA 2WQEA 4U3ZA 2HIWA 3FUPA 3O8PA 4FNWA 2XCHA 3LCOA 2UZTA 3TG1A 1YDSE 5EDPA 3F6XA 5CAVA 5BVDA 5T6KA 4QMWA 4CG9A 3KXXA 3L1SA 4PQNA 4X0MA 2PE1A 2G2FA 2JITA 4X2NA 3ZYAA 3LQ8A 4QYGA 4BTMA 3ZO1A 2PUUA 3QQHA 4YTFA 4B8LA 2CN8A 3C4CA 3B8QA 2Y7JA 4JBPA 2A4LA 5BMSA 4B7TA 2Q83A 4II5A 3LMGA 2UZWE 3R04A 3E3PA 2BILB 2VWIA 4DH1A 4CVAA 2A0CX 3OHTA 1U5RA 4FKQA 4Q2AA 4ERKA 4O81A 4I1ZA 4DITA 1AD5A 4Z16A 4N0SA 5DN3A 1F3MC 1O6YA 2ZB1A 3FL4A 5AIKA 2VNWA 3RPSA 3TUDA 3RAWA 4J95A 2PZRA 3QXPA 1MRYA 4RVTA 4APCA 2WMRA 4NYEA 5IF1A 2P2HA 1BMKA 4AN2A 1WVWA 4YC6A 5ETCA 3CD3A 2ITUA 3ACJA 3UJGA 4FKSA 2DYLA 1GZOA 4RMZA 4X3FB 2PULA 4KA3A 4KRCA 3QA8A 4JG7A 5M09A 3WE8A 5AV0A 2ITXA 3QHRA 2C3IB 3BIZA 1F5QA 3FSKA 3Q9YA 2F57A 1UWHA 4NM3A 3DAEA 3EL8A 4BBMA 3FZTA 1LUFA 2GNFA 4R6VA 2WAJA 4EH7A 1Q99A 2RFDA 1H26A 1MRUA 3PLAE 3LFQA 2FO0A 4FTCA 3QTQA 3QTIA 1BLXA 3UNJA 4QOXA 3QQFA 2YM6A 4D9TA 1YDRE 3OCBA 4HZSA 3NCGA 5AV2A 2BZJA 4MQ2A 4QNYA 4XCUA 5E8YA 4RT7A 1ZZ2A 2XIZA 3A7IA 4QMSA 4EKKA 2UW8A 2HZ0A 3FQHA 1Q8UA 3G0FA 4NIFB 3PYYA 4HPTE 5FM2A 1Q41A 3F3WA 5IH6A 4J1RA 3UIBA 3V8WA 4DBNA 3LXNA 5C4KA 4I6BA 1T45A 5D1JA 4CMTA 4QMNA 2JDRA 3A7JA 4XBUA 3D2IA 5B2KA 5C1QB 4GVAA 4KBKA 3C0GA 4YLJA 5FXQA 2HY81 3OG7A 4M68A 5CWZA 3ZEWA 1JPAA 4ZTRA 5JQ8A 2BPMA 4BDGA 3BHVA 4XRLA 1R3CA 5KMLA 4UMPA 2ZYBA 2E9VA 2A2AA 2XNBA 4BKZA 4TYGA 3RTPA 1ZOGA 4YZ9A 4WBBB 3TTJA 4KKGA 2X8DA 4AZTA 4W4YA 4IM2A 3ORPA 2OK1A 2YIYA 2C6TA 4QP9A 2BR1A 4NW5A 4XEYA 3VQUA 3VS5A 2P0CA 3NYNA 5IMXA 3NUAA 4FEVA 5ANDA 4FKOA 4EOSA 1YXSA 2X8IA 3P7BA 1UU3A 3MA6A 3MFSA 3GNIB 2CNUA 5EW8A 4EOQA 4KS8A 4I6FA 3O7LD 4A9RA 4O7ZA 1OECA 1ZMUA 4BTJA 5KBQA 3VUHA 2I0HA 1IEPA 1P2AA 3R8UA 3QA0A 4M67A 4F1MA 3FXXA 2VZ6A 2W1GA 4M12A 4XLIA 3R7VA 3E8CA 3RAKA 3D5UA 5IPJA 4CFWA 4LI5A 4UXLA 4RIYA 4C36A 4FTNA 5ETAA 3IKAA 4KIPA 2ZV9A 3UQGA 4F9WA 1OUKA 5D7VA 2W17A 3FMEA 4O21A 3DBEA 3GCUA 4NTTA 5JMSA 3MDYA 5DYJA 4FEXA 4D0XA 1ZARA 3OWJA 4XS2A 4BIDA 4TYIA 4E26A 4H3QA 4QTAA 4A9SA 3MY1A 1WBWA 3FYKX 4YJTA 5IMEA 2RFNA 5J9LA 4X6RA 5F20A 3ACKA 2BRGA 3K5VA 5JN2A 3UP2A 5HO6A 5CY3A 4F7NA 2NRUA 3CKXA 4XLVA 4FT9A 5M07A 4USFA 3FHRA 4L3JA 2CN5A 4PP9A 4TYHA 2BRHA 3OZ6A 1NA7A 5CSWA 3PRFA 1ZRZA 3QWKA 4XG3A 3W2CA 4FL1A 4NW6A 3FEGA 3E3BX 1P4FA 4U79A 2O65A 4ANNA 4ZTQA 3F88A 5GZ8A 2R7IA 4AOJA 4W4VA 4FKVA 3LLAA 4GJ2A 4GKIA 4FOBA 4OTPA 2XIRA 3SRVB 3UO6A 3W8QA 4Q9ZA 3S00A 4FEUA 2AYPA 5DPVA 4IVCA 3AT3A 3R7EA 4JDJA 4BC6A 2X6EA 2PYWA 3UODA 3PTGA 2QOBA 3OTVA 4D5KA 2X2MA 3DY7A 3VUIA 4HVHA 4J52A 5IH5A 5KMNA 3DT1A 3JVSA 3HP5A 4UXQA 3CQWA 2UW7A 4DFYA 2JBOA 3OY1A 3V5QA 5IUIA 3QC9A 5DEWA 3OXZA 5FDXA 5F95A 4BKJA 5AV1A 3V04A 1Y91A 4BHNA 3P79A 5A4TA 1FMKA 4ALWA 4FV6A 2C3LA 5CU3A 3NYVA 4E20A 3C51A 3OP5A 4O7YA 2WQOA 4QMTA 4C61A 5CQWA 5CAUA 5LVNA 1OBDA 2GQSA 4MX9A 2IW8A 5L8JA 3VBQA 4OTWA 4AZEA 5A4QA 2YCSA 1PKDA 4C3PA 3ZO4A 4YC8A 3HRBA 3V3VA 3HMMA 3ETAA 1MUOA 3EQRA 4F1OA 2IN6A 4EJNA 4AFEA 3QQKA 3FYJX 5IQHA 3AMAA 4J96A 1FQ1B 2QOFA 3H9RA 3MBLA 4IEBA 4OBPA 1XQZA 4BIEA 4I5CA 3TWJA 4OAUC 3HLLA 1JKLA 2XBJA 4F64A 3F66A 1JNKA 4JR7A 3CGOA 3FLWA 1Q5KA 4R7HA 4V05A 3R9DA 5I9WA 2X1NA 1G3NA 3EFLA 3E7VA 3W2PA 3ZONA 5IUGA 1YVJA 2CGVA 2JGZA 4RFYA 2PVMA 5CNNA 2W9FB 3ZRLA 4F6WA 3LFSA 3MS9A 4AZFA 4G3DA 3BU5A 1V0PA 3QBNA 2OF2A 2WPAA 3PY1A 3BHUA 2W4OA 3C4FA 2BUJA 1CM8A 2OW3A 4V0GB 1PXMA 2RG6A 1IRKA 3KCFA 5EHOA 5AR2A 2BMCA 4XV1A 3UPXA 2GFCA 1YOJA 2B55A 4IFCA 4RIWB 1UU8A 1JQHA 2QU5A 4GV1A 3VULA 4EK8A 4EUTA 4FT3A 2WTJA 1H08A 3CEKA 4RX7A 3ORMA 4MXYA 5JEBA 1PYXA 4BZDA 1WMKA 1SNXA 5J5SA 3LZBA 5C26A 4RA5A 2Y4IB 4CV9A 1H27A 3FE3A 3FI3A 3ZZEA 3MGYA 4ERWA 4WSQA 3TKUA 5ETIA 4UV0A 1CKPA 2HENA 3ZOSA 2HWOA 3EQBA 3IS5A 3LXLA 4MTAA 2C1BA 3EQHA 3UNKA 4EK4A 3HRFA 3NUPA 3R00A 2YJRA 5TT7A 4CZYB 2QHMA 4R7BA 4O0RA 4FGRA 4AAAA 5IEXA 4C0TA 4QPMA 2OXYA 2XH5A 4B99A 5DMZA 4QT1A 2QD9A 4ITIA 3NGAA 5FEQA 2BTSA 4L67A 4OLIA 2YFXA 2C6DA 3CXWA 2C3KA 3JPVA 4XG2A 4YJPA 3RCDA 4EWHA 3WI6A 5BNJA 4G16A 3PJ1A 2OJJA 4GYIA 2BROA 4UMQA 2YM7A 3TKHA 1WAKA 2IZSA 5CTPA 5IQIA 3O50A 1XWSA 3OCGA 2YM4A 3Q5ZA 1LR4A 2PVFA 4LMNA 3UG2A 3JY0A 2J90A 4UALA 5A9UA 2E9OA 5AUUA 2HY0A 4NT4A 3POOA 2XJ0A 4C7TA 5CEPA 1FMOE 3U6JA 3OEFX 3IECA 5CT0A 5BVWA 3VW8A 1M2QA 5CSPA 1QPDA 2JIVA 2JKQA 4M8TA 3VQHA 1DS5A 5JFWA 4EOKA 3RMFA 3F5PA 3G6HA 3RPVA 4ANSA 4XOYA 1CKJA 5LARA 2BALA 2YM8A 1QMZA 2BHEA 5HNBA 3RWQA 4O7WA 2C3JA 3C7QA 4WRGA 5DNRA 2YDIA 4JQ8A 3SLSA 1OZ1A 4NH1A 3GFEA 3E87A 3CCNA 1UWJA 2WTCA 3ZDUA 4KRDA 3A99A 4GYGA 4IH8A 4EHVA 2FUMA 3LJ1A 4D1ZA 3QQUA 3UOKA 1YW2A 2GHGA 3EKKA 5BYLA 3BWJA 4UWBA 3W8LA 3QGWA 4WNOA 3C9WA 4YJUA 4D9UA 3SKCA 3K2LA 4F7LA 4OAVB 2YAAA 3KREA 5IQBA 5I9ZA 1JSUA 4JG6A 4MBLA 3WF5A 4I6HA 4IBMA 3OFMA 4M97A 3NVKI 1IA8A 3PUPA 4WNPA 3ZC5A 2O0UA 2OI4X 2OZAB 4NFMA 4UB7A 1AQ1A 3QQGA 3G33A 4E6CA 4DCAA 4RZWA 3I5ZA 4CCBA 1XH9A 4C37A 3GU4A 1NVRA 5AP7A 2W7XA 5AX3A 2ZM1A 3GU8A 4G1WA 4I93A 2P4IA 4F1TA 1IR3A 1BYGA 1Y6AA 4H1MA 4FNYA 5T68A 1GJOA 3PJ3A 1DI9A 2UZUE 2QOCA 3LM0A 4TWNA 2Z7RA 1PYEA 3S3IA 5CZIA 3MFTA 2BKZA 5AM6A 1XBAA 2OJIA 3RBWA 4ASDA 1VR2A 2OO8X 4FZ6A 4APPA 4FTQA 1OI9A 1ZMVA 5HICA 3TZ8A 4MD9E 5IQFA 3EN7A 1W84A 5AV4A 4ANQA 5C03A 4P5QA 5FXSA 4O6LA 2NO3A 2ITQA 3RJCA 2BRNA 2XIKA 4FG8A 2C6MA 3KU2A 4MF0A 3BBTB 3LXKA 3FPQA 4C3FA 2PVNA 4S30A 5KKRB 4P2KA 2QI8A 1M7NA 5M56A 1M2PA 3R8ZA 3RGFA 1VJYA 4I4EA 3DOGA 4EOJA 5AA9A 5F9EA 2XK8A 4FVPA 3UOHA 2XYUA 3TNIA 4RRVA 4NKAA 3GQLA 2XBAA 3HA6A 2O5KA 2HELA 3KXGA 5CVHA 3MA3A 3W32A 4FZAB 4D4VA 2BRBA 3ROYA 3AQVA 2VWYA 5G6VA 3KK8A 5DT4A 2R3MA 1R78A 2QOQA 2XK7A 3TIYA 3ZZWA 5L2TA 2WD1A 3FZRA 4FTIA 5IG1A 2OGVA 2JLDA 3NNUA 5DHJA 1DAWA 2O63A 3EFWA 5HZNA 4PDSA 4O83A 4QMUA 4ASZA 2IO6A 3PA3A 5D12A 4QP1A 4RWLA 4UBAA 2QONA 1OKVA 1GOLA 5K9IA 3UG1A 1JOWB 4QYEA 3ZMMA 1A9UA 2PMOX 3F3TA 4PDOA 4CFNA 3E63A 4DFZE 4EORA 5CF8A 3QRUA 5DG5A 4FV8A 1Y57A 2BTRA 3SXSA 4L8MA 2QLQA 2H6DA 3UO4A 1X8BA 2VV9A 4FC0A 4MYGA 5E8XA 1L8TA 2Y0AA 1U59A 1LPUA 2YZLA 3GC7A 3Q4UA 1WBNA 5CXHA 4JQ7A 4X3JA 5J8IA 4BGQA 5ETFA 3R8LA 1KOAA 4IAFA 4XG6A 4F08A 5IA0A 5AP6A 3UNZA 5H8GA 4RC4A 4OR5A 5IUHA 5LQFA 2QCSA 4FNZA 2OJFE 3A7GA 3NW7A 4IXPA 4QP3A 5CS6A 4FTRA 4RFZA 4NUSA 5ANJA 5K4IA 3GXLA 1KE7A 2WHBA 4D0WA 3OROA 3QHWA 1J7IA 5DH3A 1UA2A 4IAKA 3EZRA 4XNEA 2IZRA 4BGGA 2VTAA 4FTOA 4RIXA 5DRDA 3CQUA 4GH2A 1WBTA 3OCSA 4C8BA 3G90X 1NT2A 4LGHA 2AUHA 4MH7A 2R3OA 5HVJA 2RFEA 2XK3A 4X2GA 3EQPA 3NLBA 1OM1A 5BVOA 2OWBA 5LVMA 5HIDA 4FV1A 4YSMA 2ZAZA 4C4HA 4WUNA 3O2MA 4IB1A 4QMQA 4TWOA 4I5PA 3DAJA 1IAJA 2YM5A 3LJ2A 2CLQA 3DNDA 4QP4A 2R2PA 4CCUA 5FTOA 5FQDC 3Q9XA 3K3IA 4CT2A 4HGLA 2Z8CA 3QALE 5KMIA 4DTBA 3WYYA 4FTAA 2X9EA 4YHJA 5HESA 1PMNA 2B0QA 5J1VA 3UOJA 3SG8A 4PL4A 3LPBA 3FC1X 4UZHA 4P4CA 4BVUA 4BYIA 1PKGA 4MXOA 3F5GA 1PXKA 4JDIA 3FMDA 5D7AA 4EH9A 3SXRA 1MQ4A 5GJDA 2OF4A 2VAGA 4BF2A 2FSLX 4OTDA 4HPUE 2WQMA 4GT5A 2BZKB 1GZKA 3C0HA 3R7OA 4AA5A 1VZOA 2AC3A 3ZFMA 4CZTA 3JVRA 4EH2A 5HX8A 5KMMA 5K0KA 4I24A 3ZM9A 5A4LA 2J5EA 3TNWA 2PE0A 4J97A 3Q9WA 4A07A 4EZ5A 5J1WA 3R2BA 4HCTA 4QMPA 1IG1A 2JAVA 3UDBA 3CC6A 1ZZLA 4JS8A 4C4JA 2XRUA 4HNIA 3FXZA 4FBXA 3KA0A 3TTIA 3DPKA 3IGOA 1CDKA 3QCSA 3M2WA 4H1JA 1XH5A 3PWYA 2I1MA 3HAMA 4O22A 4G17A 2W5HA 2QURA 4FSRA 3SAYA 3FLZA 3BEAA 4IWQA 4YZBA 5HLPA 3T3UA 5CX9A 3HEGA 4NSTA 4Y73A 3COIA 4JDHA 3DNEA 4FR4A 3MB6A 4RQVA 1Q62A 2ZV8A 4QTCA 3E93A 4WT6A 4NIFA 3PXFA 2VTOA 3DFCB 1P14A 4FSWA 3QD0A 4GS6A 1TVOA 3FPMA 4IAIA 4ALUA 3BBWA 5M08A 2UW3A 3EN6A 3PPZA 4E3CA 1QL6A 2QC6A 4J8MA 2HZNA 4ZTHA 5E7RA 3DBCA 4ZTSA 4A9TA 4D28A 4ACHA 3AOXA 3FKNA 4KKEA 2VWBA 2WTVA 4IC7A 1BL7A 3KN5A 4FG7A 4ZK5A 2J6MA 2OICA 2XNOA 3E8NA 2RL5A 2X2KA 4DGOA 3GOKA 4EK6A 5HTIA 5D10A 3KY2A 4QQ5A 4TWPA 4TY1A 4U41A 4BFMA 1ATPE 4WG3A 4GIHA 4EEVA 4C2WA 3G0EA 5JFVA 4ACMA 1A06A 2VWZA 3SW7A 4O7VA 3O0GA 3QXOA 3WZDA 3OS3A 4F6UA 2B9HA 2IVTA 3TDVA 2I7QA 5FBOA 2C0OA 4BDKA 4GW8A 5EOLA 3DV3A 2PMIA 2W96B 3Q96A 2W1DA 2B53A 4O7TA 3PG1A 2VO3A 5KCVA 4NCTA 4LUEA 4A9UA 3PA5A 3AD4A 4AW0A 3TNHA 5DFPA 4H3PA 3LM5A 3L8XA 3DA6A 2UW0A 4YZCA 2QG7A 1UNLA 5CSXA 3R9RA 4CLIA 3RI1A 4ZTMA 2EXCX 3HV5A 1OL5A 3R7IA 3RZFA 5AEPA 4GK2A 3BPRA 3WZKA 3U87A 5DBXA 3PDTA 3N9XA 5EQYA 1Y8GA 3OEZA 2GS6A 3UP7A 1WBSA 2GQGA 3ITZA 4AWIA 4YGAA 3NVMB 3LXPA 4HNFA 1F0QA 2WOTA 3LFCA 5FEDA 3HAVA 5AP0A 2B9JA 3GT8A 4LRKA 1KV1A 3RZBA 3WE4A 5H8EA 4G6NA 3D83A 4JVGA 4MVFA 5TKDA 5HQ0A 2QU6A 4FV3A 4HGSA 4K77A 3O8UA 4K9YA 4KSPA 4NM0A 3ZXZA 2QO7A 3ERKA 2WMAA 3HMPA 2VTJA 3HP2A 2WNTA 3D7TB 3NW5A 4QQJA 4TT7A 5CF4A 5AFVA 3V5WA 2XIXA 3VO3A 4L46A 4WA9A 5A4CA 3ALOA 5EI6A 2W1IA 2WZJA 3MPTA 5BYYA 2C5OA 2CGXA 4BCNA 3N4VA 2ZMDA 3OD6X 4LL0A 4B4LA 1H07A 3AGMA 2VTNA 2XNEA 4MEDA 3CTQA 2I6LA 4H05A 2XJ2A 3KRRA 4EOMA 3ZEPA 5EQEA 5KE0A 3MFUA 4IZ5A 5JK3A 3C5IA 5I9XA 3LFAA 4ZP5A 3NEWA 3EQDA 4O38A 3H10A 4G6OA 4UMTA 2C6EA 5A3XA 5HVKA 3SRVA 3ZC6A 5CAPA 4CLJA 4UEUA 2WU7A 3VHEA 1DAYA 3HZTA 2XK9A 5CU0A 4DEEA 4PMMA 2FB8A 4FZFB 5AX9A 3TM0A 1YWRA 4XUFA 3BYUA 2F7ZE 2XK4A 4U9AA 4BICA 2OFVA 3V51A 1OIUA 3L9MA 1J3HA 2GU8A 3GU7A 1OUYA 4ZMFA 3HL7A 4AT3A 2EVAA 3ODYX 2X4FA 4QMOA 1HCKA 4FICA 4ZTLA 2XP2A 3UVQA 4ZSAA 5AAFA 5IU2A 3SDJA 4FVRA 3PVWA 3SV0A 2G15A 4UX9A 2W05A 3ANRA 1JKTA 2YZAA 3H3CA 4MNEB 4A4LA 3AC2A 4ZIMA 4JG8A 2WMTA 4K6ZA 1AGWA 2I0YA 4RIOA 4LOPA 2B54A 4D1XA 4O86A 5EM8A 4C4IA 3AMBA 2F49A 4RQKA 2IW6A 3V6RA 3SGCA 4A4OA 3U8WA 4O91A 3IDCA 4RC3A 1YQJA 3QTXA 4CYJA 5IQEA 2W1EA 3R2YA 3ZU7A 3FI4A 3QU0A 5HG9A 4C38A 4Z55A 4IQ6A 2ERZE 3BHHA 1RJBA 4FEWA 4R5YA 1IAHA 4ACDA 1CTPE 3O7LB 4AE9A 3DBQA 3VRZA 2WOUA 3TI1A 3R6XA 2R4BA 3LQ3A 2B1PA 3PRIA 4IJPA 2PWLA 4AOTA 3RINA 2GNGA 5B2LA 4UMRA 5HG7A 4AGDA 2VGPA 3PIXA 4EBVA 4C4GA 5LMKA 3VVHA 4ACCA 4L68A 2E9PA 4ZJVA 3P0MA 2IJMA 1ZOEA 2YN8A 4LFIA 5EI2A 2J5FA 4YJVA 4RIWA 1W82A 4E4XA 5JKGA 3EHAA 3D9VA 4U3YA 3AG9A 2GNHA 3Q32A 4GK4A 2QVSE 4WHZA 3GC8A 4EYJA 4FL2A 4BBFA 4J98A 5LXMA 2VX0A 3QRKA 3OTUA 1SM2A 3OWPA 3CQEA 4CQGA 2IWIA 3F5XA 4Z3VA 3GC9A 1U54B 3CTHA 3E62A 2HXQA 4AGWA 3C4EA 3COMA 4ONAA 3AXWA 4EC8A 2R3RA 3EIDA 3PJ8A 2QG5A 2V55A 4QP2A 3A60A 5J7HA 2XEYA 3NWWA 1PF8A 1PXPA 3ORNA 2XZSA 3W10A 3DFAA 3ZLSA 2WXVA 5FTQA 4GSBA 5H8BA 3I6UA 4CMUA 3QKMA 4CSVA 2EUFB 2HOGA 4QO9A 1XBBA 2JAMA 2QR8A 2UW9A 3BQRA 2WEIA 3EN5A 4IDVA 3VHKA 4FUXA 3ZRMA 2HK5A 2OIDA 4XX9A 5CEMA 2R3QA 2JD5A 2VWWA 3I79A 4X7QA 1Q8YA 4RA4A 4MHAA 4DH7A 2A19B 3H4JA 4C34A 4DN5A 2QNJA 4G3CA 3PVBA 4HVIA 3V5JA 3G2FA 2WMVA 4IB5A 4BCKA 2QOIA 2XB7A 3OBJA 4IIRA 4YTHA 5ANIA 4FEQA 5C8MA 4Y5HA 4MF1A 2NNWB 3LKMA 1J7LA 4IW0A 4EJ7A 2YISA 3BELA 1GIIA 4OUCA 5M4UA 3GC0A 2GNIA 2B9IA 3F3VA 4L52A 4EBWA 1QPJA 3D2KA 1YDTE 5E1EA 3EQIA 4ACGA 2F2CB 4OTHA 3JR1A 4HVDA 3FLYA 4BI0A 1NVSA 4C58A 5AADA 4PP7A 3DLZA 4B8MA 4H39A 3IW7A 4YZDA 3KN6A 4E4MA 3WF6A 3RNIA 4D2SA 2HW7A 3V8SA 4QYYA 1OPJA 1FGKA 2WIHA 3MVMA 2R3PA 4USDA 5M4IA 1G5SA 4HYUA 2VTTA 4BDAA 5LVOA 4KIKA 1R0PA 4YURA 3UQCA 3IW8A 3FMJA 5M57A 4K18A 3BYMA 1Q4LA 5FD2A 2XKEA 3KXMA 2LAVA 3ZSHA 4BKYA 2ETRA 2GFSA 3LLTA 1R0EA 5DRBA 4DF3A 3VNTA 3VS1A 4EH5A 5HD4A 3GFWA 4D2RA 2PUPA 1URWA 3MH3A 5E8VA 5HEZA 1PHKA 3TV7A 4ZTNA 2VWVA 4FT0A 3U4WA 1FVRA 2PMLX 2UZOA 1VYWA 4EI4A 3ANQA 3VC4A 4EHZA 2OZAA 4S33A 4HVSA 2QHNA 4FV0A 4JRNA 4KBAA 4BR3A 4E6QA 3IO7A 2NP8A 5CU2A 5HKMA 4QYHA 2BFYA 2PVLA 3GI3A 5FEEA 4AN3A 4R3PA 3I0QA 1OKZA 2V22A 3F2AA 3PVUA 1T46A 5HG8A 4AZVA 3OVVA 2HZIA 1TQIA 4OTIA 2RIOA 3A8WA 3CP9A 3QFVA 5TO8A 5M51A 2F7XE 3IDBA 3PP1A 1KE9A 3HV4A 4FTLA 2PE2A 3AT4A 3CTJA 2CNQA 4FKGA 4BDBA 3LFFA 4FTKA 4JOAA 1P5EA 1MQBA 5FGKA 2BDFA 2EU9A 2WQNA 3HA8A 3MTLA 4G3GA 2GPHA 4WSYA 3U55A 5FP6A 3U6HA 2WMBA 3OCTA 3KRJA 2FSOX 3PXZA 3LCDA 5J79A 4ID7A 5EOBA 1ZYLA 5EM7A 4G34A 3UQFA 4W9WA 4XP3A 4LV5A 3VUKA 4I4FA 3JY9A 4TZRA 3UIXA 2BKKA 5CEKA 4ARKA 4FG9A 3DQWA 4R1YA 5J9YA 3GB2A 2ITTA 4FKPA 4C35A 5DWRA 1HCLA 4BWXA 1OIYA 5AR7A 4IZAA 4KIQA 3RHXA 4PDYA 2G2IA 5B2MA 2P3GX 3EYHA 5G1XA 4CKJA 2JFLA 5M53A 1JSTA 3L9PA 4FKRA 4L9IA 4NK9A 3KK9A 5IZFA 2YACA 2YIXA 3DAKA 2HXLA 1BI8A 4B9DA 5C4LA 3E7OA 3RNYA 4M69B 3F2NA 4CT1A 5M44A 2CMWA 4QP8A 3L9NA 3W1FA 5JH6A 3ZCLA 3PZHA 4EH6A 3DCVA 3PJCA 4IB3A 3BGPA 1SMHA 4ZOGA 4C33A 2VD5A 1EH4A 2X7GA 4I5HA 4FV7A 5JGBA 5FG8A 2W0JA 2WB8A 2ZV7A 2CGWA 4BCGA 2C47A 1VYZA 3PA4A 4GU9A 4BZOA 3OOGA 4E5BA 3GEQA 2VO0A 4QMMA 2EB2A 3OT3A 5I9YA 2Z7QA 4HZRA 3GCSA 2EXMA 1OGUA 4K0YA 4F99A 4M3QA 4TNBA 2W5AA 1JKKA 3MB7A 3R1SA 4J53A 3NCZA 4UN0C 5L2WA 3SD0A 4CTCA 1XH6A 2VTQA 2C0TA 3ZHPC 2WTKC 3WARA 3C50A 4O1PA 1Q3DA 4LRMA 3CIKA 4I94A 4AT4A 5AAEA 2UW4A 1I44A 4KNBA 4XV3A 4HYIA 5EG3A 3Q9ZA 3R9OA 1YXUA 4WUAA 2IVUA 3QRIA 5EM5A 4IX4A 3BLRA 3HMIA 4FV2A 3FKLA 4U6RA 4CMOA 2C5YA 4RIYB 4RJ3A 3NNVA 2J2IB 4FMQA 5A6OA 3C13A 4ASEA 5J95A 3Q6WA 4CEGA 4D2PA 2RF9A 5BVEA 4AS0A 4EL9A 2QOOA 1H1RA 3VUTA 2W9ZB 5IQGA 3BU3A 5BPYA 2R3NA 3D0EA 4AP7A 5BX0A 4DC2A 2XNGA 1YHSA 3IG7A 5HLNA 5LWMA 3R83A 3S1HA 5IDNA 1SVGA 3A61A 4W4XA 3ID6C 3B2TA 4PMPA 2WQBA 3R8VA 3GU6A 1Q8WA 1OPKA 5LVPA 5D9HA 4BDCA 1E9HA 5IISA 2ZMCA 2WTIA 1M52A 5HHWA 5I5ZA 2OH4A 5L6OA 3Q2JA 4YMJA 2BAKA 4GFOA 5ICPA 3NUYA 2UZNA 4GL9A 2O2UA 4FIEA 3KGAA 2YDKA 2Q0NA 3F5UA 2V62A 4KD1A 4TNDA 5AIRA 3SC1A 3VN9A 3IONA 2R3JA 1OIQA 2O3PA 4V04A 4XHKB 5EKNA 4RX8A 2ZM4A 4YJQA 4S32A 4TRLA 4ORKA 3G9NA 1JKSA 3GOPA 2DS1A 3QX2A 3HGKA 4M15A 4FSQA 2J0JA 3RAHA 3TL8A 4K1BA 4DH5A 4CFMA 4NM5A 3KQ7A 3CPBA 3R21A 3UZTA 4BZNA 5TE0A 4ALVA 3W2OA 5CANA 2AC5A 4RZVA 4F9YA 4FK3A 4YNOA 3LOKA 2PVRA 4FIFA 4BCFA 1YOLA 1OB3A 3KULB 4YZNA 3G9LX 5IQCA 2WKMA 4DYMA 4CTBA 2CNVA 1STCE 3MN3A 5GZ9A 5FUTA 4O7RA 4C4FA 4PWNA 2XA4A 4EOIA 3JXWA 3FMKA 3U4UA 3U6IA 4JL9A 2VN9A 2P2IA 3VBTA 3ZBFA 1G8AA 2YABA 1NVQA 2XRWA 4PTEA 4O84A 2VTRA 1UV5A 4JQEA 3UO5A 5B7VA 2J9MA 1B38A 2UZBA 3C4XA 3TJDA 4DFLA 4IMYA 4ZLYA 2WFYA 1ZOHA 2QKWB 2UW5A 3DKCA 3FDNA 4FKJA 5CNOA 3PLSA 5DVRA 4JT3A 3LCSA 4S2ZA 4R77A 3QAME 3Q53A 1ZLTA 1ZWSA 2WGJA 1H1WA 3DQXA 3G5DA 2ITPA 2WTWA 3I6WA 3KRXA 4ZSEA 4B0GA 4PNKA 3TN8A 3FMNA 4AW2A 1XKKA 2OIQA 3CS9A 1ZXEA 3IOPA 4L00A 4WKQA 4Y95A 3PE2A 5LJJA 4KUJA 4Z7GA 3MTFA 4Q5HA 3ORKA 4HYSA 2PZPA 4DG0E 3ZSGA 3ENMA 5EDRA 2YAKA 2BDJA 2GS2A 4PPCA 3BKBA 3CGFA 4CFFA 4AE6A 3UZPA 4OT6A 2PMNX 1LEZA 2GTNA 3NIEA 3I60A 4I5MA 4JR3A 4EZ3A 5HBEA 4FT5A 4FIHA 4AUAA 2ITNA 4FIJA 3RWPA 2YWPA 3BYSA 1WFCA 2X7FA 4G3EA 3RHKA 4NJDA 3V5LA 5KZ0A 5CI6A 4DHFA 3ZLXA 5HI2A 2R3IA
chains in the Genus database with same CATH superfamily
3OXIA 4RJ6A 3ZXTA 4CRLA 3ALNA 1OL1A 1CSNA 1J91A 1W0XC 5AR5A 3MI9A 3QZFA 3RP9A 3D94A 2X81A 3H9FA 5ACKA 5CSVA 4FX3A 4DEHA 5A46A 2XALA 5JFSA 5KO1A 3WF9A 2ETKA 2G2HA 3ODZX 4LGDA 4TXCA 3R30A 4K8AA 5K5XA 3PPKA 2OJ9A 2VUWA 3D7ZA 3KRLA 3LCTA 4CGAA 2EWAA 2XNMA 2R3LA 3TV6A 3KL8A 3WZUA 1E1XA 3QQJA 1UNGA 1FINA 2ZV2A 3KEXA 4DGGA 2X9FA 2Y8OA 2ZVAA 4IWDA 3R9HA 3FLQA 3WILA 2CJMA 4YJOA 4JJRA 3PJ2A 4JXFA 4OGRA 5IKWA 1W7HA 2GTMA 3I0OA 5CT7A 2OXDA 4EQUA 3AKJA 4DFUA 1DI8A 2VX1A 3BRBA 4I0SA 4TW9A 1KUTA 2W1CA 3OWLA 3ENHA 4XV2A 4C2VA 1JSVA 1XH7A 3VS0A 5L4QA 4KS7A 5EFQA 4FVQA 1QPEA 4IX6A 4BYJA 2Y4PA 2OZOA 2QOKA 2Y9QA 5DR2A 3UMXA 4DEIA 2UZVA 1L3RE 2OBJA 3MJ2A 4AX8A 1J7UA 2ONLA 3KMWA 4FE2A 4BRXA 3FZ1A 2HAKA 4HJOA 2QLUA 3NUUA 3AC3A 3M11A 3QGYA 4O0TA 3ZS5A 4ZY5A 5E92A 1MP8A 2UZEA 5EK7A 4E73A 4E8AA 3RPOA 3A7FA 2BIYA 3EWHA 5KMKA 1ZY5A 4IZ7A 2OG8A 3O8TA 3T8OA 3P7CA 2UVZA 1Y6BA 2GNLA 3HX4A 4BWPA 4LG4A 2GCDA 1Z5MA 4FSMA 4D55A 4KABA 3D4QA 2P55A 4AF3A 4F0GA 2CCIA 3D7TA 3Q5IA 4L44A 4MAOA 5EYDA 3ROCA 3H9OA 4L53A 3DZQA 4GT4A 1CMKE 4L3PA 4XG7A 2I0VA 2PZYA 3TIZA 4F63A 4QQTA 4DT8A 3TZ7A 4IC8A 2RGPA 4RLKA 3IW5A 3WOWA 5JSMA 5K5NA 4RJ7A 5I4NA 1H00A 4FZDB 2R3KA 4PRJA 3VWAA 1H01A 4JIAA 2OSCA 1VLRA 3COHA 3C1XA 2QODA 4NTSA 4PMSA 4GK3A 3ORZA 4X3FC 4Y72A 2JC6A 3KXNA 3TNQB 2H34A 2YJSA 4GFMA 4BWKA 3QTUA 4O1OA 5FBNC 2WMXA 1S9IA 3NS9A 3MV5A 3RM7A 1OKWA 2CSNA 5BUEA 2OFUA 4NU1A 2CDZA 4FV4A 4QQCA 3POZA 1H25A 2YA9A 5E90A 4C3RA 4IFGA 3TMOA 5E9EA 1R39A 3QD4A 1FVTA 2PHKA 3NUNA 4N57A 4O0SA 4EONA 3QKLA 3OWKA 1HOWA 1I09A 1OVEA 4YO6A 3VBXA 4DCEA 4FYOA 4FGBA 3ULZA 4A7CA 2FSTX 4G31A 2CKPA 3UPZA 4DA5A 4BDFA 4X3FA 4XV9A 3U54A 4ZMEA 4IVBA 4FIGA 4KWPA 4MWIA 2HZ4A 3TACA 4AGCA 1ZY4A 2YDJA 3WBLA 3RK5A 2BCJA 2BFXA 5HU3A 3IK3A 5LOHA 4IAYA 4EH4A 3HUCA 4BDEA 1WVYA 1DM2A 1OMWA 4U97A 2Z7SA 4MWHA 2VWXA 4F9BA 3AD6A 1FPUA 3F61A 3N51A 4IZYA 3ZRKA 3R1NA 3LVPA 4KBCA 3R9NA 1SYKA 4EC9A 4NM7A 4MNEA 3ZLWA 1BUHA 2PVJA 4O2PA 1UKIA 4DHJA 3GU5A 3IW4A 2REIA 2Z2WA 2XIYA 4UWYA 3GENA 3SX9A 1ZMWA 5CU6A 2PZIA 3R7YA 4D2VA 1YI6A 3OW4A 4U8ZA 4FTTA 3VRYA 1O6LA 5GIPE 3R28A 2JDVA 3QKKA 3GUBA 3MH2A 5HE0A 3V8TA 5JT2A 3R71A 1YI4A 3FZSA 4YNEA 3MH0A 3OUKA 5FM3A 5D11A 3T3VA 4HVGA 1SZMA 1E1VA 4W8EA 4NCTC 5ANOA 4IM0A 4G9RA 4YTCA 3DJ6A 3ZUVA 3CD8A 4DEBA 4DFBA 5BYZA 2W1FA 3LFBA 4AGUA 2C68A 4PPAA 2BHHA 3OW3A 5EQPA 3R63A 3KMUA 3QL8A 4BI1A 2I40A 4A9YA 4XRJA 2G9XA 4S34A 2BVAA 4FSNA 1GAGA 4TKSA 1U4DA 3NUXA 3Q4TA 3QF9A 1OL2A 5DT0A 3GP0A 5L2SA 5A6NA 3FLSA 3WF8A 4BTFA 3ELJA 2C4GA 3OMVA 1KE8A 2IVSA 4L42A 4FODA 5CYIA 5M4CA 3BE9A 3II5A 4GUEA 1PXNA 3MPAA 4FKUA 4FSUA 4KINA 3PE1A 5C27A 4Y85A 3MY5A 4F6SA 5K4JA 2X6DA 2H9VA 3JS2A 4YJSA 2WMQA 4BCJA 2PUNA 4U5JA 4FF8A 3DJ5A 4FTMA 3FZPA 3E88A 5E8WA 2BAQA 3VS4A 5C8NA 3ZDIA 5IEYA 5J87A 4QMLA 3VS7A 1RQQA 3KRWA 3HECA 1TKIA 2HWPA 2XM9A 3KFAA 3TUCA 4QD6A 5A54A 3P23A 4YTIA 5L2IA 2BRMA 3DXQA 1U54A 2HCKA 2J0LA 4DH3A 3Q3BA 4LOOA 3ZUUA 3P5KA 4NL0A 2FH9A 4WOVA 1YHVA 2OU7A 3KXZA 4O6EA 3SVVA 2XYNA 3MH1A 2OIBA 2XKCA 3AC1A 4MUQA 3RK7A 3KVWA 1IASA 4D58A 4RSSA 4EOLA 4YJRA 3R7GA 5CASA 5CEIA 2XNPA 4KKHA 3AD5A 1PRYA 2YLFA 4EH3A 5KUPA 3PIZA 3NW6A 4X6QC 2X2LA 3Q4CA 3CSVA 2R0IA 2C5NA 4USEA 3ATTA 4L3LA 4EZ7A 4BJJA 3LFNA 4LV7A 3EN9A 3S95A 2Y6OA 5L3AA 4EOOA 1BKXA 4UWCA 1PXJA 3VBYA 1RW8A 4HCUA 4F9AA 2ITWA 3BLAA 3DXPA 4RIXB 3SG9A 3DK7A 2R7BA 4FUYA 4RVKA 4XH6A 4BCHA 4V01A 5K0XA 4BDDA 2XK6A 2IPXA 5HOAA 3QZIA 3CR0A 3FY0A 3K54A 2O8YA 5AR3A 4HGTA 3BWFA 3EN4A 4E5WA 2UVYA 3OOMA 2FA2A 5GHVA 1SVHA 5L6WL 1M17A 4FA2A 2ITVA 2XEZA 5CI7A 5J9ZA 4IB0A 5DOSA 1M14A 4E1ZA 2A27A 1GZ8A 4DGMA 2VTMA 3CJGA 3BQCA 1H24A 1U46A 3R02A 3NAYA 4NZWB 4AA0A 3BEGA 4F0FA 4WD5A 3FQEA 4FKWA 4R3CA 3TEIA 3FLNC 4PL3A 3U9CA 5JZNA 2F7EE 2GSFA 3VJOA 3S0OA 3EQFA 5C9CA 3UC4A 1WBOA 5EW3A 3PPJA 2R3GA 2J7TA 5IA4A 2W5BA 3C4ZA 4ZZOA 4IHPA 5TF9A 1WBVA 3L8PA 2RG5A 4K2RA 5EHYA 2BIKB 2XS0A 3ATSA 2F9GA 4KB8A 5IA5A 3ZLYA 2W4JA 4J8NA 3G6GA 1BI7A 3M42A 4B6LA 4BDIA 2IZUA 1MRVA 4F0IA 4FOCA 3FI2A 2JBPA 2VTPA 4GU6A 3BL7A 1GZNA 3ULIA 1O6KA 3W2SA 2WU6A 2C69A 1Q97A 3H0YA 2A98A 4I92A 3DU8A 4F65A 5CAOA 4ZY4A 1WVXA 5T3QA 4ZAUA 4QTBA 3EH9A 3IDPA 5CVFA 4O82A 4XBRA 3W33A 2C1AA 3E5AA 4A4XA 2QO9A 1KWPA 5E91A 5TOZA 4DBXA 1LEWA 1YOMA 5BVFA 3BV2A 1Q3WA 2XNNA 3P9JA 5LMKC 4PPBA 2CGUA 2QR7A 4DT9A 2WEVA 5ANGA 5ANEA 2SRCA 4L01A 2UVXA 4WBOA 3IOKA 3DJ7A 3A4PA 3F69A 4JLCA 5ANKA 3VUDA 4DTAA 2W1ZA 2VTLA 2WIPA 3G51A 3LQ5A 3U51A 1Y8YA 2R9SA 2ZJWA 2XJ1A 2ZM3A 3Q2MA 3QCYA 2Y6MA 4KAOA 3PY3A 3RK9A 4UYAA 5FTGA 2YWVA 3BZ3A 4DHIB 2Y4IC 2XARA 4FI1A 5DA3A 4Z7HA 3TZ9A 1OL7A 5I9VA 5DLSA 2KTYA 4YU2A 3HRCA 4DTKA 3MESA 3RM6A 1JBPE 1XR1A 4YHTA 1M7QA 3CE3A 4WNMA 4MXAA 2ESMA 3O17A 4EYMA 3EFJA 4V0GA 3T9TA 3FL5A 4IX5A 4LMUA 5AWMA 4ZXTA 4U7ZA 5LWNA 4BN1A 3BLQA 3BHYA 4CV8A 2B52A 3A8XA 3E92A 3KVXA 4FSTA 3LIJA 4YHFA 4ZS0A 3MY0A 1JAMA 3REPA 3W2QA 5BVNA 3UVPA 3BE2A 3OBGA 3FQSA 5IQDA 4F7SA 3KMMA 5IDPA 4M69A 3F82A 3A7HA 2GDOA 4MBJA 5D41A 4H58A 4PTCA 5EYCA 2R5TA 3PSCA 2OH0E 4W9XA 2W1HA 5CU4A 4DEGA 3BLHA 3LCKA 4ASXA 4RWKA 4QDVA 3KKVA 4FSYA 4U42A 3RPYA 3EYGA 4LRJA 2A1AB 4RG0A 2QQ7A 1Q8ZA 4YBJA 5F94A 5HO7A 4TYEA 2PY3A 4AA4A 4U80A 1V1KA 4TWCA 5BUIA 1H8FA 3FBVA 3MIAA 4I0TA 5L8LA 1YKRA 3BYVA 1B39A 3QX4A 4QTDA 4U81A 4UZDA 2ZFYA 3OC1A 2C6LA 1PY5A 4IAZA 2X7OA 3FC2A 4ZSLA 3VUGA 4MD7E 4BCOA 3EKNA 5JQ5A 4NJ3A 2JIUA 1GIHA 2EB3A 5LVLA 1NW1A 4BCMA 3PVGA 4LQMA 4MXCA 1WBPA 4QP7A 4IE9A 2ITYA 2O64A 4TN6A 2VRXA 1KE5A 3IW6A 5J7BA 4G3FA 4DAWA 3HVCA 2DWBA 4FIIA 4N4SA 3R8PA 5AA8A 4H36A 3FKOA 4IVAA 3WF7A 1REKA 2J50A 4DG3E 4ENYA 4UYNA 3HMNA 3BL9A 4F7JA 3HMOA 4YPSA 3O96A 5A4EA 4BL1A 2FSMX 2ZOQA 4I20A 4PDPA 5DR9A 3M1SA 4WIHA 2CCHA 3VBVA 4FSZA 3ZFYA 1G8JA 4EHGA 4R1VA 5E8TA 3QWJA 4IWOA 4DLIA 2X39A 4I0RA 5AUYA 2R64A 3EQCA 4C4EA 4JAJA 2W06A 5GNKA 5AUZA 4RVMA 5TR6A 3T9IA 3UIMA 2H96A 5IH4A 4JX7A 2BZHB 5H2UA 3QZGA 4DINA 4AOIA 3UVRA 2F2UA 5I9UA 3QUPA 4AZWA 4BDJA 1W2FA 4L7SA 3SA0A 2PTKA 3S2PA 1H1PA 2NPQA 3VW6A 3DK3A 1WZYA 1XH8A 4EK5A 1GNGA 4GG5A 4AQCA 5AP5A 3RAIA 3ZUTA 2WMSA 1KV2A 3PXKA 3NRMA 4ZY6A 1Z9XA 4BGHA 5EYKA 5KZIA 4CRSA 4GT3A 4X2FA 2ZDUA 3QD2B 1UKHA 2G1TA 2RKUA 3QTZA 3FXWA 2V7AA 4M66A 3VF9A 5AUXA 3W16A 1KE6A 5CQUA 4ANLA 4EWQA 2Z7LA 5HNGA 3NZ0A 4IJ9A 2PZ5A 3WZJA 3NX8A 5EYMA 3PFQA 4L45A 4IANA 4PV0A 5KKRC 3PG3A 3THBA 5M4FA 3F7WA 5CLPA 3PSBA 2PUIA 3FV8A 5FP5A 1SVEA 4YZMA 2X8EA 3KULA 4K11A 2DQ7X 5HE3A 4JIKA 1OITA 5HE1A 4EOPA 3DGKA 3RPRA 2XUUA 4OBQA 3V6SA 1ZAOA 3WYXA 3EZVA 1RDQE 3F7ZA 3GVUA 1H0VA 4JDKA 4G5JA 1UU9A 2BDWA 3OT8A 3TNPC 3UTOA 3TDWA 2HYYA 3KC3A 4K33A 4AU8A 3QRTA 4Y46A 5AM7A 4E6DA 2GQRA 2ITZA 2OKRA 4LL5A 3UYSA 4PL5A 5HCYA 2C30A 3SOAA 3PSDA 3ET7A 3K3JA 4I6QA 3EOCA 5H3QA 3QYWA 2RFSA 4M0ZA 4AG8A 1NXKA 3VIDA 3UDTA 3ZFXA 4FL3A 5BUJA 1Q8TA 3A4OX 3ORLA 3LHJA 3QD3A 4FTUA 1PJKA 5FXRA 4W8DA 3L8SA 1LP4A 5AUWA 2Z60A 1ND4A 3CKWA 5L6PA 4CKIA 1PXLA 3HKOA 1URCA 2F4JA 3D15A 3FWQA 1OPLA 3DK6A 3UMWA 2XCKA 3HV7A 3G15A 3LMIA 5HBHA 4RX5A 2C5XA 1JLUE 3CY2A 3B8RA 5HGIA 4C62A 1P4OA 2W99B 4XG9A 4OTQA 3F9NA 3D14A 2UZLA 4CFUA 3R01A 4G9CA 3UIUA 4PMTA 5CAQA 4KSQA 2WO6A 4JBVA 3KB7A 2HW6A 5L8KA 4Y8DA 4U43A 4C57A 3P78A 4JBQA 4HOKA 4RPVA 4WRSA 5KX8A 4PY1A 4FNXA 1OBGA 3MSSA 4AN9A 5IEVA 3W18A 4GVJA 4JAIA 3SXFA 4QTEA 2PVYA 1QPCA 2QKRA 3ORIA 3RKBA 4FTJA 2UV2A 3QLGA 4I6LA 3A62A 5AR4A 3EL7A 4CD0A 5JFXA 2VTIA 3GCPA 3P86A 3LMHA 2ITOA 3ZM4A 3QLFA 4I23A 3PIYA 1B6CB 2Z02A 2OLCA 4OBOA 5E8UA 3QCXA 4MQ1A 3UOLA 2JDSA 1PXIA 2W4KA 4D1SA 4ZSJA 3S4QA 3UE4A 3ZBXA 4X2KA 3W55A 2QOHA 4M13A 1Q24A 4Y83A 1K2PA 4QPSA 2GS7A 2OJGA 3LAUA 2YEXA 5DGZA 3AMYA 4ZZMA 4RJ4A 3NAXA 3ORXA 1JVPP 2VGOA 1YRPA 3FSFA 1JWHA 4U0IA 4G5PA 5HE2A 4TL0A 1YXVA 2R0UA 3FJQE 4FKTA 4DH8A 1GY3A 2EXEA 3R0TA 4DG2E 3BHTA 3FY2A 4M84A 5EM6A 4QMXA 4RJ5A 4ZJIA 5M06A 4CG8A 4U40A 4L7FA 3PY0A 2IVVA 1FVVA 5HIBA 1PMVA 3MFRA 3B2WA 4N70A 4P90A 4NEUA 3KXHA 4X21A 4PX6A 4CQEA 2YCFA 5ACBC 4TYHB 5M55A 3NYXA 5H9BA 4AAYA 1Q61A 4CXAA 4F9CA 4CKRA 2JKMA 5HD7A 4MNFA 5HTCA 4BHZA 3MJ1A 3Q4ZA 3R7UA 2WMUA 2UZDA 3QC4A 1ZYSA 4I3ZA 4PNIA 1TFFA 3HV3A 2E2BA 4QP6A 5C8KA 1A48A 2JDOA 4DEAA 3F2RA 4LM5A 4J71A 2CKOA 5AP3A 2UUEA 5LCKA 3IQ7A 4JX3A 1REJA 2C6KA 4GUBA 2PVKA 2WMWA 4MK0A 5FWKK 4M14A 3O23A 3QCQA 2CPKE 4QMYA 3JYAA 4R5SA 3TYKA 4KIKB 2X0GA 3BI6A 2C6OA 3AC5A 3L8VA 3EFKA 4D4SA 4NWMA 4DFXE 3ZH8A 3Q52A 5F1ZA 2VTHA 4PTGA 4AXAA 3P08A 5KMOA 3CY3A 4KIOA 4N6ZA 1S9JA 3LJ0A 4YSJA 1ZYJA 3KCKA 3RALA 1H1SA 4P7EA 4R78A 4U44A 2JDTA 3I7CA 5CVGA 3C5UA 4L43A 4O27B 3F3ZA 1H0WA 4YJNA 2R3HA 3E64A 4FT7A 3K5UA 3TCPA 3TT0A 1G8SA 1KSWA 2BZIB 3FAAA 3MVHA 4XOZA 2IW9A 2JEDA 2VNYA 2ZB0A 5CALA 3DTCA 5IA2A 4G6LA 2PVHA 3BX5A 2VX3A 2VWUA 4ZSGA 2R3FA 3UBDA 4CZUA 3DZOA 5AP1A 3JUHA 3QUDA 1IA9A 2FYSA 2JKKA 4LV8A 5GJGA 1FBNA 4IDTA 1PMEA 2VO7A 5E8SA 1V0OA 2WTDA 3DDQA 5A14A 5KNJA 4RWIA 5JZJA 4AZSA 3DBFA 4ANBA 4ZZNA 5AAGA 5E4HA 3D5XA 1H28A 4GEOA 1FOTA 2YCQA 3TV4A 4RFMA 5BMMA 3LFEA 1W83A 4XP0A 5HVYA 3PP0A 1YWNA 3NR9A 3OUNB 4YLLA 3WIGA 3SHEA 4OW8A 3R1YA 2GNJA 4C59A 1YHWA 3CLYA 3MVLA 5I0BA 3NMUF 4IX3A 4GIIA 2CKQA 4JNWA 4QNAA 1M2RA 4BY9E 1VEBA 3LW0A 4GCJA 3TKIA 2LGCA 3VS2A 2J0MB 2XF0A 2ONLC 3PZEA 5JGDA 3D5WA 3UGCA 4AFJA 5GJFA 3CBLA 3EJ1A 1PMUA 4R3RA 3COKA 3IGGA 3DDPA 2J4ZA 4EK3A 5KHXA 4OTFA 3VBWA 3NPCA 5HBJA 1W98A 3ZO2A 5CZHA 3V5TA 4C02A 4O0YA 3AGLA 3MW1A 3NYOA 4P5ZA 5DI1A 3A2CA 3O71A 4RJ8A 5HORA 2VO6A 3H30A 4HGEA 4O2ZA 3HUBA 3R73A 2KULA 3HV6A 5AR8A 3IPHA 4YP8A 2C0IA 3I5NA 2X4ZA 4BCQA 4M0YA 1WCCA 1YXTA 2H8HA 2YM3A 3H0ZA 5HCXA 5C01A 2PPQA 2YIRA 3VUMA 3Q6UA 4IVDA 3HNGA 4JBOA 3VAPA 4R7IA 4YLKA 2C6IA 4D4RA 3I81A 4H3BA 3ZTXA 2ERKA 2JIIA 4GRBA 5HIEA 1BL6A 1YXXA 3NNXA 4E4NA 4GJ3A 3QQLA 4Z9LA 1GIJA 4JI9A 4RGJA 1TQMA 4RWJA 5E8ZA 3N4TA 2AQXA 4L6QA 3Q04A 4BDHA 4GMYA 4OT5A 3L9LA 3MWUA 5I3RA 1Z57A 3VJNA 4FV9A 4O0XA 4EUUA 3AC4A 3FMLA 4M7IA 3SOCA 4Q5EA 4JRVA 4MD8E 4N6YA 4FYNA 4AT5A 3Q60A 4OTGA 3R8MA 2B4SB 4O4DA 5AP4A 4GKHA 5DT3A 2CKEA 2QO2A 4ENXA 5CENA 3FZOA 2VTSA 5AP2A 4EKLA 4BCIA 5KHWA 5IA3A 3V01A 4FKLA 1UVRA 3LFDA 4PUZA 4O96A 4O0WA 5JGAA 2B9FA 4WG5A 3MVJA 5KMJA 4Q9SA 5FLFA 2WTKB 3GBZA 4AQKA 4DEDA 4DGLC 2BAJA 5DR6A 5DEYA 1BX6A 4NKSA 4MBIA 3W0PA 2OXXA 3NDMA 2CHLA 3QTWA 4FKIA 1QCFA 4TPTA 5EDQA 3UYTA 2YIWA 4DGNA 4YPDA 5LMBA 4LOQA 3QYZA 3HDMA 4IACA 2RSVA 4E4LA 1OIRA 2J0IA 1H1QA 5BQ0A 3EQGA 3WIKA 2GHMA 4HW7A 4QYFA 1OKYA 5CSHA 2YIQA 3DTWA 1UNHA 4ZJJA 3P4KA 2IZTA 4MKCA 1O9UA 5I3OA 3QRJA 2IG7A 5K3YA 4EQMA 4TTHB 5LCJA 4UMUA 2PSQA 1W8CA 4E6AA 3TZMA 1ERKA 4BCPA 2J0KA 3DB8A 3AT2A 4RX9A 5EHLA 3DS6A 4GFGA 3BV3A 3D5VA 4NFNA 4QMZA 4YO4A 4I41A 5AMNA 5FRIA 4DE4A 4CYIA 4IADA 4ZS4A 2GHLA 5IQAA 3UC3A 4AW1A 3DKGA 4I22A 1ZYDA 4IAAA 4QPAA 1V0BA 5L2QA 5HX6A 4BTKA 3R1QA 4D4YA 4XYFA 3C4WA 1XH4A 2YITA 2CLXA 4BI2A 5JRQA 2QOLA 3BU6A 3I4BA 1U5QA 4WO5A 2G01A 4ZLOA 2XM8A 4O7SA 4BBEA 4F09A 5IA1A 3TUBA 5DIAA 3UDSA 3AC8A 1CKIA 1PXOA 4J99A 2IF8A 4QMVA 1FGIA 4YBKA 5EW9A 5GZAA 3NIZA 3DLSA 3WZEA 4CFXA 1K9AA 4FZ7A 1H4LA 5HCZA 5HG5A 4XJ0A 3I1AA 4MXXA 2GMXA 2YERA 3QZHA 5HU9A 3QUEA 5CXZA 3DXNA 5AJQA 5KBRA 3NUSA 4BIBA 3I7BA 5JRSA 4E93A 1RE8A 2WELA 3N4UA 3RCJA 1NY3A 3R22A 4AACA 3EMGA 3HYHA 3PXYA 2I0EA 4MXZA 3NNWA 1APME 3BYOA 3F3UA 3MIYA 3VS6A 5CF5A 5AUVA 5F4NA 2ETMA 3OY3A 4PF4A 3E8DA 1XBCA 3CJFA 2C5VA 4D5HA 4S31A 2VU3A 4YUQA 3V5PA 2Q0BA 3DB6A 3BGQA 3OXTA 3GCQA 3DKOA 3PWDA 4QRCA 4O0VA 2E9UA 1YWVA 4LGGA 3VF8A 3QTSA 5AV3A 3FMHA 4RVLA 5CEQA 4CFVA 4DLJA 2PU8A 1XO2B 2V0DA 3PXRA 3PXQA 4DFNA 3SW4A 3UZRA 4FRFA 5EH0A 4X2JA 2UW6A 5GINE 2PK9A 3O51A 2ZDTA 1TQPA 2V5QA 4GG7A 5HNIX 5AUTA 3KF4A 4XMOA 3VS3A 2J51A 3GQIA 4EQCA 4BB4A 3ZO3A 3DKFA 3P7AA 1PW2A 3W2RA 3RVGA 3SQQA 2FGIA 2ACXA 2DUVA 4LYNA 3E8EA 4UY9A 5GIOE 4F4PA 4ANOA 1J1CA 2XKFA 3BGZA 5ITAA 5HO8A 4OTRA 3U9NA 5CF6A 4ZLZA 5CEOA 4RBLA 4EHEA 4D2WA 2XKDA 3EB0A 5LMAA 4ZEGA 4Y5QA 2FVDA 4AW5A 4D2TA 4W4WA 4J7BA 2JFMA 4IM3A 3P1AA 1ZYCA 5HTBA 2XVDA 2B7AA 3MPMA 4R8QA 4I21A 4ANMA 4ITJA 3FMMA 2YLEA 3KF7A 4A06A 4G2FA 1K3AA 4U45A 4XP2A 5EI8A 4RC2A 4WNKA 3TXOA 4DDGA 5HLWA 5EKOA 4O7LA 3QTRA 5FDPA 3FHIA 5B0XA 2P33A 5J5TA 1UU7A 2PL0A 4RLLA 1R1WA 5DE2A 4EH8A 4MCVA 3HDNA 3C0IA 3GGFA 4E5AX 5E1SA 4YR8A 4O7NA 1OL6A 2XMYA 4ITHA 3GCVA 2E9NA 2NRYA 4HYHA 4YC3A 5BVKA 1XHAA 3TJCA 4F70A 3ZSIA 3AKKA 3DBDA 3LE6A 2YHVA 4XG4A 4CNHA 3MYGA 3OF0A 4O0UA 1SNUA 4FV5A 3CPCA 4LUDA 2JKOA 3ORTA 3AKLA 4FK6A 4XG8A 4HCVA 2V7OA 1YI3A 3BCEA 4IWPA 2YCRA 4TYJA 2XAMA 4WG4A 1J1BA 4E7WA 3FI8A 3NSZA 1KOBA 1XJDA 2WQEA 4U3ZA 2HIWA 3FUPA 3O8PA 4FNWA 2XCHA 3LCOA 2UZTA 3TG1A 1YDSE 5EDPA 3F6XA 5CAVA 5BVDA 5T6KA 4QMWA 4CG9A 3KXXA 3L1SA 4PQNA 4X0MA 2PE1A 2G2FA 2JITA 4X2NA 3ZYAA 3LQ8A 4QYGA 4BTMA 3ML1A 3ZO1A 2PUUA 3QQHA 4YTFA 4B8LA 2CN8A 3C4CA 3B8QA 2Y7JA 4JBPA 2A4LA 5BMSA 4B7TA 2Q83A 4II5A 3LMGA 2UZWE 3R04A 3E3PA 2BILB 2VWIA 4DH1A 4CVAA 2A0CX 3OHTA 1U5RA 4FKQA 4Q2AA 3W0OA 4ERKA 4O81A 4I1ZA 4DITA 1AD5A 4Z16A 4N0SA 5DN3A 1F3MC 1O6YA 2ZB1A 3FL4A 5AIKA 2VNWA 3RPSA 3TUDA 3RAWA 4J95A 2PZRA 3QXPA 1MRYA 4RVTA 4APCA 2WMRA 4NYEA 5IF1A 2P2HA 1BMKA 4AN2A 1WVWA 4YC6A 5ETCA 3CD3A 2ITUA 3ACJA 3UJGA 4FKSA 2DYLA 1GZOA 4RMZA 4X3FB 2PULA 4KA3A 4KRCA 3QA8A 4JG7A 5M09A 3WE8A 5AV0A 2ITXA 3QHRA 2C3IB 3BIZA 1F5QA 3FSKA 3Q9YA 2F57A 1UWHA 4NM3A 3DAEA 3EL8A 4BBMA 3FZTA 1LUFA 2GNFA 4R6VA 2WAJA 4EH7A 1Q99A 2RFDA 1H26A 1MRUA 3PLAE 3LFQA 2FO0A 4FTCA 3QTQA 3QTIA 1BLXA 3UNJA 4QOXA 3QQFA 2YM6A 4D9TA 1YDRE 3OCBA 4HZSA 3NCGA 5AV2A 2BZJA 4MQ2A 1TZDA 4QNYA 4XCUA 5E8YA 4RT7A 1ZZ2A 2XIZA 2X0PA 3A7IA 4QMSA 4EKKA 2UW8A 2HZ0A 3FQHA 1Q8UA 3G0FA 4NIFB 3PYYA 4HPTE 5FM2A 1Q41A 3F3WA 5IH6A 4J1RA 3UIBA 3V8WA 4DBNA 3LXNA 5C4KA 4I6BA 1G8KA 1T45A 5D1JA 4CMTA 4QMNA 2JDRA 3A7JA 4XBUA 3D2IA 5B2KA 5C1QB 4GVAA 4KBKA 3C0GA 4YLJA 5FXQA 2HY81 3OG7A 4M68A 5CWZA 3ZEWA 5BV3A 1JPAA 4ZTRA 5JQ8A 2BPMA 4BDGA 3BHVA 4XRLA 1R3CA 5KMLA 4UMPA 2ZYBA 2E9VA 2A2AA 2XNBA 4BKZA