4FNYA

Crystal structure of the r1275q anaplastic lymphoma kinase catalytic domain in complex with a benzoxazole inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
302
structure length
273
Chain Sequence
SSISDLKEVPRKNITLIRGLGHGEVYEGQVSGPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title The R1275Q Neuroblastoma Mutant and Certain ATP-competitive Inhibitors Stabilize Alternative Activation Loop Conformations of Anaplastic Lymphoma Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 93
structure length 273
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fnyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fnyA01
2GHLA 3DJ5A 5C4LA 4PMPA 3TEIA 5E8XA 2JGZA 4Y5QA 3B2TA 3CY3A 3LIJA 1JNKA 5CENA 3TM0A 2VTRA 3AOXA 3PPZA 1ZRZA 4BTJA 3BHHA 4F63A 1RE8A 4XG4A 3CY2A 4BIEA 5JN2A 4C34A 5M56A 3PA5A 4CKRA 3EH9A 2J5EA 4ZY6A 3EMGA 5AP3A 2BRGA 1V1KA 4RWJA 2E9PA 3EQCA 2JKKA 4RFMA 3D4QA 3BE9A 4YU2A 5HE3A 1OKWA 1OECA 3NUSA 5D11A 3GENA 2W1FA 4PL5A 5KZ0A 1ZYSA 4N0SA 3TL8A 4CMOA 4H05A 5L6OA 4CFMA 4RWLA 1CTPE 3UZPA 2R3LA 4EZ5A 4DFXE 4N57A 4GSBA 2QU6A 2VZ6A 3MFRA 1H1QA 3WZJA 5HCZA 5L2IA 1IAJA 1DI9A 2Z7RA 3QCQA 4IQ6A 1Y91A 1ZMVA 3TUCA 4ZXTA 3UIUA 2OF4A 2WEIA 2J6MA 2NRYA 1R78A 3HZTA 2R3QA 2IJMA 3HMNA 4P7EA 1TQIA 4A9TA 3RWPA 3NR9A 4YZMA 4BDDA 2BRBA 2BTSA 4CLIA 5M4IA 4XMOA 1HCKA 3ZO2A 4MQ1A 3ZFXA 3OBJA 3CCNA 4FKGA 3BWFA 4C4EA 4HVHA 1WBNA 3EZRA 5KBQA 4NFMA 1Y6BA 3DB8A 4E4NA 2OWBA 2QU5A 2XP2A 3FZOA 5B7VA 5CNOA 2ITXA 3EJ1A 3SX9A 2ZDTA 4CFXA 4OTDA 4TNBA 4E5WA 1WBSA 3QKKA 3A4PA 3RINA 2XZSA 1PYXA 4BDGA 4I0TA 4X3FA 3C4CA 3ANQA 4D9TA 3ORLA 1Y8GA 2HZ4A 3LFBA 4DFBA 2G2FA 3PLSA 4MYGA 4F1OA 4PF4A 1ZAOA 3ROYA 2UW0A 3COKA 3QBNA 4L44A 4TYJA 3QWKA 5DPVA 2CN8A 3ACKA 2WELA 4X2FA 2UW3A 4ZZOA 1BI7A 4BI0A 4DGOA 4KIOA 3LHJA 5HU3A 3HUBA 4RWIA 4NKSA 2OICA 4UMPA 1UWHA 2IWIA 3PZEA 3UMXA 2XH5A 5AP0A 1V0OA 2XCKA 4DFLA 3UPZA 2XKFA 3BV3A 2JEDA 5E8WA 2R4BA 5DWRA 3DNEA 5K4IA 3PPJA 4CFWA 2VWIA 4MH7A 4C37A 4A7CA 3LXKA 4EZ7A 4M3QA 4QYGA 4J52A 4RX8A 4RJ6A 3VC4A 5KX8A 1Q4LA 2WQNA 2JBOA 1WFCA 2OW3A 2QKWB 3GU7A 1PMNA 2LGCA 4AZEA 3TZ7A 1U5QA 4R78A 4K1BA 4CQGA 3ORPA 2VGPA 5EYMA 2BIYA 2JLDA 4QTEA 2HELA 1PXJA 2VUWA 3RNIA 1FVVA 3SGCA 3R8MA 2BFXA 2ZMCA 3D5VA 3IECA 4IJPA 3IQ7A 4L7FA 5HNBA 3ZTXA 4EH2A 3PSBA 4W9WA 4EZ3A 4JG7A 5I3OA 4C8BA 4Q5HA 4ZS4A 4I94A 5F4NA 3GU4A 4WT6A 3VBTA 4L3PA 5CLPA 4EH7A 4RJ5A 1K2PA 3QQFA 2WTJA 4ZTSA 2VO6A 4II5A 3MW1A 2RL5A 2YWPA 4PL3A 2W1GA 4P5ZA 4CYIA 2J50A 5F1ZA 2GU8A 4U79A 5DOSA 3UYSA 3OWPA 5AV3A 2FSTX 4LRKA 5FDXA 3LCOA 3CIKA 4AZSA 3L1SA 4WUNA 4AA0A 2ERZE 4C02A 3QZHA 4GYIA 2GHGA 4IBMA 3ROCA 3DDPA 4LFIA 2BTRA 4E93A 2CMWA 4J71A 4MEDA 4EHGA 1ZMUA 4YPDA 3ZXZA 3NRMA 3Q9YA 4UBAA 4FUYA 3UVQA 3VW8A 1XO2B 2WKMA 5CZIA 2QNJA 4NJDA 4WOVA 3QTSA 3U6IA 5HTCA 2OF2A 5KMJA 3WZEA 3OMVA 4WG3A 4EK8A 2QODA 1BL7A 1STCE 4BWKA 1KOBA 4RRVA 5IQEA 3EQRA 1BI8A 1GZ8A 3V5TA 2F49A 4IVBA 5J95A 4FVPA 4K11A 4EC8A 5BYYA 3ZEWA 3LM0A 5HBHA 3HNGA 3KN5A 3OT3A 5DR2A 4FKOA 4BI2A 4FTCA 1LEZA 4AE9A 5IQDA 1YI3A 4N6ZA 5DH3A 4BN1A 3HAMA 4AGWA 4CLJA 3HYHA 4G1WA 5H2UA 4KBCA 4O7LA 4DTAA 3W55A 3BU6A 3MBLA 2H96A 2FGIA 1XQZA 3LOKA 4GK2A 4KIPA 4L6QA 4A4OA 4ASZA 3QRIA 4JR7A 4KUJA 2FH9A 3MI9A 2EXCX 4F7LA 3V6SA 3LQ8A 4W8EA 3H9OA 4MXYA 3G9LX 4Y95A 3RPRA 2GTMA 2IG7A 3MH1A 5HCYA 2PVRA 1ZOHA 3JY9A 4OBQA 4ZY5A 3E7VA 1J7IA 4C59A 5CT0A 4D2WA 3L9LA 2ZMDA 5I5ZA 2CGVA 5L2QA 5EI2A 2JFLA 3JXWA 3Q4TA 4F0GA 4P4CA 4EJNA 3PSCA 3AC4A 4MKCA 3OHTA 4QPAA 2X9EA 2HW6A 3EWHA 2PMNX 3UP2A 2I0YA 1ZOGA 5L6PA 5HVKA 3CQUA 3EIDA 5K9IA 3V8SA 4DEIA 2WZJA 4O0TA 1IG1A 3LLTA 3LXNA 2YN8A 3QWJA 2HZNA 5EM7A 3EL7A 2UZLA 2IVTA 5G6VA 4DH8A 3DKCA 2JKMA 4U40A 3E63A 5AP7A 4GIHA 4FR4A 2C0OA 4AT5A 4FSWA 2QQ7A 4QOXA 1OL7A 5TF9A 2B53A 3QCSA 1NY3A 3HEGA 4Y8DA 3SRVA 3HMMA 2O64A 2W1DA 3FUPA 3MTFA 4YC8A 4RVMA 1W83A 3QL8A 4CZTA 5FGKA 3KVWA 4HYSA 5CAQA 3QQUA 5CAUA 4O6LA 3OY3A 4D2SA 4PNKA 5IA4A 4NM0A 2E2BA 3PRIA 3DBQA 4FKIA 3ZSIA 1UNHA 1J91A 2X6DA 1P14A 3TNQB 2OXYA 5JGBA 4M69B 5HEZA 4J98A 5EKNA 2BZIB 4A4LA 5CYIA 3DBDA 2CKOA 3LJ0A 4LYNA 4B9DA 4DT9A 5L2WA 5LVMA 5D1JA 3G5DA 2C0IA 2E9OA 1Q8TA 4FMQA 3EFKA 4MTAA 5J7HA 3WYXA 1ZWSA 1LP4A 2C5NA 3KREA 4R77A 4IX3A 1YOJA 3KXNA 4PDSA 2GMXA 3UGCA 1YXVA 5AR4A 1H24A 4G9RA 2PPQA 4RQKA 3NIEA 3BI6A 3OWLA 2YABA 3QA0A 3CKXA 1OL1A 3NZ0A 4GG5A 3R83A 4QP1A 3D5WA 3TUDA 4OBPA 4YTHA 3PIXA 1O6LA 3DS6A 3PRFA 3PXZA 3N9XA 2V0DA 2UZEA 4XV9A 2JAMA 2WEVA 3OD6X 3GVUA 1OIUA 4NWMA 5E8TA 4HGEA 4QP2A 3DAKA 5FXQA 3VNTA 2WMBA 3LFFA 2C1AA 1S9IA 4PP7A 3TV6A 4FZ7A 3HAVA 4CXAA 3E5AA 3EN5A 3UP7A 1ZYDA 4RMZA 4BCIA 4J8NA 5ETIA 2JKOA 2R3MA 3F2NA 4IAAA 4KKHA 4CV8A 2VTHA 3G6GA 5GINE 3FXWA 4C35A 4GMYA 3TV7A 3R0TA 3DT1A 3PE2A 4K0YA 1WCCA 4L43A 5E8UA 4FTRA 1G8AA 4I22A 1YRPA 3SG8A 2PZPA 2WIPA 4AU8A 3HV7A 4D1XA 3MJ1A 2QOBA 4DH5A 3UOKA 3F69A 4L67A 1JKKA 4HYIA 5EOLA 4DTKA 2OXXA 4O2PA 5A46A 4QMTA 1JLUE 3LFSA 2G2IA 4RG0A 4BKZA 1BKXA 3UIXA 3CTQA 2YLFA 1CMKE 1M2PA 4LV8A 2WMXA 2Y4IC 5K0KA 4BICA 2F4JA 4U5JA 4G6LA 3KEXA 3ZO4A 4YMJA 2NRUA 2ZM4A 3ENHA 2B9IA 4BF2A 4C4IA 5I9XA 3KU2A 4GUEA 2PY3A 4RJ3A 4RJ8A 4C7TA 2CKEA 2ZV7A 4HVSA 3OBGA 5FXSA 5A4EA 1Q61A 3OTUA 4FEWA 4M69A 4UB7A 4M84A 1W84A 2P3GX 4TRLA 4EOMA 3KRXA 3BEGA 3ALOA 4Z55A 1BYGA 3PXRA 3DFAA 4GCJA 4K18A 5LVOA 4UWBA 4AZWA 2XCHA 3BV2A 3BBTB 5I9UA 2R3PA 2X4FA 3D7ZA 4IWPA 2F7XE 4JBPA 4A9UA 3BE2A 3ZRMA 5EHLA 4O81A 4O7WA 4QQJA 4CQEA 3UZRA 4GVJA 3ENMA 4OTPA 5H8EA 4KD1A 2AC3A 2FO0A 3P23A 2ZV2A 3D14A 4EONA 3DJ6A 2QVSE 3MIYA 4KNBA 1ZXEA 3MVMA 5IH5A 3NCZA 3EQGA 2XNMA 4ZTNA 3ORZA 5JK3A 3MYGA 3H0YA 2OK1A 3FI4A 1O6YA 3KXHA 5J87A 2Y4IB 3ZO3A 1GOLA 1XH9A 2X8EA 3R00A 4N4SA 4YPSA 3NMUF 2J90A 4PDPA 1VZOA 3MA6A 4FNXA 4WUAA 3CC6A 5GJDA 3EQDA 4WHZA 3QQHA 5CXZA 3PJ2A 2YACA 1NVQA 4AS0A 2OXDA 4M13A 5CX9A 3F9NA 2W5HA 4RT7A 5BX0A 4CT2A 3TIZA 3A7FA 2ITWA 3AMBA 5IUIA 3F3TA 3PG1A 4MXZA 4NJ3A 5FTOA 2GQGA 4RGJA 3QQJA 5AP6A 1JAMA 3OOGA 4FV4A 1NW1A 4EK6A 3WF9A 5CANA 5IG1A 4XRJA 3RJCA 5DHJA 2XBAA 2Z02A 4OUCA 3LVPA 3CTJA 4KABA 4GH2A 4IE9A 2XB7A 4GJ2A 4KIQA 5CU6A 4UEUA 5KO1A 3MPTA 3N4VA 4FKUA 3ZOSA 4NEUA 4JQEA 3MB7A 3ZONA 4U8ZA 1CKPA 2GQRA 4FSQA 5C9CA 4C38A 4WG4A 3PG3A 3R1QA 4IANA 3OFMA 5K0XA 4PNIA 3KCFA 5BYZA 5FP5A 5E4HA 3PVWA 4EOLA 2OGVA 4ZOGA 4S34A 4A9YA 4G3GA 4I1ZA 5FM2A 4FIJA 5CF8A 4QD6A 4C4GA 1YI6A 3VHEA 2PMOX 3F3WA 3NNVA 2YWVA 4LGDA 4J7BA 4FT0A 3BZ3A 3W33A 3ZLXA 4F4PA 4YJUA 4IB3A 4TWPA 5EM5A 5JRSA 4USFA 4ZSLA 1PHKA 1UA2A 3ORTA 4P90A 4RBLA 4WBOA 1UU8A 2DS1A 4ASDA 5JSMA 4K8AA 2V5QA 3QD2B 5IQGA 2X7OA 5L8LA 4YNEA 3EKKA 1XHAA 3DOGA 5D7AA 5DT3A 5GJFA 1PKDA 4JL9A 2XIXA 3RP9A 5HLPA 2PUPA 3Q2MA 4GL9A 3O7LD 1XKKA 5AUVA 3VQHA 3I5NA 5FD2A 4JDHA 5HO6A 2WQOA 3NYXA 3OW4A 4FGBA 4QQ5A 2Q83A 1YWVA 2BAQA 2X1NA 4HGTA 5HIBA 4R5YA 4PRJA 3SDJA 2PVMA 4QMWA 1ZZ2A 4G16A 4R3CA 4JDJA 4QMUA 3UYTA 2YIQA 3MFSA 2YITA 4DG3E 5J5SA 3QZIA 4XS2A 5JEBA 1TQMA 3REPA 4E6DA 4NK9A 1YDTE 4BZOA 3RVGA 3R2YA 5CALA 2WGJA 3QUDA 5HESA 3T9TA 3RAHA 3U87A 3VUMA 1LEWA 5GNKA 3H3CA 3PSDA 3SOAA 5CZHA 4H1MA 4BCHA 4FSYA 3SHEA 3MFUA 4BY9E 3IK3A 3FI8A 4JX3A 4EL9A 5IF1A 2J0JA 3QX4A 3BELA 3E3BX 3NUUA 3OXZA 1XH6A 4DBNA 1AD5A 2WFYA 4IHPA 2O3PA 3KMUA 1URCA 4GV1A 4BBFA 2B54A 3IG7A 3CJGA 5TOZA 4YR8A 4CFVA 3OG7A 4KS7A 2R0UA 2R3OA 4CVAA 3UIBA 3TKIA 3ZDIA 2F2UA 1OL2A 3ZRLA 1UWJA 2GPHA 1E9HA 2YCSA 4LV5A 4AQCA 1IEPA 3COHA 2J7TA 3S4QA 4AZTA 1ZMWA 2QR7A 3LXLA 3VS6A 2G2HA 4H1JA 4ZMFA 2YCRA 4GKHA 3CQEA 1H0WA 2CCIA 4C2WA 3CEKA 1M2RA 2EWAA 3QKMA 3FMHA 1SMHA 3FLWA 4GJ3A 4R1YA 4R6VA 2VAGA 3ZFYA 4CNHA 4OTQA 5LOHA 4EQUA 3O96A 4CV9A 3L8VA 3DXNA 4QP4A 5HU9A 4EC9A 3A2CA 3PA4A 4UMTA 1YW2A 5CAPA 4AZVA 3EOCA 2FYSA 3FJQE 3P7BA 5ANIA 3ZSGA 4EI4A 4Z16A 3D9VA 4KSQA 5AAEA 2QONA 3RK7A 3QTXA 3O8PA 3HP2A 4XV1A 4I20A 4APPA 2JD5A 2YDKA 2XK6A 5CXHA 4RX9A 3VS2A 5C8KA 4G3FA 3W2RA 3TZ8A 2OSCA 2GHMA 5KMMA 5DR6A 3FZ1A 3A8XA 4BDBA 2QO2A 5A6OA 3VBVA 3DBFA 2A19B 4G6NA 2R3GA 5FBNC 2ETRA 3FLSA 3I6WA 4PQNA 2PYWA 5CU0A 1DAWA 3HVCA 3HV4A 3U4WA 3RCJA 2CNQA 1VJYA 4FSMA 3GNIB 4D5KA 4C4HA 2X0GA 3AD5A 5A6NA 5AMNA 4NCTC 3Q96A 5AM7A 3LJ1A 2HIWA 4DA5A 2OKRA 3SXRA 4E20A 3RI1A 2QG5A 4Y73A 3LM5A 5CQUA 4ITJA 4S30A 4EH3A 4UN0C 5JGAA 1A48A 2XKEA 3L8PA 3F82A 3PUPA 5HD4A 2X2MA 5HTIA 4ZMEA 2AC5A 3H4JA 1NVRA 3CQWA 5L6WL 2F2CB 4L45A 3GC9A 4EH9A 5GHVA 5KMKA 3V01A 1G5SA 3KXXA 2LAVA 2CDZA 3V5QA 4L3LA 3AC1A 1PMUA 2O8YA 4H3QA 5C03A 3VWAA 3KXZA 4D58A 4FTOA 1GZOA 3P0MA 3C7QA 3EZVA 3KGAA 3I5ZA 3LZBA 1IRKA 3VHKA 1CDKA 4BZNA 2YDJA 4UXQA 5EQYA 1YXTA 4QMMA 4R7IA 2RGPA 2GQSA 3ZYAA 5M57A 1BMKA 3WYYA 4FTTA 2PUNA 2V22A 4WNOA 3PDTA 5IQAA 3A4OX 3V8WA 1L8TA 2ITNA 3VRYA 2X7GA 2ZOQA 4EYJA 1PXOA 2QKRA 3IS5A 3GP0A 4X0MA 4ZLZA 2XK3A 2UZUE 4WD5A 5CI7A 1H8FA 2ITTA 3BHVA 3FSFA 3LCKA 4KAOA 3BGPA 3R7GA 3UOLA 3I4BA 4XUFA 1F5QA 2R3HA 2BZKB 5L4QA 2ERKA 2VV9A 2A1AB 4NFNA 2W4JA 3QQGA 4L52A 4XLIA 5KZIA 3DBEA 3I7BA 3TTJA 5IQHA 2CKQA 5IDNA 2XJ0A 3VO3A 2YDIA 3M42A 5BVNA 2QOFA 5EG3A 4FOBA 1OPLA 3QX2A 3UO5A 1FMKA 3ORMA 2PVFA 4F0FA 4OTRA 2I6LA 4R8QA 4TWCA 4OW8A 2PTKA 3R8PA 4CMTA 3G0FA 3MSSA 4MNEA 1WZYA 3VBXA 5IH4A 3OVVA 1CSNA 5C01A 3ET7A 3U54A 4F9AA 5EYKA 2YCFA 4W4XA 4CT1A 4TWOA 1U59A 2R7BA 2W1IA 4YZNA 3I60A 4O6EA 4R7BA 3OTVA 3ALNA 2R5TA 3D0EA 2ITVA 4FIGA 4EOKA 3FYKX 5JMSA 5JQ5A 5CAOA 3Q4UA 5K4JA 3QXPA 2PMIA 1SNUA 1T45A 4N70A 4HYHA 2ITOA 5DBXA 5AR8A 4JRVA 3R22A 4IIRA 2WIHA 4O7NA 2C6LA 3LLAA 4J8MA 1VYZA 4FTUA 1WBPA 2C47A 4LOQA 5I4NA 2UW5A 3HKOA 4WRGA 5CASA 2CKPA 4YLKA 3C4ZA 1H28A 4KSPA 3KL8A 1UV5A 4FTJA 4QTCA 4PX6A 4MBIA 1Q99A 4JI9A 4EH8A 5IU2A 2P33A 4ZS0A 2V55A 4ZZMA 3JY0A 4IAFA 2JKQA 3KULB 3ZUTA 4OT5A 5FDPA 4FEXA 1VEBA 2YCQA 3RPSA 2Z7LA 4FZDB 5BQ0A 3GGFA 4WNKA 3WIKA 2J0MB 3R1SA 5CEPA 2PK9A 2PZYA 5GIOE 4EH6A 1QPDA 4NCTA 3II5A 4EOJA 3ZC6A 5CAVA 1R0PA 2Y6MA 4JIKA 1M7NA 3NNXA 4EK3A 3QRTA 4UWCA 2YZAA 3OXIA 3HRBA 5M4CA 3BYSA 4AGUA 3WE8A 5AX9A 4CFNA 1O9UA 4ZLYA 5FXRA 4AZFA 4DEGA 5J5TA 4WNMA 4M0YA 4HPUE 3JVSA 2R3KA 1OM1A 1F3MC 1KE9A 3MH0A 3Q3BA 2FSLX 4FTAA 3U8WA 2CNVA 3MESA 4AAAA 3LFEA 1BUHA 1MQBA 2ONLC 4IFGA 3F3ZA 1YHWA 1APME 1R3CA 4L3JA 4BL1A 5M4UA 2X8DA 2R0IA 2GS6A 4QMPA 2UW8A 4U42A 4J97A 2WTCA 4LUDA 2BRHA 3TNIA 1J1BA 4GVAA 2VWVA 3P86A 3TXOA 4C61A 3QC4A 3VVHA 4ZEGA 2JIVA 4MAOA 4X6QC 5J7BA 3KMWA 4QNAA 3TZMA 5A9UA 3BU5A 4RZVA 3NGAA 4B99A 2JBPA 3VUKA 2F57A 4O0SA 2G15A 3THBA 4MXOA 4E6QA 3LMHA 2HXLA 2OBJA 2PZ5A 3E62A 4HNFA 4DEAA 4I23A 1Z57A 4RIWA 1P5EA 1YWRA 3CJFA 2BR1A 5ANEA 3CR0A 4BGGA 2UV2A 1E1VA 1QMZA 2HK5A 3WE4A 2PZRA 1J7LA 4AE6A 4L7SA 5ETCA 1UNGA 3NSZA 4FTQA 3R7YA 2WOUA 4G31A 2WMSA 2XVDA 2B4SB 2W99B 3C0IA 4O21A 4RC2A 3QXOA 3E8DA 4U45A 5D41A 3SQQA 3FDNA 3NPCA 3Q9XA 4QYEA 3VIDA 1OKYA 3KMMA 2O0UA 3MB6A 4AN9A 4UY9A 4EEVA 3QCYA 4ITHA 2RSVA 4WSYA 1PXIA 1PKGA 3ACJA 5HVYA 3PA3A 5BVEA 2YA9A 4L68A 5HCXA 3KULA 1QCFA 3VUGA 5HX6A 2EXMA 5ANGA 3SXSA 5HG5A 2BDJA 1YHSA 3FE3A 2X2LA 4H36A 4XG9A 3R6XA 3FXXA 4BCGA 3GU6A 4XEYA 2XNPA 5HG9A 2I0EA 4ACHA 2G9XA 3FHRA 3HV3A 2XJ2A 2OIQA 3SRVB 4AWIA 4XG7A 4M97A 4PMMA 2C6MA 5CS6A 3LQ3A 4K2RA 5DNRA 4HCUA 4C33A 3D2KA 3K54A 2J0KA 1YXSA 3CKWA 1OL6A 4FK3A 4FZFB 2W5BA 2YIXA 3MDYA 2B9JA 2C5XA 2J2IB 2ZYBA 1U5RA 3GCQA 3O8UA 3C13A 3RTPA 3HDMA 4QP7A 2CGXA 3I0QA 4V05A 3ZFMA 3F5UA 2YLEA 4FVQA 1H27A 3M2WA 3R28A 5DEWA 3NUXA 3H9FA 4P2KA 4QMLA 2GTNA 5ANDA 4LL5A 1CKJA 4IWQA 5KE0A 1JKLA 1PY5A 3R7VA 4JT3A 4BTMA 4YUQA 4UYNA 4YZBA 1Y6AA 2WPAA 3GCSA 5JZJA 2OJGA 4V04A 3G33A 3TDWA 1V0PA 4H39A 2PVNA 4EJ7A 2BKZA 5IMXA 3IPHA 3BYVA 4FKVA 4LGHA 3K5UA 5EQPA 5J1VA 1DM2A 1OBGA 3BGQA 3VRZA 5HZNA 3ZMMA 4M8TA 2C6KA 5F9EA 3BLRA 5EDQA 3AMAA 3GU5A 3I1AA 2HWPA 4YBKA 5DLSA 2VWWA 5DIAA 1OZ1A 3F2AA 4YHTA 5HVJA 4JAIA 4TTHB 2IZTA 3RPOA 3VQUA 5KMOA 3PXYA 2IVUA 3R71A 4MQ2A 4FV3A 2X4ZA 5KBRA 5LQFA 4JAJA 2XMYA 3AD6A 3BLQA 2BDFA 5ITAA 3VW6A 1Q3WA 3L9MA 4QTAA 2ONLA 2G01A 4BYIA 4U6RA 3PTGA 5F20A 4FSRA 5TO8A 3D83A 4AT4A 4FX3A 3UO6A 5CEMA 3KXGA 5IISA 5FLFA 1ERKA 5EDPA 4FV7A 1XWSA 1DS5A 1U46A 2UZWE 5EHOA 4TNDA 5HHWA 2CGUA 1RQQA 5E8VA 1KOAA 5IUHA 2R7IA 1W7HA 2BRNA 4YC6A 2CSNA 5HE0A 3AC2A 3KRJA 4PMSA 2BVAA 4YJVA 1H26A 4IJ9A 1YDRE 3FQEA 3WOWA 4R3RA 4E5AX 2JAVA 1SYKA 3HL7A 3MH3A 4RC4A 4NM7A 3MS9A 2RF9A 3ZLYA 2VNYA 4EBVA 5IPJA 5I0BA 4UYAA 3UIMA 4WRSA 3DKFA 1ZY4A 3LFNA 4AGCA 1A9UA 3GEQA 3OCGA 3IOKA 4K9YA 1Q5KA 3NW6A 3R01A 4QYHA 5E9EA 2CGWA 4BBMA 2AYPA 1I09A 1MP8A 3ZS5A 5HI2A 1NT2A 1M14A 4LI5A 4DH3A 3NNUA 5JFXA 2XIRA 3CP9A 3FV8A 3WILA 4XOZA 1AQ1A 1OUKA 2VTOA 3PYYA 4J1RA 2C6DA 4ZSGA 4BGQA 2R64A 3V6RA 2C30A 5K5XA 3TNWA 2GNJA 4IAYA 2ITPA 4C3RA 1K3AA 4RX5A 2VWBA 3R8ZA 1XBAA 1IASA 3VS7A 3UNKA 4AOIA 5JKGA 5C8NA 2HZ0A 1YXUA 4BTFA 4AW5A 4HCTA 2XKDA 2YJSA 3QGWA 3P5KA 3KN6A 4IADA 4L00A 5GIPE 5CSXA 5EYCA 4O0YA 2X81A 4RVLA 3Q9WA 4QPSA 3BHTA 2UZOA 3Q6WA 4EK5A 3OS3A 2VTLA 3VN9A 4S32A 3W2PA 1PMEA 4I5PA 4EHVA 2UZBA 3M11A 3F3VA 3IDBA 5FEQA 4OLIA 4Y83A 4ZTRA 4EOPA 5AR5A 4EKKA 2OO8X 2WMVA 4YO6A 3LXPA 3CD8A 4FV8A 3VBYA 3R9DA 4O91A 3FPMA 4W8DA 4DINA 1JSVA 3QTZA 3VBQA 4ZY4A 4E4LA 4BCOA 1PYEA 1Z9XA 3OWKA 5EHYA 3QYZA 3U4UA 1KUTA 3F7ZA 5LMBA 4O27B 1B38A 3TG1A 4D9UA 4BIBA 4AT3A 3E8NA 3F5PA 5DRBA 4G3CA 4QMVA 4AG8A 2V62A 1M7QA 2YEXA 5DA3A 1R39A 4AA4A 3ZRKA 2JFMA 4IVDA 2R2PA 4ZTMA 2DWBA 4QO9A 2C3IB 4ENXA 5IDPA 3DV3A 1M2QA 3E88A 2W4OA 3ULZA 4O7VA 4GKIA 1MRYA 2YAAA 2C5YA 2VX0A 4YJPA 3RKBA 4BDCA 2BALA 3CPCA 3TCPA 4ACCA 4GRBA 5AV1A 2JDVA 4BIDA 4EQCA 3Q53A 1TVOA 5CSHA 4CCUA 1JSTA 4Z9LA 2V7OA 3FY2A 4FOCA 2WTDA 4FTLA 4IAIA 4DF3A 4JVGA 3SD0A 3FLQA 1W8CA 3DK6A 3HDNA 4G6OA 3UVPA 4BVUA 4BWPA 3SAYA 1DAYA 3DTWA 2VTJA 2WU6A 5AUTA 4USEA 2VD5A 4D2VA 2NNWB 4C36A 4IZYA 4E6CA 3RWQA 3EN4A 2C0TA 3EKNA 3GUBA 4RC3A 4DE4A 1SVHA 1JWHA 1OL5A 2VNWA 2PVHA 3IW6A 4XV3A 5CTPA 3SC1A 2H6DA 4EQMA 5JQ8A 3F61A 3IDCA 3QRUA 1J7UA 4IXPA 3DQXA 3EYHA 1Y57A 4KS8A 3UQCA 2Z7SA 2F9GA 3CD3A 3HA6A 5AUZA 4IWOA 4CFFA 4G34A 3DKGA 3IW4A 2X6EA 4FKTA 5FG8A 3KK8A 1WBTA 4G5JA 4MF1A 4XG8A 4HVDA 2QHNA 3HMOA 3E87A 2V7AA 4MWHA 4O7TA 5BMMA 5FUTA 3BKBA 4BCQA 2OH4A 5C27A 1FVRA 4NM3A 2BKKA 1PW2A 4LOPA 5CT7A 3JVRA 4PTEA 4KWPA 5AA8A 3N4TA 3HX4A 2X8IA 1PXKA 3QHWA 4GT4A 5AR3A 4AN3A 3NYVA 4FL3A 2XNOA 2BPMA 3D15A 4K6ZA 4U81A 3ZSHA 4B8MA 4G3EA 5LVPA 2IVVA 3TNPC 2J9MA 2W5AA 3NIZA 4AN2A 3UC3A 3VJOA 5JRQA 2ZAZA 5HIDA 3UNJA 4KKEA 1JQHA 2PE2A 3FMMA 4ONAA 4ZK5A 3W10A 4ALUA 3SV0A 3FKOA 2QC6A 2P2IA 2IZSA 4IB0A 3GFEA 1FPUA 4BDKA 3D7TB 2B0QA 4BGHA 5D10A 5HO8A 3DZQA 3QYWA 4YURA 4ZZNA 5HORA 3P9JA 4XOYA 5TKDA 1K9AA 1L3RE 4U3ZA 3O71A 3QZFA 3S2PA 3NYOA 4NH1A 1QPJA 3KY2A 1V0BA 3DDQA 2PVKA 3KKVA 1VYWA 5FTQA 4IB5A 2W96B 3FEGA 4RFYA 3V5JA 5AUUA 1JOWB 1KE7A 3QAME 4UXLA 4E5BA 3WIGA 1FQ1B 2QOIA 4LMNA 5ETFA 4HVGA 2OU7A 2C3KA 5KCVA 3QQLA 4FZ6A 3ERKA 5CU4A 2EB2A 3CGOA 4IX4A 4YJRA 2P55A 5CY3A 5HG7A 4ANMA 2YIWA 3IW7A 5LXMA 4FIHA 3NWWA 5E91A 2JC6A 3FQSA 3MPMA 3UC4A 1YDSE 4ZSEA 5M55A 4IW0A 4B4LA 1QL6A 1ZOEA 4G3DA 3EN6A 5HNIX 2R3FA 3FZPA 2YJRA 3WZUA 1FOTA 3R9OA 4DFYA 2RFEA 4FYOA 4KKGA 3UG2A 4USDA 3WZKA 4GT3A 3A61A 4YSMA 1UU9A 3PLAE 3T9IA 4L8MA 1O6KA 3EHAA 4HPTE 4O0RA 4JBVA 4AP7A 5L8JA 1H1SA 3Q52A 5CEOA 4XLVA 3BYUA 3PJ3A 4IFCA 4IM2A 4Q9SA 2J0LA 5CVGA 3LFDA 3UQFA 1YVJA 4YJTA 2E9UA 5FM3A 2UZTA 4DFUA 5E8ZA 4FT5A 4MBJA 3OEZA 3QQKA 4I4FA 5EH0A 4YTCA 3BQCA 4C62A 5DRDA 3FC1X 1WVWA 4QMYA 5AV2A 2J51A 2B55A 4NU1A 4MD8E 3DFCB 5H9BA 4QP9A 4DH7A 4A4XA 2WQBA 3WZDA 4OAUC 2HXQA 5ETAA 2Y6OA 3O2MA 5F94A 3TN8A 4PMTA 4Y5HA 3Q04A 1R1WA 3EN7A 5HKMA 4AF3A 2XRUA 1IR3A 1OI9A 1OIRA 2C3LA 4FSNA 4JG8A 4IWDA 5DFPA 3RBWA 3DCVA 1OIQA 4GG7A 3D7TA 4F1MA 5AV0A 1BLXA 3UOHA 5AUWA 5AR7A 1XH4A 4O7YA 5DEYA 4HVIA 3HV6A 1YHVA 3W2CA 4D2PA 3DU8A 1UKIA 2IZUA 2OLCA 4FNZA 2PUUA 5BPYA 4KBAA 3EB0A 3HMIA 4IC8A 2CLQA 3L8SA 4CTBA 3OP5A 5LJJA 4NW5A 4TZRA 3PP0A 2W1HA 3NYNA 3WBLA 4BDHA 3DTCA 4EUTA 4FNWA 3OCSA 3VS4A 4LL0A 3BPRA 3A7JA 2IO6A 3P08A 4YBJA 3ZU7A 1TKIA 4QMOA 1FBNA 2VN9A 3E64A 2GNFA 2EU9A 3MN3A 5I3RA 3NAYA 4A9SA 2QG7A 1SVEA 3ZUVA 5I9ZA 5JFWA 5J9LA 1P2AA 3EQBA 4KRCA 4HZSA 4LQMA 4CEGA 3A7HA 4J95A 4DC2A 2VO0A 3A8WA 4RA5A 5EKOA 4ALVA 3F7WA 1ZY5A 5AAFA 3UO4A 3AC5A 3F5GA 3OEFX 3PWYA 2UW4A 4I0RA 4E3CA 3FMKA 3CTHA 3ZBXA 4UWYA 3HA8A 1XH5A 3FMLA 3S00A 4AA5A 1FGIA 3E8CA 4W4YA 3FZSA 3LFQA 2WQMA 1GIJA 3EL8A 3LFAA 5CVHA 3QRKA 4JS8A 4FT7A 4R5SA 1UVRA 3V5WA 3P7AA 4EBWA 4RLKA 4UALA 1YQJA 4DH1A 1RDQE 3ULIA 4BWXA 4EOIA 4RFZA 1HCLA 2C3JA 3L9NA 4D2RA 3IW8A 4YO4A 1PRYA 4UMRA 2BHHA 3FLZA 3BYOA 5FQDC 3MWUA 3ZLSA 1Q62A 4ERKA 5LWMA 4MNEB 2UUEA 4YHFA 5L2SA 1DI8A 3QZGA 2QHMA 4MK0A 4OTGA 3RHKA 5AADA 2F7EE 4AW1A 2JIUA 3RMFA 3ZBFA 4YTFA 1OITA 4OGRA 2HENA 2RKUA 4E6AA 3DAJA 4V01A 3Q4ZA 3R2BA 5EK7A 2QOOA 3HMPA 4PDOA 5T3QA 2F7ZE 4UMQA 3KC3A 1ZYLA 4HGLA 3C0GA 4V0GB 4PPAA 3ZH8A 3VAPA 1UNLA 3IGOA 4FV9A 4L53A 3SOCA 5K3YA 4TXCA 4JR3A 2A2AA 3ATTA 5K5NA 4NTSA 3U9NA 3PE1A 4CKJA 2HY0A 1W98A 4D4RA 4F6WA 4E1ZA 5KNJA 3Q2JA 4J53A 2BRMA 5D9HA 3IW5A 5BNJA 4FG8A 3NEWA 5AA9A 3RAWA 3I79A 3AT4A 2ITUA 3R04A 2XM9A 4FK6A 4FF8A 3OCTA 4GT5A 2PULA 4I0SA 4O83A 4FVRA 3VUTA 2YM7A 1LR4A 3LFCA 4LGGA 3QKLA 5EM8A 4QQTA 1IA9A 4YSJA 3HUCA 5C4KA 4OAVB 4WO5A 3C1XA 4DFZE 4HCVA 2ZV8A 3JS2A 4FV1A 4Y85A 4F0IA 3IDPA 2VTPA 2YM4A 3PVUA 4HYUA 4R1VA 5J9ZA 4MXCA 4ZJIA 3G15A 4FTMA 4I92A 3RPVA 2OH0E 4EYMA 2JDRA 3A62A 3FWQA 4W4WA 5IUGA 1HOWA 4M12A 3MY1A 3UNZA 1KE5A 3W2QA 4PPBA 4RWKA 3LKMA 4U0IA 5CEKA 1YI4A 2GFSA 4RPVA 1SVGA 4PY1A 5KMNA 4FI1A 4R3PA 3B2WA 4KA3A 4DG0E 3UVRA 4YZCA 3VS0A 3RM7A 4QYFA 2ZVAA 1Q8ZA 3WI6A 2WMUA 3QTIA 3Q60A 5LCJA 2Y8OA 3HGKA 5CSWA 4X2NA 4TWNA 3RALA 3T3VA 3HLLA 4U41A 3F66A 3QRJA 2UZVA 4IAKA 3D94A 5LVNA 1H0VA 4MNFA 5C8MA 3W8QA 4C3FA 2WQEA 4ANSA 1MUOA 4JXFA 1H1WA 5KKRC 3EQIA 4IDTA 1XBBA 3EFLA 4FODA 4TYIA 4ASXA 4XNEA 4OTHA 2QURA 3ZXTA 1GNGA 4QPMA 4QNYA 5IA5A 4MWIA 3NAXA 1H1RA 4TYHB 4G2FA 5A3XA 3TV4A 4BCPA 5CSPA 3HRFA 4FSTA 2VTIA 2XUUA 4RIWB 4V0GA 5DR9A 2O2UA 5EDRA 4BKJA 4YP8A 4GK4A 4YJOA 5DMZA 4QMSA 3SA0A 3PIYA 3FPQA 2OI4X 1E1XA 4WG5A 2GS2A 5JT2A 5KMIA 1GIHA 4C4FA 4I5CA 3MTLA 4CCBA 2Z60A 4AW2A 2OZOA 4CRLA 1WBWA 2EB3A 4ZTHA 5ANJA 1U4DA 3S3IA 2QOCA 4Q2AA 4DAWA 1F0QA 4RIXB 3TWJA 4BI1A 4EH5A 2NP8A 5D12A 1PXPA 3AQVA 4FG7A 1PJKA 3DGKA 5M08A 3LJ2A 2RG5A 3JYAA 4DEDA 3TT0A 2XEZA 3RAKA 4D55A 3UJGA 2WAJA 3IKAA 1KWPA 3H0ZA 2OJFE 3E7OA 1REKA 4PDYA 5DVRA 3D5XA 5M51A 4FKPA 1EH4A 4QTBA 2C5VA 5KKRB 2UVZA 1OB3A 2QOQA 2UW9A 4CYJA 5LWNA 2YIRA 4FNYA 4NT4A 1Q3DA 2W1CA 1VR2A 4XBUA 3S1HA 5IZFA 5C26A 5C1QB 1XH7A 4ITIA 4Z7HA 3OZ6A 5HNGA 3POZA 2R3JA 4OBOA 1Q41A 3R30A 3U9CA 4O82A 2VO3A 3CS9A 3ORKA 2XNEA 3KVXA 3OY1A 4KIKB 4WIHA 4YNOA 5HE2A 4BB4A 4FT3A 4DGNA 2XNGA 2BAKA 4IZAA 4QMNA 4ACMA 1J1CA 4CZUA 3Q32A 4G17A 4E26A 5CU2A 4RJ7A 4XG6A 4U43A 4IACA 3CSVA 2H34A 3CE3A 2VX3A 4FKSA 3AC8A 1JSUA 2GNLA 3ORIA 2W0JA 4GK3A 4QRCA 2UZDA 2WTKC 3ZLWA 2XM8A 3MH2A 3P7CA 4QP8A 3BIZA 4GFGA 4QYYA 4ASEA 4MXXA 4FKLA 5EOBA 4CTCA 2J0IA 3PFQA 4Z7GA 3BQRA 2QO9A 3NCGA 3I0OA 3ODZX 4U97A 1IAHA 2XK4A 2PHKA 2ZM3A 4HNIA 4FG9A 3OUNB 1SM2A 2VWUA 2YM8A 3GC8A 4ZIMA 2JDTA 4O1OA 1CKIA 3DKOA 4XV2A 4B8LA 4LG4A 5AEPA 3DA6A 5HG8A 4C58A 4TYHA 3TIYA 1UKHA 4DHFA 4D2TA 2VTQA 3H10A 4Q5EA 2OJ9A 2WTWA 3KQ7A 4YHJA 4LRMA 2XK7A 2IVSA 2IZRA 3NW7A 5HD7A 1H01A 4JDKA 5DE2A 2SRCA 4C4JA 2QI8A 3UOJA 1B6CB 2BFYA 2NPQA 1OGUA 3PXQA 4FIIA 4RIYB 4FZAB 5AP5A 5BVWA 4EORA 2PVLA 4FSUA 5IA1A 3U6JA 3GOKA 3R73A 5J9YA 2HAKA 2GCDA 4RIXA 4O22A 5HGIA 3OWJA 2BHEA 3R8VA 4UV0A 3DQWA 4MD9E 3RM6A 3QA8A 2OG8A 3CXWA 4KINA 2WTKB 3HV5A 3GB2A 4WSQA 5CF4A 3UZTA 5DYJA 4FV5A 2A0CX 2GNHA 1W0XC 2YM5A 4X3JA 2UVXA 4EHZA 2BCJA 3DXQA 3BGZA 1WAKA 1PXNA 4F65A 5HICA 2BAJA 2B1PA 2E9VA 3ZM4A 4DCEA 2IN6A 2CCHA 4GU6A 3BYMA 1T46A 3EFJA 3EQFA 3GQIA 2HZIA 3SXFA 4FV0A 2C6EA 4D4YA 3TI1A 3P78A 4MF0A 4OTWA 4M14A 4XH6A 5BUJA 5IH6A 2OFUA 4PV0A 3V04A 1JPAA 4KIKA 2ACXA 4JQ7A 2XK9A 4GS6A 2W1EA 3PXKA 2XKCA 4L01A 3ZCLA 3TDVA 3NX8A 3KB7A 3W1FA 4IZ7A 4F9BA 4MCVA 3VS5A 4A07A 5M44A 2OFVA 3MY5A 5E90A 3K5VA 3BHUA 2CHLA 3G0EA 3GOPA 1WMKA 3I6UA 3QUPA 4U9AA 1Y8YA 3ZDUA 4EOSA 1OKZA 4YJNA 4FA2A 3KRLA 3OROA 2O63A 2BROA 2HYYA 3FZTA 3PXFA 4EK4A 2B52A 3EQPA 1KV2A 3GC7A 4L46A 3ZEPA 3ZZEA 3CBLA 4BDJA 3ODYX 3BHYA 4FSZA 4BZDA 2FA2A 5DT0A 2UW6A 3OUKA 4HGSA 3AT3A 3C51A 2VWYA 3BX5A 1PXMA 3LAUA 3MVLA 2FUMA 2XBJA 3LCDA 3C4EA 4IZ5A 4YZ9A 3VUIA 4APCA 4C2VA 4DN5A 3UPXA 1FGKA 3FKNA 4JOAA 5HOAA 5ACBC 4JIAA 2VTNA 3ETAA 3BCEA 4I5MA 4TPTA 4X21A 1FMOE 4D0WA 3NW5A 3C4XA 3E92A 1Q97A 3VUDA 3KRWA 3R9NA 1H08A 4IVAA 4X2GA 4O7ZA 1GZNA 3U6HA 1P4OA 4FE2A 3R7IA 1NXKA 3NUNA 2ZM1A 1IA8A 2OIBA 3DK3A 5ACKA 1PMVA 4RIYA 4FICA 2WHBA 3R8UA 4D28A 3MJ2A 2BZJA 1NVSA 3GI3A 3NLBA 4IAZA 5AJQA 3TZ9A 4AW0A 1Q24A 3R8LA 3PJ8A 4DYMA 3NNWA 3R21A 1OMWA 2IW6A 4FL1A 4XP3A 4EKLA 3PJCA 5IA2A 4ACGA 5GJGA 2B9HA 5CVFA 4F6UA 2X7FA 3C0HA 3MGYA 5DT4A 3FMJA 5IMEA 4X6RA 4YLLA 2YZLA 3GQLA 1GZKA 4F1TA 4A9RA 4XG3A 5F95A 2WMAA 3DB6A 3NDMA 2ITQA 4BDFA 5DI1A 1WVXA 4S33A 2XIYA 1B39A 5FWKK 2R3IA 3E3PA 3PJ1A 4GIIA 2X9FA 3R7UA 2PUIA 2ZB1A 3JR1A 4RVTA 4EH4A 3Q5IA 4O96A 2VWXA 5A54A 1H07A 2VRXA 4DGMA 5LMKC 1XR1A 3KF4A 4O84A 2OJJA 2I1MA 4RVKA 4Y72A 3TJDA 4HZRA 5GZ8A 2YISA 4M66A 4O0WA 2HW7A 4I41A 3G9NA 4O0VA 5AX3A 3RK9A 3K2LA 5L2TA 1KE6A 5CQWA 5HQ0A 4MD7E 2QOHA 2PZIA 4DTBA 2GS7A 3MV5A 3UDBA 4IC7A 2GFCA 4PP9A 3O17A 3T3UA 4ANQA 4DEHA 2DUVA 3D5UA 1H4LA 5T6KA 4BCNA 3AD4A 5CEQA 2QD9A 4GU9A 4ZTQA 5TE0A 4DFNA 4L42A 4FC0A 1OBDA 1TQPA 4TL0A 3PIZA 4TYEA 3RZFA 4ZAUA 3C4FA 3KA0A 3AMYA 2A4LA 2UZNA 4E8AA 3N4UA 4RJ4A 3JPVA 3WF8A 4PUZA 4ZJJA 5I9YA 2CJMA 3PP1A 4DT8A 3Q5ZA 4FV2A 3CPBA 3VS3A 1NA7A 3SW4A 3QD0A 5A4CA 4JLCA 3V8TA 2VTSA 4DITA 5AV4A 3T8OA 3PY1A 3S95A 4JJRA 3A7GA 3V5PA 4UZDA 3GBZA 2W7XA 3I81A 4U7ZA 4BDEA 2P0CA 3DLSA 4RQVA 1YOMA 4PTCA 4M15A 4O7SA 3F3UA 4D5HA 4CD0A 1FVTA 4U44A 5L8KA 5EFQA 4I6BA 2X2KA 1KE8A 4I93A 2XNBA 5CU3A 4CG9A 4BBEA 3WF5A 1MRUA 3LCTA 5B2LA 2Z7QA 4IX5A 4XJ0A 5E1SA 2R3NA 3SVVA 3KF7A 5BVDA 3TTIA 2ITZA 1YXXA 4QT1A 3FL5A 4CMUA 3GCVA 4FIFA 3AXWA 4Z3VA 2C6IA 5DGZA 3A60A 4F9WA 1Q8UA 2AUHA 3FC2A 2WO6A 3DBCA 5FBOA 4ANOA 4YLJA 4ACDA 3IO7A 3OF0A 4I24A 2W1ZA 3RNYA 2RFSA 5EYDA 3NS9A 2Z8CA 4JQ8A 4XRLA 2PMLX 4B0GA 4FKWA 2CN5A 2BIKB 2YERA 3QFVA 4OTFA 5FRIA 4NM5A 4BCJA 4LRJA 3I7CA 4ZJVA 5IQBA 4PWNA 4O0XA 5JGDA 1JBPE 2GNGA 3GCPA 3ANRA 2XYNA 1RJBA 2GNIA 2PSQA 3COIA 3OOMA 4L9IA 5J8IA 2B9FA 4O38A 4BCMA 4D4VA 4TYGA 3R1NA 3FY0A 4FEQA 4PPCA 5CEIA 4F6SA 4JX7A 3ORXA 2YFXA 2YM6A 4BFMA 2FSMX 5I9WA 4FKRA 4XP0A 1H00A 3G6HA 5DG5A 2JDOA 3G51A 3QF9A 4IM3A 4ALWA 3R7EA 3R9HA 3JUHA 2QLUA 2W9FB 3ATSA 3QTQA 3C4WA 1ZLTA 2ESMA 3C5UA 4W4VA 5EW8A 5JFSA 1XH8A 3HP5A 2Q0NA 5M06A 2EVAA 4UMUA 2C68A 4YC3A 3FI3A 3F6XA 3IONA 3RGFA 4CG8A 1I44A 5M07A 3POOA 3COMA 4S31A 3W18A 1OKVA 3TKHA 4BHNA 1BX6A 5CNNA 2H8HA 4QMXA 5LMKA 5HO7A 5E92A 1Q8WA 4D1SA 4FT9A 2PWLA 4A06A 4AACA 3G2FA 2WMQA 2WOTA 4FTKA 4FEUA 2VTMA 2HWOA 3TKUA 5JH6A 4X2KA 1JKTA 4YJSA 2ZB0A 4BHZA 4F70A 3NVKI 4P5QA 4ID7A 4TKSA 3FL4A 3V51A 4WBBB 4I4EA 4AFEA 4QMQA 3FZRA 2KULA 2YIYA 3FYJX 3QUEA 3VF8A 3EQHA 2XF0A 2A27A 2CPKE 1ND4A 3ZHPC 4QMZA 4TY1A 3KCKA 2PE1A 3LMGA 3TNHA 5M09A 5CI6A 3ZUUA 2OZAB 3P4KA 5KHWA 4E73A 3MY0A 4C3PA 4ZSAA 4IMYA 1WBOA 2WMTA 4BYJA 2GDOA 3GC0A 2J4ZA 3QGYA 4RIOA 4EWHA 2Y0AA 4E4MA 5LVLA 2XEYA 4C57A 4DLIA 4I6FA 2I7QA 1PF8A 2NO3A 3ZZWA 2RIOA 2C69A 2OJIA 4JG6A 5TT7A 1AGWA 2H9VA 2DQ7X 2J5FA 2JITA 3OT8A 4EUUA 2CLXA 3O8TA 3Q4CA 5D7VA 1QPCA 3GXLA 2I40A 2XK8A 3C9WA 2WXVA 1UU3A 3AGMA 3DJ7A 3MIAA 3FLYA 4LUEA 5HBJA 5J1WA 1GY3A 3W2SA 4B6LA 1LPUA 3WF6A 2X39A 2WNTA 1SZMA 3HRCA 5EW9A 3QD3A 5AUXA 5AWMA 2QOLA 4CFUA 3S0OA 1YWNA 4M67A 3NVMB 1PXLA 1MQ4A 3FMEA 2XS0A 2VTTA 2W17A 4FL2A 5A4TA 4UX9A 4ANBA 3PWDA 4ORKA 4YZDA 5IA3A 4DBXA 3LCSA 5AP4A 1X8BA 5AR2A 2VTAA 4TT7A 4H3BA 3O50A 5HE1A 2UW7A 4LOOA 2KTYA 3R63A 2XIZA 5E8YA 3LW0A 4QTDA 5AP1A 4FEVA 3U55A 4AFJA 4QP6A 2ETKA 4FTIA 4PL4A 4AUAA 1M52A 4I6HA 3RHXA 3F2RA 2QOKA 5G1XA 1GIIA 3UTOA 3OXTA 3VULA 1G3NA 4NSTA 4ZTLA 2UVYA 4BDAA 5BUIA 3DY7A 2JDSA 5BVFA 4O1PA 4XG2A 3QTUA 4M7IA 3FXZA 2BMCA 5I9VA 3U51A 3FMDA 3L8XA 2ITYA 2P4IA 3QU0A 4K77A 3VS1A 3VUHA 4GUBA 3BBWA 4OTIA 1LUFA 1REJA 3MVHA 5BUEA 4LM5A 2ZDUA 3KXMA 4XX9A 2YHVA 3PY0A 4F7JA 3ORNA 2OZAA 3H9RA 2VGOA 4ERWA 3DXPA 3R02A 3MA3A 4FKJA 1OVEA 2W06A 3P79A 3SKCA 5GZAA 1XBCA 3IOPA 1Z5MA 2XNNA 4BTKA 4O0UA 4F64A 3V3VA 3C5IA 5BYLA 5ICPA 5FEDA 5HLWA 5A14A 5IEYA 3LQ5A 2HY81 3MVJA 3WARA 5M53A 5KHXA 2VU3A 2ZJWA 3CLYA 4YTIA 4GYGA 3WF7A 5IKWA 4TW9A 4NIFB 4ZP5A 3OCBA 4JRNA 4YJQA 2IW9A 4RSSA 3DPKA 4U80A 5GZ9A 1GJOA 2GSFA 3Q9ZA 3EFWA 4D0XA 5IQFA 3PPKA 4O2ZA 3O23A 4IB1A 3FLNC 4G9CA 5BMSA 5E1EA 4XP2A 4I3ZA 3DZOA 4AGDA 1OPJA 3MFTA 2RFNA 1YKRA 1QPEA 1WBVA 4FV6A 4AOJA 4WNPA 5AAGA 5EI6A 1G8SA 1KV1A 5H3QA 3RPYA 3VF9A 3ZM9A 1W82A 2IPXA 4M68A 4XCUA 4DEBA 3QTWA 4RLLA 4NW6A 4RZWA 5J79A 2Y9QA 2PE0A 2Y4PA 3G90X 3F88A 3RAIA 3N51A 4WKQA 3W8LA 3ID6C 4AX8A 4F7SA 4TN6A 4RX7A 5M4FA 3UQGA 5HIEA 4EOOA 3NUAA 3A99A 4F08A 5KMLA 1ZYJA 3E8EA 3QLGA 2PU8A 4FTNA 3LMIA 2XJ1A 1UU7A 2C1BA 5LARA 4KRDA 2XYUA 3B8RA 3KRRA 4ANLA 3SW7A 5AFVA 3M1SA 5IA0A 2PL0A 5IEXA 3QLFA 5ANKA 5KUPA 3TUBA 4J99A 4I6QA 1R0EA 3LE6A 2RG6A 3UE4A 1M17A 4BDIA 3K3IA 3RK5A 3QHRA 5E8SA 3UMWA 4E4XA 4DCAA 3GU8A 5A4QA 3R9RA 5L3AA 3FQHA 5EM6A 1Q8YA 4GFOA 5H8BA 3Q6UA 4EWQA 2VWZA 3MPAA 3AGLA 4DG2E 4IEBA 2RFDA 4GFMA 5B2MA 2DYLA 2O65A 4F7NA 4NYEA 3FSKA 4YGAA 5HBEA 1H25A 1ZARA 4I21A 4JNWA 3O0GA 3R7OA 4G5PA 4HOKA 3AT2A 3DAEA 3CGFA 2OIDA 1OUYA 2QLQA 2EUFB 4ENYA 2I0VA 2FSOX 5LCKA 3SLSA 1KSWA 4FIEA 4S2ZA 2W4KA 3ELJA 4X2JA 2C5OA 3W32A 3ZO1A 5IEVA 4J96A 4ZLOA 4XHKB 1JVPP 4FGRA 4D4SA 4WA9A 1ZZLA 3NUPA 2QR8A 5AIKA 4CSVA 3ITZA 5AM6A 2VX1A 5B0XA 4NL0A 2W05A 3KFAA 3TJCA 3RCDA 4MHAA 4DLJA 4NIFA 3AC3A 3O7LB 3SG9A 3NUYA 3C50A 4MVFA 3QTRA 5BVOA 1OPKA 3OW3A 1U54B 2WB8A 2G1TA 1XJDA 4N6YA 2C4GA 3L9PA 2O5KA 5HTBA 4JBQA 4R7HA 4ANNA 3UG1A 4ARKA 5H8GA 3LPBA 4QP3A 2PVJA 4FYNA 4OR5A 4NTTA 4KB8A 4IH8A 2Z2WA 3BEAA 4GEOA 4F9CA 5IQIA 1URWA 5EW3A 4NKAA 1ZYCA 2B7AA 2QO7A 4EHEA 5E7RA 4FUXA 2BUJA 4H58A 3FI2A 5TR6A 2HCKA 2YM3A 4IX6A 3H30A 5HLNA 3K3JA 1YOLA 1CM8A 2HOGA 3A7IA 3D2IA 3DK7A 4QQCA 2CNUA 3V5LA 3FAAA 4LMUA 5CSVA 1OIYA 3DNDA 4I5HA 4RA4A 1MRVA 4IVCA 2R3RA 2VO7A 4Q9ZA 4BR3A 4XBRA 3ZC5A 4IDVA 2WMRA 5B2KA 1H1PA 3B8QA 5JZNA 3QD4A 2C6OA 4E7WA 1J3HA 1SNXA 2P2HA 3PVGA 4BCFA 4AXAA 2ETMA 2QCSA 2XIKA 3PZHA 4PTGA 3GFWA 3QCXA 4CZYB 3FMNA 5LMAA 3FKLA 1WVYA 2C6TA 3QALE 4BCKA 5AP2A 4C0TA 3DLZA 3FHIA 4OT6A 4KBKA 2FVDA 4X3FC 4EOQA 4HJOA 2WMWA 5FTGA 2W9ZB 2XRWA 3GCUA 4MX9A 3UODA 1GAGA 5AIRA 2REIA 1ATPE 3RZBA 3EN9A 1FINA 3IGGA 4JBOA 4CRSA 5AUYA 4F09A 5IQCA 4BC6A 3PVBA 1RW8A 4AOTA 4ZSJA 4DGGA 3AG9A 4DGLC 5CWZA 5EQEA 4W9XA 1JKSA 2JIIA 3OC1A 3QC9A 4B7TA 2BILB 5FP6A 3UBDA 4NZWB 4MBLA 4BKYA 4HW7A 3O51A 3EYGA 3PY3A 4FKQA 5ANOA 1BL6A 3VBWA 4D1ZA 4K33A 5DN3A 4F9YA 2BDWA 5T68A 4IM0A 5BVKA 3R1YA 5CF5A 3GT8A 2FB8A 2YAKA 2BZHB 3P1AA 2PVYA 2E9NA 2IW8A 4GW8A 3W16A 1A06A 3VJNA 4O7RA 4O86A 4UZHA 1U54A 4CGAA 5CF6A 4MXAA 5FEEA 2WTVA 4X7QA 3TACA 4F99A 2R9SA 2I0HA 4BRXA 4X3FB 4H3PA 1S9JA 3BLHA 3BRBA 4Y46A 4CKIA 2Q0BA 2WU7A 4XYFA 2WTIA 5A4LA 2Y7JA 3E93A 4NUSA 3HECA 3BU3A 5JFVA 1P4FA 3KK9A 2XA4A 4U3YA 2ZV9A 4DEEA 3W2OA 5HX8A 2EXEA 5EI8A 3F5XA 2WD1A 3FBVA 4FBXA 4M0ZA 3BWJA 4JDIA
chains in the Genus database with same CATH superfamily
2GHLA 3DJ5A 5C4LA 4PMPA 3TEIA 5E8XA 2JGZA 4Y5QA 3B2TA 3CY3A 3LIJA 1JNKA 5CENA 3TM0A 2VTRA 3AOXA 3PPZA 1ZRZA 4BTJA 3BHHA 4F63A 1RE8A 4XG4A 3CY2A 4BIEA 5JN2A 4C34A 5M56A 3PA5A 4CKRA 3EH9A 2J5EA 4ZY6A 3EMGA 3VONA 5AP3A 2BRGA 1V1KA 4RWJA 2E9PA 3EQCA 2JKKA 4RFMA 3D4QA 3BE9A 4YU2A 5HE3A 1OKWA 1OECA 3NUSA 5D11A 3GENA 2W1FA 4PL5A 5KZ0A 1ZYSA 4N0SA 3TL8A 4CMOA 4H05A 5L6OA 4CFMA 4RWLA 1CTPE 3UZPA 2R3LA 4EZ5A 4DFXE 4N57A 4GSBA 2QU6A 2VZ6A 3MFRA 1H1QA 3WZJA 5HCZA 5L2IA 1IAJA 1DI9A 2Z7RA 3QCQA 4IQ6A 3TMOA 1Y91A 1ZMVA 3TUCA 4ZXTA 3UIUA 2OF4A 2WEIA 2J6MA 2NRYA 1R78A 3HZTA 2R3QA 2IJMA 2NYAA 3HMNA 4P7EA 1TQIA 4A9TA 3RWPA 3NR9A 4YZMA 4BDDA 2BRBA 2BTSA 4CLIA 5M4IA 4XMOA 1HCKA 3ZO2A 4MQ1A 3ZFXA 3OBJA 3CCNA 4FKGA 3BWFA 4AQKA 4C4EA 4HVHA 1WBNA 3EZRA 5KBQA 4NFMA 1Y6BA 3DB8A 4E4NA 2OWBA 2QU5A 2XP2A 3FZOA 5B7VA 5CNOA 2ITXA 3EJ1A 3SX9A 2ZDTA 4CFXA 4OTDA 4TNBA 4E5WA 1WBSA 3QKKA 3A4PA 3RINA 2XZSA 1PYXA 4BDGA 4I0TA 3NFGB 4X3FA 3C4CA 3ANQA 4D9TA 3ORLA 1Y8GA 2HZ4A 3LFBA 4DFBA 2G2FA 3PLSA 4MYGA 4F1OA 4PF4A 1ZAOA 3ROYA 2UW0A 3COKA 3QBNA 4L44A 4TYJA 3QWKA 5DPVA 2CN8A 3ACKA 2WELA 4X2FA 2UW3A 4ZZOA 1BI7A 4BI0A 4DGOA 4KIOA 3LHJA 5HU3A 3HUBA 4RWIA 4NKSA 2OICA 4UMPA 1UWHA 2IWIA 3PZEA 3UMXA 2XH5A 5AP0A 1V0OA 2XCKA 4DFLA 3UPZA 2XKFA 3BV3A 2JEDA 5E8WA 2R4BA 5DWRA 3DNEA 5K4IA 4JMQA 3PPJA 4CFWA 2VWIA 4MH7A 4C37A 4A7CA 3LXKA 4EZ7A 4M3QA 4QYGA 4J52A 4RX8A 4RJ6A 3VC4A 5KX8A 3TYKA 1Q4LA 2WQNA 2JBOA 1WFCA 2OW3A 2QKWB 2X0OA 3GU7A 1PMNA 2LGCA 4AZEA 3TZ7A 1U5QA 4R78A 4K1BA 4CQGA 3ORPA 2VGPA 5EYMA 2BIYA 2JLDA 4QTEA 2HELA 1PXJA 2VUWA 3RNIA 1FVVA 3SGCA 3R8MA 2BFXA 2ZMCA 3D5VA 3IECA 4IJPA 3IQ7A 4L7FA 5HNBA 3ZTXA 4EH2A 3PSBA 4W9WA 4EZ3A 4JG7A 5I3OA 4C8BA 4Q5HA 4ZS4A 4I94A 5F4NA 3GU4A 4WT6A 3VBTA 4L3PA 5CLPA 4EH7A 4RJ5A 1K2PA 3QQFA 2WTJA 4ZTSA 2VO6A 4II5A 3MW1A 2RL5A 2YWPA 4PL3A 2W1GA 4P5ZA 4CYIA 2J50A 5F1ZA 2GU8A 4U79A 5DOSA 3UYSA 3OWPA 5AV3A 2FSTX 4LRKA 5FDXA 3LCOA 3CIKA 4AZSA 3L1SA 4WUNA 4AA0A 2ERZE 4C02A 3QZHA 4GYIA 2GHGA 4IBMA 3ROCA 3DDPA 4LFIA 2BTRA 4E93A 2CMWA 4J71A 4MEDA 4EHGA 1ZMUA 4YPDA 3ZXZA 3NRMA 3Q9YA 4UBAA 4FUYA 3UVQA 3VW8A 1XO2B 2WKMA 5CZIA 2QNJA 4NJDA 4WOVA 3QTSA 3U6IA 5HTCA 2OF2A 5KMJA 3WZEA 3OMVA 4WG3A 4EK8A 2QODA 1BL7A 1STCE 4BWKA 1KOBA 4RRVA 5IQEA 3EQRA 3AKLA 4QEBA 1BI8A 1GZ8A 3V5TA 2F49A 4IVBA 5J95A 4FVPA 4K11A 4EC8A 5BYYA 3ZEWA 3LM0A 5HBHA 3HNGA 3KN5A 3OT3A 5DR2A 4FKOA 4BI2A 4FTCA 1LEZA 4AE9A 5IQDA 1YI3A 4N6ZA 5DH3A 4BN1A 3HAMA 4AGWA 4CLJA 3HYHA 4G1WA 5H2UA 4KBCA 4O7LA 4DTAA 3W55A 3BU6A 3MBLA 2H96A 2FGIA 1XQZA 3LOKA 4GK2A 4KIPA 4L6QA 4A4OA 4ASZA 3QRIA 4JR7A 4KUJA 2FH9A 3MI9A 2EXCX 4F7LA 3V6SA 3LQ8A 4W8EA 3H9OA 4MXYA 3G9LX 4Y95A 3RPRA 2GTMA 2IG7A 3MH1A 5HCYA 2PVRA 1ZOHA 3JY9A 4OBQA 3NFFB 4ZY5A 3E7VA 1J7IA 4C59A 5CT0A 4D2WA 3L9LA 2ZMDA 5I5ZA 2CGVA 5L2QA 5EI2A 2JFLA 3JXWA 3Q4TA 3BL7A 4F0GA 4P4CA 4EJNA 3PSCA 3AC4A 4MKCA 3OHTA 4QPAA 2X9EA 2HW6A 3EWHA 2PMNX 3UP2A 2I0YA 1ZOGA 5L6PA 5HVKA 3CQUA 3EIDA 5K9IA 3V8SA 4DEIA 2WZJA 4O0TA 1IG1A 3LLTA 3LXNA 2YN8A 3QWJA 2HZNA 5EM7A 3EL7A 2UZLA 2IVTA 5G6VA 4DH8A 3DKCA 2JKMA 4U40A 3E63A 5AP7A 4GIHA 4FR4A 2C0OA 4AT5A 4FSWA 2QQ7A 4QOXA 1OL7A 5TF9A 2B53A 3QCSA 1NY3A 3HEGA 4Y8DA 3SRVA 3HMMA 2O64A 2W1DA 3FUPA 3MTFA 4YC8A 4RVMA 1W83A 3QL8A 4CZTA 5FGKA 3KVWA 4HYSA 5CAQA 3QQUA 5CAUA 4O6LA 3OY3A 4D2SA 4PNKA 5IA4A 4NM0A 2E2BA 3PRIA 3DBQA 4FKIA 3ZSIA 1UNHA 1J91A 2X6DA 1P14A 3TNQB 2OXYA 5JGBA 4M69B 5HEZA 4J98A 5EKNA 2BZIB 4A4LA 5CYIA 3DBDA 2CKOA 3LJ0A 4LYNA 4B9DA 4DT9A 5L2WA 5LVMA 5D1JA 3G5DA 2C0IA 2E9OA 1Q8TA 4FMQA 3EFKA 4MTAA 5J7HA 3WYXA 1ZWSA 1LP4A 2C5NA 3KREA 4R77A 4IX3A 1YOJA 3KXNA 4PDSA 2GMXA 3UGCA 1YXVA 5AR4A 1H24A 4G9RA 2PPQA 4RQKA 3NIEA 3BI6A 3OWLA 2YABA 3QA0A 3CKXA 1OL1A 3NZ0A 4GG5A 3R83A 4QP1A 3D5WA 3TUDA 4OBPA 4YTHA 3PIXA 1O6LA 3DS6A 3PRFA 3PXZA 3N9XA 2V0DA 1XMMA 2UZEA 4XV9A 2JAMA 2WEVA 3OD6X 3GVUA 1OIUA 4NWMA 5E8TA 4HGEA 4QP2A 3DAKA 5FXQA 3VNTA 2WMBA 3LFFA 2C1AA 1S9IA 4PP7A 3TV6A 4FZ7A 3HAVA 4CXAA 3E5AA 1TZDA 3EN5A 3UP7A 1ZYDA 4RMZA 4BCIA 4J8NA 5ETIA 2JKOA 2R3MA 3F2NA 4IAAA 4KKHA 4CV8A 2VTHA 3G6GA 5GINE 3FXWA 4C35A 4GMYA 3TV7A 3R0TA 3DT1A 3PE2A 4K0YA 1WCCA 4L43A 5E8UA 4FTRA 1G8AA 4I22A 1YRPA 3SG8A 2PZPA 2WIPA 4AU8A 3HV7A 4D1XA 3KIOC 3MJ1A 2QOBA 4DH5A 3UOKA 3F69A 4L67A 1JKKA 4HYIA 5EOLA 4DTKA 2OXXA 4O2PA 5A46A 4QMTA 1JLUE 3LFSA 2G2IA 4RG0A 4BKZA 1BKXA 3UIXA 3CTQA 2YLFA 1CMKE 1M2PA 4LV8A 2WMXA 2Y4IC 5K0KA 4BICA 2F4JA 4U5JA 4G6LA 3KEXA 3ZO4A 4YMJA 2NRUA 2ZM4A 3ENHA 2B9IA 4BF2A 4C4IA 5I9XA 3KU2A 4GUEA 2PY3A 4RJ3A 4RJ8A 4C7TA 2CKEA 2IEWA 2ZV7A 4HVSA 3OBGA 5FXSA 5A4EA 1Q61A 3OTUA 4FEWA 4M69A 4UB7A 4M84A 1W84A 2P3GX 4TRLA 4EOMA 3KRXA 3BEGA 3ALOA 4Z55A 1BYGA 3PXRA 3DFAA 4GCJA 4K18A 5LVOA 4UWBA 4AZWA 2XCHA 3BV2A 3BBTB 5I9UA 2R3PA 2X4FA 3D7ZA 4IWPA 2F7XE 4JBPA 4A9UA 3BE2A 3ZRMA 5EHLA 4O81A 4O7WA 4QQJA 4CQEA 3UZRA 4GVJA 3ENMA 4OTPA 5H8EA 4KD1A 2AC3A 2FO0A 3P23A 2ZV2A 3D14A 4EONA 3DJ6A 2QVSE 3MIYA 4KNBA 1ZXEA 3MVMA 5IH5A 3NCZA 3EQGA 2XNMA 4ZTNA 3ORZA 5JK3A 3MYGA 3H0YA 2OK1A 3FI4A 1O6YA 3KXHA 5J87A 3AKJA 2Y4IB 3ZO3A 1GOLA 1XH9A 2X8EA 3R00A 4N4SA 4YPSA 3NMUF 2J90A 4PDPA 1VZOA 3MA6A 4FNXA 4WUAA 3CC6A 5GJDA 3EQDA 4WHZA 3QQHA 5CXZA 3PJ2A 2YACA 1NVQA 4AS0A 2OXDA 4M13A 5CX9A 3F9NA 2W5HA 4RT7A 5BX0A 4CT2A 3TIZA 3A7FA 2ITWA 3AMBA 5IUIA 3F3TA 3PG1A 4MXZA 4NJ3A 5FTOA 2GQGA 4RGJA 3QQJA 5AP6A 1JAMA 3OOGA 4FV4A 1NW1A 4EK6A 3WF9A 5CANA 5IG1A 4XRJA 3RJCA 5DHJA 2XBAA 2Z02A 4OUCA 3LVPA 3CTJA 4KABA 4GH2A 4IE9A 2XB7A 4GJ2A 4KIQA 5CU6A 4UEUA 5KO1A 1ST4A 3MPTA 3N4VA 4FKUA 3ZOSA 4NEUA 4JQEA 3MB7A 3ZONA 4U8ZA 1CKPA 2GQRA 4FSQA 5C9CA 4C38A 4WG4A 3PG3A 3R1QA 4IANA 3OFMA 5K0XA 4PNIA 3KCFA 5BYZA 5FP5A 5E4HA 3PVWA 4EOLA 2OGVA 4ZOGA 4S34A 4A9YA 4G3GA 4I1ZA 5FM2A 4FIJA 5CF8A 4QD6A 4C4GA 1YI6A 3VHEA 2PMOX 3F3WA 3NNVA 2YWVA 4LGDA 4J7BA 4FT0A 3BZ3A 3W33A 3ZLXA 4F4PA 4YJUA 4IB3A 4TWPA 5EM5A 5JRSA 4USFA 4ZSLA 1PHKA 1UA2A 3ORTA 4P90A 4RBLA 4WBOA 1UU8A 2DS1A 4ASDA 5JSMA 4K8AA 2V5QA 3QD2B 5IQGA 2X7OA 5L8LA 4YNEA 3EKKA 1XHAA 3DOGA 5D7AA 5DT3A 5GJFA 1PKDA 4JL9A 2XIXA 3RP9A 5HLPA 2PUPA 3Q2MA 4GL9A 3O7LD 1XKKA 5AUVA 3VQHA 3I5NA 5FD2A 4JDHA 5HO6A 2WQOA 3NYXA 3OW4A 4FGBA 4QQ5A 2Q83A 1YWVA 2BAQA 2X1NA 4HGTA 5HIBA 4R5YA 4PRJA 3SDJA 2PVMA 4QMWA 1ZZ2A 4G16A 4R3CA 4JDJA 4QMUA 3UYTA 2YIQA 3MFSA 2YITA 4DG3E 5J5SA 3QZIA 4XS2A 5JEBA 1TQMA 3REPA 4E6DA 4NK9A 1YDTE 4BZOA 3RVGA 3R2YA 5CALA 2WGJA 3QUDA 5HESA 3T9TA 3RAHA 3U87A 3VUMA 1LEWA 5GNKA 3H3CA 3PSDA 3SOAA 5CZHA 4H1MA 4BCHA 4FRFA 4FSYA 3SHEA 3MFUA 4BY9E 3IK3A 3FI8A 4JX3A 4EL9A 5IF1A 2J0JA 3QX4A 3BELA 3E3BX 3NUUA 3OXZA 1XH6A 4DBNA 1AD5A 2WFYA 4IHPA 2O3PA 3KMUA 1URCA 4GV1A 4BBFA 2B54A 3IG7A 3CJGA 5TOZA 4YR8A 4CFVA 3OG7A 4KS7A 2R0UA 2R3OA 4CVAA 3UIBA 3TKIA 3ZDIA 2F2UA 1OL2A 3ZRLA 1UWJA 2GPHA 1E9HA 2YCSA 4LV5A 4AQCA 1IEPA 3COHA 2J7TA 3S4QA 4AZTA 1ZMWA 2QR7A 3LXLA 3VS6A 2G2HA 4H1JA 4ZMFA 2YCRA 4GKHA 3CQEA 1H0WA 2CCIA 4C2WA 3CEKA 1M2RA 2EWAA 3QKMA 3FMHA 1SMHA 3FLWA 4GJ3A 4R1YA 4R6VA 2VAGA 3ZFYA 4CNHA 4OTQA 5LOHA 4EQUA 3O96A 4CV9A 3L8VA 3DXNA 4QP4A 5HU9A 4EC9A 3A2CA 3PA4A 4UMTA 1YW2A 5CAPA 4AZVA 3EOCA 2FYSA 3FJQE 3P7BA 5ANIA 3ZSGA 4EI4A 4Z16A 3D9VA 4KSQA 5AAEA 2QONA 3RK7A 3QTXA 3O8PA 3HP2A 4XV1A 4I20A 4APPA 2JD5A 2YDKA 2XK6A 5CXHA 4RX9A 3VS2A 5C8KA 4G3FA 3W2RA 3TZ8A 2OSCA 2GHMA 5KMMA 5DR6A 3FZ1A 3A8XA 4BDBA 2QO2A 5A6OA 3VBVA 3DBFA 2A19B 4G6NA 2R3GA 5FBNC 2ETRA 3FLSA 3I6WA 4PQNA 2PYWA 5CU0A 1DAWA 3HVCA 3HV4A 3U4WA 3RCJA 2CNQA 1VJYA 4FSMA 3GNIB 4D5KA 4C4HA 2X0GA 3AD5A 5A6NA 5AMNA 4NCTC 3Q96A 5AM7A 3LJ1A 2HIWA 4DA5A 2OKRA 3SXRA 4E20A 3W0RA 3RI1A 2QG5A 4Y73A 3LM5A 5CQUA 4ITJA 4S30A 4EH3A 4UN0C 5JGAA 1A48A 2XKEA 3L8PA 3F82A 3PUPA 5HD4A 2X2MA 5HTIA 4AXDA 4ZMEA 2AC5A 3H4JA 1NVRA 3CQWA 5L6WL 2F2CB 4L45A 3GC9A 4EH9A 5GHVA 5KMKA 3V01A 1G5SA 3KXXA 2LAVA 2CDZA 3V5QA 4L3LA 3AC1A 1PMUA 2O8YA 4H3QA 5C03A 3VWAA 3KXZA 4D58A 4FTOA 1GZOA 3P0MA 3C7QA 3EZVA 3KGAA 3I5ZA 3LZBA 1IRKA 3VHKA 1CDKA 4BZNA 2YDJA 4UXQA 3P5JC 1YXTA 5EQYA 4QMMA 4R7IA 2RGPA 2GQSA 3ZYAA 5M57A 1BMKA 3WYYA 4FTTA 2PUNA 2V22A 4WNOA 3PDTA 5IQAA 3A4OX 3V8WA 1L8TA 2ITNA 3VRYA 2X7GA 2ZOQA 4EYJA 1PXOA 2QKRA 3IS5A 3GP0A 4X0MA 4ZLZA 2XK3A 2UZUE 4WD5A 5CI7A 1H8FA 2ITTA 3BHVA 3FSFA 3LCKA 4KAOA 3BGPA 3R7GA 3UOLA 3I4BA 4XUFA 1F5QA 2R3HA 2BZKB 5L4QA 2ERKA 2VV9A 2A1AB 4NFNA 2W4JA 3QQGA 4L52A 4XLIA 5KZIA 3DBEA 3I7BA 3TTJA 5IQHA 2CKQA 5IDNA 2XJ0A 3VO3A 2YDIA 3M42A 5BVNA 2QOFA 5EG3A 4FOBA 1OPLA 3QX2A 3UO5A 1FMKA 3ORMA 2PVFA 4F0FA 4OTRA 2I6LA 4R8QA 4TWCA 4OW8A 2PTKA 3R8PA 4CMTA 3G0FA 3MSSA 4MNEA 1WZYA 3VBXA 5IH4A 3OVVA 1CSNA 5C01A 3ET7A 3U54A 4F9AA 5EYKA 2YCFA 4W4XA 4CT1A 4TWOA 1U59A 2R7BA 2W1IA 4YZNA 3I60A 4O6EA 4R7BA 3OTVA 3ALNA 2R5TA 3D0EA 2ITVA 4FIGA 4EOKA 3FYKX 5JMSA 5JQ5A 5CAOA 3Q4UA 5K4JA 3QXPA 2PMIA 1SNUA 1T45A 4N70A 4HYHA 2ITOA 5DBXA 5AR8A 4I6LA 4JRVA 3R22A 4IIRA 2WIHA 4O7NA 2C6LA 3LLAA 4J8MA 1VYZA 4FTUA 1WBPA 2C47A 4LOQA 5I4NA 2UW5A 3HKOA 4WRGA 5CASA 1G8JA 2CKPA 4YLKA 3C4ZA 1H28A 4KSPA 3KL8A 1UV5A 4FTJA 4QTCA 4PX6A 4MBIA 1Q99A 4JI9A 4EH8A 5IU2A 2P33A 4ZS0A 2V55A 4ZZMA 3JY0A 4IAFA 2JKQA 3KULB 3ZUTA 4OT5A 5FDPA 4FEXA 1VEBA 2YCQA 3RPSA 2Z7LA 4FZDB 5BQ0A 3GGFA 4WNKA 3WIKA 2J0MB 3R1SA 5CEPA 2PK9A 2PZYA 5GIOE 4EH6A 1QPDA 4NCTA 3II5A 4EOJA 3ZC6A 5CAVA 1R0PA 2Y6MA 4JIKA 1M7NA 3NNXA 4EK3A 3QRTA 4UWCA 2YZAA 3OXIA 3HRBA 5M4CA 3BYSA 4AGUA 3WE8A 5AX9A 4CFNA 1O9UA 4ZLYA 5FXRA 4AZFA 4DEGA 5J5TA 4WNMA 4M0YA 4HPUE 3JVSA 2R3KA 1OM1A 1F3MC 1KE9A 3MH0A 3Q3BA 2FSLX 4FTAA 3U8WA 2CNVA 2XARA 3MESA 4AAAA 3LFEA 1BUHA 1MQBA 2ONLC 4IFGA 3F3ZA 1YHWA 1APME 1R3CA 4L3JA 4BL1A 5M4UA 2X8DA 2R0IA 2GS6A 4QMPA 2UW8A 4U42A 4J97A 2WTCA 4LUDA 2BRHA 3TNIA 1J1BA 4GVAA 2VWVA 3P86A 3TXOA 4C61A 3QC4A 3VVHA 4ZEGA 2JIVA 4MAOA 4X6QC 5J7BA 3KMWA 4QNAA 3TZMA 5A9UA 3BU5A 4RZVA 3NGAA 4B99A 2JBPA 3VUKA 2F57A 4O0SA 2G15A 3THBA 4MXOA 4E6QA 3LMHA 2HXLA 2OBJA 2PZ5A 3E62A 4HNFA 4DEAA 4I23A 1Z57A 4RIWA 1P5EA 1YWRA 3CJFA 2BR1A 5ANEA 3CR0A 4BGGA 2UV2A 1E1VA 1QMZA 2HK5A 3WE4A 2PZRA 1J7LA 4AE6A 4L7SA 5ETCA 1UNGA 3NSZA 4FTQA 3R7YA 2WOUA 4G31A 2WMSA 2XVDA 2B4SB 2W99B 3C0IA 4O21A 4RC2A 1W2DA 3E8DA 3QXOA 4U45A 5D41A 3SQQA 3FDNA 3NPCA 3Q9XA 4QYEA 3VIDA 1OKYA 3KMMA 2O0UA 3MB6A 4AN9A 4UY9A 4EEVA 3QCYA 4ITHA 2RSVA 4WSYA 1PXIA 1PKGA 3ACJA 5HVYA 3PA3A 5BVEA 2YA9A 4L68A 5HCXA 1TFFA 3KULA 1QCFA 3VUGA 5HX6A 2EXMA 5ANGA 3SXSA 5HG5A 2BDJA 1YHSA 3FE3A 2X2LA 4H36A 4XG9A 3ML1A 3R6XA 3FXXA 4BCGA 3GU6A 4XEYA 2XNPA 5HG9A 2I0EA 4ACHA 2G9XA 3FHRA 3HV3A 2XJ2A 2OIQA 3SRVB 4AWIA 4XG7A 4M97A 4PMMA 2C6MA 3W0SA 5CS6A 3LQ3A 4K2RA 5DNRA 4HCUA 4C33A 3D2KA 3K54A 4QDVA 2J0KA 1YXSA 3CKWA 1OL6A 4FK3A 4FZFB 2W5BA 2YIXA 3MDYA 2B9JA 2C5XA 2J2IB 2ZYBA 1U5RA 3GCQA 3O8UA 3C13A 3RTPA 3HDMA 4QP7A 2CGXA 3I0QA 4V05A 3ZFMA 3F5UA 2YLEA 4FVQA 1H27A 3M2WA 3R28A 5DEWA 3NUXA 3H9FA 4P2KA 4QMLA 2GTNA 5ANDA 4LL5A 1CKJA 4IWQA 5KE0A 1JKLA 1PY5A 3R7VA 4JT3A 4BTMA 4YUQA 4UYNA 4YZBA 1Y6AA 2WPAA 3GCSA 5JZJA 2OJGA 4V04A 3G33A 3TDWA 1V0PA 4H39A 2PVNA 4EJ7A 2BKZA 5IMXA 3IPHA 3BYVA 4FKVA 4LGHA 3K5UA 5EQPA 5J1VA 1DM2A 1OBGA 3BGQA 3VRZA 5HZNA 3ZMMA 4M8TA 2C6KA 5F9EA 3BLRA 5EDQA 3AMAA 3GU5A 3I1AA 2HWPA 4YBKA 5DLSA 2VWWA 5DIAA 1OZ1A 3F2AA 4YHTA 5HVJA 4JAIA 4TTHB 2IZTA 3RPOA 3VQUA 5KMOA 3PXYA 2IVUA 3R71A 4MQ2A 4FV3A 2X4ZA 5KBRA 5LQFA 4JAJA 2XMYA 3AD6A 3BLQA 2BDFA 5ITAA 3VW6A 1Q3WA 3L9MA 4QTAA 2ONLA 2G01A 4BYIA 3O5AA 4U6RA 3PTGA 5F20A 4FSRA 5TO8A 3D83A 4AT4A 4FX3A 3UO6A 5CEMA 3KXGA 5IISA 5FLFA 1ERKA 5EDPA 4FV7A 1XWSA 1DS5A 1U46A 2UZWE 5EHOA 3UDSA 4TNDA 5HHWA 2CGUA 1RQQA 5E8VA 1KOAA 5IUHA 2R7IA 1W7HA 2BRNA 4YC6A 2CSNA 5HE0A 3AC2A 3KRJA 4PMSA 2BVAA 4YJVA 1H26A 4IJ9A 1YDRE 3FQEA 3WOWA 4R3RA 4E5AX 2JAVA 1SYKA 3HL7A 3MH3A 4RC4A 4NM7A 3MS9A 2RF9A 3ZLYA 2VNYA 4EBVA 5IPJA 5I0BA 4UYAA 3UIMA 4WRSA 3DKFA 1ZY4A 3LFNA 4AGCA 1A9UA 3GEQA 3OCGA 3IOKA 4K9YA 1Q5KA 3NW6A 3R01A 4QYHA 5E9EA 2CGWA 4BBMA 2AYPA 1I09A 4O4FA 1MP8A 3ZS5A 5HI2A 1NT2A 1M14A 4LI5A 4DH3A 3NNUA 1VLRA 5JFXA 2XIRA 3CP9A 3FV8A 3WILA 4XOZA 1AQ1A 1OUKA 2VTOA 3PYYA 4J1RA 2C6DA 4ZSGA 4BGQA 2R64A 3V6RA 2C30A 5K5XA 3TNWA 2GNJA 4IAYA 2ITPA 4C3RA 1K3AA 4RX5A 2VWBA 3R8ZA 1XBAA 1IASA 3VS7A 3UNKA 4AOIA 5JKGA 5C8NA 2HZ0A 1YXUA 4BTFA 4AW5A 4HCTA 2XKDA 2YJSA 3QGWA 3P5KA 3KN6A 4IADA 4L00A 5GIPE 5CSXA 5EYCA 4O0YA 2X81A 4RVLA 3Q9WA 4QPSA 3BHTA 2UZOA 3Q6WA 4EK5A 3OS3A 2VTLA 3VN9A 4S32A 3W2PA 1PMEA 4I5PA 4EHVA 2UZBA 3M11A 3F3VA 2XANA 3IDBA 5FEQA 4OLIA 4Y83A 4ZTRA 4EOPA 5AR5A 4EKKA 2OO8X 2WMVA 4YO6A 3LXPA 3CD8A 4FV8A 3VBYA 3R9DA 4O91A 3FPMA 4W8DA 4DINA 1JSVA 3QTZA 3VBQA 4ZY4A 4E4LA 4BCOA 1PYEA 1Z9XA 3OWKA 5EHYA 3QYZA 3U4UA 1KUTA 3F7ZA 5LMBA 4O27B 1B38A 3TG1A 4D9UA 3PUFC 4BIBA 4AT3A 3E8NA 3F5PA 5DRBA 4G3CA 4QMVA 4AG8A 2V62A 1M7QA 2YEXA 5DA3A 1R39A 4AA4A 3ZRKA 2JFMA 4IVDA 2R2PA 4ZTMA 2DWBA 4QO9A 2C3IB 4ENXA 5IDPA 3DV3A 1M2QA 3E88A 2W4OA 3ULZA 4O7VA 4GKIA 1MRYA 2YAAA 1G8KA 2C5YA 2VX0A 4YJPA 3RKBA 4BDCA 2BALA 3CPCA 3TCPA 4ACCA 4GRBA 5AV1A 2JDVA 4BIDA 4EQCA 4BJJB 3Q53A 1TVOA 5CSHA 4CCUA 1JSTA 4Z9LA 2V7OA 3FY2A 4FOCA 2WTDA 4FTLA 4IAIA 4DF3A 4JVGA 3SD0A 3FLQA 1W8CA 3DK6A 3HDNA 4G6OA 3UVPA 4BVUA 4BWPA 3SAYA 1DAYA 3DTWA 2VTJA 2WU6A 5AUTA 4USEA 2VD5A 4D2VA 2NNWB 4C36A 4IZYA 4E6CA 3RWQA 3EN4A 2C0TA 3EKNA 3GUBA 4RC3A 4DE4A 1SVHA 1JWHA 1OL5A 2VNWA 2PVHA 3IW6A 4XV3A 5CTPA 3SC1A 2H6DA 4EQMA 5JQ8A 3F61A 3IDCA 3QRUA 1J7UA 4IXPA 3DQXA 3EYHA 1Y57A 4KS8A 3UQCA 2Z7SA 2F9GA 3CD3A 3HA6A 5AUZA 4IWOA 4CFFA 4G34A 3DKGA 3IW4A 2X6EA 4FKTA 5FG8A 3KK8A 1WBTA 4G5JA 4MF1A 4XG8A 4HVDA 2QHNA 3HMOA 3E87A 2V7AA 4MWHA 4O7TA 5BMMA 5FUTA 3BKBA 4BCQA 2OH4A 5C27A 1FVRA 4NM3A 2BKKA 1PW2A 4LOPA 5CT7A 3JVRA 4PTEA 4KWPA 5AA8A 3N4TA 3HX4A 2X8IA 1PXKA 3QHWA 4GT4A 5AR3A 4AN3A 3NYVA 4FL3A 2XNOA 2BPMA 3D15A 4K6ZA 4U81A 3ZSHA 4B8MA 4G3EA 5LVPA 2IVVA 3TNPC 2J9MA 2W5AA 3NIZA 4AN2A 3UC3A 3VJOA 5JRQA 2ZAZA 5HIDA 3UNJA 4KKEA