2R5TA

Crystal structure of inactive serum and glucocorticoid- regulated kinase 1 in complex with amp-pnp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
284
Chain Sequence
QINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Sgk1
publication title Crystal structure of the kinase domain of serum and glucocorticoid-regulated kinase 1 in complex with AMP PNP.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 284
sequence length 297
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r5tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r5tA01
2QLQA 5J9ZA 4M0YA 5EK7A 3ZO4A 4JDIA 3T3UA 2F7EE 4DTBA 2PVJA 2F4JA 1OL1A 5H2UA 4YTIA 4CCBA 5AUTA 2RFDA 4TN6A 5IEYA 4B99A 2WMBA 4BZNA 5E7RA 4EH9A 4LL0A 2ZM3A 3G9NA 4UX9A 2WEIA 3ZDIA 2JITA 1PXLA 5CS6A 2B9HA 5BUIA 4DFYA 2X81A 3NAYA 3T9IA 2BIYA 3W16A 2YAAA 3NSZA 4F4PA 5IA2A 1CMKE 2HY81 4ENXA 2XKCA 4RJ7A 4E26A 5LQFA 4F7SA 5C8KA 1YXXA 4BTKA 1Q61A 2VNWA 3PG1A 2VTOA 3VJNA 4PMPA 3GVUA 2G15A 2WMWA 1NT2A 3UQFA 5LVPA 4QMSA 1FVVA 1WZYA 3DAKA 4WBOA 4L52A 2IZRA 4E6QA 1W98A 4HVIA 4F9BA 3BBTB 2GSFA 3MGYA 3UVPA 4C7TA 4AOTA 2GU8A 1YI3A 3PSCA 4G6OA 5A4LA 5BVNA 5IISA 3KRLA 3EHAA 4CD0A 4M68A 1PXPA 2FYSA 4NZWB 4DFLA 2CMWA 2X9FA 4EOOA 3N4VA 4CXAA 4AN2A 3NNXA 4IAKA 3AC4A 3KCKA 3OCBA 1BYGA 4JBOA 4YJNA 4O1OA 2XK3A 2UZUE 4IX3A 5D9HA 3PSDA 2OZAB 3C4ZA 3F69A 3PLSA 5KMMA 2X2KA 5ACKA 1G8SA 3HAVA 2FO0A 4LQMA 4MYGA 5DI1A 1BX6A 4FX3A 3V8SA 1AD5A 2OLCA 3TN8A 4FTKA 3W18A 3LPBA 2XM9A 4BKJA 2F9GA 2HZNA 3A7JA 1KE7A 3FC1X 4FVRA 4F70A 4ZSAA 4WUNA 3A8WA 5T6KA 4F0FA 3AD5A 4RVLA 4DEDA 3PXYA 4D2RA 5HVKA 5K4IA 2GQSA 3CTHA 4U97A 5D10A 2SRCA 4B8MA 3R1YA 3QTWA 4GIHA 4FTAA 4X2FA 3FL5A 4U8ZA 3NAXA 5JK3A 3O7LB 2BZKB 2P3GX 4PWNA 3CKWA 2XKDA 5E8UA 3E3PA 2QKWB 2WTKB 2Y8OA 3DTCA 1YDTE 4J98A 1H26A 1WVYA 2O64A 4XG3A 3KL8A 1IR3A 3QTUA 4UWCA 3L9NA 1NVQA 4YJTA 3QUPA 5ANDA 4DLJA 4MF1A 4YTCA 4QQCA 2GTNA 2OFVA 4RJ3A 4AA0A 5DYJA 2B53A 5AADA 5GHVA 4WRGA 2J0JA 2NO3A 3I6WA 1WVXA 3RINA 3IDBA 3VS5A 3ZHPC 5F20A 1P14A 4HYSA 4QTBA 3KMWA 5AV1A 2YLEA 2VTTA 3LFSA 5A46A 2G9XA 4KUJA 5DA3A 1O9UA 3FHRA 3TKUA 4FEWA 2ITYA 5K0KA 3UO4A 4EH8A 2VTMA 4TWOA 3SG8A 3N4UA 3OF0A 1J7LA 4XP3A 4F9WA 3JUHA 5JZJA 3NNVA 4L42A 3LW0A 5BUJA 4Y5QA 3EFJA 4A9RA 1KE5A 3EN7A 4PPCA 4PDOA 4QYFA 1YI6A 3HUBA 3CLYA 3NRMA 4L44A 4Q5HA 4RRVA 3V5WA 4TL0A 5J9LA 2AUHA 5HU3A 1A06A 4J96A 5IPJA 3ZUTA 5CU4A 3BCEA 3BWJA 3D9VA 5EM6A 1GOLA 1M17A 1Q8UA 1W83A 1H4LA 1IA8A 4D1SA 2XH5A 3AC5A 3G9LX 4Z55A 4EL9A 3FZPA 5CAQA 3ETAA 4M15A 4K1BA 4XBRA 2PPQA 3ZLWA 3RI1A 3COHA 2J51A 3C4FA 4DLIA 4GG7A 4BDCA 1GZKA 5J5SA 1H00A 2IVVA 1OKZA 4RC3A 3TACA 4GK2A 4EHVA 3WE4A 4BI1A 3TEIA 2OF4A 5K4JA 4YHFA 2GQRA 1MRVA 3U6JA 3LFFA 5CSWA 1H0VA 4RVMA 4GKIA 2GDOA 3UOHA 1Q8ZA 4ACCA 2C6LA 3ZLSA 5GZAA 4EK6A 4C58A 4DTKA 3P0MA 2XK6A 3FPQA 5IU2A 1REKA 4R8QA 4YJQA 4HVHA 5AUUA 4KB8A 4OTFA 3T8OA 5BMMA 4CGAA 2BDJA 5AR8A 5DG5A 5TT7A 4J53A 3OROA 4YJRA 5HG5A 3VBTA 1TQPA 2X6EA 2REIA 4CFFA 3TDWA 3ZC5A 2OJIA 4LV5A 4ALVA 5TR6A 5CASA 5JRQA 4DCAA 3BV2A 5HD7A 4ALWA 4GT3A 5IEVA 4FODA 3BGPA 2JDOA 2UW9A 3BIZA 4YJOA 4FYNA 4TPTA 5I3OA 3E88A 3OEZA 2OJGA 2FGIA 3PXQA 1APME 4QMYA 4X2JA 3CC6A 3UIUA 2IG7A 4ZMEA 3V8TA 4OLIA 3A8XA 3A99A 2X0GA 4G9CA 5B7VA 4F65A 5D11A 2XK7A 4XG9A 2BR1A 5FWKK 4CSVA 4ANLA 5DVRA 5L8LA 3VS1A 2CNUA 2YCFA 3EH9A 2VWZA 5K3YA 4LYNA 1BL6A 4R1YA 4DH7A 4FKGA 4CYJA 2YISA 2J0MB 4USFA 4XCUA 4M69A 5AV3A 4RBLA 5AP7A 2VX1A 2BMCA 3UQCA 4BF2A 3I1AA 3EQPA 3AXWA 1YRPA 5DRDA 3U8WA 3VIDA 3VUIA 5BVFA 5A4QA 3NLBA 3ACJA 3UJGA 5LMKC 2V62A 2FH9A 1ZYDA 1Q8TA 3ACKA 5HG7A 3CTJA 5C8MA 3OWKA 4I3ZA 4E4XA 5CSVA 4C61A 4IXPA 4M0ZA 3R7GA 5IQFA 4QTEA 2WU7A 2R3OA 2VTRA 2ITNA 3P4KA 2G2IA 3TG1A 1E1XA 4ZS4A 4XMOA 4RWJA 4PL5A 4AN3A 5C1QB 4BY9E 4XNEA 3LFBA 4I5HA 4LMUA 4AA5A 4IM0A 2R3JA 4BTMA 3IW5A 1IA9A 4CFUA 4JR7A 4FSMA 2CSNA 4RX5A 5FQDC 4L53A 4ZTMA 2W1GA 3ANQA 3P1AA 4L46A 5AJQA 5HTBA 4MTAA 4IIRA 3HA6A 3ZEPA 2ERZE 3MJ2A 3MVMA 3NUPA 5T3QA 3VQUA 3LMIA 2WMTA 3ZU7A 2WO6A 3F66A 4RFMA 4FNYA 3HRCA 4BBMA 1URCA 5KZ0A 4FUYA 1LR4A 3CPBA 3FZTA 3KMMA 1H01A 3E87A 3I0QA 4XRJA 4HCTA 2XK4A 4MEDA 3VBVA 2J50A 3WIKA 4LRKA 3UPXA 4ASXA 5CAPA 5TOZA 4UZDA 3R21A 1WVWA 3FZRA 2IW6A 3RVGA 4U79A 4AF3A 3DXQA 5J5TA 2BDWA 4PDPA 4FIIA 4GMYA 4NTTA 4QMTA 4U5JA 3ULZA 3AOXA 3UOJA 3OWLA 5IH4A 3OWPA 3NNUA 2WTDA 2VTJA 2FA2A 4O2PA 3R1QA 2GFSA 4QMMA 4RZWA 3WF5A 4U9AA 3O2MA 2FSMX 2VWIA 2YDJA 4GK3A 4PMTA 3EFLA 1OM1A 3A4PA 3G15A 4FF8A 2J90A 1GAGA 3FI2A 4YNEA 3CY3A 2DS1A 3GXLA 3OTUA 2VWWA 5AX9A 4BDBA 1YWNA 2YIRA 2HIWA 2DYLA 2QOCA 3I81A 2VGPA 3KQ7A 4XV2A 4BWPA 3QL8A 3HUCA 3P79A 4P5ZA 4QP1A 5DEWA 3TKIA 5KMLA 3MH0A 4FKVA 2VN9A 2Q83A 3CD8A 4YURA 3EFWA 1YOLA 4CFXA 4DEHA 3ODYX 4KSQA 3W2SA 4EEVA 5L8JA 3BU3A 3LQ5A 2VWYA 3NYOA 4KD1A 4K77A 2BAQA 3EQBA 2W4KA 3LLTA 1OI9A 5EM5A 1G8AA 4FI1A 4M8TA 4RX7A 3U55A 5L3AA 2RF9A 1QMZA 5A54A 4C2WA 1OECA 5M55A 2XNMA 1Q3DA 5I0BA 2H96A 4RG0A 1FPUA 1H07A 5DIAA 4EK5A 4O7LA 4FVQA 1LP4A 4M14A 4TWPA 1XQZA 5ACBC 2QI8A 4G9RA 4ZZMA 2DUVA 4KAOA 5ETIA 4FTNA 4L6QA 5BPYA 1OUYA 4PUZA 1NY3A 3FMLA 4FEQA 2FUMA 3BLRA 4O21A 4EC8A 2F49A 2YM4A 2BHHA 3MWUA 5ANGA 1A48A 3HRBA 3EQGA 1FVRA 4L8MA 2R3HA 4XS2A 3UMXA 3RKBA 4F1TA 2Q0BA 4F9AA 3SVVA 3UODA 2OZOA 5AM6A 3IOPA 2VD5A 3HP5A 3W2QA 4KIQA 4V0GA 1GIIA 2LGCA 4W4XA 3ATSA 3C5UA 1YWRA 4GJ2A 5IUHA 4KKEA 1JLUE 1QPEA 2XP2A 2XYUA 5CVFA 1ZARA 3FL4A 3W2OA 4R5YA 4DG0E 2UZWE 5F4NA 4YPDA 3TNWA 5KUPA 5AP5A 4O0YA 1J91A 4EOJA 1ZXEA 4KIKA 4IC7A 2UW6A 3CJGA 3AGLA 3NUNA 4O2ZA 2V7OA 4FZDB 4OTDA 2GNJA 5CSXA 1M2RA 2QODA 2RG5A 3AC3A 4FT0A 4XLIA 5IH5A 4GSBA 4X2KA 5EQYA 2OH0E 4GKHA 3DK3A 4HCUA 4LRJA 2R3GA 2J0KA 5IQAA 3HMOA 1WBWA 2GS7A 3C9WA 3ZRKA 5FLFA 3ORXA 4Q9ZA 5AV4A 3OY3A 4LFIA 3TIZA 3MDYA 4FZAB 4FSRA 2P2HA 3OBGA 3KY2A 4FTJA 1E9HA 5J79A 3HV4A 2OICA 4U41A 2B4SB 4FZ7A 3D5VA 3LJ0A 4M69B 4TW9A 2BROA 3DAEA 3ZSIA 5BMSA 4AG8A 2XBJA 4AGCA 4L01A 4NJ3A 3AD4A 2ITUA 2UVZA 1X8BA 3F9NA 3NUUA 3UIBA 2OSCA 3LFQA 4MQ1A 2Z2WA 5HLNA 1MP8A 5CAOA 3EYHA 5E8XA 5E91A 5EDPA 3Q2JA 4A9YA 4IAIA 4E7WA 1I44A 1RQQA 2VU3A 2QHMA 2PZYA 3BV3A 3C1XA 3PSBA 4HGTA 3TI1A 1Q8YA 4OR5A 4XBUA 3QRTA 3F2RA 3DTWA 5CANA 5IQBA 3Q60A 3LJ2A 2PL0A 2YCSA 5C03A 3GQIA 4EH5A 4F9YA 3O17A 4FEUA 4O84A 4AGDA 4EK3A 3BYUA 2ZV2A 3BHUA 3CXWA 5H8BA 1ZOEA 3NW7A 4YZCA 4NFMA 3DBFA 4QYYA 3TDVA 5KHWA 3VBXA 3KC3A 2VZ6A 4YZBA 3BKBA 4G6LA 2W06A 1H1WA 5DLSA 3UG1A 3W33A 3B8RA 1R3CA 3MS9A 4M66A 2HW6A 3AC8A 4I0SA 4KABA 4EKKA 2W4JA 3PZEA 1XBBA 3QD3A 4EHEA 1KE6A 3HRFA 4D0XA 4D55A 3D7ZA 4RWKA 3F3WA 3OT3A 2R3RA 3FZ1A 2ZVAA 4PDSA 4D1ZA 5EKNA 2E9PA 4HZRA 4EI4A 4FGBA 1PXIA 4EK4A 3DS6A 1R1WA 3R22A 3KGAA 4FTTA 4LUEA 1UV5A 4KBKA 1JSVA 4AFEA 1WBPA 5AP6A 5CT0A 1SZMA 1H08A 3GB2A 4WOVA 3W55A 4O7SA 1MQBA 4O7TA 1UU9A 4ANNA 3EKKA 2YM6A 4A07A 4L68A 4XG6A 2YA9A 5M53A 3F7WA 3PJ3A 3FMNA 4DG3E 2X39A 4MXOA 4BB4A 4FL3A 4YTFA 3C0GA 1AQ1A 1SNUA 5KMOA 4ZSEA 4HPUE 3VBQA 5AX3A 5H9BA 3R8UA 2YM8A 2R9SA 5EM8A 1YXUA 2R0UA 3GI3A 3V5QA 1PHKA 5M08A 2HY0A 2YIWA 2ZYBA 3P08A 4I22A 5IDPA 5EH0A 4UWBA 5CXHA 5G6VA 4GFMA 1GNGA 4MHAA 3SLSA 2O3PA 3A4OX 2EXMA 3DBEA 3H9OA 3JYAA 4LG4A 5CF4A 4YLKA 4DHFA 2X4FA 3ZTXA 4IH8A 4EOKA 4N70A 5J8IA 4XEYA 3WF6A 2YERA 3E5AA 5AM7A 2GHLA 4I6QA 5AV2A 3OCGA 3R7VA 3VJOA 4HZSA 5ANOA 2UZNA 2CLQA 3PP1A 1CSNA 4JQ7A 3S00A 3V51A 4TYJA 4DN5A 3R1SA 4S31A 5FUTA 3JXWA 3BHTA 4TNBA 2QC6A 5BYLA 2R3QA 4K18A 4N6ZA 2JBOA 3ZBXA 5BVDA 4UY9A 3FZSA 4YBKA 5AP4A 2XM8A 2A19B 4FV9A 4ZY6A 4C0TA 5J9YA 4O6LA 2CN5A 5EYCA 5HE1A 2UV2A 3PWYA 1YQJA 1UNGA 3Q2MA 4JXFA 3GU5A 4QPMA 3LQ3A 2HOGA 3EQDA 3EKNA 1MQ4A 3FEGA 4C34A 3POZA 4L7SA 3U6IA 2JDVA 3MFSA 4RWLA 2V5QA 4D2SA 4AE9A 1OZ1A 2ETKA 3D2IA 1U54A 2IZUA 2CGWA 3GC7A 4R3RA 4YR8A 5E92A 3PY1A 4FUXA 4AZSA 1WBTA 4I5CA 2DQ7X 4BVUA 4B6LA 4JBPA 4YBJA 1URWA 3GCUA 4KBCA 3RK5A 3AD6A 4WKQA 4ZLOA 2YITA 4JRVA 4EH6A 2WMQA 1M2PA 5K5XA 5L2WA 4E5WA 4PL4A 3C0IA 3EFKA 4EQCA 5KX8A 2IO6A 2C5VA 4DFZE 5A6NA 2WU6A 4ZIMA 2X6DA 4ITJA 4FT7A 1WFCA 2W99B 2C4GA 3EQFA 3ANRA 4MXXA 4ZTNA 1XKKA 2YCQA 2CHLA 4I0RA 1KE9A 4O83A 4FK6A 3Q6WA 3FC2A 1IG1A 4FIEA 4HYHA 4E8AA 1XH7A 2QOOA 5FBNC 3EZVA 3IW7A 4U45A 2C6MA 2VX0A 5IA5A 3DOGA 1FOTA 2VO6A 1ZMWA 1DS5A 3KXHA 4OBOA 2R3PA 2XK9A 3G6GA 4I94A 4QP8A 4BCFA 2XIKA 4UMTA 1V0PA 2ITWA 4D9UA 3C0HA 4U0IA 1EH4A 3R0TA 4OTHA 1QCFA 4CNHA 4W4VA 1U59A 3VN9A 4NH1A 4YC6A 2GPHA 3G6HA 2WOUA 2XK8A 5I9YA 5CEQA 4MBIA 2X7GA 5E8TA 3WOWA 4KRCA 4E5AX 3COIA 4NIFB 3LE6A 4H36A 3DJ5A 4A4LA 3BGQA 4U42A 3PLAE 3AMBA 3M11A 4MAOA 2QO9A 4XLVA 3C13A 3ZYAA 3W2RA 5IQEA 4DBNA 5FXSA 5TE0A 4I21A 2XBAA 4QMOA 4CKRA 1RJBA 5FP6A 2B9IA 3ALOA 3L8SA 5DEYA 2ITQA 1XH8A 4YJVA 4NK9A 3RP9A 4FKOA 1YW2A 4G1WA 5AR5A 5IKWA 4BDAA 5HORA 3EIDA 1H27A 1M7QA 3IQ7A 3PA4A 5BVEA 3ZONA 4E1ZA 2NRUA 2PE0A 2VWXA 3OWJA 4GT4A 4S32A 1VEBA 4DH5A 5CAVA 3NIZA 5DWRA 2WTKC 5FP5A 3RWPA 1PJKA 3RM6A 2ETMA 5HX8A 5LJJA 2GHMA 3BQCA 2H8HA 3WBLA 2E9UA 2VGOA 4O0RA 5DR9A 3C50A 3NIEA 4FV8A 3REPA 3NR9A 4EONA 4O81A 4ACMA 5BX0A 4YSMA 3D7TA 3BLQA 3MW1A 4BZOA 4L3LA 5HIDA 4BWXA 1ATPE 4C4JA 4FV7A 4JQ8A 3FMEA 3C4EA 4YLLA 3DK6A 5HG8A 4D5KA 1WBOA 5CX9A 4EH4A 4YLJA 3QRKA 3KCFA 3U9CA 5IQDA 5HQ0A 3KXXA 3F2AA 2C5YA 3F5XA 4C37A 3HV3A 1XWSA 2BVAA 3DCVA 3Q6UA 3LFEA 2ZAZA 3FMJA 4H3PA 3RHKA 3MI9A 4AT5A 4WSQA 4ZY5A 5HNIX 5E8VA 4BCIA 2JC6A 1ZZ2A 3EL8A 1M2QA 4BCMA 1ZRZA 4NT4A 4BCKA 4BKYA 4QMVA 4ZJJA 4DEAA 1UVRA 4BTFA 5BYYA 1OKWA 1YVJA 2YIQA 4USEA 3DQWA 3FZOA 4XH6A 3K2LA 2ITZA 1O6LA 2J5EA 3BEGA 4PQNA 4BIDA 5CAUA 2XUUA 4I4FA 5JFWA 1QPJA 3KF4A 3PPJA 4UXLA 4Q9SA 3P23A 4YMJA 2C30A 3PFQA 4OUCA 2PVRA 4FV6A 4YO4A 1H1RA 2WMAA 2YIXA 3QZIA 3WF8A 4FGRA 3QA8A 4MNEB 5M51A 4II5A 4IDVA 3KN6A 2WOTA 2YWPA 2VTQA 3GFEA 4P5QA 3KRJA 4OTIA 4EZ5A 4NU1A 1W0XC 4O0XA 1LPUA 4GU6A 1Q62A 2Z8CA 2UUEA 3RCDA 3FMKA 2YJRA 5AAFA 4CTBA 4ZJVA 3O7LD 1MRYA 5C4LA 4JI9A 4QQTA 4O1PA 4K9YA 4QTDA 4YZ9A 2I0HA 2F2UA 1CDKA 2XNNA 4E93A 4FT5A 3IECA 3DKGA 2PMLX 3AT4A 1XH6A 3D15A 3E3BX 2X9EA 3KRWA 3DGKA 3MPTA 4I5MA 4FKUA 4EJNA 2R3FA 1YXVA 3O71A 3QF9A 4IWDA 4IZ5A 4O0UA 2XIYA 3UOLA 3MA3A 4UWYA 3ZUVA 4K0YA 3P78A 5KNJA 1PXJA 3DT1A 3R71A 3U6HA 3MSSA 3OMVA 3PJ2A 2QOLA 4BR3A 3H10A 1M14A 4AZFA 1U54B 3QTIA 3ITZA 4ANSA 3HMMA 3VUKA 4M3QA 3PE1A 4LGDA 4IX4A 3FLQA 2GNHA 3P9JA 4ALUA 4C3FA 3KRRA 2ZB0A 5A4TA 2WELA 3I6UA 1BUHA 4X0MA 5ITAA 4E6CA 4ACHA 4XYFA 1YOJA 3IGGA 3KFAA 1GIJA 1JNKA 3PA5A 2JDSA 1NVRA 4I4EA 5HHWA 4D9TA 2WMRA 1FMOE 3FHIA 3MPAA 5LVNA 1IASA 2WQNA 4AW1A 5BUEA 3FQEA 3ZDUA 3PJ8A 2X8DA 1I09A 3A7FA 2X4ZA 2CNVA 1CKIA 3FLZA 2DWBA 2V7AA 4QQ5A 2WIHA 2Y4PA 4CYIA 2BDFA 5EHYA 3DNDA 3C4WA 2YZLA 1M52A 2ETRA 3GNIB 5IQGA 4I20A 2WHBA 3I79A 5JFXA 3U54A 3AC2A 4YP8A 3HV5A 1J7IA 4JQEA 3QTZA 3PVGA 1P5EA 4XOYA 4OT6A 4DFXE 4XG8A 4D4YA 5DT4A 4RA5A 3ENMA 4C3RA 1P2AA 2HWPA 3Q53A 4GW8A 4O91A 3KREA 4FG9A 4BIEA 3IW4A 3D4QA 4H3QA 5IF1A 1R39A 4XP0A 4WNMA 2EXEA 4IM2A 2EUFB 2W5AA 2XRWA 1FBNA 4DGGA 5CF6A 5DFPA 5E1EA 2XNPA 3VULA 3ORMA 3G5DA 1QPDA 3PXRA 5KZIA 2O0UA 3V6RA 3D5WA 2PE2A 4FSQA 4X3FA 4FTIA 5DNRA 4DFNA 1HCLA 4G3DA 4CFNA 3R83A 3DAJA 3SHEA 3R00A 4XHKB 3QQUA 1OL7A 2OGVA 1XH4A 3HA8A 3O8TA 3QRJA 4FICA 1GZOA 4F0GA 3GC8A 3VRYA 4QMZA 4F6UA 2XA4A 2OFUA 5B0XA 1ZWSA 4EQUA 5FEQA 1DM2A 4O7YA 2C5NA 4RFZA 3WYYA 4XJ0A 5CU3A 4ZXTA 3VVHA 2WTIA 4LRMA 4C02A 5TKDA 5CEPA 3QYWA 3NX8A 5JGDA 4MX9A 4AA4A 4TYHA 3MFUA 4GYIA 3FPMA 3R04A 4GEOA 4NW6A 1YKRA 4YZMA 4AW0A 3ZSHA 4RJ4A 4WG4A 3FY0A 3WZUA 3M2WA 5IDNA 1BMKA 5AUWA 1PKDA 2PVNA 5DPVA 3QD4A 5GJGA 3WIGA 1ZOGA 4OTPA 4TKSA 4A9TA 3D7TB 3KKVA 3DU8A 3F5PA 4O22A 5GJFA 4TNDA 4ZEGA 2KULA 3ULIA 3WYXA 2ZMCA 1ZYJA 5FM2A 3NYVA 1OIQA 2Q0NA 4R78A 2I40A 3E62A 2WQOA 3BHVA 2CKOA 5HU9A 3VNTA 1PMUA 4GU9A 2EWAA 5JGAA 2CN8A 4CT1A 4FK3A 4ARKA 2ZV8A 4E6AA 5HE3A 3ZM9A 5M57A 4FTLA 3QQHA 4JG8A 5E4HA 3TV6A 3ZFMA 1K2PA 2XNEA 3NEWA 3QLFA 4LOPA 3V3VA 1PYXA 3PYYA 2CGUA 3EN5A 4JT3A 1J1CA 2UZOA 3F7ZA 5JSMA 3FQHA 2VWUA 5LCJA 4D0WA 2XZSA 3FMDA 2C6OA 5CSHA 3WARA 4F7LA 2QO7A 4N57A 5LXMA 5HZNA 4OTWA 2UZEA 4FZ6A 4DC2A 4C38A 5CF8A 4I23A 2JD5A 5AEPA 4EBWA 4HGSA 2R3NA 3F5UA 4UXQA 2CGVA 2ITXA 1PF8A 5CLPA 4QMUA 1XO2B 4EC9A 4FNZA 3R7UA 4TT7A 5LMBA 1F5QA 2C0IA 4EWQA 1R78A 4A06A 3FI8A 3DDPA 3HNGA 3QKKA 3Q9XA 3UZRA 5HGIA 3KRXA 4IACA 2HYYA 4JL9A 4QRCA 3K3IA 3TKHA 1CKJA 5LARA 5HG9A 2QOFA 3S3IA 3QQLA 3PP0A 2ITTA 3I7CA 2GNFA 3Q04A 3ZFXA 3NDMA 4TWNA 4TYGA 1OITA 2QURA 4PP7A 4FIFA 4GL9A 3CGOA 2BTRA 5CNOA 4FV4A 5DR6A 4NUSA 2A2AA 3PA3A 3VRZA 5I9VA 4DBXA 2G2FA 5DOSA 4CRSA 4DFUA 4J8MA 4LGHA 3BYOA 4F63A 4BGHA 1H1SA 4BC6A 2JGZA 4U7ZA 4ACDA 4HCVA 1G3NA 3LM0A 1PXOA 3L9MA 3KULA 4FTOA 3GUBA 1K3AA 2XYNA 3G90X 1IEPA 3MB6A 4JOAA 5CU6A 4EKLA 2J9MA 5CEOA 4F9CA 4P4CA 3RM7A 1U5RA 3QX2A 4WUAA 2YDIA 4HNIA 5F9EA 4B9DA 4G17A 3VS0A 4C57A 5CNNA 2C3IB 4X6RA 3RPOA 4OAVB 4G3CA 2VAGA 4FL2A 3CD3A 4L45A 4ZLYA 3U51A 4XG4A 4GV1A 5D41A 1W84A 3Q9WA 2JKOA 3QTQA 1U46A 1HCKA 3C4CA 4ID7A 4PDYA 3HLLA 3UDBA 5IG1A 2NRYA 4ACGA 3KF7A 2CJMA 2V22A 3NCGA 4JAIA 3GU6A 5M44A 4L9IA 3DK7A 3K3JA 3N9XA 3VWAA 3ZO3A 5EW9A 2C3KA 3DBCA 4QYGA 4JG7A 1XHAA 3PXKA 1ZYLA 4RIWA 2A0CX 3WE8A 5HKMA 3ZRLA 4TRLA 4EZ3A 3R02A 1XBCA 1LEWA 3II5A 1IAJA 3U87A 4XG2A 5AUXA 1JBPE 4HGEA 2BKKA 4AE6A 3FLYA 2BIKB 3V04A 3UZTA 3MN3A 3TXOA 3ZLYA 4K2RA 4G3FA 3R9HA 4ENYA 1F0QA 4W8EA 5BVOA 2PULA 5AUZA 4B7TA 3FXZA 2W5BA 5CZHA 3ZMMA 1SVGA 5JFVA 3ZZEA 5M4IA 5E9EA 1KE8A 1GJOA 5JN2A 3SGCA 5KMKA 4AZEA 2IPXA 1XH9A 5C9CA 3ROCA 4FL1A 4NM3A 3QUDA 4G31A 3F6XA 1RE8A 5C27A 3H3CA 4A9SA 2P2IA 4IMYA 4J97A 3R9OA 4UMPA 4X2GA 1P4OA 1YWVA 4B8LA 1OBGA 4JDJA 1UU8A 2PVLA 2OWBA 3Q4CA 5GIPE 2R2PA 1VYWA 2ZMDA 5ETFA 4ANOA 4IZAA 5EOBA 5JZNA 4PF4A 3TT0A 2UW3A 3OW4A 3RWQA 3UOKA 4YSJA 2JIVA 5CEIA 2IW8A 3OTVA 1JOWB 3UYTA 1FVTA 4BWKA 1Y8GA 4P2KA 2WAJA 4MBLA 3MVHA 2HW7A 3PG3A 4G16A 4L3PA 4RZVA 2VTIA 5JQ8A 3UIMA 1NXKA 4IJ9A 3DBQA 4FEXA 4TTHB 2IJMA 4QP6A 5ANIA 3QCXA 4NJDA 3R8VA 3UPZA 3FLWA 5T68A 2RFEA 2XMYA 3BYMA 3HVCA 2AC5A 2OG8A 3DLZA 4QYHA 5LCKA 4D4SA 2PZ5A 2WMVA 3QD2B 5AUYA 2FB8A 4MXCA 4XV9A 3TJDA 5GZ8A 2RIOA 3EOCA 3CY2A 4RT7A 4XOZA 5M4CA 3TUCA 5KMNA 4M97A 5FEEA 2J0LA 4GG5A 3A7HA 4RJ5A 2J5FA 2PMOX 2F2CB 4PTEA 5E8WA 3QRIA 2BAJA 3DXNA 3JPVA 5IUIA 5J95A 5J7BA 3EQCA 3K5UA 4D4RA 3JR1A 1B38A 4BYJA 2WTVA 1GY3A 1UNLA 5HCZA 2B0QA 4RPVA 4EOSA 3UQGA 4CMTA 4EZ7A 4IDTA 2FSLX 2XEZA 2CDZA 3ATTA 2I0YA 3N4TA 4CEGA 3QRUA 3OP5A 1PMEA 4PRJA 4U43A 5HO8A 3R8ZA 3TTJA 3VAPA 1JKLA 3MH3A 2OI4X 5BQ0A 1J3HA 1YI4A 2UW7A 3R28A 2EVAA 4JLCA 2XNOA 5HNBA 3RPRA 2PMIA 4IX6A 1G5SA 4RLLA 2J0IA 4FNWA 4FTQA 2QO2A 4ZTSA 3G2FA 3EN6A 5CI7A 3BYSA 3EYGA 3QTXA 2V55A 4IVAA 4RVKA 3S95A 4FE2A 5FXQA 4EJ7A 2R3IA 3GQLA 5CU2A 4IADA 1WBNA 3R63A 2PK9A 4IANA 4IJPA 4OTQA 5L6WL 3VO3A 4RIYA 4DA5A 4XV1A 4I6BA 2UVYA 5A14A 4X3JA 3QBNA 2PTKA 4JDHA 4AQCA 5AR2A 3Q9ZA 2B7AA 1HOWA 4D2WA 4R7HA 1O6KA 4K6ZA 4FV5A 4MCVA 3IGOA 4LI5A 3GC9A 4RJ8A 5DR2A 5I9UA 5C26A 1VZOA 2GCDA 3EZRA 4LV8A 3VF9A 5I4NA 2X7OA 5LWNA 3BU5A 1YDRE 5JT2A 3M42A 4IB0A 3LIJA 3RPSA 4HOKA 5FDPA 3EN4A 4BICA 4JJRA 4XG7A 5EQEA 3PTGA 2WTCA 3F5GA 3ORLA 3QU0A 4X2NA 3ROYA 2XJ1A 4CKIA 3WF7A 4NKSA 4RA4A 2C68A 5EOLA 3ZSGA 3S1HA 1Q4LA 4FKTA 3UYSA 3UBDA 2PVKA 3Q3BA 4I5PA 3DJ7A 2BILB 3PY3A 3F3VA 3DB8A 4FV0A 3BEAA 3RCJA 1UU7A 4BN1A 5AP0A 2GFCA 2Z7LA 3A7IA 3RMFA 2BRHA 2ZV9A 3TZ7A 3RAWA 2I0VA 5DGZA 4GUEA 4DITA 2X1NA 3PPZA 4RC4A 3V5PA 4MXYA 3GENA 1CTPE 5K5NA 3IS5A 5HX6A 2JIIA 3OW3A 4HYUA 3BE9A 4F99A 1M7NA 2O8YA 4KKGA 3F3TA 4FTCA 3FUPA 3LCSA 3BRBA 3EJ1A 3OVVA 2PY3A 5E8ZA 3B2WA 3GCPA 3NS9A 1TQMA 4DAWA 2G2HA 2YIYA 4LMNA 3SC1A 4TWCA 2ACXA 2XCKA 4BDEA 5A6OA 2BRMA 5EHOA 3LMHA 4FBXA 5ANKA 3Q32A 3ORZA 1XJDA 2OU7A 3I0OA 3HYHA 5FEDA 3PVBA 4R7IA 2QU6A 4PNKA 4J8NA 3FXWA 4FTRA 4GCJA 4RIXA 3AGMA 4P90A 2C47A 3CIKA 5IQIA 4UYNA 2ZM4A 3EQIA 4GJ3A 4EQMA 4AOIA 4CVAA 2B55A 2C1AA 4G5PA 4H58A 4IVBA 2ITOA 4DF3A 3PRIA 4BKZA 3ODZX 2Y4IC 3ZLXA 3AC1A 2QD9A 5BYZA 2CKQA 2VV9A 3ORIA 2QCSA 2IVUA 2VWVA 5B2MA 4FKQA 4C4EA 2A4LA 4FIGA 3UP2A 3PE2A 3DKFA 4G6NA 1XR1A 3LFNA 5HO7A 3OEFX 3FI3A 4O7RA 4F6SA 2WXVA 1Q41A 1OIRA 3ZEWA 2HZ0A 5HO6A 4WNPA 2HXQA 4NEUA 4PV0A 3E8NA 5FXRA 4ASDA 3PWDA 3TUDA 4JNWA 2QKRA 2W1EA 4RC2A 3HDNA 4YZNA 3CPCA 3QC4A 1J7UA 4ITIA 4WG3A 4AFJA 2EB2A 5J87A 5JQ5A 2WEVA 3OT8A 4C4GA 3OBJA 3V5LA 4BBEA 4UB7A 4BFMA 4DT9A 5EYKA 3BWFA 2XRUA 2A27A 3IDCA 1PMNA 4QD6A 3WILA 4QQJA 4JVGA 4MNFA 2VTSA 3QTRA 5CEMA 1FINA 2YDKA 4IB1A 4J99A 3UNJA 4LL5A 5IA4A 2E9VA 3F3UA 2OBJA 3W10A 1ZZLA 3CTQA 1SM2A 3KXGA 4IAZA 5ETCA 2F7XE 4AZWA 4IX5A 4CFMA 2WKMA 4E4LA 5AR7A 3OY1A 2VTPA 3SD0A 4U6RA 2OZAA 5HLPA 4I6HA 4UN0C 4YU2A 3QA0A 4Y83A 3PUPA 5KE0A 4IE9A 3W8LA 3P5KA 4Z16A 1OKVA 1YXSA 3IW8A 4V0GB 5A3XA 1FGIA 2O2UA 5DT3A 2QOKA 3JS2A 3OHTA 1PMVA 3H9FA 3T9TA 3EMGA 2XIXA 1A9UA 1SMHA 3ZS5A 3AMAA 3LHJA 2R3LA 4H1JA 4O7WA 3QCQA 4GIIA 4U80A 2VO7A 2YHVA 4A4XA 4HVGA 3OS3A 4BDKA 1KOAA 4IEBA 4KIKB 4BZDA 1FQ1B 4QYEA 3BBWA 2C6KA 3AT3A 2J4ZA 5ANJA 4WNOA 1NA7A 1TQIA 4FIHA 4UV0A 3MFTA 4MXAA 5FBOA 2WTWA 4OTGA 2FVDA 3L8XA 5HESA 3W1FA 3C5IA 4CG8A 4HPTE 3HKOA 4ZLZA 4C35A 5TO8A 3RJCA 4AUAA 4M13A 4Z9LA 3SV0A 3VUDA 3KEXA 2XEYA 3VS6A 5LVLA 4C36A 5J1WA 1ND4A 5DN3A 4F08A 1JQHA 2OK1A 3LFDA 2GNGA 3ZCLA 2P33A 4DEIA 4DG2E 2AC3A 5KHXA 5I9WA 4S34A 3AG9A 5A9UA 3EQHA 4IWPA 4KSPA 4ZTLA 4N0SA 5HVJA 3DBDA 4BCOA 1Q24A 2XNGA 3R7OA 3ORKA 5CXZA 2R4BA 4YO6A 5HBHA 2X2MA 3HMPA 2QU5A 4HGLA 5HEZA 3RNYA 4QO9A 2XJ0A 3RZBA 4HW7A 2FSOX 2I6LA 2Y4IB 4RIYB 4WSYA 5L2TA 3COKA 1PYEA 1TKIA 5L2QA 2J7TA 1KWPA 2XIRA 3E8CA 1LUFA 5K0XA 4D5HA 1PKGA 5BVKA 3K5VA 3QCSA 2E2BA 4O27B 2JEDA 4NWMA 1E1VA 4AZVA 1Y6AA 2W1ZA 1VYZA 3R6XA 1AGWA 3DQXA 2W1HA 3TL8A 3COMA 4JRNA 3NVMB 3A60A 3OXIA 4IFGA 1V0OA 2R3KA 4QMPA 3QWJA 2W96B 1SYKA 4U40A 5E8SA 5AA8A 4RLKA 3V8WA 1S9IA 4FV1A 4HVDA 3R7IA 3F2NA 2YZAA 2OXYA 5D12A 3UNZA 5A4EA 1YHWA 3G0EA 2JFLA 1RW8A 3O50A 4IAAA 3OCSA 3U4UA 3JY9A 3AQVA 2IW9A 2CLXA 3C7QA 2Y7JA 3V5TA 4AOJA 4CG9A 4IZ7A 4C2VA 3VUGA 4MD8E 5AFVA 3FQSA 4BDIA 5LMAA 2QOBA 3DJ6A 2VRXA 4ZSLA 4TZRA 2C69A 4RSSA 2GNIA 2ZM1A 3PXZA 3PPKA 4L67A 4MWIA 1PW2A 3U4WA 3R7YA 2QG7A 3DDQA 3Q96A 3ORTA 5CQUA 3A61A 1ZOHA 4C4FA 4DYMA 4L7FA 1ZYCA 5EDRA 5BNJA 3BYVA 4PTGA 5FTQA 4QNYA 4LOQA 1SVEA 3KK8A 3NCZA 4KA3A 5CVHA 1Z5MA 3ELJA 3SRVA 3T3VA 5H8GA 4G3EA 3K54A 5HIBA 3Q5ZA 4FSTA 3G0FA 2W0JA 2IZTA 2IWIA 4YJSA 5H3QA 4EHGA 4H3BA 4BI0A 2HELA 4HVSA 2UZDA 2WFYA 1WAKA 2UW4A 3GP0A 3SOCA 4AAAA 2JDTA 2QOIA 5KMIA 3BU6A 2C6TA 5FTGA 4FTUA 4DCEA 3D2KA 4Z3VA 2GQGA 1OPLA 5E90A 4GRBA 3FYKX 3Q52A 2RG6A 4D2TA 4CMUA 3O23A 2E9OA 3O96A 5HE0A 3H4JA 4W9XA 3E63A 3UG2A 4F0IA 4FA2A 3F88A 2H34A 3D94A 5ICPA 3Q4TA 4IVDA 4Q5EA 4B4LA 3M1SA 1FMKA 2J2IB 4BDDA 5IQHA 1BLXA 5AR3A 2KTYA 4O38A 5JGBA 5CU0A 2YWVA 3FKNA 2XKEA 2YACA 1W7HA 4R6VA 4QP3A 4CV9A 1YHVA 1GZNA 4GVJA 4JBVA 3TUBA 2B54A 3FXXA 3ENHA 3QZHA 2QVSE 5EHLA 3SG9A 4IAFA 3NUAA 4DT8A 1W8CA 4NM7A 4BCQA 5I3RA 1OIUA 3CE3A 4H05A 4UZHA 4V05A 5CYIA 4KNBA 4E5BA 4FIJA 4MD9E 1OBDA 3NYXA 4Y85A 3CGFA 2ZOQA 4DFBA 5EKOA 4APPA 1KV1A 3BE2A 3RZFA 1SNXA 5M4FA 5IA1A 4ANMA 4N4SA 3WF9A 4QP2A 4APCA 1B39A 1UKIA 1L3RE 2IN6A 4U3ZA 5E1SA 4IFCA 3VW8A 5HOAA 3UE4A 3V6SA 3O8PA 3ET7A 4RIOA 3L1SA 4KKHA 4RX9A 1OIYA 2UW8A 4QPAA 4QP9A 4PPAA 5EFQA 5FRIA 5E8YA 2PVYA 2QQ7A 3D5XA 3CBLA 2HWOA 4BDGA 2UZLA 5IQCA 4O7NA 4FOCA 4BI2A 4ASEA 3LLAA 2JKMA 2H6DA 2WGJA 2XNBA 4FMQA 4IAYA 1OPJA 1T45A 4FVPA 4MK0A 3UMWA 4CV8A 4O7ZA 5K9IA 5KBRA 5EW8A 3PZHA 4CFVA 2VTNA 4TY1A 4IM3A 3V5JA 4EOQA 3VHEA 2XCHA 4BL1A 5JFSA 5KO1A 5HTCA 4FKWA 4ZSGA 5B2LA 1BI7A 2OH4A 3OC1A 3BX5A 3R8LA 3IO7A 3P7CA 3NVKI 3HGKA 3DFAA 4CRLA 4F64A 5AAGA 2CPKE 5CZIA 1BKXA 3RHXA 2XKFA 3KA0A 2C6IA 2Z60A 4O6EA 5EI6A 4CTCA 2QOHA 1YDSE 3R01A 4NM0A 3ZOSA 4YTHA 4JG6A 4FV3A 4O0WA 3O0GA 4WIHA 3UZPA 4BGGA 2WIPA 4CFWA 2PUIA 3UNKA 5M56A 1PY5A 2VTAA 2WQBA 4Q2AA 4L00A 1JAMA 5HIEA 5AA9A 3WZEA 5KKRC 1B6CB 3CR0A 2GS6A 2C3JA 3UO5A 3D5UA 4EUTA 1Q99A 3IK3A 4PY1A 3GU7A 5CQWA 3L8PA 4QNAA 2RFNA 2E9NA 4GFGA 4C8BA 4O82A 3RPVA 2JFMA 4BCJA 5HTIA 2B1PA 4JIAA 3KK9A 2C1BA 4UEUA 4FEVA 2ONLA 2W9ZB 4EHZA 4XP2A 2OIDA 2GMXA 4MWHA 4QMLA 2W5HA 3S2PA 3FAAA 4R1VA 4MQ2A 2X7FA 2YM7A 4M84A 4CZUA 3QD0A 3R2BA 3GGFA 5H8EA 2W1IA 4QMXA 3QC9A 3TNHA 1IAHA 4LOOA 3I4BA 1OL2A 3OFMA 5G1XA 3R9DA 2HK5A 2OJFE 2QHNA 1VR2A 3TZMA 1SVHA 3R8PA 4W4YA 4XX9A 5AP1A 3HECA 4EOLA 2X8IA 3PXFA 4AZTA 2W7XA 2NNWB 1W82A 3LAUA 2UZBA 1UKHA 3SXFA 4ERKA 2WNTA 3BPRA 3EN9A 2VTLA 5LMKA 1QPCA 5M4UA 3TM0A 1TVOA 2GHGA 3FLSA 2GTMA 3IG7A 3PIXA 4R3PA 5DH3A 3I7BA 5EI2A 5BVWA 4EBVA 1NVSA 4I24A 4I1ZA 2PZPA 2W4OA 4ORKA 4MXZA 3I5NA 4TYEA 3SXRA 2OIQA 4D2PA 5L8KA 3MYGA 3OXZA 4S33A 4WO5A 1F3MC 4KIOA 1H28A 1ZLTA 4RWIA 3VS7A 5AV0A 5FGKA 3OOMA 3UVQA 4C4IA 4BBFA 4AT4A 3BELA 2Y6OA 2Z7SA 5AP3A 2F7ZE 3QUEA 3KU2A 4M12A 3LM5A 4FC0A 5AAEA 2PE1A 5IH6A 4CZYB 3MIYA 2JAVA 4CT2A 1XH5A 4D1XA 3FMHA 3SRVB 3O8UA 2JDRA 3MESA 4ZZOA 3FSKA 3LCTA 2BZJA 4FG7A 5CSPA 3AT2A 3DB6A 5CF5A 3JVRA 4JBQA 2BFYA 3FI4A 3FMMA 3MTFA 4YHTA 4ZSJA 3TJCA 4C33A 2HZIA 4XRLA 1DAYA 3POOA 3NGAA 3I60A 3MFRA 5ETAA 3TV4A 4EYMA 4HJOA 1U5QA 3R2YA 4EOPA 4GVAA 3BHHA 2ONLC 4CQGA 4Z7HA 4BHZA 1YOMA 2WTJA 3E7OA 3MVJA 3QLGA 4O0TA 4X3FC 2G1TA 4GT5A 2BRNA 2PSQA 4BCNA 1PXMA 4ASZA 3MJ1A 2PUPA 1OMWA 1V0BA 2YFXA 4PL3A 5IA0A 2W1CA 3RK7A 3DXPA 2W9FB 3GU4A 4XUFA 3OD6X 1Y91A 3ALNA 5D7AA 5GNKA 1JKTA 2HZ4A 3VS4A 4QT1A 2YJSA 3DFCB 3HMNA 1VJYA 3OXTA 5KKRB 1MRUA 2HAKA 2I7QA 3VUTA 4GUBA 5EM7A 5AUVA 3I5ZA 2VX3A 3MY0A 3D0EA 2EXCX 2XVDA 4MH7A 5HE2A 4E73A 4AW5A 5HLWA 3ZFYA 4FTMA 4KRDA 3UO6A 4J71A 4UYAA 3GOKA 3UVRA 3LZBA 4RVTA 2YN8A 2VUWA 3NUSA 3P7BA 4G5JA 3LFCA 2C3LA 5AIKA 3TWJA 3VUMA 4ZTRA 4DGLC 2B9FA 5ANEA 4V01A 4MBJA 4I92A 4Y72A 1Q97A 3ERKA 4AT3A 4K11A 4I0TA 5GIOE 4EOMA 4S30A 4XV3A 3VF8A 3FDNA 5HI2A 5CTPA 3KXMA 4F09A 2P0CA 2QR7A 2WD1A 4FNXA 4QTCA 2ZJWA 4BIBA 1OGUA 3DZOA 3LCKA 1Q8WA 2ZDTA 1KSWA 4OBPA 2CNQA 4AX8A 3NW5A 3HV7A 4FSUA 3NUYA 4NFNA 4CMOA 3SW4A 5J1VA 4HYIA 4WBBB 3VUHA 3W8QA 5M07A 4JR3A 1JSTA 2RKUA 3EL7A 3GC0A 3R73A 5L6OA 3MH2A 1H1QA 2HXLA 3N51A 3LCOA 4AACA 1H1PA 2OO8X 2OF2A 4KBAA 2XS0A 3HMIA 4PX6A 1DI8A 3S4QA 3ZXZA 2JKQA 1S9JA 5IZFA 1YXTA 1NW1A 3KXNA 3MBLA 1UWHA 4N6YA 2OJ9A 5C01A 3LOKA 4FYOA 4JDKA 2OKRA 4FOBA 3R9RA 4LGGA 2CKEA 3IW6A 4FZFB 3LQ8A 2PU8A 3G51A 4GK4A 1R0EA 2R0IA 4JX3A 4OTRA 5CWZA 5HBEA 4AS0A 3E64A 2BPMA 4YZDA 5IMEA 2R3MA 3B2TA 4WHZA 4DEBA 4IVCA 3V01A 2V0DA 3ID6C 3ZH8A 5L2IA 5EG3A 3GBZA 4E4NA 2W17A 3LXLA 2ITVA 3PIZA 3DNEA 4GYGA 2PZIA 3HX4A 3QTSA 4ANQA 3TNPC 4D28A 4FV2A 5IUGA 3KMUA 3OCTA 1QL6A 2VTHA 1ZMUA 3FLNC 5JEBA 4WRSA 3MY1A 3ZBFA 3ORNA 4ZZNA 2XB7A 3QCYA 2CKPA 3MV5A 2W1FA 3R8MA 2ERKA 4AGWA 3CP9A 2B52A 2PZRA 2VO0A 3FV8A 4GFOA 2OW3A 3DKCA 3RPYA 3FE3A 1WCCA 4E4MA 3OZ6A 3ZXTA 2I1MA 2WMXA 3A7GA 4X3FB 3HEGA 2RL5A 4F6WA 4USDA 3WZJA 1OB3A 3QQGA 4AU8A 5F95A 1Y57A 3GCVA 5J7HA 1WMKA 4NW5A 3QXOA 5FTOA 2QG5A 4YGAA 2YCRA 2G01A 1OL5A 2PMNX 4PNIA 2GS2A 3QX4A 4K8AA 2VNYA 4KWPA 2CGXA 4Y5HA 4Y95A 4R7BA 3F61A 2QLUA 1P4FA 3A62A 3QGWA 4CCUA 5CVGA 4E6DA 2Y6MA 3F82A 2XJ2A 1T46A 2UZVA 4RQKA 4CLIA 4FT3A 4DINA 1Q5KA 2PYWA 3E8DA 3SAYA 3FKLA 4FT9A 4TYHB 3THBA 3BLHA 3TNQB 3QAME 2PWLA 4KS8A 4UMRA 4NYEA 4YHJA 2JAMA 4DEEA 2WQEA 3H0YA 3VHKA 4CZTA 3W2PA 2Y0AA 3PJCA 2O5KA 4W8DA 5GINE 4WA9A 3BGZA 3IOKA 3PVUA 4FKJA 2OXXA 1V1KA 3B8QA 4BCGA 2Y9QA 5DHJA 3R1NA 4DH1A 4P7EA 2ZV7A 3NW6A 3ORPA 4FKLA 4KS7A 3TTIA 2HCKA 4DE4A 4IB5A 4YUQA 3LCDA 3MPMA 3FJQE 4KINA 1WBSA 3CCNA 4LM5A 4NTSA 5FG8A 4EH7A 2RGPA 5A4CA 5KCVA 4PMMA 2UZTA 3SX9A 1JPAA 3CQEA 5EYMA 4EYJA 3NMUF 4AGUA 3KB7A 3R7EA 2Z7QA 4J95A 5B2KA 5KMJA 4EWHA 3WI6A 1H0WA 5I9ZA 3HL7A 2JIUA 4NL0A 1JSUA 5FDXA 3E8EA 1KOBA 2BRBA 3EB0A 5D7VA 4V04A 4G3GA 3NYNA 4JIKA 2Z7RA 4EOIA 4PP9A 3H0ZA 2QR8A 3QQFA 3F3ZA 3TIYA 4AP7A 4BYIA 2W05A 4O0VA 4X21A 1BL7A 2PVFA 2WQMA 3L9PA 4EUUA 4OAUC 3QQKA 3QXPA 4QP4A 3TV7A 2A1AB 4DH8A 1DI9A 3VQHA 1UA2A 2C5OA 3EQRA 2RSVA 5HCXA 5TF9A 4K33A 4ZS0A 3VS2A 3HAMA 3Q5IA 5DE2A 3BI6A 5HCYA 2YAKA 4L3JA 4NIFA 4BRXA 5I9XA 4IWQA 4RX8A 1OL6A 2UW0A 3G33A 1UU3A 5CALA 4FSWA 5IA3A 5M06A 5L2SA 2ITPA 4ZP5A 3MY5A 2C6DA 1XBAA 5HD4A 2I0EA 5AIRA 2WPAA 4QMNA 2HENA 3NPCA 5EYDA 2BKZA 4ONAA 3OUNB 4BDFA 2EB3A 2Z02A 3FBVA 1ZMVA 4D2VA 5JH6A 4JS8A 4GS6A 4LUDA 3SW7A 4WNKA 2VWBA 3KVWA 2XF0A 4H39A 2BUJA 4FKPA 1KV2A 3VS3A 3WZDA 2PUNA 3OG7A 3D83A 3GEQA 2ZDUA 3DA6A 2PHKA 4QTAA 4Y73A 3RGFA 3KULB 3QALE 4ERWA 3D14A 2YEXA 4UMQA 5DMZA 1CKPA 1REJA 2P55A 4NM5A 3IDPA 4ANBA 2YM5A 2EU9A 3P7AA 3H9RA 4MKCA 4RFYA 4FKIA 2BHEA 4DTAA 5EW3A 1WBVA 5JRSA 3FWQA 3IONA 2BZHB 3MB7A 4L43A 2LAVA 5F1ZA 3CJFA 2FSTX 3LMGA 2YM3A 3UC3A 3CSVA 2GNLA 3CEKA 4MF0A 3UTOA 1YHSA 4IHPA 1ZYSA 4C59A 4UBAA 2X2LA 4F1MA 1STCE 4UMUA 4YC8A 5C4KA 4NSTA 4EH3A 5L4QA 4D58A 3ZM4A 2UVXA 3A2CA 4PMSA 5LOHA 3KN5A 4NKAA 4DGOA 3SXSA 4CLJA 4IW0A 4NCTA 4D4VA 1Z57A 3HDMA 4RIWB 4Y8DA 4QMWA 1IRKA 4IB3A 5D1JA 4CQEA 4R5SA 4FSNA 3PIYA 4AXAA 3Q9YA 4ZTHA 3UC4A 4C3PA 4S2ZA 4F7JA 4YPSA 3R30A 4M7IA 2C0OA 2F57A 3IKAA 4JX7A 3E92A 1J1BA 3PDTA 1UNHA 4AW2A 2WB8A 3JY0A 3NZ0A 4CKJA 4MVFA 4A7CA 1O6YA 2CCIA 2IVSA 3BQRA 4HNFA 4BHNA 4ITHA 4F1OA 3LXPA 4I93A 3UP7A 4QMQA 1R0PA 3GCQA 2JLDA 3O51A 4GH2A 5I5ZA 3FYJX 3R9NA 3H30A 5KBQA 3DLSA 3IPHA 3QKMA 5CENA 4MNEA 5JMSA 2BRGA 4W9WA 5F94A 1PXNA 3ZO2A 3PVWA 3ZC6A 2YABA 4QOXA 3RBWA 2IZSA 4IWOA 1U4DA 3W32A 1FGKA 3GU8A 1K9AA 4EK8A 3VW6A 5HBJA 4RGJA 2R5TA 4ZTQA 4U44A 3RALA 4OW8A 4AWIA 1H25A 2PVHA 4ZK5A 2BCJA 4BCPA 2O63A 4YC3A 3QZFA 1PRYA 4I41A 1ZY4A 3E93A 2NPQA 4PTCA 2P4IA 2H9VA 3DV3A 4I6FA 1UWJA 2QNJA 3DKOA 3FSFA 4FSZA 2CCHA 3HP2A 4FSYA 3CQUA 4QP7A 5DBXA 5JKGA 5LVOA 5FD2A 3RNIA 3SQQA 4E3CA 4J7BA 4OGRA 4BGQA 3RAHA 4BTJA 3BZ3A 3QFVA 4R3CA 4WT6A 3KXZA 3RK9A 5AR4A 4EORA 4FKRA 4BDJA 5IMXA 3S0OA 4Z7GA 2BZIB 1GIHA 2XIZA 2C5XA 5GJDA 3GCSA 5EI8A 1JWHA 2JBPA 4ZAUA 4FG8A 4Y46A 1OKYA 3LFAA 1JKKA 2R64A 5CT7A 4QPSA 3WZKA 3GFWA 1H8FA 3ZUUA 3Q4UA 4KIPA 3QKLA 3NNWA 4X6QC 1PXKA 4NCTC 5AP2A 3P86A 4OT5A 4YJUA 4DGMA 3MH1A 5CI6A 2W1DA 3LJ1A 5CEKA 4H1MA 4BDHA 3GOPA 2WMUA 2ZB1A 1DAWA 2OJJA 1OPKA 2IVTA 4U3YA 3QQJA 4ZMFA 2X8EA 3SKCA 3MTLA 4IQ6A 3SDJA 5DRBA 1ZAOA 3OUKA 4OBQA 2BALA 1ERKA 4TXCA 1CM8A 3OOGA 1OVEA 3KVXA 4IC8A 3DPKA 3QHRA 4RMZA 4PPBA 5LWMA 3HV6A 4WG5A 2YLFA 3RAKA 4JAJA 4J52A 3BHYA 4DH3A 3VC4A 3VBWA 4RQVA 3C51A 5M09A 4ZJIA 3ZZWA 5FM3A 3TCPA 5AMNA 4B0GA 3QWKA 1H24A 1OUKA 3RTPA 4X7QA 3TNIA 4EH2A 3CQWA 3SA0A 5L6PA 1JVPP 2RFSA 3E7VA 4C4HA 4R77A 4AN9A 3AMYA 3ZRMA 3C4XA 3MIAA 3LKMA 3VBYA 1Y6BA 3UGCA 2R7BA 3ZO1A 3DY7A 4M67A 3PJ1A 1MUOA 4MD7E 5HNGA 4IZYA 3CS9A 4UALA 1L8TA 5IEXA 4G2FA 5LVMA 1RDQE 2ESMA 3RAIA 4IBMA 3U9NA 4DEGA 3TZ8A 4O96A 1JKSA 4W4WA 2JKKA 4FKSA 2R7IA 2WMSA 5EQPA 5AWMA 5HVYA 3SOAA 5HICA 3PY0A 1KUTA 3QZGA 3LVPA 4O0SA 2O65A 2OXDA 2WZJA 3L9LA 2VO3A 3W2CA 4A4OA 3QGYA 5CY3A 4U81A 3FKOA 3Q4ZA 1Y8YA 3EWHA 5GZ9A 3FY2A 3JVSA 2QONA 3UIXA 3LXKA 1LEZA 3TZ9A 3LXNA 2BAKA 5C8NA 3QYZA 2AYPA 2PVMA 4F7NA 4TYIA 4BCHA 3NUXA 1GZ8A 4A9UA 4YNOA 4DGNA 2PUUA 3MA6A 4YJPA 2C0TA 2C6EA 1ZY5A 2NP8A 1Q3WA 2J6MA 3QHWA 2QOQA 3GT8A 4G34A 5DT0A 2OIBA 2BTSA 3L8VA 3CKXA 5EDQA 4FR4A 4C62A 4O86A 3DZQA 4E20A 2UW5A 2B9JA 4WD5A 4ZY4A 3NWWA 4RIXB 4ZOGA 1BI8A 3MVLA 2BFXA 3PRFA 4RJ6A 3HZTA 1Z9XA 4O7VA 4J1RA
chains in the Genus database with same CATH superfamily
2QLQA 5J9ZA 4M0YA 5EK7A 3ZO4A 4JDIA 3T3UA 2F7EE 4DTBA 2PVJA 2F4JA 1OL1A 5H2UA 4YTIA 4CCBA 5AUTA 2RFDA 4TN6A 5IEYA 4B99A 2WMBA 4BZNA 5E7RA 4EH9A 4LL0A 2ZM3A 3G9NA 4UX9A 2WEIA 3ZDIA 2JITA 1PXLA 5CS6A 2B9HA 5BUIA 4DFYA 2X81A 3NAYA 3T9IA 2BIYA 3W16A 2YAAA 3NSZA 4F4PA 5IA2A 1CMKE 2HY81 4ENXA 2XKCA 4RJ7A 4E26A 5LQFA 4F78A 4F7SA 5C8KA 1YXXA 4BTKA 1Q61A 2VNWA 3PG1A 2VTOA 3VJNA 4PMPA 3GVUA 2G15A 2WMWA 1NT2A 3UQFA 5LVPA 4QMSA 1FVVA 1WZYA 3DAKA 4WBOA 4L52A 2IZRA 4E6QA 1W98A 4HVIA 4F9BA 3BBTB 2GSFA 3MGYA 3UVPA 4C7TA 4AOTA 2GU8A 1YI3A 3PSCA 4G6OA 5A4LA 5BVNA 5IISA 3KRLA 3EHAA 4CD0A 4M68A 1PXPA 2FYSA 4NZWB 4DFLA 2CMWA 2X9FA 4EOOA 3N4VA 4CXAA 4AN2A 3NNXA 4IAKA 3AC4A 3KCKA 3OCBA 1BYGA 4JBOA 4YJNA 4O1OA 2XK3A 2UZUE 4IX3A 5D9HA 3PSDA 2OZAB 3C4ZA 3F69A 3PLSA 5KMMA 2X2KA 5ACKA 1G8SA 3HAVA 2FO0A 4LQMA 4MYGA 5DI1A 1BX6A 4FX3A 3V8SA 1AD5A 2OLCA 3TN8A 4FTKA 3W18A 3LPBA 2XM9A 4BKJA 2F9GA 2HZNA 3A7JA 1KE7A 3FC1X 4FVRA 4F70A 4ZSAA 4WUNA 3A8WA 5T6KA 4F0FA 3AD5A 4RVLA 4DEDA 3PXYA 4D2RA 5HVKA 5K4IA 2GQSA 3CTHA 4U97A 5D10A 2SRCA 4B8MA 3R1YA 3QTWA 4GIHA 4FTAA 4X2FA 3FL5A 4U8ZA 3NAXA 5JK3A 3O7LB 2BZKB 2P3GX 4PWNA 3CKWA 2XKDA 5E8UA 3E3PA 2QKWB 2WTKB 2Y8OA 3DTCA 1YDTE 4J98A 1H26A 1WVYA 2O64A 4XG3A 3KL8A 1IR3A 3QTUA 4UWCA 3L9NA 1NVQA 4YJTA 3QUPA 5ANDA 4DLJA 4MF1A 4YTCA 4QQCA 2GTNA 2OFVA 4RJ3A 4AA0A 2XALA 3NFFB 2B53A 5AADA 5DYJA 5GHVA 4WRGA 2J0JA 2NO3A 3I6WA 1WVXA 3RINA 3IDBA 3VS5A 3ZHPC 5F20A 1P14A 4HYSA 4QTBA 3KMWA 5AV1A 2YLEA 2VTTA 3LFSA 5A46A 2G9XA 4KUJA 3AKLA 5DA3A 1O9UA 3FHRA 3TKUA 4FEWA 2ITYA 5K0KA 3UO4A 4EH8A 2VTMA 4TWOA 3SG8A 3N4UA 3OF0A 1J7LA 4XP3A 4F9WA 3JUHA 5JZJA 3NNVA 4L42A 2IF8A 3LW0A 5BUJA 4Y5QA 3EFJA 4A9RA 1KE5A 3EN7A 4PPCA 4PDOA 4QYFA 1YI6A 3HUBA 3CLYA 3NRMA 4L44A 4Q5HA 4RRVA 3V5WA 4TL0A 5J9LA 2AUHA 5HU3A 1A06A 4J96A 5IPJA 3ZUTA 5CU4A 3BCEA 3BWJA 3D9VA 5EM6A 1GOLA 1M17A 1Q8UA 1W83A 1H4LA 1IA8A 4D1SA 2XH5A 3AC5A 3G9LX 4Z55A 4EL9A 2NYAA 3FZPA 5CAQA 3ETAA 4M15A 4K1BA 4XBRA 2PPQA 3ZLWA 3RI1A 3COHA 2J51A 3C4FA 4DLIA 4GG7A 4BDCA 1GZKA 5J5SA 1H00A 2IVVA 1OKZA 4RC3A 3TACA 4GK2A 4EHVA 3WE4A 4BI1A 3TEIA 2OF4A 5K4JA 4YHFA 2GQRA 1MRVA 3U6JA 3LFFA 5CSWA 1H0VA 4RVMA 4GKIA 2GDOA 3UOHA 1Q8ZA 4ACCA 2C6LA 3ZLSA 5GZAA 4EK6A 4C58A 4DTKA 3P0MA 2XK6A 3FPQA 5IU2A 1REKA 4R8QA 4YJQA 4HVHA 5AUUA 4KB8A 4OTFA 3T8OA 5BMMA 4CGAA 2BDJA 5AR8A 5DG5A 5TT7A 4J53A 3OROA 4YJRA 5HG5A 3VBTA 1TQPA 2X6EA 2REIA 4CFFA 3TDWA 3ZC5A 2OJIA 4LV5A 4ALVA 5TR6A 5CASA 5JRQA 4DCAA 3BV2A 5HD7A 4ALWA 4GT3A 5IEVA 4FODA 3BGPA 2JDOA 2UW9A 3BIZA 4YJOA 4FYNA 4TPTA 5I3OA 3E88A 3OEZA 2OJGA 2FGIA 3PXQA 1APME 4QMYA 4X2JA 3CC6A 3UIUA 2IG7A 4ZMEA 3V8TA 4OLIA 3A8XA 3A99A 2X0GA 4G9CA 5B7VA 4F65A 5D11A 2XK7A 4XG9A 2BR1A 5FWKK 4CSVA 4ANLA 5DVRA 5L8LA 3VS1A 2CNUA 2YCFA 3EH9A 2VWZA 5K3YA 4LYNA 1BL6A 4R1YA 4DH7A 4FKGA 4CYJA 2YISA 2J0MB 4USFA 4XCUA 4M69A 5AV3A 4RBLA 5AP7A 2VX1A 2BMCA 3UQCA 4BF2A 3I1AA 3EQPA 3AXWA 1YRPA 5DRDA 3U8WA 3VIDA 3VUIA 5BVFA 5A4QA 3NLBA 3ACJA 3UJGA 5LMKC 2V62A 2FH9A 1ZYDA 1Q8TA 3ACKA 5HG7A 3CTJA 5C8MA 3OWKA 4I3ZA 4E4XA 5CSVA 4C61A 4IXPA 4M0ZA 3R7GA 5IQFA 4QTEA 2WU7A 2R3OA 2VTRA 2ITNA 3P4KA 2G2IA 3TG1A 1E1XA 4ZS4A 4XMOA 4RWJA 4PL5A 4AN3A 5C1QB 4BY9E 4XNEA 3LFBA 4I5HA 4LMUA 4AA5A 4IM0A 2R3JA 4BTMA 3IW5A 1IA9A 4FRFA 4CFUA 4JR7A 4FSMA 2CSNA 4RX5A 5FQDC 4L53A 4ZTMA 2W1GA 3ANQA 3P1AA 4L46A 5AJQA 5HTBA 4MTAA 4IIRA 3HA6A 3ZEPA 2ERZE 3MJ2A 3MVMA 3NUPA 5T3QA 3VQUA 3LMIA 2WMTA 3ZU7A 2WO6A 3F66A 4RFMA 4FNYA 3HRCA 4BBMA 1URCA 5KZ0A 3VONA 4FUYA 1LR4A 3CPBA 3FZTA 3KMMA 1H01A 3E87A 3I0QA 4XRJA 4HCTA 2XK4A 4MEDA 3VBVA 2J50A 3WIKA 4LRKA 3UPXA 4ASXA 5CAPA 5TOZA 4UZDA 3R21A 1WVWA 3FZRA 2IW6A 3RVGA 4U79A 4AF3A 3DXQA 5J5TA 2BDWA 4PDPA 4FIIA 4GMYA 4NTTA 4QMTA 4U5JA 3ULZA 3AOXA 3UOJA 3OWLA 5IH4A 3OWPA 3NNUA 2WTDA 2VTJA 2FA2A 4O2PA 3R1QA 2GFSA 4QMMA 4RZWA 3WF5A 4U9AA 3O2MA 2FSMX 2VWIA 2YDJA 4GK3A 4PMTA 3EFLA 1OM1A 3A4PA 3G15A 4FF8A 2J90A 1GAGA 3FI2A 4YNEA 3CY3A 2DS1A 3GXLA 3OTUA 2VWWA 5AX9A 4BDBA 4DDIA 1YWNA 2YIRA 2HIWA 2DYLA 2QOCA 3I81A 2VGPA 3KQ7A 4XV2A 4BWPA 3QL8A 3HUCA 3P79A 4P5ZA 4QP1A 5DEWA 3TKIA 5KMLA 3MH0A 4FKVA 2VN9A 2Q83A 3CD8A 4YURA 2XANA 3EFWA 1YOLA 4CFXA 4DEHA 3ODYX 4KSQA 4DHJA 3W2SA 4EEVA 5L8JA 3BU3A 3LQ5A 2VWYA 3NYOA 4KD1A 4K77A 2BAQA 3EQBA 2W4KA 3LLTA 1OI9A 5EM5A 1G8AA 4FI1A 4M8TA 4RX7A 3U55A 5L3AA 2RF9A 1QMZA 5A54A 4C2WA 1OECA 5M55A 2XNMA 1Q3DA 5I0BA 2H96A 4RG0A 1FPUA 1H07A 5DIAA 4EK5A 4O7LA 4FVQA 1LP4A 4M14A 4TWPA 1XQZA 5ACBC 2QI8A 4G9RA 4ZZMA 2DUVA 4KAOA 5ETIA 4FTNA 4L6QA 5BPYA 1OUYA 4PUZA 1NY3A 3FMLA 4FEQA 2FUMA 3BLRA 4O21A 4EC8A 2F49A 2YM4A 2BHHA 3MWUA 5ANGA 1A48A 3HRBA 3EQGA 1FVRA 4L8MA 2R3HA 4XS2A 3UMXA 3RKBA 4F1TA 2Q0BA 4F9AA 3SVVA 3UODA 2OZOA 5AM6A 3IOPA 2VD5A 3HP5A 3W2QA 4KIQA 4V0GA 1GIIA 2LGCA 4W4XA 3ATSA 3C5UA 1YWRA 4GJ2A 5IUHA 4KKEA 1JLUE 1QPEA 2XP2A 2XYUA 5CVFA 2XAMA 1ZARA 3FL4A 3W2OA 4R5YA 4DG0E 2UZWE 5F4NA 4YPDA 3TNWA 5KUPA 5AP5A 4O0YA 1J91A 4EOJA 1ZXEA 4KIKA 4IC7A 2UW6A 3CJGA 3AGLA 3NUNA 4O2ZA 2V7OA 4FZDB 4OTDA 2GNJA 5CSXA 1M2RA 2QODA 2RG5A 3AC3A 4FT0A 4XLIA 5IH5A 4GSBA 4X2KA 5EQYA 2OH0E 4GKHA 3DK3A 4HCUA 4LRJA 2R3GA 2J0KA 5IQAA 3HMOA 1WBWA 2GS7A 3C9WA 3ZRKA 5FLFA 3ORXA 4Q9ZA 5AV4A 3OY3A 4LFIA 3TIZA 3MDYA 4FZAB 4LDTA 4FSRA 2P2HA 3OBGA 3KY2A 4FTJA 1E9HA 5J79A 3HV4A 2OICA 4U41A 2B4SB 4FZ7A 3D5VA 3LJ0A 4M69B 4TW9A 2BROA 3DAEA 3ZSIA 5BMSA 4AG8A 2XBJA 4AGCA 4L01A 4NJ3A 3AD4A 2ITUA 2UVZA 1X8BA 3F9NA 3NUUA 3UIBA 2OSCA 3LFQA 4MQ1A 2Z2WA 5HLNA 1MP8A 5CAOA 3EYHA 5E8XA 5E91A 5EDPA 3Q2JA 4A9YA 4IAIA 4E7WA 1I44A 1RQQA 2VU3A 2QHMA 2PZYA 3BV3A 3C1XA 3PSBA 4HGTA 3TI1A 1Q8YA 4OR5A 4XBUA 3QRTA 3F2RA 3DTWA 5CANA 5IQBA 3Q60A 3LJ2A 2PL0A 2YCSA 5C03A 3GQIA 4EH5A 4F9YA 3O17A 4FEUA 4O84A 4AGDA 4EK3A 3BYUA 2ZV2A 3BHUA 3CXWA 5H8BA 1ZOEA 3NW7A 4YZCA 4NFMA 3DBFA 4QYYA 3TDVA 5KHWA 3VBXA 3KC3A 2VZ6A 4YZBA 3BKBA 4G6LA 2W06A 1H1WA 5DLSA 3UG1A 3W33A 1ST0A 3B8RA 1R3CA 3MS9A 4M66A 2HW6A 3AC8A 4I0SA 4KABA 4EKKA 2W4JA 3PZEA 1XBBA 3QD3A 4EHEA 1KE6A 4JMQA 3HRFA 4D0XA 4D55A 3D7ZA 4RWKA 3F3WA 3OT3A 2R3RA 3FZ1A 2ZVAA 4PDSA 4D1ZA 5EKNA 2E9PA 4HZRA 4EI4A 4FGBA 1PXIA 4EK4A 3DS6A 1R1WA 3R22A 3KGAA 4FTTA 4LUEA 1UV5A 4KBKA 1JSVA 4AFEA 1WBPA 5AP6A 5CT0A 1SZMA 1H08A 3GB2A 4WOVA 3W55A 4O7SA 1MQBA 4O7TA 1UU9A 4ANNA 3EKKA 2YM6A 4A07A 4L68A 4XG6A 2YA9A 5M53A 2XAOA 3F7WA 3PJ3A 3FMNA 4DG3E 2X39A 4MXOA 4BB4A 4FL3A 4YTFA 3C0GA 2AEGA 1AQ1A 1SNUA 5KMOA 4ZSEA 4HPUE 3VBQA 5AX3A 5H9BA 3R8UA 2YM8A 2R9SA 5EM8A 1YXUA 2R0UA 3GI3A 3V5QA 1PHKA 5M08A 2HY0A 2YIWA 2ZYBA 3P08A 4I22A 5IDPA 5EH0A 4UWBA 5CXHA 5G6VA 4GFMA 1GNGA 4MHAA 3SLSA 2O3PA 3A4OX 2EXMA 3DBEA 3H9OA 3JYAA 4LG4A 5CF4A 4YLKA 4DHFA 2X4FA 3ZTXA 4IH8A 4EOKA 4N70A 5J8IA 4XEYA 3WF6A 2YERA 3E5AA 5AM7A 2GHLA 4I6QA 5AV2A 3OCGA 3R7VA 3VJOA 4HZSA 5ANOA 2UZNA 2CLQA 3PP1A 1CSNA 4JQ7A 3S00A 3V51A 4TYJA 4DN5A 3R1SA 4S31A 5FUTA 3JXWA 3BHTA 4TNBA 2QC6A 5BYLA 2R3QA 4K18A 4N6ZA 2JBOA 3ZBXA 5BVDA 4UY9A 3FZSA 4YBKA 5AP4A 2XM8A 2A19B 4FV9A 4ZY6A 4C0TA 5J9YA 4O6LA 2CN5A 5EYCA 4LV7A 5HE1A 2UV2A 3PWYA 1YQJA 1UNGA 3Q2MA 4JXFA 3GU5A 3W0PA 4QPMA 3LQ3A 2HOGA 3EQDA 3EKNA 1MQ4A 3FEGA 4C34A 3POZA 4L7SA 3U6IA 2JDVA 3MFSA 4RWLA 2V5QA 4D2SA 4AE9A 1OZ1A 2ETKA 3D2IA 1U54A 2IZUA 2CGWA 3GC7A 4R3RA 4YR8A 5E92A 3PY1A 4FUXA 4AZSA 1WBTA 4I5CA 2DQ7X 4BVUA 4B6LA 4JBPA 4YBJA 1URWA 3GCUA 4KBCA 3RK5A 3AD6A 4WKQA 3W0MA 4ZLOA 2YITA 4JRVA 4EH6A 2WMQA 1M2PA 5K5XA 5L2WA 4E5WA 4PL4A 3C0IA 3EFKA 4EQCA 5KX8A 2IO6A 2C5VA 4DFZE 5A6NA 4MUQA 2WU6A 4ZIMA 2X6DA 4ITJA 4FT7A 1WFCA 1G8KA 2W99B 2C4GA 3EQFA 3ANRA 4MXXA 4ZTNA 1XKKA 2YCQA 2CHLA 4I0RA 1KE9A 4O83A 4FK6A 3Q6WA 3FC2A 1IG1A 4FIEA 4HYHA 4E8AA 1XH7A 2QOOA 5FBNC 3EZVA 3IW7A 4U45A 2C6MA 2VX0A 5IA5A 3DOGA 1FOTA 2VO6A 1ZMWA 1DS5A 3KXHA 4OBOA 2R3PA 2XK9A 3G6GA 4I94A 4QP8A 4BCFA 2XIKA 4UMTA 1V0PA 2ITWA 4D9UA 3C0HA 4U0IA 1EH4A 3R0TA 4OTHA 1QCFA 4CNHA 4W4VA 1U59A 3VN9A 4NH1A 4YC6A 2GPHA 3G6HA 2WOUA 2XK8A 5I9YA 5CEQA 4MBIA 2X7GA 5E8TA 3WOWA 4KRCA 4E5AX 3COIA 4NIFB 3LE6A 4H36A 3DJ5A 4A4LA 4AQKA 3BGQA 4U42A 3PLAE 3AMBA 3M11A 4MAOA 2QO9A 4XLVA 3C13A 3ZYAA 3W2RA 5IQEA 4DBNA 5FXSA 5TE0A 4I21A 2XBAA 4QMOA 4CKRA 1RJBA 5FP6A 2B9IA 3ALOA 3L8SA 5DEYA 2ITQA 1XH8A 4YJVA 4NK9A 3RP9A 4FKOA 1YW2A 4G1WA 5AR5A 5IKWA 4BDAA 5HORA 3EIDA 1H27A 1M7QA 3IQ7A 3PA4A 5BVEA 3ZONA 4E1ZA 2NRUA 2PE0A 2VWXA 3OWJA 4GT4A 4S32A 1VEBA 4DH5A 5CAVA 3NIZA 5DWRA 2WTKC 5FP5A 3RWPA 1PJKA 3RM6A 2ETMA 5HX8A 5LJJA 2GHMA 3BQCA 2H8HA 3WBLA 2E9UA 2VGOA 4O0RA 5DR9A 3C50A 3NIEA 4FV8A 3REPA 3NR9A 4EONA 4O81A 4ACMA 5BX0A 4YSMA 3D7TA 3BLQA 3MW1A 4BZOA 4L3LA 5HIDA 4BWXA 1ATPE 4C4JA 4FV7A 3O5AA 4JQ8A 3FMEA 3C4EA 4YLLA 3DK6A 5HG8A 4D5KA 1WBOA 5CX9A 4EH4A 4YLJA 3QRKA 3KCFA 3U9CA 5IQDA 5HQ0A 3KXXA 3F2AA 2C5YA 3F5XA 4C37A 3HV3A 1XWSA 2BVAA 3DCVA 3Q6UA 3LFEA 2ZAZA 3FMJA 4H3PA 3RHKA 3MI9A 4AT5A 4WSQA 4ZY5A 5HNIX 5E8VA 4BCIA 2JC6A 1ZZ2A 3EL8A 1M2QA 4BCMA 1ZRZA 4NT4A 4BCKA 4BKYA 4QMVA 4ZJJA 4DEAA 1UVRA 4BTFA 5BYYA 1OKWA 1YVJA 2YIQA 4USEA 3DQWA 3FZOA 4XH6A 3K2LA 2ITZA 1O6LA 2J5EA 3BEGA 4PQNA 4BIDA 5CAUA 2XUUA 4I4FA 5JFWA 1QPJA 3KF4A 3PPJA 4UXLA 4Q9SA 3P23A 4YMJA 2C30A 3PFQA 4OUCA 2PVRA 4FV6A 4YO4A 1H1RA 2WMAA 2YIXA 3QZIA 3WF8A 4FGRA 3QA8A 4MNEB 5M51A 4II5A 4IDVA 3KN6A 2WOTA 2YWPA 2VTQA 3GFEA 4P5QA 3KRJA 4OTIA 4EZ5A 4NU1A 1W0XC 4O0XA 1LPUA 4GU6A 1Q62A 2Z8CA 2UUEA 3RCDA 3FMKA 2YJRA 5AAFA 4CTBA 4ZJVA 3O7LD 1MRYA 5C4LA 4JI9A 4QQTA 4O1PA 4K9YA 4QTDA 4YZ9A 2I0HA 2F2UA 1CDKA 2XNNA 4E93A 4FT5A 3IECA 3DKGA 2PMLX 3AT4A 1XH6A 3D15A 3E3BX 2X9EA 3KRWA 3DGKA 3MPTA 4I5MA 4FKUA 4EJNA 2R3FA 1YXVA 3O71A 3QF9A 4IWDA 4IZ5A 4O0UA 2XIYA 3UOLA 3MA3A 4UWYA 3ZUVA 4K0YA 3P78A 3UDZA 5KNJA 1PXJA 3DT1A 3R71A 3U6HA 3MSSA 3OMVA 3PJ2A 2QOLA 4BR3A 3H10A 1M14A 4AZFA 1U54B 3QTIA 3ITZA 4ANSA 3AKKA 3HMMA 3VUKA 4M3QA 3PE1A 4AXDA 4LGDA 4QDVA 4IX4A 3FLQA 2GNHA 3P9JA 4ALUA 4C3FA 3KRRA 3W0NA 2ZB0A 5A4TA 2WELA 3I6UA 1BUHA 4X0MA 5ITAA 4E6CA 4ACHA 4XYFA 1YOJA 3IGGA 3KFAA 1GIJA 1JNKA 3PA5A 2JDSA 1NVRA 4I4EA 5HHWA 4D9TA 2WMRA 1FMOE 3FHIA 3MPAA 5LVNA 1IASA 2WQNA 4AW1A 5BUEA 3FQEA 3ZDUA 3PJ8A 2X8DA 1I09A 3A7FA 2X4ZA 2CNVA 1CKIA 1W2DA 3FLZA 2DWBA 2V7AA 4QQ5A 2WIHA 2Y4PA 4CYIA 2BDFA 5EHYA 3DNDA 3C4WA 2YZLA 1M52A 2ETRA 3GNIB 5IQGA 4I20A 2WHBA 3I79A 5JFXA 3U54A 4AXFA 3AC2A 4YP8A 3HV5A 1J7IA 4JQEA 3QTZA 3PVGA 1P5EA 4XOYA 4OT6A 4DFXE 4XG8A 4D4YA 5DT4A 4RA5A 3ENMA 4C3RA 1P2AA 2HWPA 3Q53A 4GW8A 4O91A 3KREA 4FG9A 4BIEA 3IW4A 3D4QA 4H3QA 5IF1A 1R39A 4XP0A 4WNMA 2EXEA 4IM2A 2EUFB 2W5AA 2XRWA 1FBNA 4DGGA 5CF6A 5DFPA 5E1EA 2XNPA 3VULA 3ORMA 3G5DA 1QPDA 4AAYA 3PXRA 5KZIA 2O0UA 3V6RA 3D5WA 2PE2A 4FSQA 4X3FA 4FTIA 5DNRA 4DFNA 1HCLA 4G3DA 4CFNA 3R83A 3DAJA 3SHEA 3R00A 4XHKB 3QQUA 1OL7A 2OGVA 1XH4A 3HA8A 3O8TA 3QRJA 4FICA 1GZOA 4F0GA 3GC8A 3VRYA 4QMZA 4F6UA 2XA4A 2OFUA 5B0XA 1ZWSA 4EQUA 5FEQA 1DM2A 4O7YA 2C5NA 4RFZA 3WYYA 4XJ0A 5CU3A 4ZXTA 3VVHA 2WTIA 4LRMA 4C02A 5TKDA 5CEPA 4QDEA 3QYWA 3NX8A 5JGDA 4MX9A 4AA4A 4TYHA 3MFUA 4GYIA 3FPMA 3R04A 4GEOA 4NW6A 1YKRA 4YZMA 4AW0A 3ZSHA 4RJ4A 4WG4A 3FY0A 3WZUA 3M2WA 5IDNA 1BMKA 5AUWA 1PKDA 2PVNA 5DPVA 3QD4A 5GJGA 3WIGA 1ZOGA 4OTPA 4TKSA 4A9TA 3D7TB 3KKVA 3DU8A 3F5PA 4O22A 5GJFA 4TNDA 4ZEGA 2KULA 3ULIA 3WYXA 2ZMCA 1ZYJA 5FM2A 3NYVA 1OIQA 2Q0NA 4R78A 2I40A 3E62A 2WQOA 3BHVA 2CKOA 5HU9A 3VNTA 1PMUA 4GU9A 2EWAA 5JGAA 2CN8A 4CT1A 4FK3A 4ARKA 2ZV8A 4E6AA 5HE3A 3ZM9A 5M57A 4FTLA 3QQHA 4JG8A 5E4HA 3TV6A 2X0QA 3ZFMA 1K2PA 2XNEA 3NEWA 3QLFA 4LOPA 3V3VA 1PYXA 3PYYA 2CGUA 3EN5A 4JT3A 1J1CA 2UZOA 3F7ZA 5JSMA 3FQHA 2VWUA 5LCJA 4D0WA 2XZSA 3FMDA 2C6OA 5CSHA 3WARA 4F7LA 2QO7A 4N57A 5LXMA 5HZNA 4OTWA 1TZDA 2UZEA 4FZ6A 4DC2A 4C38A 5CF8A 4I23A 2JD5A 5AEPA 4EBWA 4HGSA 2R3NA 3F5UA 4UXQA 2CGVA 2ITXA 1PF8A 5CLPA 4QMUA 1XO2B 4EC9A 4FNZA 3R7UA 1VLRA 4TT7A 5LMBA 1F5QA 2C0IA 4EWQA 1R78A 4A06A 3FI8A 3DDPA 3HNGA 3QKKA 3Q9XA 3UZRA 5HGIA 3KRXA 4IACA 2HYYA 4JL9A 4QRCA 3K3IA 3TKHA 1CKJA 5LARA 5HG9A 2QOFA 3S3IA 3QQLA 3PP0A 2ITTA 3I7CA 2GNFA 3Q04A 3ZFXA 3NDMA 4TWNA 4TYGA 1OITA 2QURA 2X0PA 4PP7A 4FIFA 4GL9A 3CGOA 2BTRA 5CNOA 4FV4A 5DR6A 4NUSA 2A2AA 3PA3A 3VRZA 5I9VA 4DBXA 2G2FA 5DOSA 4CRSA 4DFUA 4J8MA 4LGHA 1XMMA 3BYOA 4F63A 4BGHA 1H1SA 4BC6A 2JGZA 4U7ZA 4ACDA 4HCVA 1G3NA 3LM0A 1PXOA 3L9MA 3KULA 4FTOA 3GUBA 1K3AA 2XYNA 3G90X 1IEPA 3MB6A 4JOAA 5CU6A 4EKLA 2J9MA 5CEOA 4F9CA 4P4CA 3RM7A 1U5RA 3QX2A 4WUAA 2YDIA 4HNIA 5F9EA 4B9DA 4G17A 3VS0A 4C57A 5CNNA 2C3IB 4X6RA 3RPOA 4OAVB 4G3CA 2VAGA 4FL2A 3CD3A 4L45A 4ZLYA 3U51A 4XG4A 4GV1A 5D41A 1W84A 3Q9WA 4AXEA 2JKOA 3QTQA 1U46A 1HCKA 3C4CA 4ID7A 4PDYA 3HLLA 3UDBA 5IG1A 2NRYA 4ACGA 3KF7A 2CJMA 2V22A 3NCGA 4JAIA 3GU6A 5M44A 4L9IA 3DK7A 3K3JA 3N9XA 3VWAA 3ZO3A 5EW9A 2C3KA 3DBCA 4QYGA 4JG7A 1XHAA 3PXKA 1ZYLA 4RIWA 2A0CX 3WE8A 5HKMA 3ZRLA 4TRLA 4EZ3A 3R02A 1XBCA 1LEWA 3II5A 1IAJA 3U87A 4XG2A 5AUXA 1JBPE 4HGEA 2BKKA 4AE6A 1W2CA 2BIKB 3FLYA 3V04A 3UZTA 3MN3A 3TXOA 3ZLYA 4K2RA 4G3FA 3R9HA 4ENYA 1F0QA 4W8EA 5BVOA 1ST4A 2PULA 5AUZA 4B7TA 3FXZA 2W5BA 5CZHA 3ZMMA 1SVGA 5JFVA 3ZZEA 5M4IA 5E9EA 1KE8A 4O4DA 1GJOA 5JN2A 3SGCA 5KMKA 4AZEA 2IPXA 1XH9A 5C9CA 3ROCA 4FL1A 4NM3A 3QUDA 4G31A 3F6XA 1RE8A 5C27A 3H3CA 4A9SA 2P2IA 4IMYA 4J97A 3R9OA 4UMPA 4X2GA 1P4OA 1YWVA 4B8LA 1OBGA 4JDJA 1UU8A 2PVLA 2OWBA 3Q4CA 5GIPE 2R2PA 1VYWA 2ZMDA 5ETFA 4ANOA 4IZAA 5EOBA 5JZNA 4PF4A 3TT0A 2UW3A 3OW4A 3RWQA 3UOKA 4YSJA 2JIVA 5CEIA 2IW8A 3OTVA 1JOWB 3UYTA 1FVTA 4BWKA 1Y8GA 4P2KA 2WAJA 4MBLA 3MVHA 2HW7A 3PG3A 4G16A 4L3PA 4RZVA 2VTIA 5JQ8A 3UIMA 1NXKA 4IJ9A 3DBQA 4FEXA 4TTHB 2IJMA 4QP6A 5ANIA 3QCXA 4NJDA 3R8VA 3UPZA 3FLWA 5T68A 2RFEA 2XMYA 3BYMA 3HVCA 2AC5A 2OG8A 3DLZA 4QYHA 5LCKA 4D4SA 2PZ5A 2WMVA 3QD2B 5AUYA 2FB8A 4MXCA 4XV9A 3TJDA 5GZ8A 2RIOA 3EOCA 3CY2A 4RT7A 4XOZA 5M4CA 3TUCA 3BL9A 5KMNA 4M97A 5FEEA