2R5TA

Crystal structure of inactive serum and glucocorticoid- regulated kinase 1 in complex with amp-pnp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
297
structure length
284
Chain Sequence
QINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Sgk1
publication title Crystal structure of the kinase domain of serum and glucocorticoid-regulated kinase 1 in complex with AMP PNP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 284
sequence length 297
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r5tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r5tA01
2XVDA 4L67A 2GPHA 1YDRE 4RIYA 5EYCA 5JH6A 2X7GA 4EUUA 1L8TA 2WIHA 3EZVA 4YJSA 2PZ5A 5F20A 4G17A 4YNEA 2VO3A 2JBPA 4DGNA 3E62A 4GT3A 3ZUUA 2W7XA 2J50A 2LGCA 4OR5A 4XBRA 2XRWA 3HA8A 2X1NA 4HCVA 3VQUA 3S1HA 4FT9A 4M84A 4TYJA 4U40A 3VRZA 4IAKA 3GEQA 4NWMA 3WF5A 4UBAA 4UEUA 3VUMA 4C3PA 2VTAA 1VEBA 4J71A 5EI8A 5AUVA 4MD8E 5IUIA 2YEXA 3C4WA 1QPDA 2W1IA 4MX9A 5L8KA 4DA5A 1W8CA 2OZOA 3F6XA 4IW0A 3HKOA 4IJPA 4ASZA 1BX6A 3R2YA 4FNYA 1W0XC 3DB6A 3QA8A 4NCTC 5HIBA 3WF7A 2YWPA 3UC4A 5HX6A 3NNWA 2Y4PA 5I9YA 4FTTA 1H1QA 2IPXA 4GRBA 4M3QA 3FY2A 3D5VA 1XBBA 3A7IA 3IOKA 3RWQA 4BY9E 1Q3DA 2BFYA 4ASEA 4C4IA 4TYEA 4D2SA 3UPZA 3P7CA 5BMMA 5BNJA 3R71A 2I0HA 3ITZA 4J95A 2YLEA 3R9OA 4O83A 4D9UA 2PYWA 1O9UA 1H27A 3BZ3A 5JT2A 2PY3A 4KKEA 3WIKA 3ZC6A 3QHRA 3JYAA 2QHNA 3R7VA 4BCNA 4QYGA 3VS2A 4DC2A 3CD3A 3IO7A 5IH5A 5LVMA 4MF1A 3PZHA 2YM7A 3BBTB 2X6EA 3NIZA 3W2OA 3BE2A 3FYJX 3P78A 3R01A 1XBCA 3PRIA 2J5FA 5B2MA 2UZVA 3F88A 3D7ZA 4RVMA 2F7ZE 3W2QA 3ZUVA 4EC8A 1WZYA 3VUDA 3DBQA 2XNOA 3MESA 4EZ7A 1PXOA 2FUMA 3I5NA 4L01A 4QMXA 2OU7A 3VS5A 2JDSA 4PMPA 3MTLA 2V7AA 2QD9A 3OXZA 3U87A 4L8MA 4ITHA 2YN8A 2A2AA 3LJ0A 3LCTA 4RVLA 5BUEA 3I7BA 4O22A 3DAJA 3LKMA 3O71A 3BYSA 4TNDA 1KWPA 3O8UA 1YWNA 3ZH8A 5JN2A 2XUUA 4AOJA 5DFPA 3FL4A 3D5WA 3IQ7A 4GYIA 1F0QA 3EJ1A 3LXPA 5FM3A 2CN8A 3U6IA 3KK9A 2YM8A 4H1JA 1JKKA 4O0TA 3VUIA 1OB3A 4WT6A 1BKXA 3KF4A 1YDSE 3QZGA 5E1EA 1R0EA 4MK0A 5FXQA 2R3QA 5HE2A 3U9CA 3NZ0A 3A61A 2W5AA 5DE2A 3TV4A 3KQ7A 4ORKA 4K6ZA 4YJNA 3NS9A 3G9NA 4ZJIA 4RPVA 3S3IA 1MQBA 5EDRA 3VS6A 4ACDA 4FKUA 2CCIA 5D11A 3MA3A 4BZDA 4F1MA 1OECA 4NM0A 3P08A 2C1AA 3TZ7A 1UNHA 4E26A 2HOGA 4GH2A 3RNIA 4OTDA 1WBSA 3U4WA 1QCFA 3WOWA 3ZLXA 4PDSA 1YXVA 4AW5A 4MYGA 4MBJA 4B6LA 4FV0A 4EEVA 3JS2A 4BIEA 2CLQA 4FSTA 3A7GA 3OOMA 4DEEA 3ZM9A 5HKMA 3M11A 5FQDC 3G6HA 3PP0A 3E63A 4HVIA 1JOWB 4QTDA 2C5OA 4WSYA 4G1WA 2CDZA 4M14A 3RJCA 4GUBA 4X2JA 2XJ1A 4FIEA 4Y8DA 1M17A 3TWJA 4IAFA 2VWBA 4FIFA 4FSRA 2XNGA 5ANDA 3S00A 1U59A 1J1CA 4KB8A 5C8MA 4I94A 4UWCA 2PZYA 2CSNA 4JBQA 4TNBA 5CEIA 3WE8A 2VZ6A 2C3KA 2BMCA 3R8PA 4O7LA 2C3JA 3R9HA 4A9SA 4ZAUA 3EL7A 4MEDA 3F3TA 4XG3A 3R8ZA 1PMEA 4RJ6A 5EW9A 3CTQA 3W1FA 4FKQA 4BGGA 4AA5A 4C8BA 4P90A 5C1QB 3E8CA 4PMTA 2GNLA 4GL9A 4K0YA 3BHYA 5EM7A 4HZSA 1MP8A 4RJ8A 4ERKA 4K1BA 2W1DA 4EK5A 2NNWB 5KMNA 5CT0A 5F1ZA 4DFZE 5A54A 5TR6A 3PUPA 3FSFA 3F61A 3BLQA 4G31A 5HGIA 3NYVA 3OW3A 2EU9A 3FXWA 3AT2A 4GFMA 4QMOA 4BFMA 1PKDA 2H6DA 2EWAA 5KO1A 3E3BX 3Q6WA 4AP7A 5FP6A 3U6HA 1ZOEA 5C8NA 2HZ0A 2EB2A 2B9HA 3KFAA 4IDVA 1YDTE 3BBWA 1PRYA 3COMA 3QUDA 3O2MA 4L6QA 4CFWA 4ARKA 2XBJA 3RWPA 4FIHA 3QTQA 4FOBA 2W99B 4Y72A 4C33A 1JKTA 1QPCA 2WTWA 2J6MA 3BLHA 3LXNA 4DT9A 4ANQA 5DIAA 2I0VA 4IZYA 4PX6A 4YUQA 4C61A 3KRRA 5ANKA 2WTCA 1HOWA 5HG8A 2WAJA 2VTSA 1GJOA 4XG9A 5C26A 2WKMA 4O0UA 5CF4A 2CLXA 2XKCA 2QODA 4I23A 2GNHA 4ANOA 2R3JA 5H8GA 1H0VA 4E5AX 3VW8A 1Q5KA 2XYUA 3GB2A 4O0RA 2V0DA 5K5NA 3UZRA 3IPHA 4NTSA 5E91A 1Z57A 5LXMA 4XS2A 3IK3A 4M69A 3E93A 4CQEA 2BDJA 2F7XE 3MY0A 3OT8A 3RM7A 3Q9YA 3GCPA 5EW3A 5JGDA 2RFEA 3I4BA 5HD4A 4Y85A 1W84A 2PVHA 5AX3A 4DG0E 2QI8A 3UC3A 5JFSA 5G6VA 4DE4A 4X21A 1UVRA 2VNWA 3LLTA 4JDIA 4QTEA 3VUKA 2JITA 2XIYA 3F5GA 1LPUA 5CAQA 3MB6A 3E7OA 4JG6A 4DH8A 3QC9A 4EH6A 5A4QA 3AXWA 4BDGA 1KUTA 3RPSA 3QLGA 2WQMA 4O7NA 4ZJJA 4PTGA 3TDVA 4PMMA 3Q4TA 4HOKA 5AM6A 4Y83A 4OBQA 2BZKB 2BPMA 5DA3A 4BI0A 2RG6A 2XK3A 2KULA 3DQWA 4HYHA 3VBTA 4BI2A 3VBXA 2IZRA 4M13A 4FT3A 4CZYB 2XM9A 3DXQA 2ZYBA 3ZLYA 4GJ2A 4C35A 4GIIA 1G3NA 4AF3A 4AXAA 2RKUA 3BU6A 2FA2A 4PPCA 3HA6A 3R28A 3BHTA 3HDMA 3PSBA 4QQ5A 4X7QA 4PP9A 4KBAA 3A99A 4QMUA 2ITVA 2ZAZA 2W17A 3SGCA 4DBXA 5FEQA 4YTIA 4FTJA 3UO6A 3UP2A 4AFEA 4E73A 2OSCA 4A9TA 4BDDA 1GZ8A 4KBCA 3O50A 4H05A 3FLNC 3R83A 3HMPA 3TIZA 4F7SA 2XYNA 4YLKA 3GT8A 3LW0A 3PLSA 4IZ7A 4U97A 4WSQA 4TL0A 5L6PA 1CKJA 3P9JA 3FYKX 4RJ4A 3RAIA 4X3JA 1MRUA 4EOQA 2X8IA 5IEXA 2EUFB 4IX3A 3QZFA 5BMSA 3G33A 4U9AA 5DT3A 2B55A 1GIHA 3F3UA 3PVGA 5A14A 1SYKA 4FSWA 2OXYA 4J53A 4BZNA 3IGGA 1NW1A 5L2SA 2XKFA 4FZ6A 4LL0A 2J0JA 5ETIA 3CP9A 2R5TA 4LUEA 4GT5A 4ENXA 2A27A 2P4IA 3LJ2A 4IFGA 3PG3A 4YC6A 4AU8A 4K2RA 4O1PA 4D1ZA 4G34A 4YBJA 5CANA 3Q5ZA 4RJ5A 3W2SA 2B54A 4BRXA 4V05A 5HTCA 3C0HA 3R7EA 3EFWA 3PRFA 4E5BA 3DFCB 1I44A 3ZRKA 1QMZA 4NKSA 3VS0A 5M53A 4TKSA 4OTGA 4Q9SA 3GC9A 4JS8A 4AACA 4DN5A 5CU2A 3C9WA 3E8EA 3L8PA 4BCMA 4XG7A 2WMTA 5A6NA 2HWPA 4C57A 2UZBA 5DWRA 5AP4A 2ETRA 4FA2A 3KXZA 1MUOA 4IM3A 4ZY4A 3I5ZA 3O7LB 2VWIA 3PP1A 4IIRA 4D4VA 5AAFA 4E93A 2XJ2A 3UQCA 5IMEA 1GY3A 5BVOA 1YOLA 3BGQA 4FG9A 4FYOA 2VGPA 4B9DA 4EOJA 3FI8A 2WB8A 1JVPP 4NT4A 3GOPA 4OAUC 3EIDA 5JZNA 4I92A 4ZTRA 3A8WA 2Q83A 3S95A 4L46A 5H9BA 3TNWA 5HG7A 4DGOA 2VO7A 4I5CA 2JAMA 4J98A 2UW7A 3OD6X 4FYNA 1JSVA 4XX9A 4DYMA 2Y4IB 2CKOA 2ZM3A 4O81A 4QMPA 2OGVA 3KXXA 3PVBA 4WHZA 4L3LA 4RLLA 2XBAA 2P2HA 3FUPA 5DR9A 3DNEA 5L3AA 3Q6UA 5FTQA 3PIZA 2AUHA 3ODYX 4GS6A 4IWDA 3UIMA 1OBDA 3QTRA 3IG7A 1H07A 3FE3A 3FPMA 5AUTA 3HRCA 4RZVA 4XG6A 5H8EA 2IN6A 4CYJA 4IZ5A 5HLWA 4FUXA 2YDIA 3GFEA 4RX7A 3O8TA 4L53A 5HNGA 2XRUA 4XMOA 4ZLOA 5M08A 3ERKA 2BR1A 1GNGA 4I6FA 3I0QA 5KNJA 4QPMA 3RAHA 5B2KA 4U6RA 4EZ3A 2F2UA 3O8PA 4GG7A 3P86A 2PMIA 3IECA 3II5A 3WZJA 4MD7E 1UU7A 3T9TA 3G2FA 3QWJA 4FX3A 4JG7A 4ZMFA 3L9LA 1KE5A 3EFJA 3A4PA 4R8QA 3P0MA 1WBOA 3WE4A 4HZRA 4EHVA 2PVJA 2X6DA 5DR2A 2CNVA 4FE2A 4NEUA 1WBTA 3ZEPA 4OAVB 5AAEA 3I6WA 5EKNA 4NJ3A 4UY9A 3HUCA 4F6WA 4LOPA 4IC7A 3LQ3A 1YWVA 2IVVA 2XIZA 3AC1A 1TVOA 4BCFA 3HV6A 3ZLWA 5A6OA 4RIWB 2JD5A 2YABA 1YOMA 4CT2A 5CU0A 3EQPA 3VAPA 2P0CA 3O23A 3TG1A 4CZTA 4NZWB 4AGUA 1M7QA 1IASA 5I9ZA 1BI7A 2PUPA 5FUTA 5BUIA 4X3FC 4NKAA 2X2LA 3AC3A 2WMSA 1ZAOA 3PG1A 4C34A 2CJMA 5CZHA 1V0BA 1Y8GA 3MN3A 5LVPA 1G8SA 4IWQA 3QQLA 3D15A 4TYGA 4RIOA 1FMKA 5IF1A 5IZFA 4C58A 1M7NA 4ALWA 3L8VA 3UIBA 4QTCA 4KWPA 4FV2A 1CM8A 2JIUA 4CXAA 2RSVA 4X2GA 2F9GA 4EOPA 4Q5HA 5AP6A 5L6WL 2OICA 3TNIA 4GK4A 2R4BA 4YPDA 3VBYA 4FC0A 4PL5A 3GCQA 2VTIA 5M06A 1OL1A 2O0UA 2JBOA 3ZUTA 3ZSGA 4JAJA 3UOHA 3FDNA 1Q8YA 3QHWA 5EOBA 3NVMB 1I09A 5AR8A 4H3PA 3I1AA 4FSUA 4I0SA 4FIGA 5I4NA 4TXCA 2YAKA 4ZTHA 2X39A 2PZIA 3ROCA 3ZDUA 2ZB0A 4DFYA 3G6GA 4BL1A 4R1YA 4F1TA 2AC5A 2DYLA 2J0LA 3FQEA 2JDRA 2EXEA 4F9BA 5M55A 3SDJA 5JMSA 4I22A 2VTRA 4XOZA 4ACHA 3EOCA 2VX0A 3H0ZA 4G3CA 4JBPA 3ZMMA 3RBWA 4FG7A 4CRLA 2B52A 2CGVA 2O2UA 3PWDA 4HYSA 4O6LA 5AV3A 3ZFMA 4FBXA 4EH8A 2I0EA 4FV1A 3D5UA 5GIOE 5HCYA 1JKSA 4AFJA 1SNUA 5CNOA 5TKDA 2ZMDA 4D28A 2GHMA 2VNYA 2WQOA 2R3FA 3TL8A 2OO8X 4MQ2A 2ERKA 4QNYA 4RFZA 4XLIA 4YLJA 1KE7A 2B0QA 4CSVA 3OROA 3R1YA 4MCVA 2BTSA 4LI5A 2UZDA 4CFVA 4ANMA 2VWXA 4X6QC 3P7BA 1SMHA 2DQ7X 2BIKB 2OIDA 5EM8A 4BBEA 3MVMA 3KY2A 3LHJA 4C37A 4AE6A 4RIWA 2FVDA 2ZDUA 4FTOA 2FB8A 3FMHA 2YJSA 4B99A 3BE9A 3BGPA 4TWCA 4YPSA 2PVKA 4TWNA 5FTGA 5DN3A 4XRJA 3MWUA 2QG5A 2QG7A 1L3RE 3LPBA 3CJGA 4H1MA 1FVVA 4HGSA 2FSLX 2P55A 5AA8A 5FBOA 3IDCA 4QMZA 1PMUA 3C13A 4UZHA 3KXNA 5CI7A 4NUSA 3DAEA 4HVGA 2VN9A 5AV0A 3L8SA 3PE1A 4C7TA 4FI1A 3AD4A 1OI9A 3P7AA 4O6EA 3NRMA 1SM2A 3LCSA 4I3ZA 3EN5A 3R02A 5J8IA 3Q4CA 1XH7A 3KCKA 2UZNA 3R63A 5L6OA 5BYYA 2HAKA 2C0OA 2VTJA 4C3FA 3FMDA 4DH7A 3RPVA 3TKUA 4BDAA 1YW2A 2C6KA 2ITQA 5FP5A 3SOCA 2H34A 5IEYA 4PDOA 4QP4A 3N4VA 3DJ5A 4HVHA 3JY0A 4DTKA 3HRFA 1LEWA 3CE3A 4KAOA 5AJQA 3ZLSA 4ZK5A 5D9HA 2ONLC 4L9IA 1PJKA 3K3JA 4RWLA 3UODA 2YITA 3R8VA 3ZO2A 1MQ4A 4O0YA 4KRDA 2IW8A 2UVYA 4L44A 3VJOA 3VS4A 3QX2A 3PVUA 3R04A 2I7QA 4FEQA 3B8RA 4F0FA 4HNFA 4CKIA 5KX8A 5CQUA 3FLWA 4CLIA 5CLPA 5KE0A 3L1SA 5IPJA 2F4JA 1XR1A 3HAMA 4L42A 4OBPA 5IA1A 5ACBC 3A7HA 3FZ1A 3G0EA 4B8LA 2QOIA 1PXKA 4FV9A 4JR7A 4HVDA 3R22A 3ZXTA 5J7HA 4XG8A 2IJMA 2OLCA 4LOQA 3JY9A 4CYIA 2XNBA 1H1SA 2YCRA 5AP1A 2NO3A 1H01A 2WXVA 1BUHA 2UW6A 3I60A 3D83A 2YAAA 3QWKA 4F0IA 2V22A 3SOAA 3HV4A 3BQCA 5I5ZA 3CEKA 4IAAA 1E1XA 3AD6A 4O7RA 4JT3A 1YKRA 2VWUA 2WELA 3MFRA 5CVGA 2XZSA 4CNHA 1J7LA 3D0EA 4DEDA 1YHVA 4DTAA 3NWWA 3MH1A 1EH4A 2WOUA 3AGMA 3PJCA 4JX7A 3MY5A 4NIFB 3SW7A 5HTBA 4KINA 2OFUA 3SXRA 1O6KA 5KHXA 4IX4A 3BCEA 5HVJA 4E3CA 5J9ZA 4BGHA 5C01A 3DPKA 4BDKA 4L43A 4CMOA 4G5PA 2REIA 3EQIA 4G3EA 2Y0AA 3HP2A 3REPA 5LJJA 1H4LA 4GUEA 2R7BA 3WZKA 3EQCA 1OVEA 3QLFA 5ETAA 2BAJA 1XH9A 1A48A 4PL3A 2YDKA 4ASXA 5KMIA 2YWVA 3OCTA 2JKMA 3F3WA 4U80A 5L2QA 3I6UA 4BCHA 5CXZA 2YZLA 3JXWA 5L2WA 4DGGA 3OXIA 3H0YA 3AC5A 4UXQA 2NRUA 5KMJA 2VRXA 3GGFA 5C27A 2UZTA 4C2VA 4C4JA 3DBCA 3TKIA 5LOHA 5HOAA 3KCFA 5DG5A 3GFWA 4UMUA 4A9UA 5LMKC 4O7VA 5TO8A 4ALVA 4YO4A 5BPYA 4CMUA 3LXLA 3GU6A 3PA5A 3V04A 3OP5A 4BKZA 2X7FA 5CYIA 4FKRA 3TI1A 5IA2A 4JBOA 4RFYA 2J51A 3FMEA 4MNFA 3KMUA 4NCTA 2Z7SA 4S32A 4YJTA 3COHA 4ZZNA 5CI6A 4RVTA 4XP3A 4FKJA 4BCKA 5FLFA 3EN4A 2OJFE 3QQGA 1UWHA 2JAVA 4ACGA 4I21A 4D1XA 3IW6A 3RM6A 4BKYA 4S34A 2ZJWA 4IXPA 4K77A 5J5TA 4R7HA 2C6TA 2QVSE 4H36A 4NW6A 2C6OA 4RG0A 3SHEA 3W2RA 4QD6A 3RCJA 1IAJA 1YXXA 4S33A 3MPTA 5K9IA 3VUTA 1OIUA 4LRKA 3GUBA 3QTSA 2B53A 3KC3A 4JI9A 4AW1A 1YHSA 3UE4A 2B1PA 1PXJA 2G1TA 2XJ0A 1CKPA 4O2PA 2X81A 4NM5A 4EK3A 3DS6A 4LG4A 3RK9A 4CRSA 3KRXA 4FZ7A 4NIFA 4EKLA 3VRYA 2ZV9A 2W9ZB 3K2LA 4IX5A 2WMRA 4FV5A 4J8NA 5EI2A 3VBWA 5HICA 3UMXA 4EK4A 4KUJA 3KVXA 4RIXB 4PNKA 5L2TA 2VTHA 3CQEA 3FEGA 2J90A 1ZYCA 3AC2A 3BQRA 1M2RA 5IU2A 4FTMA 4EQMA 4ANSA 5M4CA 4BF2A 3KVWA 4J8MA 2AYPA 1P5EA 3DOGA 3UGCA 4DFLA 1HCLA 3OBJA 5JRSA 2F7EE 4UX9A 2PVMA 3RP9A 5EM5A 1UNLA 4PL4A 2ZMCA 5BUJA 4RLKA 3SX9A 4KIOA 4LQMA 1SNXA 4GU9A 4WIHA 1OL2A 5HO7A 5KMLA 1G8AA 2R3RA 4DEGA 3ZONA 3IS5A 4FSYA 5GZAA 5JRQA 5EHYA 1H8FA 4FZAB 5AR7A 4WA9A 2HW7A 5JFVA 2QKRA 2W0JA 2ITZA 4ACCA 3SXFA 5FDPA 3HV5A 4CD0A 4IJ9A 3PIYA 5HNIX 4ZS0A 1WVWA 4WG3A 2DUVA 4F08A 3E3PA 1H1PA 5HNBA 4BICA 3KK8A 1WBNA 5AEPA 2YIWA 3RGFA 4TT7A 3FMMA 1YI4A 5TT7A 3FQHA 4M7IA 4QPSA 4O27B 4WO5A 2J9MA 2OIBA 4HPUE 2QLUA 3GC7A 3UJGA 3MH2A 2ITTA 1REJA 4FL1A 4H39A 2WOTA 3MY1A 2OJIA 4UMTA 1GZNA 4AN2A 2H96A 4FV3A 2V5QA 4FNXA 1IRKA 5EQYA 4I6QA 4X2NA 1A9UA 3FMKA 3TKHA 3E8NA 4CZUA 4AA4A 4KRCA 5ETCA 4AZTA 1STCE 4F65A 1FVRA 1OBGA 2ETKA 3SV0A 5H8BA 3N4UA 5DYJA 4DFBA 5EQPA 3VJNA 4BDEA 4FKOA 3GVUA 2UW8A 3BI6A 2OIQA 4IFCA 3CTHA 3B8QA 3D94A 3GCSA 4NFNA 4V0GB 3VF9A 4BTMA 4ZTNA 4BTFA 4F9CA 5AA9A 4OTHA 4XEYA 4R3RA 3RZBA 3BYVA 1WMKA 3F9NA 4FZDB 4XP2A 5ANEA 5HBEA 1J7IA 3DU8A 3BU3A 3DBEA 1OKVA 4OT5A 1FINA 4RIXA 3NUYA 2X8DA 2Z60A 3FI4A 4I4EA 4ZS4A 1PMNA 4QMLA 4IAYA 1GIJA 3PJ2A 3HLLA 4FTQA 3PTGA 4E4MA 2WIPA 1DAYA 1Q8UA 4Q5EA 3O17A 3QRJA 3RK5A 3ZU7A 3BHVA 2C5VA 4BIBA 2X8EA 4M69B 3IW5A 4AZVA 5HQ0A 3NUAA 3GXLA 2YIQA 4PTEA 4OGRA 4RSSA 3TJCA 3GQIA 5CF8A 2PUIA 4QMNA 5AUUA 4F9YA 4X6RA 4EH4A 3WI6A 3UO4A 3A7JA 3QQHA 2P33A 3R21A 4J1RA 5BYZA 3V01A 3ZCLA 3ZO3A 3P1AA 3VN9A 2R3PA 2WQBA 5AUYA 4Y73A 3GOKA 4KS8A 2O8YA 5DBXA 3AT3A 3DLZA 3T3VA 4CG9A 1UKHA 2B4SB 2E9NA 1OIRA 2JFMA 1QPJA 2BKKA 1YXTA 3IDPA 4FKGA 3ORZA 3Q9XA 5HIDA 4AT3A 4PP7A 3FKLA 4XUFA 2WMBA 1KE8A 5ETFA 5EHOA 1TQIA 1GOLA 1G5SA 5DHJA 4EOIA 3FZRA 1OL5A 5AP5A 4IHPA 1OL6A 1LP4A 4WNKA 3DFAA 3Q3BA 4J7BA 4WG4A 4PDPA 3FC2A 3EL8A 3KRJA 2Z7QA 4GMYA 2WNTA 4OLIA 4WKQA 5HESA 2WMAA 2VWWA 3C50A 2O64A 3EWHA 2WMXA 5L8JA 4CTBA 2HCKA 4BTJA 2GTMA 3UQFA 3FKNA 3W8QA 2WQEA 2XK8A 3LM0A 4A4OA 3V5JA 3LLAA 1A06A 4G6LA 3ANQA 3KU2A 2PVNA 4I20A 3Q2MA 5CEOA 1WFCA 3TTJA 1BL6A 4DFUA 4MAOA 1BI8A 2YCQA 3MS9A 4M68A 3R9DA 5CEKA 5KUPA 4O2ZA 2R3MA 2V7OA 5K0KA 3O51A 4BCOA 1IG1A 3OVVA 3VIDA 5CU6A 3IOPA 4LRMA 4ERWA 4V0GA 2GU8A 4F7NA 4TW9A 3V8WA 3UIXA 5JKGA 2Y6MA 5E1SA 1U54B 3HUBA 5LWNA 3LFDA 2WTJA 3FWQA 2F57A 3R8MA 1ZMUA 1E1VA 3D2KA 3MDYA 3QRKA 3R00A 4CKJA 5I9WA 2VTTA 3DB8A 2WTIA 5DMZA 2BHEA 4W8DA 4YTCA 5JSMA 1YXSA 1KE6A 4ANNA 2E9PA 4S31A 4C4GA 1XBAA 5CEMA 4USFA 4D2VA 5C4LA 5AM7A 5KKRC 2C6EA 3G5DA 4W8EA 5HBHA 3SAYA 2Y8OA 3LE6A 4USDA 4YJOA 4I24A 1WBPA 2X9EA 3OY1A 4IBMA 2CGXA 3HDNA 3VUHA 4YZBA 3UDBA 4G3DA 4D2RA 2BUJA 4DLIA 3QD2B 4R7IA 3QRIA 3TJDA 5CF5A 3RCDA 5CVFA 2IWIA 4OT6A 3NAXA 4KBKA 3ORKA 1NY3A 4J52A 3FLQA 5H3QA 5HX8A 5EH0A 1AD5A 3A60A 1PF8A 1Q24A 3KA0A 4MXYA 5J95A 4W4XA 4WBBB 4OTWA 3V5WA 2J0MB 4WRSA 5IUGA 4LGHA 2UUEA 2VTMA 2C1BA 3D9VA 3JVSA 3WF6A 4EYJA 4S2ZA 4MWIA 2HYYA 4PPBA 4UB7A 4W4YA 5AUWA 3KGAA 4DH1A 3HEGA 4O7SA 1KOAA 2CHLA 3UO5A 4L45A 4XV3A 2FH9A 5M07A 5GINE 4ENYA 2QO9A 5AV1A 3RNYA 4QP9A 5CU3A 4I41A 4I4FA 3LOKA 4TYHB 3W33A 3FMLA 1MRVA 5CNNA 5IQCA 3FZSA 5KMKA 3OFMA 4R5YA 4W4VA 1RJBA 4FZFB 4IB0A 1NT2A 2VX3A 5FM2A 2BRMA 4WNOA 3SA0A 3WARA 1JNKA 3UIUA 2YIRA 1DI8A 4PMSA 4FTNA 4XV2A 4ZIMA 1ZOHA 5G1XA 3SG8A 3R1NA 2FSOX 2X9FA 2QNJA 3CBLA 4PQNA 3CSVA 1BL7A 3WBLA 4XG4A 3AC8A 2C3IB 3JVRA 4FVPA 5EOLA 5ACKA 3WIGA 3GC0A 4F1OA 4D2PA 1M52A 5CU4A 1Q62A 1U54A 4MXAA 3H3CA 5E8VA 4X3FB 1OMWA 3R8LA 3P4KA 5DPVA 3ORLA 1FGKA 3LFEA 3C4CA 3M42A 2YJRA 2OJJA 3TNPC 4P5ZA 4MVFA 4NM7A 5D7AA 2WMQA 2BZIB 2J5EA 2WTKC 3SQQA 4CGAA 4XG2A 4CFXA 3QQJA 2OF4A 3DT1A 3QTUA 1Q8ZA 4AUAA 1T46A 2VGOA 1P2AA 4D9TA 4G9RA 4EBVA 3NYXA 1REKA 1X8BA 3D7TB 3DQXA 4MQ1A 3V51A 3ZBXA 5HVYA 3LFCA 3V6RA 4N57A 4KKGA 3RZFA 5IDNA 1ERKA 1ZYSA 3AG9A 3DDPA 4LFIA 3Q9ZA 1VJYA 2OF2A 3PIXA 3DBDA 4KD1A 4WNMA 3NNUA 4BDJA 2G2IA 3AMYA 4QP7A 2NP8A 4BN1A 4M0ZA 1E9HA 3R7OA 3LFNA 1NVQA 2HWOA 3TACA 1OM1A 3TEIA 5CSHA 4DTBA 3BPRA 4RQKA 2XIXA 3ACKA 3QTZA 3PY1A 2OJ9A 4I0TA 4TYHA 1R39A 3BHUA 1OGUA 4JIAA 5CTPA 3DBFA 4IAIA 2WFYA 4JQEA 4X2FA 4AT4A 2W1ZA 4YZMA 4EKKA 4JDKA 3WZEA 3QAME 4YSJA 5LVNA 1AGWA 4QO9A 3NGAA 1R1WA 3R1QA 5EYMA 2C68A 1VZOA 3NNXA 1P4FA 4OTQA 3HMMA 4WNPA 3CQWA 3PXQA 1PXLA 2C0IA 4JJRA 2WGJA 4EBWA 3CQUA 3B2TA 3EYHA 4L7FA 5ANJA 1ZYLA 3OBGA 2XK7A 2XS0A 3VS3A 5IA4A 4A7CA 4EH2A 4UWYA 1XQZA 4FSNA 3PXKA 1UU9A 1F3MC 1UV5A 2JFLA 3FAAA 3KXHA 5M4FA 4DINA 4AGWA 3CKWA 4A4XA 4A9YA 4C36A 2F2CB 1R3CA 3DZQA 1W98A 4E8AA 1OPLA 2VX1A 2WO6A 5FEDA 3LAUA 3KKVA 3CJFA 3U9NA 2C5NA 2PMLX 4BIDA 3L9PA 4X3FA 4CCUA 2R3GA 2J0KA 3KMMA 5F95A 3WZUA 1J7UA 4O82A 3HRBA 2GFSA 3MFUA 3POZA 4IANA 5J87A 2XP2A 3UP7A 3ATTA 4GKIA 3VULA 1Q41A 1ZARA 4HJOA 4USEA 4FT5A 4O0SA 4KIKB 2FYSA 5EHLA 5JZJA 4AZWA 4Z16A 1XO2B 3OWKA 2BDFA 3FZTA 4TN6A 4JBVA 3PXFA 4ALUA 1IEPA 4CFUA 1J91A 3OXTA 4OBOA 4V01A 3KEXA 5C8KA 1NVSA 4RBLA 3MA6A 1K9AA 3ZTXA 5CXHA 3VBVA 4UXLA 1GZOA 2RFNA 4YZ9A 2UW9A 4D0WA 3D7TA 4AGDA 4YJPA 5IQBA 2DWBA 5AWMA 5HG5A 4KNBA 5HU3A 3OEZA 2HY0A 4BHNA 3ZZWA 2R3LA 4GT4A 5CAVA 4XJ0A 2PVYA 2PL0A 3V6SA 4PV0A 1UU3A 1ZZLA 3M2WA 3R2BA 3TIYA 2ITWA 1DAWA 1Y6BA 3LCDA 4YJRA 4R1VA 4UMRA 2PZRA 5E9EA 3SW4A 5CY3A 5ANIA 4RT7A 2G01A 2ZB1A 3Q60A 3CGFA 1B38A 3GBZA 2GDOA 2XNEA 3MH3A 2YM3A 3TUBA 2IVTA 3DK3A 4ZTLA 5I3RA 4S30A 5EG3A 3CPBA 4ZP5A 4C0TA 2UZWE 3DKCA 3ORMA 5DRDA 3HNGA 3FZOA 4ZOGA 3R30A 3QQUA 1CTPE 3Q9WA 4RWIA 2XIRA 3AT4A 4XCUA 3TCPA 4CLJA 4XOYA 3BWJA 4YJQA 1TKIA 5KZ0A 2C5XA 1FPUA 3DJ7A 3PPJA 4DH5A 3F82A 3NSZA 5IEVA 3Q4UA 4LYNA 2Z2WA 2UZEA 1PYEA 3U4UA 1H08A 3R73A 4D5HA 2WTVA 3EMGA 1O6LA 2H9VA 4KSPA 4U0IA 5EDPA 4N0SA 4CFFA 1MRYA 4QMWA 2UZLA 4RC3A 3THBA 2P2IA 5J7BA 4OTPA 5F94A 3HAVA 5IQGA 3R1SA 3NUPA 5DGZA 1ZMWA 1SZMA 5DT4A 3VNTA 5ITAA 1WAKA 4QYHA 4O91A 1PHKA 2JIIA 4C4FA 4NH1A 2QR7A 2P3GX 4FIJA 1ZYJA 5D10A 5EQEA 2Z7RA 3QCXA 3EH9A 4AZFA 4EYMA 2RF9A 3NNVA 4EHGA 3MFSA 3OCGA 4KIKA 3QGYA 5JGAA 5K4IA 2OI4X 4U43A 4TY1A 2I0YA 2PE0A 4ZXTA 3ENHA 4D58A 3ZYAA 5CSPA 4G2FA 5T6KA 4YTHA 3QXOA 4Z3VA 5E4HA 3DK7A 3L9MA 3NAYA 4RGJA 2BAQA 2PMNX 3EN7A 3FMNA 3ZFYA 4AAAA 4AOIA 5HD7A 1LR4A 4KABA 4M0YA 3MV5A 5IA3A 4R77A 4GK3A 3CGOA 5K3YA 4D55A 1T45A 4E4LA 1JWHA 1GAGA 5IQIA 2Y7JA 3UNZA 3EQGA 4RWKA 4GIHA 4HNIA 4LGDA 2O3PA 5E8WA 2FO0A 2XK4A 4K11A 2GFCA 4FIIA 5CEQA 4BDCA 3EQRA 2R3IA 2VAGA 2ONLA 3EQDA 4DEIA 2VTNA 3DAKA 3W2PA 1TQPA 2Z7LA 3F5PA 4QQTA 5AIKA 4EQCA 4GJ3A 1XHAA 3HV3A 4W4WA 4BHZA 1RW8A 1ZY5A 3T8OA 1FMOE 3QD3A 3UNJA 3HGKA 3TZ9A 4D4YA 3H10A 2IZTA 3C0GA 5LCJA 2YCFA 1H25A 2JKQA 2PE1A 3GCVA 3N9XA 1K3AA 2G2FA 2ITOA 3CD8A 5KZIA 1DM2A 5E90A 4I93A 1Q3WA 5EYDA 1H28A 2BIYA 1YOJA 5E8YA 3UYSA 1F5QA 5LQFA 5CSWA 2GHGA 3Q5IA 2C5YA 4EH9A 2YM4A 4JLCA 3DK6A 4O84A 5FTOA 5L8LA 3W10A 1M2PA 3FC1X 5E92A 4A4LA 5EKOA 4MXZA 3PVWA 5F4NA 4UV0A 2B7AA 4M67A 3MI9A 2Q0NA 3AC4A 2HZNA 3LQ5A 5CEPA 3CS9A 4GU6A 5CSVA 4XP0A 2PK9A 5DNRA 4AT5A 1OL7A 3E8DA 4CFNA 4FKIA 3CTJA 5CENA 3RK7A 4RZWA 4Z7HA 2W1HA 4EL9A 4QP1A 4ZLZA 4N4SA 2GNFA 3QKMA 2JIVA 4YR8A 2WEVA 5E7RA 3QQFA 3T9IA 3NIEA 1XJDA 5DI1A 5I0BA 4DGLC 4ONAA 3MW1A 2UV2A 4AW2A 1KSWA 5J1WA 4QTAA 1ZWSA 3MFTA 5LVLA 5F9EA 4Z9LA 5E8ZA 3IDBA 3EHAA 4RA4A 4CTCA 3FJQE 4P2KA 4E7WA 3ULZA 3FSKA 5AAGA 4C38A 3K3IA 3NMUF 2ZV2A 3PXZA 5LWMA 3SKCA 4YMJA 2QOKA 2C30A 1XH6A 4MBIA 4IADA 3M1SA 4O96A 2OK1A 3V8TA 3GU5A 5E8XA 4R3CA 4F99A 4U45A 4PF4A 3F7ZA 3LQ8A 2SRCA 3E87A 4KKHA 5HU9A 2BRHA 2ZM1A 3CIKA 3NX8A 1V0PA 4DFXE 4HYUA 3UG2A 4F63A 4QPAA 1YVJA 3ROYA 1HCKA 3WYYA 4O1OA 5LMKA 4DF3A 3BLRA 4FVQA 2EXCX 2BTRA 2C6IA 3B2WA 4U81A 5A4TA 4LMNA 4MXOA 2W1FA 5AMNA 5BVKA 3DJ6A 4RFMA 3HVCA 5E8UA 3PPKA 4FV6A 3RAWA 5A46A 4I5PA 2B9FA 1ZOGA 2BROA 3FHIA 2PWLA 2QQ7A 4CKRA 4B4LA 2YIXA 5DR6A 4NFMA 4N6YA 1RE8A 4V04A 1YXUA 5AUZA 2PVRA 4F6UA 4IC8A 2HIWA 4KA3A 4YHTA 3T3UA 3PY3A 4QNAA 1JPAA 2CMWA 3MYGA 4O0WA 3TTIA 5IG1A 2IW9A 4UYNA 4I0RA 4IEBA 3CCNA 2R9SA 4L7SA 4AOTA 3NDMA 4D4RA 2X2MA 3L8XA 2ZV8A 4YHFA 1U46A 4Y5QA 3H9FA 5HLNA 4FEVA 4DBNA 5AFVA 3MPMA 1OPJA 2A0CX 2F49A 3UZPA 2BHHA 4F6SA 5HVKA 2VTLA 4IWOA 1CKIA 4NL0A 1ZY4A 3FKOA 1U4DA 3ZBFA 3TNHA 3PYYA 5EK7A 4PRJA 4XHKB 4R3PA 4H58A 1VR2A 3EKKA 3F3ZA 1PXIA 4BYJA 3MH0A 3TV6A 4BDIA 5J1VA 3COIA 4JG8A 1Q61A 4K18A 1H26A 2O65A 3OOGA 3PXYA 5FD2A 4IQ6A 4ZSLA 3RINA 5IKWA 3KULB 4BDHA 4QMTA 4EH3A 5JQ5A 4IM2A 2Y9QA 4CCBA 1QPEA 3V5TA 2QOFA 4P5QA 4ZTSA 5AADA 4NYEA 2QOCA 4CG8A 4AX8A 2XCKA 5A4CA 4AW0A 5HEZA 4FV8A 4YHJA 3W18A 4E6QA 3OCBA 3JUHA 1JBPE 3KF7A 3D2IA 3PJ8A 4OW8A 5D7VA 2OBJA 2RL5A 4ANLA 4G9CA 1M2QA 5HZNA 3MVJA 4EOOA 1URWA 3NEWA 3QRTA 1Y6AA 2QU6A 5IUHA 4DT8A 5EFQA 1BMKA 1UNGA 3OS3A 3TDWA 2ZOQA 4JAIA 3NPCA 4R5SA 3C4FA 2BKZA 4M97A 2W96B 3QZIA 5KBRA 2XMYA 2OH4A 5E8TA 3P79A 3NYNA 3LIJA 4E4NA 5GIPE 5FBNC 4EJ7A 4YJVA 4YZNA 5L2IA 3VHKA 3FLZA 3QFVA 3UG1A 4NW5A 3OT3A 3KL8A 4XRLA 3SVVA 2YCSA 2WQNA 4GW8A 1RQQA 2ESMA 2JC6A 3KXGA 4I6HA 4QQJA 3LCOA 4GK2A 2DS1A 3NCGA 1OZ1A 4ZZMA 3I7CA 2XM8A 4YJUA 2B9IA 3QCQA 3F5UA 1WVXA 4KIPA 2CCHA 1Y91A 3FHRA 2R3HA 5EYKA 5TOZA 2C69A 3AMAA 3V3VA 4E4XA 2PZPA 4B0GA 1PXMA 3OWPA 1UA2A 3ALNA 4FKPA 4IVAA 2W06A 4WBOA 4HW7A 3QGWA 4ZSEA 5HCZA 1O6YA 4GFGA 1PKGA 3OG7A 4AA0A 3ET7A 3GENA 3DY7A 3HMOA 5IQAA 3GU7A 3VWAA 1IR3A 4JNWA 4O7TA 4G16A 2AC3A 2R2PA 4IVBA 4XLVA 4AZEA 2A4LA 5J5SA 1KV2A 1XWSA 4DEHA 3NCZA 4F7LA 4U8ZA 4L3JA 4P7EA 5DT0A 4M66A 2X0GA 3UBDA 5IH6A 2EB3A 4EQUA 4IB1A 4QMSA 3KULA 1JQHA 2R3NA 1KE9A 1R78A 3KN6A 3NUNA 1Q8WA 3O96A 4IZAA 4IVCA 1BYGA 2W1GA 3OW4A 4FSZA 3UTOA 4UMPA 5KKRB 2W1CA 4AG8A 4ZSGA 2EXMA 5K5XA 3ID6C 3C4EA 2C6DA 3PFQA 2XK6A 4WRGA 5IISA 3BV2A 3E92A 5CQWA 5DEYA 2VTQA 4XYFA 4I1ZA 4DH3A 5HO6A 4ITIA 4JXFA 3QCYA 4Y95A 4M15A 4X0MA 2J7TA 2JGZA 4RX9A 2I1MA 2Z8CA 5AR3A 4QTBA 4BZOA 2VV9A 4D2TA 4DG3E 4AN3A 4MNEB 1JLUE 2OW3A 4WUNA 3F7WA 3KRWA 5HLPA 2ZVAA 4GVAA 5H2UA 4B7TA 5IQDA 4CV9A 5M57A 3QRUA 3DKOA 2BCJA 4CFMA 4CMTA 2IZSA 3RPRA 3BYMA 1VYZA 1Y8YA 2WMUA 3BEAA 1J1BA 2X7OA 2RIOA 3UVRA 3CY2A 3C5IA 4YLLA 1R0PA 2KTYA 3DDQA 3HX4A 2YHVA 3U55A 4FT7A 3VBQA 2W1EA 1U5QA 5HG9A 1FVTA 1H1RA 4KIQA 2JDOA 5IQHA 3R7UA 4BCPA 3LVPA 3QTWA 4MXCA 3MIAA 3RVGA 4K9YA 1SVHA 3MJ1A 5IDPA 2NRYA 2BVAA 3Q04A 4AZSA 1B39A 3I81A 4MH7A 4F7JA 3KN5A 4JQ7A 4GVJA 2BILB 4GYGA 2XKEA 3PPZA 5M09A 4N70A 3VF8A 1S9JA 5IA0A 4FTKA 4IB3A 3MB7A 3EKNA 2YACA 3Q32A 3BU5A 5D1JA 3TM0A 3U8WA 3JR1A 2IVSA 5GJDA 3PXRA 2GNJA 2XB7A 5I3OA 4ACMA 4U41A 4TWOA 2IG7A 3AMBA 4GEOA 5TE0A 3BRBA 5CAOA 4TWPA 4Y5HA 2W05A 3UMWA 2QURA 5JGBA 5M51A 3F69A 3HECA 4U3ZA 4QQCA 3F5XA 4L3PA 4N6ZA 3F2RA 4UALA 2C6LA 4CQGA 3DV3A 3W55A 2IVUA 3CY3A 4L52A 1XH8A 5BVWA 1M14A 2G2HA 3O7LD 2UVZA 4EHZA 5B0XA 2WTKB 3KRLA 5FXSA 2X2KA 3COKA 3TNQB 4BWPA 2OFVA 4BDBA 2R7IA 4LGGA 4BC6A 4BCGA 5M44A 4HGEA 3MVHA 4PY1A 5K4JA 3HL7A 3RALA 5HBJA 5FG8A 2QO7A 4OTIA 3PJ3A 4YO6A 3BKBA 3WILA 5JK3A 4YNOA 2CGUA 5ANOA 2JEDA 2BALA 4DCAA 1TQMA 1Q8TA 1B6CB 5FWKK 3QALE 5GHVA 4D4SA 1W82A 3FI3A 2CN5A 3W8LA 5C03A 3E7VA 2WHBA 4MNEA 4YZDA 2OH0E 2E2BA 2Q0BA 3G51A 3A7FA 2QO2A 4F0GA 5JQ8A 2PE2A 5GJFA 4I6BA 3BELA 3KB7A 5EM6A 4RJ3A 5JFWA 5AX9A 3MSSA 4U79A 3SRVB 1OUYA 4G3FA 2G15A 5HORA 3FI2A 3DZOA 3P5KA 1UWJA 2A1AB 2VO6A 3DCVA 2E9UA 4FV4A 4ITJA 4O0VA 4IE9A 2WD1A 5HI2A 5HE3A 4FL3A 3KXMA 1Y57A 3QYZA 3EB0A 3VO3A 2PULA 4QP8A 2UVXA 3PLAE 3F2NA 4EWHA 3Q52A 2YM6A 2VWZA 4KSQA 2VO0A 5DH3A 1JAMA 4EC9A 5CALA 5GZ8A 4IX6A 4Y46A 3PE2A 1PXPA 3PA3A 4PDYA 5I9VA 2R64A 1DS5A 2PVLA 4Z55A 2I6LA 2UZUE 5LCKA 4FNZA 2JLDA 2QOHA 1OKWA 3F66A 3LZBA 4RQVA 3AQVA 4QOXA 3QXPA 3FL5A 5AIRA 1UKIA 2QR8A 1ATPE 2C3LA 5K0XA 2E9VA 3AOXA 3TXOA 2XF0A 2QONA 5CVHA 5FEEA 3QU0A 2R0IA 4UZDA 4MHAA 4DEBA 3QA0A 2O5KA 4RC2A 4EK6A 3FY0A 4FOCA 5IA5A 3UOLA 4F09A 4ZZOA 3D5XA 4ASDA 2V62A 3V8SA 3KMWA 4F9AA 3DLSA 4GFOA 4L68A 4LV8A 2ERZE 3G15A 3CXWA 5KMMA 2ZV7A 1OPKA 2RG5A 2HZIA 5LMBA 2WTDA 4JIKA 4BB4A 3OZ6A 3LFQA 2I40A 4G6OA 4YC3A 4D5KA 3DA6A 4FKVA 4O7WA 3UQGA 3BX5A 2CNQA 3A2CA 3AGLA 4MF0A 3VW6A 1YI3A 4GCJA 3D14A 4HVSA 3N51A 3NR9A 4NSTA 3BV3A 4DG2E 1Z5MA 3EN6A 4BYIA 3LMGA 3SD0A 2OZAB 3NW5A 4G3GA 2GQSA 3C1XA 2UW3A 3GC8A 4FKSA 1V0OA 5EDQA 4C62A 3EFKA 4ZEGA 4DEAA 3VC4A 4YU2A 1P14A 3ZO4A 2W4OA 2HXQA 4RA5A 1SVGA 2CGWA 3O0GA 4JRVA 4XV1A 5EI6A 3E64A 4F70A 5M4IA 3MVLA 3OF0A 4LOOA 2BRNA 3ODZX 3I0OA 1PXNA 2PHKA 4II5A 4D1SA 3ORNA 2CKQA 3IKAA 3SRVA 2HENA 3ATSA 3PY0A 4FKLA 4U5JA 5J79A 1OIQA 3RAKA 4BWXA 1P4OA 3TV7A 1CMKE 2HY81 4FTLA 3QKKA 2PU8A 4ID7A 5CZIA 3TUDA 4U44A 2FSMX 4CEGA 5IMXA 4BWKA 4QP2A 4C3RA 3ULIA 4BCQA 3OTVA 3QUEA 2BDWA 2ITXA 3PSCA 2GHLA 4RC4A 4RJ7A 2X4ZA 4UYAA 3FZPA 2OXXA 2YERA 4WG5A 3QTIA 4EUTA 4FTRA 4NK9A 3TZMA 3RMFA 4FTAA 3OC1A 4Q9ZA 2XIKA 4LM5A 4XH6A 3ZZEA 4E5WA 2JKOA 4CT1A 3ZOSA 3LFFA 4APPA 1UU8A 4EORA 2H8HA 2Y6OA 2FGIA 3NUUA 4TRLA 4UMQA 4C2WA 3EFLA 4D0XA 5GNKA 3RPOA 5AUXA 5BVFA 2YM5A 4RVKA 3R9NA 5I9XA 2E9OA 3HMIA 4L00A 2UZOA 3PA4A 3VHEA 4TYIA 2GS6A 3ZSIA 3WF9A 2HK5A 3QYWA 4FTCA 3A8XA 1PMVA 1QL6A 5AP2A 4IVDA 1KV1A 3NYOA 2QOOA 5GJGA 2W9FB 3C5UA 3QUPA 3ACJA 3FXXA 5BVDA 5BVEA 4ZY5A 3DTCA 4O38A 5ICPA 3OCSA 2X4FA 4HYIA 4YP8A 4E20A 4EOMA 3IW7A 4JQ8A 4APCA 4EH5A 3DTWA 4FODA 4C4EA 3OY3A 5HO8A 2YIYA 3BYOA 2QOLA 3QQKA 2OZAA 2GNIA 4QYYA 1XH4A 2PVFA 1LEZA 3DKFA 3SLSA 3S4QA 4RX8A 3ZRMA 3EQFA 3JPVA 1IAHA 4YC8A 1FGIA 4DITA 4BGQA 3SG9A 5IQFA 3ORXA 4YBKA 2R0UA 4FICA 4GV1A 5DEWA 3LMIA 2CKEA 4H3QA 3GU8A 4K8AA 3HP5A 3TT0A 4R6VA 2NPQA 3ZC5A 4QMQA 3LXKA 3Q2JA 1ZLTA 1BLXA 1GIIA 2B9JA 3DKGA 4WD5A 3C51A 3OWLA 3RPYA 1Q99A 2HXLA 4WUAA 5CASA 3S0OA 2RGPA 3CR0A 1WBVA 4PNIA 3DNDA 3FXZA 3MGYA 4J96A 3Q4ZA 3QBNA 3ZHPC 2W5BA 4LRJA 5AP3A 4BBMA 2XNNA 5B7VA 2YLFA 4FMQA 3ZXZA 4AQCA 1PY5A 4HCTA 2JDTA 4HGLA 4E6CA 4GG5A 1FBNA 4ZLYA 3V5LA 2VU3A 5E8SA 4EOKA 2HZ4A 1OKYA 2YDJA 5AP7A 3A62A 2R3KA 3OEFX 2XEZA 5KMOA 3PDTA 4G6NA 1PW2A 4PTCA 2QOBA 3ENMA 4BCJA 1Z9XA 4RMZA 4BR3A 3IGOA 2GCDA 5LARA 3U51A 4EONA 4QRCA 5ANGA 3EQHA 3I79A 3P23A 5AV4A 3OTUA 2ITYA 1YQJA 2OKRA 2RFDA 2GNGA 2PMOX 3AD5A 3QX4A 2XCHA 4YSMA 3GCUA 4IMYA 3TZ8A 1KOBA 3QD4A 4Q2AA 2R3OA 4TPTA 4EK8A 2Z02A 3ETAA 4ZTQA 2BAKA 4FSMA 4RRVA 4AWIA 4RX5A 3IW4A 5B2LA 2C4GA 2IZUA 1W7HA 3QC4A 4BVUA 2UW4A 3CLYA 4FGBA 4J99A 3EQBA 3EYGA 3POOA 3E5AA 4Z7GA 4PPAA 3HYHA 5M56A 1RDQE 2PTKA 3UOKA 2V55A 3WYXA 4FGRA 5C9CA 4FEXA 4O0XA 2ZM4A 5KHWA 5AR4A 2QLQA 5LVOA 4FTIA 5EW8A 5KCVA 2PUNA 1ZRZA 2JDVA 2XKDA 3QKLA 4JL9A 4MBLA 4W9WA 3SC1A 4EJNA 4YZCA 1H1WA 1Q4LA 3VUGA 4JVGA 4U42A 2XNMA 4HPTE 4LL5A 1S9IA 3MBLA 5FXRA 4ZMEA 4O7YA 5AP0A 2VUWA 4QMMA 4R78A 4O21A 4FKWA 3BGZA 1CDKA 5CS6A 5CSXA 3R7YA 4E1ZA 2WPAA 3ZM4A 1VYWA 3MJ2A 4BDFA 3DXNA 2J2IB 4ZSJA 2GQGA 2QCSA 4IH8A 3WF8A 5HHWA 1NVRA 3GP0A 5LMAA 1Q97A 4QP3A 2VWVA 5FGKA 2XK9A 2YZAA 5DLSA 3V5PA 4AN9A 3OUNB 2ITUA 2BFXA 3ORIA 3VS7A 4FT0A 1APME 1YRPA 2HELA 3UOJA 3VS1A 1JSTA 4DCEA 3RHXA 4B8MA 3RHKA 3LMHA 1H00A 3IW8A 2YFXA 1NA7A 4W9XA 2A19B 2IW6A 5A9UA 3GU4A 2OG8A 3ZRLA 3G9LX 5D41A 3TN8A 2ITNA 4FKTA 3UPXA 3LFAA 2Y4IC 3ANRA 4FR4A 5BX0A 4F64A 1WBWA 5CAPA 1CSNA 4PUZA 4YURA 4C02A 4ZSAA 3QL8A 4BBFA 4FSQA 3TUCA 4FV7A 5AR5A 3UYTA 5A4EA 3S2PA 4CV8A 2OWBA 3KREA 4OTFA 1OITA 3K54A 1SVEA 3Q96A 1FOTA 3H9OA 4FL2A 4IDTA 4XV9A 3FLYA 4YTFA 5J9LA 2W4KA 5CAUA 3LJ1A 3CPCA 2C0TA 4K33A 2UW5A 4JRNA 4LMUA 5DVRA 4TZRA 2WMWA 2QKWB 2CNUA 1ZZ2A 2OXDA 4FNWA 3C4XA 4JX3A 4OTRA 4OUCA 3ZEWA 4BCIA 4F4PA 5AV2A 4X2KA 3QD0A 3R9RA 5CX9A 4MXXA 3ZFXA 5T3QA 4O7ZA 5JFXA 4ZY6A 3MTFA 2VTOA 1YWRA 2W5HA 4HCUA 4QYFA 2BZHB 3HZTA 5L4QA 2BZJA 1NXKA 1W83A 4PWNA 3W2CA 3NLBA 3NUSA 4C59A 4ZTMA 4FEUA 3R8UA 4G5JA 3R7IA 3RI1A 2WEIA 2XA4A 3FQSA 4FF8A 3VVHA 3NW6A 3A4OX 3V5QA 5AR2A 4AS0A 4U3YA 1AQ1A 3NVKI 1ZXEA 3WZDA 3R6XA 1LUFA 5TF9A 2OJGA 1J3HA 3BIZA 3PJ1A 2PSQA 2UW0A 3OWJA 3GNIB 4IB5A 2QOQA 2WMVA 3MPAA 1ZMVA 5HIEA 3K5UA 2EVAA 4IM0A 4FTUA 2CKPA 2C47A 3FBVA 4BTKA 2PPQA 3ZS5A 3BYUA 3UZTA 4I5MA 3C0IA 4P4CA 3E88A 3EN9A 4A9RA 4FK6A 4DAWA 4EOSA 1YI6A 4M8TA 4JOAA 1OIYA 3FV8A 3IONA 4KS7A 1URCA 2LAVA 2J4ZA 1GZKA 4QP6A 5BVNA 2J0IA 3Q53A 3BWFA 4U7ZA 5A3XA 2XEYA 4LV5A 1XKKA 1YHWA 3R7GA 2O63A 4QMYA 2QU5A 4IWPA 1JKLA 3VQHA 4DHFA 4F9WA 5C4KA 1DI9A 3BHHA 3G90X 4EOLA 4XNEA 4MKCA 2C6MA 5FDXA 4EHEA 3H9RA 3QCSA 3ORTA 2WU7A 4XBUA 3UVPA 4DFNA 1PYXA 4DLJA 3ZO1A 3LCKA 1JSUA 2HW6A 4NTTA 5IH4A 2GMXA 3LM5A 1U5RA 4UWBA 5BQ0A 4RIYB 2PUUA 4M12A 1ND4A 4FG8A 3FLSA 4BI1A 4AGCA 2BRBA 4NM3A 4A06A 2BRGA 4LUDA 5HE0A 3W32A 4GSBA 5J9YA 1FQ1B 4JDJA 1XH5A 2W4JA 2GSFA 4BKJA 4FVRA 4MD9E 4GKHA 5KBQA 5FRIA 2ACXA 2XH5A 2RFSA 3NW7A 3QZHA 1K2PA 3PWYA 4I5HA 2JKKA 4IACA 4TTHB 5BYLA 2ETMA 2ZDTA 3K5VA 4ANBA 3SXSA 5DOSA 3ORPA 4YGAA 4QYEA 1IA9A 5CT7A 4JR3A 2VTPA 4WOVA 2WU6A 5T68A 4AE9A 2G9XA 3ALOA 4IAZA 4HGTA 4ZJVA 4O86A 1V1KA 4QT1A 3H4JA 1H24A 3CC6A 2YA9A 5HCXA 3W16A 4EZ5A 4UN0C 4EI4A 5HE1A 1WVYA 2VD5A 2XNPA 2VWYA 3ZDIA 4A07A 2QC6A 3OMVA 3QF9A 2YISA 3FMJA 3DGKA 3H30A 3L9NA 4MTAA 4NJDA 3F3VA 3U6JA 3UNKA 4FEWA 5DRBA 2GQRA 3C7QA 3LFSA 4NU1A 3QTXA 4JDHA 4RWJA 4MWHA 2QHMA 3C4ZA 5GZ9A 5CF6A 3OHTA 2GS7A 3MIYA 3PSDA 1IA8A 4E6AA 3CKXA 4C4HA 4DGMA 3RKBA 4J97A 3ZSHA 4EH7A 4CVAA 5HTIA 3HMNA 4H3BA 2WZJA 3UVQA 2IO6A 2ITPA 4FK3A 2GS2A 3GQLA 3HV7A 2GTNA 3GI3A 4EWQA 5M4UA 1OKZA 4QMVA 4FUYA 5D12A 3LFBA 2CPKE 5A4LA 3G0FA 1H0WA 3R0TA 4R7BA 3U54A 4D2WA 3DXPA 3BEGA 2FSTX 3RTPA 3FPQA 3EZRA 5IQEA 3OUKA 5I9UA 1ZYDA 3PZEA 5JEBA 3D4QA 3F2AA 4E6DA 3ELJA 3NUXA 5CWZA 1OUKA 3N4TA 1WCCA
chains in the Genus database with same CATH superfamily
2XVDA 4L67A 2GPHA 1YDRE 4RIYA 5EYCA 5JH6A 2X7GA 4EUUA 1L8TA 2WIHA 2AEGA 3EZVA 4YJSA 2PZ5A 5F20A 4G17A 4YNEA 2VO3A 2JBPA 4DGNA 3E62A 4GT3A 3ZUUA 2W7XA 4BJJB 2J50A 2LGCA 4OR5A 4XBRA 2XRWA 3HA8A 2X1NA 4HCVA 3VQUA 3S1HA 4FT9A 4M84A 1TZDA 4TYJA 4U40A 3VRZA 4IAKA 3GEQA 4NWMA 3WF5A 4UBAA 4UEUA 3VUMA 4C3PA 2VTAA 1VEBA 4J71A 5EI8A 5AUVA 4MD8E 5IUIA 2YEXA 3C4WA 1QPDA 2W1IA 4MX9A 5L8KA 4DA5A 1W8CA 2OZOA 3F6XA 4IW0A 3HKOA 4IJPA 4ASZA 1BX6A 3R2YA 4FNYA 1W0XC 3DB6A 3QA8A 4NCTC 5HIBA 3WF7A 2YWPA 3UC4A 5HX6A 3NNWA 2Y4PA 5I9YA 4FTTA 1H1QA 2IPXA 4GRBA 4M3QA 3FY2A 3D5VA 1XBBA 3A7IA 3IOKA 3RWQA 4BY9E 1Q3DA 2BFYA 4ASEA 4C4IA 4TYEA 4D2SA 3UPZA 3BL9A 3P7CA 5BMMA 5BNJA 3R71A 2I0HA 3ITZA 4J95A 2YLEA 3R9OA 4O83A 4D9UA 2PYWA 1O9UA 1H27A 3BZ3A 5JT2A 2PY3A 4KKEA 3WIKA 3ZC6A 3QHRA 3JYAA 2QHNA 3R7VA 4BCNA 4QYGA 3VS2A 4DC2A 3CD3A 3IO7A 5IH5A 5LVMA 4MF1A 3PZHA 2YM7A 3BBTB 2X6EA 3NIZA 3W2OA 3BE2A 3FYJX 3P78A 3R01A 1XBCA 3PRIA 2J5FA 5B2MA 2UZVA 3F88A 3D7ZA 4FRFA 2F7ZE 4RVMA 3W2QA 3ZUVA 1WZYA 3VUDA 4EC8A 3DBQA 2XNOA 3MESA 4EZ7A 1PXOA 2FUMA 3I5NA 4L01A 4QMXA 2OU7A 3VS5A 2JDSA 4PMPA 3MTLA 2V7AA 2QD9A 3OXZA 3U87A 4L8MA 4ITHA 2YN8A 2A2AA 3LJ0A 3LCTA 4RVLA 5BUEA 3I7BA 4O22A 3DAJA 3LKMA 3O71A 3BYSA 4TNDA 1KWPA 3O8UA 1YWNA 3ZH8A 5JN2A 2XUUA 4AOJA 5DFPA 3FL4A 4BJJA 3D5WA 3IQ7A 4GYIA 1F0QA 3EJ1A 3LXPA 5FM3A 2CN8A 3U6IA 3KK9A 2YM8A 4H1JA 1JKKA 4O0TA 3VUIA 4AXFA 1OB3A 4WT6A 3W0OA 1BKXA 3KF4A 1YDSE 3QZGA 5E1EA 1R0EA 4MK0A 5FXQA 2R3QA 5HE2A 3U9CA 3NZ0A 3A61A 2W5AA 5DE2A 3TV4A 3KQ7A 4ORKA 4K6ZA 4YJNA 3NS9A 3G9NA 4ZJIA 4RPVA 3S3IA 1MQBA 5EDRA 3VS6A 4ACDA 4FKUA 2CCIA 5D11A 3MA3A 4BZDA 4F1MA 1OECA 4NM0A 3P08A 2C1AA 3TZ7A 1UNHA 4E26A 2HOGA 4GH2A 3RNIA 4OTDA 3UDZA 1WBSA 4AXEA 3UDTA 3U4WA 1QCFA 3WOWA 3ZLXA 4PDSA 1YXVA 4AW5A 4MYGA 4MBJA 4B6LA 4FV0A 4EEVA 3JS2A 4BIEA 2CLQA 4FSTA 3A7GA 3OOMA 4DEEA 3ZM9A 5HKMA 3M11A 5FQDC 3G6HA 3PP0A 3E63A 4HVIA 1JOWB 4QTDA 2C5OA 4WSYA 4G1WA 2CDZA 4M14A 3RJCA 4GUBA 4X2JA 2XJ1A 4FIEA 4Y8DA 1M17A 3TWJA 4IAFA 2VWBA 4FIFA 4FSRA 2XNGA 5ANDA 3S00A 1U59A 1J1CA 4KB8A 5C8MA 4I94A 4UWCA 2PZYA 2CSNA 4JBQA 4TNBA 5CEIA 3WE8A 2VZ6A 2C3KA 2BMCA 3R8PA 3TYKA 4O7LA 2C3JA 3R9HA 4A9SA 4ZAUA 3EL7A 4MEDA 3F3TA 4XG3A 3R8ZA 3VONA 1PMEA 4RJ6A 5EW9A 3CTQA 3W1FA 4FKQA 4BGGA 4AA5A 4C8BA 4P90A 5C1QB 3E8CA 4PMTA 2GNLA 4GL9A 4K0YA 3BHYA 5EM7A 4HZSA 1MP8A 4RJ8A 4ERKA 4DHJA 4K1BA 2W1DA 4EK5A 2NNWB 5KMNA 5CT0A 5F1ZA 4DFZE 5A54A 5TR6A 3PUPA 3FSFA 3F61A 3BLQA 4G31A 5HGIA 3NYVA 3OW3A 2EU9A 3FXWA 3AT2A 4GFMA 4QMOA 4BFMA 1PKDA 2H6DA 2EWAA 5KO1A 3E3BX 3Q6WA 4AP7A 5FP6A 3U6HA 1ZOEA 5C8NA 2HZ0A 2EB2A 2B9HA 3KFAA 4IDVA 1YDTE 3BBWA 1PRYA 3COMA 3QUDA 3O2MA 4L6QA 4CFWA 4ARKA 2XBJA 3RWPA 4FIHA 3QTQA 4FOBA 2W99B 4Y72A 4C33A 1JKTA 1QPCA 2WTWA 2J6MA 3BLHA 3LXNA 4DT9A 4ANQA 5DIAA 2I0VA 4IZYA 4PX6A 4YUQA 4C61A 3KRRA 5ANKA 2WTCA 1HOWA 5HG8A 2WAJA 2VTSA 1GJOA 4XG9A 5C26A 2WKMA 4O0UA 5CF4A 2CLXA 2XKCA 2QODA 4I23A 2GNHA 4ANOA 2R3JA 5H8GA 1H0VA 4E5AX 3VW8A 3PFYA 1Q5KA 2XYUA 3GB2A 4O0RA 2V0DA 5K5NA 3UZRA 3IPHA 4NTSA 5E91A 1Z57A 5LXMA 4XS2A 3IK3A 4M69A 3E93A 4CQEA 2BDJA 2F7XE 3MY0A 3OT8A 3RM7A 3Q9YA 2X0QA 3GCPA 5EW3A 5JGDA 2RFEA 3I4BA 5HD4A 4Y85A 1W84A 2PVHA 5AX3A 4DG0E 2QI8A 3UC3A 5JFSA 5G6VA 4DE4A 4X21A 1UVRA 2VNWA 3LLTA 4JDIA 4QTEA 3VUKA 2JITA 2XIYA 3F5GA 1LPUA 5CAQA 3MB6A 3E7OA 4JG6A 4DH8A 3QC9A 4EH6A 5A4QA 3TMOA 3AXWA 4QDEA 4BDGA 1KUTA 3RPSA 3QLGA 2WQMA 4O7NA 4ZJJA 4PTGA 3TDVA 4PMMA 3Q4TA 4HOKA 5AM6A 4Y83A 4OBQA 2BZKB 2BPMA 5DA3A 4BI0A 2RG6A 2XK3A 2KULA 3DQWA 4HYHA 3VBTA 4BI2A 3VBXA 2IZRA 4M13A 4FT3A 4CZYB 2XM9A 3DXQA 2ZYBA 3ZLYA 4GJ2A 4C35A 4GIIA 1G3NA 3W0MA 4AF3A 4AXAA 2X0OA 2RKUA 3BU6A 2FA2A 4PPCA 3HA6A 3R28A 3BHTA 3HDMA 3PSBA 4QQ5A 4X7QA 4PP9A 4KBAA 3A99A 4QMUA 2ITVA 2ZAZA 2W17A 3SGCA 4DBXA 5FEQA 4YTIA 4FTJA 3UO6A 3UP2A 4AFEA 4E73A 2OSCA 4A9TA 4BDDA 1GZ8A 4KBCA 3O50A 4H05A 3FLNC 3R83A 3HMPA 3TIZA 4F7SA 2XYNA 4YLKA 3GT8A 3LW0A 3PLSA 4IZ7A 4U97A 4WSQA 4TL0A 5L6PA 1CKJA 3P9JA 3FYKX 4RJ4A 3RAIA 4X3JA 1MRUA 4EOQA 2X8IA 5IEXA 2EUFB 4O4FA 4IX3A 3QZFA 5BMSA 3G33A 4U9AA 5DT3A 3NFFB 2B55A 1GIHA 3F3UA 3PVGA 5A14A 1SYKA 4FSWA 2OXYA 4J53A 4BZNA 3IGGA 1NW1A 5L2SA 2XKFA 4FZ6A 4LL0A 2J0JA 5ETIA 3CP9A 2R5TA 4LUEA 4GT5A 4ENXA 2A27A 2P4IA 3LJ2A 4IFGA 3PG3A 4YC6A 4AU8A 4K2RA 4O1PA 4D1ZA 4G34A 4YBJA 5CANA 3Q5ZA 4RJ5A 3W2SA 2B54A 4BRXA 4V05A 5HTCA 3C0HA 3R7EA 3EFWA 3PRFA 4E5BA 3DFCB 1I44A 3ZRKA 1QMZA 4NKSA 3VS0A 5M53A 4TKSA 4OTGA 4Q9SA 3GC9A 4JS8A 4AACA 4DN5A 5CU2A 3C9WA 3E8EA 3L8PA 4BCMA 4XG7A 2WMTA 5A6NA 2HWPA 4C57A 2UZBA 1TFFA 4QEBA 5DWRA 5AP4A 2ETRA 4FA2A 3KXZA 1MUOA 4IM3A 4ZY4A 3I5ZA 3O7LB 2VWIA 3PP1A 4IIRA 4D4VA 5AAFA 4E93A 2XJ2A 3UQCA 5IMEA 1GY3A 5BVOA 1YOLA 3BGQA 4FG9A 4FYOA 2VGPA 4B9DA 4EOJA 3FI8A 2WB8A 1JVPP 4NT4A 3GOPA 4OAUC 3EIDA 5JZNA 4I92A 4ZTRA 3A8WA 2Q83A 3S95A 4L46A 5H9BA 3TNWA 5HG7A 4DGOA 2VO7A 4I5CA 2JAMA 4J98A 2AQXA 2UW7A 3OD6X 1JSVA 4FYNA 4XX9A 4DYMA 2Y4IB 2CKOA 2ZM3A 4O81A 4QMPA 2OGVA 3KXXA 3PVBA 4WHZA 4L3LA 4RLLA 2XBAA 2P2HA 3FUPA 5DR9A 3DNEA 5L3AA 3Q6UA 5FTQA 3PIZA 2AUHA 3ODYX 4GS6A 4IWDA 3UIMA 1OBDA 3QTRA 3IG7A 1H07A 3FE3A 3FPMA 5AUTA 3HRCA 4RZVA 4XG6A 5H8EA 2IN6A 4CYJA 4IZ5A 5HLWA 4FUXA 2YDIA 3GFEA 4RX7A 3O8TA 4L53A 5HNGA 2XRUA 4XMOA 4ZLOA 5M08A 3ERKA 2BR1A 1GNGA 4I6FA 3I0QA 5KNJA 4QPMA 3RAHA 5B2KA 4U6RA 4EZ3A 2F2UA 3O8PA 4GG7A 3P86A 2PMIA 3IECA 3II5A 3WZJA 4MD7E 1UU7A 3T9TA 3G2FA 3QWJA 4FX3A 4JG7A 4ZMFA 3L9LA 1KE5A 3EFJA 3A4PA 4R8QA 3P0MA 1WBOA 3WE4A 4HZRA 4EHVA 2PVJA 2X6DA 5DR2A 2CNVA 4FE2A 4NEUA 1WBTA 3ZEPA 4OAVB 5AAEA 3I6WA 5EKNA 4NJ3A 4UY9A 3HUCA 4F6WA 4LOPA 4IC7A 3LQ3A 1YWVA 2IVVA 2XIZA 3AC1A 1TVOA 4BCFA 3HV6A 3ZLWA 5A6OA 4RIWB 2JD5A 2YABA 1YOMA 4CT2A 5CU0A 3EQPA 3VAPA 2P0CA 3O23A 3TG1A 4CZTA 4NZWB 4AGUA 1M7QA 1IASA 5I9ZA 1BI7A 2PUPA 5FUTA 5BUIA 4X3FC 4NKAA 2X2LA 3AC3A 2WMSA 1ZAOA 3PG1A 4C34A 2CJMA 5CZHA 1V0BA 1Y8GA 3MN3A 5LVPA 1G8SA 4IWQA 3QQLA 3D15A 4TYGA 4RIOA 1FMKA 5IF1A 5IZFA 4C58A 1M7NA 4ALWA 3L8VA 3UIBA 4QTCA 4KWPA 4FV2A 1CM8A 2JIUA 4CXAA 2RSVA 4X2GA 2F9GA 4EOPA 4Q5HA 5AP6A 5L6WL 2OICA 3TNIA 4AQKA 4GK4A 2R4BA 4YPDA 3VBYA 4FC0A 4PL5A 3GCQA 2VTIA 5M06A 1OL1A 2O0UA 2JBOA 3ZUTA 3ZSGA 4JAJA 3UOHA 3FDNA 1Q8YA 3QHWA 5EOBA 3NVMB 1I09A 5AR8A 4H3PA 3I1AA 4FSUA 4I0SA 4FIGA 5I4NA 4TXCA 2YAKA 4ZTHA 2X39A 2PZIA 3ROCA 3ZDUA 2ZB0A 4DFYA 3G6GA 4BL1A 4R1YA 4F1TA 2AC5A 2DYLA 2J0LA 3FQEA 2JDRA 4DDIA 2EXEA 4F9BA 5M55A 3SDJA 5JMSA 4I22A 2VTRA 4XOZA 4ACHA 3EOCA 2VX0A 3H0ZA 4G3CA 4JBPA 3ZMMA 3RBWA 4FG7A 4CRLA 2B52A 2CGVA 2O2UA 3PWDA 4HYSA 4O6LA 5AV3A 3ZFMA 4FBXA 4EH8A 2I0EA 4FV1A 3D5UA 4AAYA 5GIOE 5HCYA 1JKSA 4AFJA 1SNUA 5CNOA 5TKDA 2ZMDA 4D28A 2GHMA 2VNYA 2WQOA 2R3FA 3TL8A 2OO8X 4MQ2A 2ERKA 4QNYA 4RFZA 4XLIA 4YLJA 1KE7A 2B0QA 4CSVA 3OROA 3R1YA 4MCVA 2BTSA 4LI5A 2UZDA 4CFVA 4ANMA 2VWXA 4X6QC 3P7BA 1SMHA 2DQ7X 2BIKB 2OIDA 5EM8A 4BBEA 3MVMA 3KY2A 3LHJA 4C37A 4AE6A 4RIWA 2FVDA 2ZDUA 4FTOA 2FB8A 3FMHA 2YJSA 4B99A 3BE9A 3BGPA 4TWCA 4YPSA 2PVKA 4TWNA 5FTGA 5DN3A 4XRJA 3MWUA 2QG5A 2QG7A 1L3RE 3LPBA 3CJGA 4H1MA 1FVVA 4HGSA 2FSLX 2P55A 5AA8A 5FBOA 3IDCA 4QMZA 1PMUA 3C13A 4UZHA 3KXNA 5CI7A 4NUSA 3DAEA 4HVGA 2VN9A 5AV0A 3L8SA 3PE1A 4C7TA 4FI1A 3AD4A 1OI9A 3P7AA 4O6EA 3NRMA 1SM2A 3LCSA 4I3ZA 3EN5A 3R02A 5J8IA 3Q4CA 1XH7A 3KCKA 2UZNA 3R63A 5L6OA 5BYYA 2HAKA 2C0OA 2VTJA 4C3FA 3FMDA 4DH7A 3RPVA 3TKUA 4BDAA 1YW2A 2C6KA 2ITQA 5FP5A 3SOCA 2H34A 5IEYA 4PDOA 4QP4A 3N4VA 3DJ5A 4HVHA 3JY0A 4DTKA 3HRFA 1LEWA 3CE3A 4KAOA 5AJQA 3ZLSA 4ZK5A 5D9HA 2ONLC 4L9IA 1PJKA 3K3JA 4RWLA 3UODA 2YITA 3R8VA 3ZO2A 1MQ4A 4O0YA 4KRDA 2IW8A 2UVYA 4L44A 3VJOA 3VS4A 3QX2A 3PVUA 3R04A 2I7QA 4FEQA 3B8RA 4F0FA 4HNFA 4CKIA 5KX8A 4AXDA 5CQUA 3FLWA 3ML1A 4CLIA 5CLPA 5KE0A 3L1SA 5IPJA 2F4JA 1XR1A 3HAMA 4L42A 4OBPA 5IA1A 5ACBC 3A7HA 3FZ1A 3G0EA 4B8LA 2QOIA 1PXKA 4FV9A 4JR7A 4HVDA 3R22A 3ZXTA 5J7HA 4XG8A 2IJMA 2OLCA 4LOQA 3JY9A 4CYIA 2XNBA 1H1SA 2YCRA 5AP1A 2NO3A 1H01A 2WXVA 1BUHA 2UW6A 3I60A 3D83A 2YAAA 3QWKA 4F0IA 2V22A 3SOAA 3HV4A 3BQCA 5I5ZA 3CEKA 4IAAA 1E1XA 3AD6A 1G8KA 4O7RA 4JT3A 1YKRA 2VWUA 2WELA 3MFRA 5CVGA 2XZSA 4CNHA 1J7LA 3D0EA 4DEDA 1YHVA 4DTAA 3NWWA 3MH1A 1EH4A 2WOUA 3AGMA 3PJCA 4JX7A 3MY5A 4NIFB 3SW7A 5HTBA 4KINA 2OFUA 3SXRA 1O6KA 5KHXA 4IX4A 3BLAA 3BCEA 5HVJA 4E3CA 5J9ZA 4BGHA 5C01A 3DPKA 4BDKA 4L43A 4CMOA 4G5PA 2REIA 3EQIA 4G3EA 2Y0AA 3HP2A 3REPA 5LJJA 1H4LA 4GUEA 2R7BA 3WZKA 3EQCA 1OVEA 3QLFA 5ETAA 2BAJA 1XH9A 1A48A 4PL3A 2YDKA 4ASXA 5KMIA 2YWVA 3OCTA 2JKMA 3F3WA 4U80A 5L2QA 3I6UA 4BCHA 5CXZA 2YZLA 3JXWA 5L2WA 4DGGA 3OXIA 3H0YA 3AC5A 4UXQA 2NRUA 5KMJA 2VRXA 3GGFA 5C27A 2UZTA 4C2VA 4C4JA 3DBCA 3TKIA 5LOHA 5HOAA 3KCFA 5DG5A 3GFWA 4UMUA 4A9UA 5LMKC 4O7VA 5TO8A 4ALVA 4YO4A 5BPYA 4CMUA 3LXLA 3GU6A 3PA5A 3V04A 3OP5A 4BKZA 2X7FA 5CYIA 4FKRA 3TI1A 5IA2A 4JBOA 4RFYA 2J51A 3FMEA 4MNFA 3KMUA 4NCTA 2Z7SA 4S32A 4YJTA 3COHA 4ZZNA 5CI6A 4RVTA 4XP3A 4FKJA 4BCKA 5FLFA 3EN4A 2OJFE 3QQGA 1UWHA 2JAVA 4ACGA 4I21A 4D1XA 3IW6A 3RM6A 4BKYA 4S34A 2ZJWA 4IXPA 4K77A 5J5TA 4R7HA 2C6TA 2QVSE 4H36A 4NW6A 2C6OA 4RG0A 3SHEA 3W2RA 4QD6A 3RCJA 1IAJA 1YXXA 4S33A 3MPTA 5K9IA 3VUTA 1OIUA 4LRKA 3GUBA 3QTSA 2B53A 3KC3A 4JI9A 4AW1A 1YHSA 3UE4A 2B1PA 1PXJA 2G1TA 2XJ0A 1CKPA 4O2PA 2X81A 4NM5A 4EK3A 3DS6A 4LG4A 3RK9A 4CRSA 3KRXA 4FZ7A 4NIFA 4EKLA 3VRYA 2ZV9A 2W9ZB 3K2LA 4IX5A 2WMRA 4FV5A 4J8NA 5EI2A 3VBWA 5HICA 3UMXA 4EK4A 4KUJA 3KVXA 4RIXB 4PNKA 5L2TA 2VTHA 3CQEA 3FEGA 2J90A 1ZYCA 3AC2A 3BQRA 1M2RA 5IU2A 4FTMA 4EQMA 4ANSA 5M4CA 4BF2A 3KVWA 4J8MA 2AYPA 1P5EA 3DOGA 3UGCA 4DFLA 1HCLA 3OBJA 5JRSA 2F7EE 4UX9A 2PVMA 3RP9A 5EM5A 1UNLA 4PL4A 2ZMCA 5BUJA 4RLKA 3SX9A 4KIOA 4LQMA 1SNXA 4GU9A 4WIHA 1OL2A 5HO7A 5KMLA 1G8AA 2R3RA 4DEGA 3ZONA 3IS5A 4FSYA 5GZAA 5JRQA 5EHYA 1H8FA 4FZAB 5AR7A 4WA9A 2HW7A 5JFVA 2QKRA 2W0JA 2ITZA 4ACCA 3SXFA 5FDPA 3HV5A 4CD0A 4IJ9A 3PIYA 5HNIX 4ZS0A 1WVWA 4WG3A 2DUVA 4F08A 3E3PA 1H1PA 5HNBA 4BICA 3KK8A 1WBNA 5AEPA 2YIWA 3RGFA 4TT7A 3FMMA 1YI4A 5TT7A 3FQHA 4M7IA 4QPSA 4O27B 4WO5A 2J9MA 2OIBA 4HPUE 2QLUA 3GC7A 3UJGA 3MH2A 2ITTA 1REJA 4FL1A 4H39A 2WOTA 3MY1A 2OJIA 4UMTA 1GZNA 4AN2A 2H96A 4FV3A 2V5QA 4FNXA 1IRKA 5EQYA 1G8JA 4I6QA 4X2NA 1A9UA 3FMKA 3TKHA 3E8NA 4CZUA 4AA4A 4KRCA 5ETCA 4AZTA 1STCE 4F65A 1FVRA 1OBGA 2ETKA 3SV0A 5H8BA 3N4UA 5DYJA 4DFBA 5EQPA 3W0NA 3VJNA 4BDEA 4FKOA 3GVUA 2UW8A 3BI6A 2OIQA 4IFCA 3CTHA 3B8QA 3D94A 1W2DA 3GCSA 4NFNA 4V0GB 3VF9A 4ZTNA 4BTMA 4BTFA 4F9CA 4OTHA 5AA9A 4XEYA 4R3RA 3RZBA 3BYVA 1WMKA 3F9NA 4FZDB 4XP2A 5ANEA 5HBEA 1J7IA 3DU8A 3BU3A 3DBEA 1OKVA 4OT5A 1FINA 4RIXA 3NUYA 2X8DA 2Z60A 3FI4A 4I4EA 4ZS4A 1PMNA 4QMLA 4IAYA 1GIJA 3PJ2A 3HLLA 4FTQA 3PTGA 4E4MA 2WIPA 1DAYA 1Q8UA 4Q5EA 3O17A 3QRJA 3RK5A 3ZU7A 3BHVA 2C5VA 4BIBA 2X8EA 4M69B 3IW5A 4AZVA 5HQ0A 3NUAA 3GXLA 2YIQA 4PTEA 4OGRA 4RSSA 3TJCA 3GQIA 5CF8A 2PUIA 4QMNA 5AUUA 4F9YA 4X6RA 4EH4A 3WI6A 3UO4A 3A7JA 3QQHA 2P33A 3R21A 4J1RA 5BYZA 3V01A 3ZCLA 3ZO3A 4O4CA 3P1AA 3VN9A 2R3PA 2WQBA 5AUYA 4Y73A 3GOKA 4KS8A 2O8YA 5DBXA 3AT3A 3DLZA 3T3VA 4CG9A 1UKHA 2B4SB 2E9NA 1OIRA 2JFMA 1QPJA 2BKKA 1YXTA 3IDPA 4FKGA 3ORZA 3Q9XA 5HIDA 4AT3A 4PP7A 3FKLA 4XUFA 2WMBA 1KE8A 5ETFA 5EHOA 1TQIA 1GOLA 1G5SA 5DHJA 4EOIA 3FZRA 1OL5A 5AP5A 4IHPA 1OL6A 1LP4A 4WNKA 3DFAA 3Q3BA 4J7BA 4WG4A 4PDPA 3FC2A 1ST4A 3EL8A 3KRJA 2Z7QA 4GMYA 2WNTA 4OLIA 4WKQA 5HESA 2WMAA 2VWWA 3C50A 2O64A 3EWHA 2WMXA 5L8JA 4CTBA 2HCKA 4BTJA 2GTMA 3UQFA 2ZFYA 3FKNA 3W8QA 2WQEA 2XK8A 3LM0A 4A4OA 3V5JA 3LLAA 1A06A 4G6LA 3ANQA 3KU2A 2PVNA 4I20A 3Q2MA 5CEOA 1WFCA 3TTJA 1BL6A 4DFUA 4MAOA 1BI8A 2YCQA 3MS9A 4M68A 3R9DA 5CEKA 5KUPA 4O2ZA 2R3MA 2V7OA 5K0KA 3O51A 4BCOA 1IG1A 3OVVA 3VIDA 5CU6A 3IOPA 4MUQA 4LRMA 4ERWA 4V0GA 2GU8A 4F7NA 4TW9A 3V8WA 3UIXA 5JKGA 3AKLA 2Y6MA 5E1SA 1U54B 3HUBA 5LWNA 3LFDA 2WTJA 3FWQA 2F57A 3R8MA 1ZMUA 1E1VA 3D2KA 3MDYA 3QRKA 3R00A 4CKJA 5I9WA 2VTTA 3DB8A 2WTIA 5DMZA 2BHEA 4W8DA 4YTCA 5JSMA 1YXSA 1KE6A 4ANNA 2E9PA 4S31A 4C4GA 2XALA 1XBAA 5CEMA 4USFA 4D2VA 5C4LA 5AM7A 5KKRC 2C6EA 3G5DA 4W8EA 5HBHA 3SAYA 2Y8OA 3LE6A 4USDA 4YJOA 4I24A 1WBPA 2X9EA 3OY1A 4IBMA 2CGXA 3HDNA 3VUHA 4YZBA 3UDBA 4G3DA 4D2RA 2BUJA 4DLIA 3QD2B 4R7IA 3QRIA 3TJDA 5CF5A 3RCDA 5CVFA 2IWIA 4OT6A 3NAXA 4KBKA 3ORKA 1NY3A 4J52A 3FLQA 5H3QA 5HX8A 5EH0A 1AD5A 3A60A 1PF8A 1Q24A 3KA0A 4MXYA 5J95A 4W4XA 4WBBB 4OTWA 3V5WA 2J0MB 4WRSA 5IUGA 4LGHA 2UUEA 2VTMA 2C1BA 3D9VA 3JVSA 3WF6A 4EYJA 4S2ZA 4MWIA 2HYYA 4PPBA 4UB7A 4W4YA 5AUWA 3KGAA 4DH1A 3HEGA 4O7SA 1KOAA 2CHLA 3UO5A 4L45A 4XV3A 2FH9A 5M07A 5GINE 4ENYA 2QO9A 5AV1A 3W0SA 3RNYA 4QP9A 5CU3A 4I41A 4I4FA 3LOKA 4TYHB 3W33A 3FMLA 1MRVA 5CNNA 5IQCA 3FZSA 5KMKA 3OFMA 4R5YA 4W4VA 1RJBA 4FZFB 4IB0A 1NT2A 2VX3A 5FM2A 2BRMA 4WNOA 3SA0A 3WARA 1JNKA 3UIUA 2YIRA 1DI8A 4PMSA 4FTNA 4XV2A 4ZIMA 1ZOHA 5G1XA 3SG8A 3R1NA 2FSOX 2X9FA 2QNJA 3CBLA 4PQNA 3CSVA 1BL7A 3WBLA 4XG4A 3AC8A 2C3IB 3JVRA 4FVPA 5EOLA 5ACKA 3WIGA 3GC0A 4F1OA 4D2PA 1M52A 5CU4A 1Q62A 1U54A 4MXAA 3H3CA 5E8VA 4X3FB 1OMWA 3R8LA 3P4KA 5DPVA 3ORLA 1FGKA 3LFEA 3C4CA 1VLRA 3M42A 2YJRA 2OJJA 3TNPC 4P5ZA 4MVFA 4NM7A 5D7AA 2WMQA 2BZIB 2J5EA 2WTKC 3SQQA 4CGAA 4XG2A 4CFXA 3QQJA 2OF4A 3DT1A 3QTUA 1Q8ZA 4AUAA 1T46A 2VGOA 1P2AA 4D9TA 4G9RA 4EBVA 3NYXA 1REKA 1X8BA 3D7TB 3DQXA 4MQ1A 3V51A 3ZBXA 5HVYA 3LFCA 3V6RA 4N57A 4KKGA 3RZFA 5IDNA 1ERKA 1ZYSA 3AG9A 3DDPA 4LFIA 3Q9ZA 1VJYA 2OF2A 3PIXA 3DBDA 4KD1A 4WNMA 3NNUA 4BDJA 2G2IA 3AMYA 4QP7A 2NP8A 4BN1A 4M0ZA 1E9HA 3R7OA 3LFNA 1NVQA 2HWOA 3TACA 1OM1A 3TEIA 5CSHA 2XAMA 3BPRA 4RQKA 4DTBA 2XIXA 3ACKA 3QTZA 3PY1A 2OJ9A 4I0TA 4TYHA 1R39A 3BHUA 1OGUA 4JIAA 5CTPA 3DBFA 4IAIA 2WFYA 4JQEA 4X2FA 4AT4A 2W1ZA 4YZMA 4EKKA 4JDKA 3WZEA 3QAME 4YSJA 5LVNA 1AGWA 4O4DA 4QO9A 3NGAA 1R1WA 3R1QA 5EYMA 2C68A 1VZOA 3NNXA 1P4FA 4OTQA 3HMMA 4WNPA 3CQWA