5DEWA

Crystal structure of pak1 in complex with an inhibitor compound 5
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
DEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Design of Selective PAK1 Inhibitor G-5555: Improving Proper-ties by Employing an Unorthodox Low-pKa Polar Moiety
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5dewA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5dewA01
3ZBXA 3HDMA 4AT3A 2XS0A 3QL8A 3ZEPA 5FLFA 4P90A 2WMBA 1AQ1A 4GK4A 4HGEA 4IZ5A 3ZUTA 2YM8A 4UV0A 4HZRA 2OICA 4OTIA 4DEDA 3VS5A 1XQZA 3LOKA 4K0YA 4BCHA 5A46A 3A62A 4F08A 4F7LA 3EHAA 3OROA 1FGIA 5KMOA 2QOBA 2F2UA 3CLYA 4FV9A 3RPRA 5K0KA 4A9RA 4CLIA 2QHNA 3D7TB 3KL8A 5H8GA 5I9ZA 3BGQA 4CCBA 2CNQA 5AV2A 2OO8X 3DNDA 4G34A 3GGFA 3PE1A 4S2ZA 3IW8A 3JYAA 2I7QA 3L9LA 4E5AX 4ACCA 5CAPA 4UEUA 3HDNA 3QYWA 4E4LA 2GNFA 1GZOA 1H1WA 3FHRA 1IR3A 3NNXA 3ZXZA 2YABA 4PX6A 3ZZWA 3UP7A 4D5HA 3BIZA 4QP3A 3VN9A 3Q9YA 2F2CB 3HRFA 4K9YA 3RP9A 2W9ZB 1G5SA 3C5IA 2EB2A 3FZ1A 4PF4A 2PYWA 2FA2A 4EOJA 3U6HA 4EH8A 4L68A 3R28A 3P5KA 4DYMA 1FBNA 4J96A 1V0BA 3NLBA 4UYAA 4FNZA 5HG9A 3UG1A 3NUNA 1UWJA 3MVMA 4OTHA 4BI0A 2I1MA 1YKRA 4GMYA 4MQ2A 1Z9XA 4AGCA 2OSCA 5KHWA 3Q9ZA 3TXOA 4EQCA 3T9TA 4UZHA 5BMMA 4LRMA 2PTKA 4YHTA 3OWPA 4XP0A 5E8XA 4FNYA 4NFMA 4CV8A 2PK9A 2R0IA 4YHFA 5JH6A 2ITNA 3OZ6A 4FIHA 4XNEA 3R7GA 4FYOA 1JBPE 4YTFA 5KMKA 5LQFA 3PPKA 1PJKA 5A54A 4K11A 3LW0A 4GG7A 1LUFA 2BFXA 4Z9LA 1JKTA 5JFWA 4FYNA 4IX6A 2WTJA 4D9UA 2X6EA 4E5BA 2QOLA 4NYEA 4G6LA 3QQUA 5HZNA 2JKQA 2W4KA 4PDSA 2R3JA 3CPCA 4L6QA 1IRKA 3RPSA 3FQEA 4CFFA 3TN8A 2WTWA 4FT3A 2P33A 3GB2A 2YN8A 2RFNA 4MXYA 4YZCA 5EHYA 4OT6A 4CSVA 3LQ8A 3EKKA 5JFXA 3POZA 5HU9A 4O7VA 3OY1A 3CTQA 4DFXE 3CPBA 4I21A 2O64A 3K2LA 3O23A 4JDIA 1J7UA 2QI8A 4I92A 2A2AA 5D11A 3A8XA 4R3PA 4ITJA 3QCYA 3UO4A 2PVRA 3GT8A 1R0PA 5D1JA 4ASEA 2WNTA 3PJ2A 3ZFXA 3CQWA 3E63A 3IQ7A 1URCA 2VX0A 5FD2A 4YPDA 3E93A 3LZBA 1H27A 2XK7A 2G2FA 2BZJA 2ZM4A 4JR7A 5HCXA 5BNJA 4C62A 2ZM1A 2HOGA 2RFEA 2OH0E 3QRUA 4I94A 4LFIA 4DGGA 3QAME 3QCSA 2YIRA 4MH7A 4WKQA 3EOCA 2UZEA 3P86A 4E20A 5KX8A 4U8ZA 4QYFA 5M06A 2A4LA 4YNEA 1MP8A 4O6LA 4MXZA 4Y83A 2WEVA 3G6HA 3QLFA 2CJMA 2BHEA 4FC0A 5CSVA 1JAMA 5HIBA 2QD9A 1FVTA 4HGTA 3LFAA 5HO6A 2E9VA 4M97A 4J53A 4APCA 2J0KA 4WUAA 5HE1A 5L6PA 2IPXA 3EQIA 2YM4A 5LCJA 2R3LA 4I6QA 5FP5A 5CVHA 5C26A 3ODZX 5EH0A 3ZO2A 5C01A 4UMTA 4C37A 2YIQA 2Y4PA 5E1SA 2RSVA 4Z7GA 4EJNA 3B8QA 3UOJA 3SA0A 4KIQA 2PZPA 4RIYB 4AGDA 1KE8A 4XJ0A 5EYDA 4ENXA 4Z3VA 3LKMA 3FKOA 2GNHA 2X1NA 3PJ8A 2OH4A 4JQ7A 4MWIA 5K5XA 2QG7A 3EJ1A 4YPSA 1PXPA 2YLEA 3F5XA 3QZIA 4ZSJA 5EYMA 4QQTA 4RRVA 3GCSA 3M42A 2CLQA 5M53A 3C50A 3DZOA 3V5TA 2OZAA 4WG4A 5CQWA 2W5HA 2ZAZA 1E1XA 4RX9A 5FP6A 3GBZA 3VHEA 4G5JA 4MNEA 2OZOA 4R8QA 3I6WA 3M1SA 3O51A 3SGCA 1KE5A 4RJ7A 3IPHA 4FV4A 4BI1A 1BUHA 5GJDA 4ZK5A 3UQFA 4U40A 3RPOA 1YOLA 3Q9WA 4E8AA 2XJ1A 4PDYA 5M55A 4G16A 3Q6WA 5LMAA 4X2GA 1G3NA 4LGGA 3WZUA 4RX5A 3ERKA 1OI9A 1OPKA 4F1TA 3NNWA 2Y0AA 4ZJIA 2PVKA 2W1FA 5EYCA 3RI1A 2WAJA 4U3YA 3GP0A 4BTKA 4D2WA 1PF8A 4QP6A 2UZLA 1HCLA 4K8AA 3MH0A 5EDPA 5J1VA 2R5TA 3FLQA 1B6CB 3ENHA 4Y72A 5G1XA 4ZTMA 2FH9A 3TNHA 1YOMA 4D1SA 4YGAA 4GT5A 5CENA 3ACJA 4ZXTA 2WU7A 3OOMA 4CV9A 4IAKA 3TTJA 1OIQA 3KMWA 3PA5A 5AM7A 3C4CA 1FVVA 3ZFYA 3EFKA 4ZS0A 1BI7A 4M69A 1Q99A 4KBAA 2P55A 3T3UA 3LE6A 4QP8A 3PIZA 3W1FA 2QOQA 3IW6A 2HENA 3RZBA 1REKA 5GJFA 4CNHA 4U81A 3CC6A 1ERKA 3PLSA 4I23A 4RQVA 2C6LA 4X2NA 5BVNA 2CKOA 3C7QA 1S9IA 2UZUE 3CTHA 2Z60A 4FKJA 4FV8A 4LYNA 3WF7A 4O22A 4QMVA 4DH8A 4RQKA 2PWLA 2HXLA 4X3JA 4CQGA 5JZNA 1M2PA 4RZWA 4L67A 3C0GA 5H2UA 4IX4A 4S30A 1Q8YA 2UZOA 3EFLA 3KA0A 3P08A 4ZZMA 3ZDUA 4K6ZA 1ZMVA 3NUAA 4QP7A 4XBUA 3EZVA 2X39A 3ZLWA 3V8SA 5DT3A 4BDKA 4RC3A 2PL0A 3JUHA 2P2HA 1XR1A 2W9FB 4XS2A 5AAFA 3W16A 3PVWA 3I7BA 4UXQA 2J6MA 3A7GA 5EM8A 5IZFA 3I79A 4U0IA 3ZXTA 5BVOA 1OBDA 3B8RA 2WOUA 3RVGA 2ESMA 5AAGA 3ZSIA 5JEBA 5AP5A 3ORIA 5AP6A 5LVNA 3SRVB 3DB6A 4ITIA 4JQEA 4Y95A 2RIOA 5DG5A 4PMSA 1JKSA 4U41A 3HA8A 2X8IA 3OD6X 4B8LA 2XEYA 4E1ZA 4ZTQA 4NKAA 1J91A 5IUGA 1MRYA 3WZKA 4Z55A 3DT1A 1MRVA 3RBWA 2IN6A 3FMLA 4MVFA 5M56A 3UO5A 4QMXA 3TNWA 3UC3A 2XNOA 3NSZA 3MJ1A 3FUPA 3E92A 3ORNA 3TZ8A 3VRZA 4O0UA 3W2SA 4DEHA 4IWQA 5DRBA 1JSTA 4C58A 3BCEA 3WARA 5M51A 2QOIA 5FXRA 2GNIA 4GK2A 4YBJA 2WQBA 5C4LA 4O1OA 5AIKA 3W8QA 3K54A 4CZTA 2GHGA 3C1XA 3OFMA 2HIWA 1PXLA 4GVJA 4EJ7A 4YTHA 3O8PA 5AEPA 4IH8A 4BIBA 4G3DA 3GCPA 4HPTE 2F4JA 2XNEA 3NCZA 3P7CA 2CGUA 4KINA 1FMOE 4QMPA 4XG3A 1ZYDA 3QTRA 2EXMA 5CZHA 3PA3A 4JRVA 3F5UA 4NW5A 5BYLA 5EM6A 1JSVA 3AXWA 3L9PA 4GV1A 5K5NA 5KUPA 3EQFA 4A4LA 2J0LA 2JKMA 2H34A 4G3CA 4W4WA 5AFVA 3LVPA 2C30A 4BGGA 5DMZA 5FQDC 5L2SA 4PP7A 3QBNA 2HW7A 4JBPA 3V8WA 4KSQA 1XHAA 2VWWA 3CTJA 3HLLA 5BVWA 4IQ6A 1OPJA 4XX9A 3E64A 3F9NA 5I9WA 4LOQA 4ZSLA 4ALWA 3VQHA 3MN3A 4R1YA 3UNKA 4UN0C 1OL7A 4DT8A 2PMLX 3IW4A 3JXWA 5IG1A 1XH5A 2GHMA 1ZOHA 1NXKA 3IW7A 3O7LB 2UW4A 4FKSA 4GK3A 5HVKA 5K3YA 4F9WA 5AP7A 4MXAA 5BUEA 4FSZA 2YERA 3PE2A 3R63A 4I4EA 3FSFA 5K9IA 5E8YA 1UKIA 2WGJA 5TR6A 4HVGA 3UPZA 5HTBA 2W99B 3HAVA 2E2BA 3I4BA 4O7ZA 4GL9A 5D7AA 3MW1A 5F95A 3UZPA 1PMNA 3KXZA 1TQPA 2JBPA 3SXSA 4C4GA 3GOKA 4C4JA 1YDRE 3VQUA 4BCNA 1U5RA 3IKAA 4A9TA 3N4VA 1H1PA 2VD5A 3FPQA 3K3JA 4R7HA 3FZRA 3R7UA 3W2RA 3GI3A 4C35A 4JR3A 2IJMA 3R71A 4BDFA 1ZWSA 3F7ZA 2B7AA 5G6VA 1M52A 5DNRA 2XA4A 3SAYA 5ANKA 3MA3A 4IB0A 1OMWA 1OIRA 5KMLA 4XRJA 3MTFA 3F66A 2V55A 5EFQA 3HV6A 5HX8A 2VTRA 4ACHA 4BCMA 1WFCA 1JLUE 3DPKA 4HCVA 4ARKA 4CLJA 4C4IA 5AV4A 4F6SA 2ITTA 4PL3A 4OAUC 4BDHA 3AT4A 4JBVA 4RFYA 3VUIA 4L00A 3P79A 5JFSA 4U5JA 2J4ZA 2C6EA 3LFDA 2V5QA 2WD1A 2B54A 4MNFA 4AW5A 4QQ5A 4C33A 3EN5A 3CBLA 5AUUA 3QZFA 5DWRA 2Y9QA 4EEVA 2ITQA 2EXCX 4Z16A 2JD5A 5AR2A 3QQJA 4M3QA 2PUNA 3O50A 1QPCA 2VTLA 2ZV2A 1U5QA 1F5QA 1URWA 1NT2A 3HV5A 1KOAA 1Z57A 3O71A 3RZFA 3L9MA 5JN2A 4WNMA 4ZTNA 3FMEA 4BTFA 3DAKA 3FPMA 4OTWA 3Q4TA 5IQAA 3NX8A 3EYGA 4RVLA 3VW8A 4G9RA 2V62A 3W32A 2JDRA 3QTSA 2WELA 1UU7A 3V6RA 4D2PA 1OZ1A 1YOJA 2BMCA 3D14A 1Q8UA 3A60A 1SVGA 3KC3A 2OKRA 3HAMA 4L43A 3R7OA 1H28A 2YM5A 5C8KA 4QRCA 1UV5A 2NRYA 1ZARA 3MVLA 5BVFA 2HELA 2B1PA 2OG8A 3FC2A 4IJPA 3RAKA 4UZDA 3SC1A 5E8WA 3LFEA 1GNGA 4I20A 4QMZA 5GIOE 1NA7A 4G6OA 4O0SA 3SD0A 1L8TA 3BYSA 3UMXA 3LHJA 4G17A 3TNQB 3QD3A 3VS4A 3TDVA 2ITWA 4D2VA 3D5VA 1U54B 4M0ZA 2Z02A 3RHXA 4C02A 4EK5A 3NMUF 4E6QA 1KWPA 2R4BA 2Z8CA 1ZLTA 4HYIA 3DA6A 5AUTA 5AV0A 5C4KA 3EZRA 1OL5A 4QT1A 3AC2A 2W1GA 4ACGA 4XRLA 4I5MA 2IW6A 3DKCA 2UVYA 5AUYA 2YCSA 2BRHA 2WQMA 3FKNA 4HGLA 2YAAA 3BE2A 3SOCA 2C5XA 1PXNA 2P3GX 3LJ0A 3Q5IA 4WIHA 2VWIA 2YM6A 1FOTA 2QKRA 5H9BA 3C13A 3BYMA 2CCIA 4BTMA 3NW6A 4BWXA 5A4QA 2CN5A 1T46A 4DEBA 3ULZA 3EN7A 3VJNA 2CN8A 3FE3A 3ZC5A 5DR9A 2XNBA 2F7EE 2GSFA 4I22A 4NCTC 3ANQA 4FGBA 5I9VA 3V5LA 4RC2A 5D41A 4F7NA 3PJCA 2B55A 2VTJA 3NEWA 4S33A 3T3VA 5DEYA 3V5JA 3LXNA 2ITYA 3GU6A 2VAGA 3HUCA 2WMQA 4G9CA 4C61A 3ZUVA 5FEQA 2PU8A 4BKZA 3IOPA 3BHTA 3LCKA 2E9OA 4F4PA 3PY3A 3V04A 2OBJA 3BI6A 4RPVA 4L8MA 2ZJWA 1GOLA 1OECA 4C8BA 4FKIA 4L52A 2B4SB 2BAKA 4OR5A 3BV3A 4MHAA 1H4LA 3HRBA 4YTIA 3DDPA 2F7XE 2QLQA 4FKUA 4FTRA 4S32A 4X7QA 4BCKA 5IA1A 4QYYA 2R9SA 4Q2AA 5J79A 3VW6A 2NP8A 4V01A 4R5SA 3HP5A 2G2IA 4GCJA 5I9UA 3R2YA 4FEXA 4JI9A 4BZNA 5IUHA 4BN1A 2PVJA 2VTMA 3AMYA 4X3FB 3FV8A 3KCKA 3KXMA 1BX6A 1J1BA 1OL6A 1SVEA 1UU8A 4U7ZA 5AMNA 3G0FA 2X2KA 4W4XA 5CU4A 5HESA 4BC6A 1J3HA 3D2IA 4TXCA 4YJSA 4P7EA 5FTOA 4FSMA 3EFJA 3K5UA 3PFQA 2PMOX 4M7IA 4AT5A 2JDSA 2CGWA 1W84A 4B9DA 3FL5A 1OBGA 3V01A 4DFZE 5FTQA 4L7SA 4DG2E 4O0RA 2B9IA 5C9CA 4IVDA 2O3PA 3U6IA 4PTGA 3RJCA 3LPBA 2X7OA 3QD4A 2G1TA 4QQCA 4RIXB 5DRDA 2GQSA 2H96A 2UW0A 3PXZA 4EUTA 4J97A 5CEQA 3GCUA 2UV2A 3WOWA 3G2FA 4LV5A 3PWDA 4WSYA 4E6AA 4C59A 3ORXA 4IX3A 4FEVA 5CLPA 3PXKA 4FV5A 4M67A 5CI7A 1H0VA 3TG1A 4NFNA 5ANOA 3LFQA 3I7CA 4DCEA 3FL4A 3LIJA 4XLVA 4YJTA 2VWVA 1LEWA 3RCDA 3VF8A 3ZM4A 3TV6A 4ANBA 5IA2A 5AR7A 4LRKA 3D15A 4ZSAA 3I81A 5IKWA 1G8AA 5BX0A 3LLAA 2FO0A 4ZOGA 2FGIA 1LP4A 4EQUA 4MWHA 1ZOGA 4R1VA 4RA5A 4YU2A 3MI9A 3O2MA 2XYUA 2BILB 4RJ6A 4AOTA 4CKJA 2R7BA 4PTEA 4U43A 2GDOA 2W1ZA 5ANIA 3PXQA 5EKOA 1OL2A 5F20A 1BYGA 4D0XA 3EN9A 5JT2A 1A06A 2I6LA 4QMMA 4X0MA 4R77A 2C4GA 1H1SA 4WNKA 4R3CA 3MVJA 5ETFA 3TDWA 2ITVA 4DBNA 3UVRA 5T6KA 3EQBA 3TL8A 1KE7A 2QC6A 4A07A 1H08A 4L3PA 4IAFA 4W9XA 2JBOA 4BGQA 2GQRA 4IAYA 2W4OA 5FDPA 4EK8A 5IQCA 4XLIA 4J99A 5EI2A 5TOZA 3KRJA 4YJUA 4C34A 2VTSA 4QTCA 3RTPA 3LFSA 3VBXA 1OIYA 4OLIA 4CG9A 2YWVA 1M14A 2X6DA 3NR9A 5GJGA 4TTHB 2ETMA 4RIWA 1PKDA 4IIRA 1P2AA 1TQIA 3H9RA 3V51A 4AF3A 4NZWB 5CAVA 5CU6A 2GQGA 4I3ZA 3MY5A 4Y5HA 4FICA 4FZFB 5CT7A 3UP2A 2QR8A 1CMKE 5IF1A 1TQMA 5FG8A 3OCGA 3GCQA 4QMQA 4J8MA 2E9PA 5M07A 2XKDA 5H3QA 4BYIA 5AX9A 4BCIA 2P0CA 4ZY6A 2Z7LA 3FI4A 4FBXA 4UALA 2VNYA 4EORA 1JVPP 3I60A 2OGVA 2AC3A 2ONLA 3LFBA 3VAPA 5B2MA 4WBOA 4UMUA 5JGDA 2C3KA 3DXQA 1WBVA 2UZTA 2BIKB 4ZJJA 4BDGA 4WG5A 5A6OA 4TY1A 4FIFA 3TTIA 3S00A 4ZAUA 4QP1A 1XH6A 3CGOA 2R3IA 3E88A 3HRCA 1IEPA 4OGRA 3ZCLA 5JZJA 3NRMA 2O8YA 3VS6A 4YTCA 2A0CX 3DZQA 3E3BX 2VX3A 1H07A 3ORZA 4K77A 5AUVA 4IB5A 2Y6MA 4L3LA 3LCTA 4ZEGA 3R8LA 2OW3A 4CTCA 2WTDA 4NT4A 4HZSA 3SXFA 1KV1A 3R8ZA 4Q9ZA 1Y57A 5EW9A 2IZRA 3A7HA 4CEGA 4A06A 2CKPA 2F7ZE 1ZZ2A 4JBQA 4U79A 4GSBA 3DK6A 2W1IA 3SDJA 4WRGA 4IACA 4BCPA 1U59A 4C0TA 2UZNA 3TEIA 1JWHA 4BYJA 2JITA 2G9XA 3DXNA 3NYOA 1JSUA 2HWOA 3NS9A 1KSWA 3BELA 3NGAA 2X8EA 3PJ3A 3SG8A 5DEWA 4UX9A 3ZRKA 4EC9A 2Q0NA 4IZAA 2CGVA 3RPVA 5E8UA 4DF3A 1ZRZA 2H6DA 1XH9A 2XKFA 4JT3A 3K5VA 3OXZA 2P4IA 4LI5A 2WTIA 4B0GA 2XJ0A 2IVUA 1WVWA 4EBWA 4E4MA 4JDHA 5J87A 3IG7A 5DLSA 5HLPA 3PSCA 4YJRA 2IVVA 1PYXA 3LFCA 5CSWA 3FMDA 3HMOA 4ZZOA 1PMEA 2Z7QA 4P5ZA 4DGMA 4W8EA 5DT4A 1SM2A 3NVKI 3KRWA 4FV1A 3D9VA 3VUGA 3VBVA 3VC4A 3CIKA 4WG3A 3EL7A 2WMAA 4QMOA 4IAAA 2BRNA 2FSTX 3DQWA 4LM5A 4UXLA 2VV9A 1K2PA 2XBJA 1V0OA 2EUFB 4PY1A 5CTPA 3DLSA 4UWBA 5CU0A 4X3FC 3DFAA 4BCFA 3GUBA 4AN3A 3KQ7A 4AOJA 4F1OA 4IAIA 3S95A 4DFLA 3KF7A 1IA9A 3VF9A 3VS1A 2QOCA 2BZKB 3TI1A 4AOIA 1LEZA 3W2QA 3QQGA 4GG5A 4Q5HA 4B4LA 3QWJA 4FVPA 3P9JA 4I6BA 4KIPA 3FI2A 3TT0A 5J1WA 5M4UA 4JOAA 5TT7A 2OJJA 1E1VA 5ANJA 4WHZA 2HW6A 5J5SA 5ITAA 3ZUUA 3FC1X 4I0RA 4X21A 3ZRMA 1Q62A 2UW9A 3MVHA 2FB8A 2GFSA 4XP3A 3C4FA 1H1RA 4GU6A 4IC8A 4YNOA 3UOKA 2Y6OA 2WKMA 4USEA 1X8BA 1JNKA 3GU8A 4CG8A 3IDCA 2C68A 1F3MC 4AFJA 4EWQA 2WMXA 5IEYA 4QYGA 2YEXA 5FDXA 4D2SA 5GIPE 2PE0A 3M2WA 3KF4A 4ZMFA 3OXTA 1PY5A 2DS1A 4QMUA 3TKUA 4CZUA 5BUJA 2RG5A 3BHHA 2JLDA 3IS5A 3Q5ZA 1RQQA 1PXJA 2WZJA 4MKCA 3QKLA 4MXXA 4BWPA 2J50A 4PPAA 5HG7A 5L2QA 5HO8A 2C3IB 4V0GA 3W2PA 3F5GA 2WOTA 4Z7HA 3RKBA 4CT2A 3NUSA 5KBRA 2X4ZA 5AP1A 4R7IA 4BCQA 3KK9A 3F3TA 3PY0A 1XJDA 5AP4A 4EOSA 5HG5A 3QRTA 5CSXA 1GY3A 4PV0A 2XEZA 5KMMA 2SRCA 3CE3A 2REIA 1CTPE 4QP9A 5IDNA 5HNGA 4MD8E 2BUJA 4ID7A 4YO6A 4AP7A 3AMAA 3EQPA 4IM0A 2JGZA 4JNWA 4XH6A 4QTBA 2R3MA 2XNNA 4LOPA 4ENYA 1PXOA 3JY9A 2QU5A 5LVOA 3PIXA 4FVQA 4WSQA 4CD0A 2Q83A 2PHKA 3IOKA 3QKMA 2HY0A 3QTUA 4ANNA 1VEBA 2X81A 4AE6A 1J7IA 3PG1A 4YZNA 4MEDA 1JOWB 4FIIA 5AR8A 3CGFA 3RGFA 4FK3A 2BDJA 1J7LA 3DJ5A 4L7FA 1SVHA 5CI6A 3BQRA 4D55A 3NUPA 4FKOA 4QYHA 3P1AA 4R7BA 4TKSA 2C47A 4FZ7A 5CZIA 1MQBA 5L4QA 2PY3A 4FTNA 4FSWA 2WMUA 3FMNA 5IQFA 3F82A 1OKZA 3FLNC 3MWUA 4ZMEA 4HYHA 4MTAA 5HD7A 2B52A 3KB7A 4PQNA 2J0JA 2JIIA 4ZY5A 4FOBA 4NIFA 5CNOA 3FHIA 3FJQE 1UA2A 2YIYA 3F2RA 4MNEB 3RK5A 5AUZA 4TRLA 2NO3A 3MB7A 4DH7A 3VS3A 4FKRA 3MPTA 4IVBA 3KREA 2R3OA 3ORTA 5J7BA 2ACXA 4FTJA 4M14A 4BBMA 3HMPA 4MBLA 3U4UA 5JFVA 5TE0A 4BWKA 5HLWA 4FTIA 1LPUA 4BIEA 5AM6A 4EZ5A 1MRUA 2R3QA 4IZYA 1ZAOA 2O63A 2QODA 5F4NA 2UVZA 5A3XA 3GC9A 2QVSE 2IZSA 3KXXA 3KULB 3OG7A 4WO5A 4L3JA 4GUEA 4XCUA 5HO7A 5HBHA 3AT3A 4TWCA 4WD5A 2QQ7A 4ASXA 2CHLA 4RZVA 5DR6A 5CEOA 4B6LA 3W18A 3MDYA 1UNHA 2CSNA 2WEIA 5FXSA 1IG1A 4FGRA 2O65A 3OBGA 5DA3A 3SX9A 2YHVA 3CP9A 3OBJA 1W7HA 3S0OA 2A19B 4F6UA 2XCKA 3E8EA 4M69B 1M7NA 3R21A 2G01A 1Q41A 3TM0A 5J9ZA 4ONAA 2IZTA 2OU7A 3G51A 4FT9A 4FV0A 4NSTA 2IVTA 2QO7A 2ZM3A 3DKGA 3COHA 4X6QC 5EHOA 4EKKA 3TUBA 5D9HA 2OWBA 3AGLA 4AG8A 4EHZA 3COMA 3UMWA 3NAYA 1OKYA 3OCBA 4I5HA 4JDKA 3MJ2A 4AWIA 5IQHA 5CU2A 2C6TA 3VUDA 3D0EA 4TYEA 4LGDA 3FMMA 1OB3A 3MFTA 2C3JA 5CF4A 4KBKA 4ZIMA 4O7YA 2ERZE 3D7ZA 4DT9A 4KB8A 4XV9A 3L9NA 2XIRA 4DH3A 3OTVA 2E9UA 2XF0A 2JKOA 3BBWA 3JVRA 3GU4A 5BVDA 2R64A 3DCVA 3ETAA 3QF9A 2G2HA 4AA0A 5KCVA 3R7VA 4A7CA 4EUUA 4DC2A 3EQDA 1YXSA 5B0XA 4G2FA 4UYNA 3QTWA 5DN3A 3VWAA 3LAUA 2BFYA 3UJGA 4O7NA 3QXPA 4AGUA 3WILA 2C6IA 5CS6A 2YDJA 3F2NA 4RLKA 2WMRA 3UZRA 4H3BA 2XK4A 4H36A 2Z7RA 4JG6A 4UWYA 3F3ZA 4IE9A 4ZLYA 5AR4A 3I6UA 2XK9A 4GJ2A 5AUXA 5KKRB 4G3EA 4ZSEA 3R9DA 5F94A 4ZTLA 1XH8A 1XWSA 5HG8A 4O38A 4APPA 3FEGA 1P5EA 2IVSA 1STCE 3EN4A 3D5WA 2X2MA 4WNPA 3Q53A 4PTCA 1Q97A 2PVFA 4L45A 2QLUA 2EXEA 1FINA 3GU7A 3R22A 2OI4X 4HVIA 2OIQA 4RVTA 5E8VA 2QONA 3AC4A 4F0FA 4FSQA 1GZ8A 4FTAA 4FUYA 5E9EA 2UZVA 3U55A 3Q60A 3ZO4A 4FTQA 3BQCA 4D58A 4E73A 2XZSA 3BRBA 3DBDA 3RK7A 4IB3A 3A7FA 3PZHA 3PRIA 4FODA 1UNLA 5CEPA 4C3FA 3L8XA 3MFUA 4FMQA 2BPMA 2BVAA 1MQ4A 4DTBA 4O83A 3Q52A 4AW0A 1R1WA 1YI3A 3R04A 3QGWA 2WMSA 4FOCA 5BVKA 5CASA 3E8CA 3OP5A 5BVEA 3ZBFA 2CNVA 4NM3A 2GNGA 4EZ3A 3ZMMA 2YDIA 4YZBA 3SRVA 4BF2A 4E3CA 3NUUA 1UWHA 4F09A 1NVSA 4OUCA 3AC8A 2JKKA 2WMWA 3DDQA 4M13A 1CKJA 3U87A 3OC1A 4FSUA 2XRWA 5CXHA 4PDOA 3DAJA 5HNBA 4ANSA 1XH4A 2C1AA 4YLKA 4QQJA 5AWMA 4CCUA 2PVYA 3GQLA 3KKVA 4Y8DA 3QCXA 2VGOA 3R7EA 4FIEA 4XOZA 4CMUA 3IGOA 3BU5A 2X8DA 5LWNA 2XKEA 4KS8A 4M8TA 3UZTA 4JVGA 1FGKA 4M12A 4FTMA 5HI2A 3TV7A 3S1HA 2WU6A 4KABA 3RPYA 3R8PA 2EWAA 1BMKA 3QXOA 3UOHA 4FV2A 3FY0A 3DAEA 3QA0A 4FNXA 5M44A 3KXHA 3LM5A 2VTHA 3PXRA 4ZLZA 5F9EA 4RMZA 2OJGA 3KEXA 2ZDUA 4KD1A 2ITOA 4QMWA 3P23A 4O27B 3B2TA 3QRKA 4FZDB 3PTGA 2QKWB 4TN6A 2WTCA 5EHLA 3VHKA 3PIYA 5ACKA 4ACDA 2PMNX 4EH7A 2YCQA 4OBQA 5KNJA 5EQPA 4XEYA 2IG7A 4USFA 2Z2WA 3TZ7A 3ZSGA 2V7OA 2VZ6A 4AAAA 4F9BA 1REJA 3FXZA 5CAOA 4DBXA 2UVXA 2YAKA 3REPA 5CSPA 5CWZA 5M4FA 2PZ5A 2XP2A 4P2KA 1ATPE 2YZAA 1ND4A 2WQNA 3FQSA 4WNOA 4J7BA 4YO4A 3Q04A 2VO7A 4BI2A 2VWZA 3PVBA 4RX7A 3BYUA 3O8TA 2C0IA 2C0TA 4RSSA 1NVQA 1XBBA 3BLHA 2B9JA 5D7VA 4EOQA 3BU6A 5BYYA 1NY3A 2BKKA 4I5PA 3E8DA 1OIUA 3COKA 1OITA 1WVYA 3OEZA 3RAIA 4LMUA 3AQVA 3EFWA 4AZFA 4AS0A 4A9SA 4DH1A 4AQCA 4HVDA 4EOOA 5HVYA 2PZYA 3D83A 2W1DA 3MS9A 3A8WA 3OY3A 3UIUA 4I5CA 1Q3WA 3VULA 3VNTA 4BR3A 1CSNA 2DYLA 2ITZA 3PY1A 4QD6A 2HAKA 4BL1A 4I0SA 1YXXA 4IAZA 4FV3A 1B38A 4U80A 4ZTHA 5J9LA 4GT4A 4KKHA 4RIOA 3EQGA 1H0WA 4FL2A 4XG8A 4II5A 3AMBA 3W8LA 3CY3A 3IGGA 4ANQA 4J8NA 5HIEA 2PZIA 2QOHA 4M68A 1PXKA 3DTWA 1M2RA 3NZ0A 3MESA 2C5OA 2W96B 3F69A 1IA8A 2CCHA 5TF9A 2YCRA 3PP0A 5E91A 5E4HA 1V0PA 5AAEA 4C7TA 5KMIA 2X9EA 3N9XA 2YIXA 2YITA 4A4OA 4UMRA 5FRIA 5EK7A 3WF5A 4AACA 3O0GA 3ALNA 3G33A 4JRNA 4DN5A 4IB1A 3UVPA 5ACBC 1GIJA 3NUYA 3NDMA 3R1QA 3BWJA 3H0ZA 4JS8A 3MTLA 4KRCA 3A2CA 4LGHA 3UDBA 4LRJA 1AGWA 4F70A 3MGYA 1DS5A 3N51A 3PVGA 5CSHA 3H0YA 3ZU7A 5CX9A 3RMFA 1MUOA 2BZHB 2XVDA 3BHUA 3ZLXA 4D2TA 3Q9XA 3W33A 3QTIA 4CT1A 3F6XA 5AR3A 1K3AA 2J0IA 5IMXA 3WZDA 2FSLX 3FMHA 4R5YA 5CF5A 4MF0A 4BKJA 2XYNA 3C51A 4CMOA 4DEAA 5KKRC 3I0OA 3QUEA 4AXAA 3AGMA 3ZSHA 3ATTA 2BR1A 3FAAA 4ERKA 5B7VA 2YCFA 4O84A 3EKNA 2UW6A 3BLQA 3HMNA 4BDJA 4GKHA 3U54A 4EOIA 5CAQA 4RWIA 4NUSA 1JQHA 1UKHA 2YM7A 3RWQA 1Y8GA 4BFMA 3LFNA 4W8DA 3ZLSA 5BQ0A 1Q8WA 1HCKA 2XIXA 4IC7A 4O7LA 1E9HA 2PVNA 4EWHA 3FDNA 4DLIA 1R3CA 3TIYA 4XG7A 5J8IA 1KV2A 3DBQA 4P5QA 1FVRA 4EHEA 4F0IA 2GMXA 4ASZA 2VWYA 4FTUA 4MF1A 2YDKA 5ICPA 1ZY5A 3ORPA 4HNFA 2PULA 1XO2B 4O0VA 5LMKA 3MFSA 3HKOA 2NPQA 5HD4A 4BKYA 1W0XC 3SQQA 3BEGA 5EDQA 4DEEA 5L8LA 3PWYA 4DA5A 4KIKA 2R2PA 3NYVA 2VUWA 2QOKA 2W4JA 2YWPA 4TYHB 5FBOA 3AD6A 4IWPA 3ZRLA 4BTJA 1Q3DA 4L42A 5DBXA 3WF6A 2WQOA 4KIOA 2DQ7X 3HV3A 3ORKA 1WBSA 4F6WA 3B2WA 3C4XA 3COIA 2HZIA 2UW3A 5I5ZA 4QO9A 2C1BA 2JAMA 3DK3A 1H24A 4FL3A 3UNJA 3UQGA 4WBBB 1WBWA 3DJ7A 3NVMB 1PMUA 3NNUA 4F65A 3RCJA 5LXMA 1SNUA 3GENA 3H9FA 3MH2A 4XV2A 5DVRA 5HNIX 2VTQA 3ROCA 1GIIA 3IECA 5L2TA 4JG7A 4O96A 3RNYA 5GHVA 5IMEA 2PE1A 3EQRA 3FZOA 3O8UA 3SV0A 4E6CA 3H10A 5EOBA 2CMWA 3ZDIA 4DFNA 3BU3A 4J98A 3UG2A 3ZHPC 1GJOA 2X7GA 3CS9A 4GRBA 2JIVA 4N70A 2VRXA 5IH5A 2W06A 5M09A 3E7VA 1YWNA 4N0SA 1UVRA 4BBFA 3Q96A 3VUHA 3KMMA 5HE0A 2IZUA 4Y5QA 3DXPA 3EIDA 4XHKB 4K1BA 2GCDA 3TJCA 1QCFA 3QRJA 4JLCA 3BLRA 5JQ5A 4TYIA 2GNLA 4I6HA 2O0UA 3EYHA 2ZB1A 4GS6A 2OJFE 5CQUA 5E92A 5HHWA 3OT3A 3ZLYA 4F7JA 4H05A 4HCTA 5IH6A 1WZYA 2W0JA 2EVAA 3NYNA 5TKDA 4C4EA 1WBTA 5IH4A 3LQ3A 4DFBA 4FG8A 4DLJA 4KUJA 3H9OA 5KZIA 3HL7A 2A1AB 3RWPA 1VYWA 4QYEA 3Q4UA 3PJ1A 5AIRA 4H39A 5L8JA 4A4XA 4F0GA 2FSOX 4XYFA 4O21A 4RBLA 3MSSA 3OS3A 4X3FA 4ANLA 2YJSA 2R3HA 4TYGA 5EW8A 4JIKA 3KGAA 4AW2A 1O6LA 2Q0BA 4E6DA 3QRIA 2OXYA 1R0EA 3I5ZA 4PP9A 2XIYA 5CANA 4F9AA 3HZTA 3BWFA 4JIAA 3FLZA 2IO6A 1YXTA 2RF9A 3ENMA 3LFFA 4O6EA 5ANEA 3E7OA 4DITA 3TKHA 2R3KA 4GU9A 5AX3A 4EOKA 3OVVA 4BGHA 4FKTA 4FZAB 4LL0A 3CKXA 5IPJA 3LM0A 3WZJA 4QTEA 4O86A 4MYGA 4YLLA 4AA4A 4QOXA 3MBLA 3VUMA 3ZYAA 3ATSA 4FE2A 1IAHA 4D4RA 3KXNA 1P4FA 3ALOA 4YJVA 3R8MA 3R83A 3ROYA 2BRBA 3G9NA 3Q4CA 3ZOSA 5JGAA 3SW7A 3ODYX 1WBNA 4D4YA 4YUQA 3KRLA 3F3VA 3SVVA 2VNWA 5FBNC 4LG4A 3PRFA 4HVSA 1YDTE 4OTFA 4EHGA 2RGPA 5AA9A 2I40A 2IWIA 2QG5A 5FUTA 5IQBA 3A4PA 3H3CA 3HMIA 4E93A 3KK8A 3PVUA 4LV8A 4TW9A 3SLSA 4B99A 3KRRA 1YQJA 3QHWA 3EL8A 4FKPA 3LCSA 3NYXA 3QC9A 2O5KA 2WB8A 4DTKA 2VTNA 1WBOA 2YISA 3CCNA 3TKIA 4XG6A 4MQ1A 4U44A 5CF6A 2XK8A 2OF4A 2WPAA 4MX9A 4CKIA 2I0VA 1OPLA 3GVUA 2HK5A 3R30A 3R7YA 3R8UA 4EOMA 2C6MA 4AZWA 5HBEA 3OCTA 3C4ZA 3FSKA 5HTIA 3NIZA 3RHKA 3LXKA 5IISA 4FL1A 5IUIA 5DIAA 4C4FA 3AC1A 4CFXA 4YJPA 2WHBA 4BDEA 4EYMA 4FSRA 5IDPA 2ZV7A 2XH5A 4K33A 5H8BA 4IMYA 3VRYA 4QTDA 3R01A 3V5PA 3VBYA 4DFUA 3KVXA 4ZTSA 5I0BA 4DE4A 2C5YA 2VO0A 3R2BA 3QQKA 2YLFA 3CQUA 4AT4A 3DB8A 3G90X 3DNEA 4D4VA 2HZ0A 2R0UA 5DE2A 4JX7A 4UY9A 3WE4A 3IK3A 3WYYA 3DQXA 1HOWA 4R3RA 4X6RA 3QTQA 4G3GA 4QPMA 3ZZEA 4X2KA 3LCDA 5AJQA 3SKCA 3ZO1A 2R3FA 5DT0A 1SYKA 4GYGA 1B39A 4DEIA 2UUEA 4OBOA 1YRPA 3QGYA 4D4SA 3ZO3A 3CXWA 3OW4A 3LQ5A 1YHSA 2VWXA 3A4OX 4DH5A 4EH3A 5FTGA 3SHEA 3V3VA 3ID6C 3NAXA 1P4OA 5CVFA 3EB0A 4D28A 3F7WA 1QPDA 2J5FA 4ANMA 4BB4A 4TNDA 2BHHA 4J52A 4YZDA 3S4QA 4AN2A 3QZHA 2Y4IB 4KA3A 4HCUA 3QD0A 4BHNA 3PSDA 4ZZNA 3RM7A 3OUKA 2UZWE 4QNAA 1DM2A 1VYZA 4D1XA 3UIMA 1FQ1B 2UZDA 3FLYA 3CR0A 4PDPA 5E8ZA 5C03A 5HORA 2ZYBA 4MD7E 3AD4A 4J71A 3DBEA 2H8HA 4E5WA 4WA9A 1WAKA 1Y8YA 4LUEA 2C5NA 3QX2A 4GIHA 4GJ3A 3OTUA 1H26A 3F3UA 5EYKA 4Y73A 3HYHA 4FZ6A 2LGCA 2QR7A 4KS7A 4YHJA 4BZOA 2ITPA 3NPCA 1ZMWA 3BHVA 3KU2A 2FVDA 4FEWA 2GU8A 3ITZA 4RWKA 3C9WA 1YWVA 3R73A 3EQHA 2OJIA 3OWKA 5CVGA 1WCCA 2ETKA 3V5QA 3W2CA 1TVOA 3D7TA 1KE9A 2CPKE 2QU6A 3GCVA 4FTKA 4HJOA 3CD8A 3G6GA 3U4WA 4IFGA 4EH4A 5LVPA 2XK3A 2VWBA 4FF8A 4F9YA 4FUXA 2XRUA 2JIUA 5E8TA 5H8EA 3TNPC 3MYGA 3TUCA 1PXMA 2WMVA 4X2FA 4FT0A 1VJYA 2RG6A 1EH4A 5HVJA 2B9FA 1GZKA 3OT8A 2JAVA 4UBAA 4C3PA 2UW7A 2YZLA 3CSVA 4O81A 3GU5A 4MAOA 4CFMA 3FXXA 4EOPA 4GKIA 3KRXA 4GEOA 4XP2A 1WVXA 4MXCA 4H1JA 2WMTA 3JY0A 5JKGA 4FX3A 4NL0A 2RL5A 2H9VA 4OTRA 3ZTXA 3OOGA 3AG9A 3CEKA 2R7IA 3IDBA 4CVAA 1GAGA 1NVRA 4N6ZA 4AZTA 2I0YA 4IM2A 4RX8A 3A99A 2CLXA 4V04A 4FA2A 1WBPA 2YACA 5A4EA 3KCFA 4MD9E 4JAJA 4GFMA 3BV2A 4V0GB 4J95A 3R00A 5EM7A 3S3IA 3W10A 5J5TA 4PMTA 5C8MA 3VS2A 5IEVA 4DTAA 3DTCA 5ETAA 2PVHA 2QURA 4OTQA 1OGUA 3NWWA 4TNBA 2ZMDA 5KO1A 3FLWA 5AP0A 2BROA 4BDIA 1H01A 5EG3A 1Q61A 3DJ6A 4EK3A 4V05A 4QMNA 4N57A 3M11A 4KKEA 1OL1A 3QQFA 3TNIA 3C0HA 3CJGA 5K4IA 4KBCA 3MA6A 4HGSA 3NW5A 3VS0A 3U51A 2I0HA 4AE9A 4Y46A 4CXAA 3ZEWA 2GFCA 5DFPA 5I3OA 3QLGA 4N6YA 4CZYB 4NM7A 2VTOA 2F57A 2W05A 3K3IA 3U9NA 4EQMA 4F7SA 4PL4A 4IADA 3G15A 1UU9A 5L2WA 4NH1A 3VBTA 3WYXA 3UIXA 3LMIA 4O91A 4NM5A 4BZDA 3D94A 1O9UA 5BYZA 3F61A 2BCJA 2C0OA 2C3LA 5L2IA 4BDBA 3HV7A 2PUPA 3G0EA 4RFMA 2YJRA 1FMKA 3NUXA 1I09A 4G31A 4I1ZA 2UW5A 2CGXA 3DOGA 3FZSA 4AUAA 2KTYA 5ETCA 3QUDA 3ORLA 4O2ZA 5FWKK 4EL9A 5M4CA 4ALVA 5GZ8A 2XIKA 5IA4A 3FMJA 4M66A 3R8VA 1O6YA 3PA4A 1AD5A 3UPXA 4F63A 2PUIA 2ETRA 4IVCA 5HQ0A 4NIFB 4C36A 4BY9E 2WIPA 1PHKA 3Q6UA 4UB7A 2KULA 4AX8A 4IWDA 3DV3A 2ONLC 4P4CA 4DCAA 1QPJA 4KSPA 4TT7A 3UOLA 2WTKB 4C4HA 3O7LD 4RJ5A 5GZ9A 4EONA 3HX4A 4XBRA 3F3WA 5AADA 1G8SA 3KVWA 3Q2MA 2OZAB 3HP2A 3HV4A 2HCKA 4PWNA 2Y7JA 3EN6A 4NJ3A 3IW5A 4OBPA 5DGZA 5AA8A 4ORKA 2Y8OA 4O1PA 4JDJA 4RG0A 2VU3A 2XJ2A 1M2QA 3JS2A 3A61A 4CTBA 3S2PA 5CALA 5E7RA 4FVRA 2J5EA 5CU3A 2BRMA 3QU0A 3HNGA 4CRLA 5LJJA 4QMYA 3WIGA 3OCSA 3FQHA 2B9HA 5J95A 5FEDA 3HGKA 3KFAA 3LJ1A 4FG7A 5L6WL 4CQEA 2F49A 2W5AA 4NEUA 4CYIA 5I3RA 5L8KA 3A7JA 4AA5A 3ZS5A 4TPTA 4DFYA 4BCGA 2CKEA 2HY81 3PXYA 3MPMA 4GIIA 4D2RA 1VR2A 4Q9SA 4RIYA 1P14A 4IXPA 4U45A 2GS2A 2XNPA 4IDVA 3W2OA 1DAYA 4U3ZA 5T68A 4GW8A 3TZMA 1YXVA 2C5VA 4O2PA 5JGBA 3UQCA 3AC3A 4NK9A 4JAIA 4RWLA 5FM3A 4DGLC 1H00A 3QKKA 5JRSA 5EI8A 3RM6A 5BUIA 2X7FA 2Y4IC 4EH6A 2O2UA 4MCVA 1YVJA 3LJ2A 4O0TA 2BZIB 4AZVA 5I4NA 5HIDA 3UO6A 3PZEA 3EQCA 3LXPA 2CNUA 1S9JA 2C6KA 3DU8A 2VN9A 5IQIA 2R3NA 3KULA 4D0WA 4XG9A 3PPJA 3MPAA 4QP2A 2XMYA 1QL6A 2A27A 2C69A 4ZLOA 5ANDA 2VTAA 4FKGA 5GZAA 1NW1A 2PMIA 3FXWA 4Y85A 4ERWA 3HMMA 2ZVAA 3GC0A 1R78A 2W1CA 4L46A 4RLLA 5LARA 3FMKA 5EDRA 2J7TA 4YZMA 2BIYA 1OVEA 5J7HA 2XKCA 2AYPA 1Y91A 1L3RE 3BX5A 5E8SA 4EKLA 3RALA 3MH3A 3FY2A 4YC3A 4EH2A 1FPUA 4AW1A 1R39A 4N4SA 3II5A 4OTGA 1K9AA 4XV3A 4NW6A 3BE9A 5CT0A 3VIDA 4O7SA 3GQIA 3R7IA 3SW4A 5M08A 3QWKA 5EKNA 3L8SA 5FGKA 4BHZA 1SZMA 3VBWA 4FSYA 2ITXA 5IQDA 5IA5A 3PG3A 4F64A 4JXFA 3LMHA 5A4TA 3R1YA 4EH9A 4GYIA 1PW2A 4GT3A 3CY2A 3Q32A 1XKKA 3TCPA 4G3FA 2QHMA 2JDOA 3NW7A 5J9YA 5IQEA 3U6JA 5D10A 2VTPA 3FZTA 4FV7A 4H3QA 1JKLA 5C1QB 2C6DA 4OAVB 5BMSA 4M15A 3ZONA 4FKWA 3GC7A 4ZS4A 4TYJA 4GH2A 4RJ3A 5AR5A 3ZC6A 2RFSA 5IQGA 1OUKA 2XUUA 4O0YA 4WOVA 4YC6A 2FUMA 4FSTA 4ALUA 3W55A 4G1WA 5A14A 3R1SA 4HYSA 4H58A 3UYSA 3QUPA 4USDA 3DK7A 4BVUA 1I44A 4EHVA 3WF8A 2QOFA 3OUNB 2JC6A 2HWPA 4PRJA 1OKVA 2FYSA 2HZNA 5AP3A 3TJDA 4OW8A 5DI1A 3CJFA 3CKWA 4XG2A 4DHFA 3RINA 3FYKX 4C3RA 4QTAA 1PRYA 4EC8A 2OXXA 3ZH8A 4RFZA 3KN5A 3OWJA 5DPVA 5LWMA 1ZZLA 4O7TA 4JBOA 3H30A 1W82A 3PUPA 4E26A 2BTRA 2OIBA 4RC4A 2X4FA 2V7AA 4W9WA 5L3AA 3QC4A 4YBKA 2OLCA 4QNYA 3D5UA 4ZY4A 1ZYLA 1KOBA 2VTIA 4TWPA 3NNVA 1IASA 4FEQA 4NTSA 4BCOA 4EH5A 3BEAA 4RVKA 4NCTA 2J51A 5GINE 1PKGA 3QD2B 4QPAA 2PZRA 4C57A 4RVMA 2OFVA 5AV3A 4FTCA 4O7RA 1M17A 3ACKA 4HOKA 1OKWA 3G5DA 3HECA 4KNBA 2WO6A 4TWOA 4AN9A 4BCJA 3N4TA 3ELJA 3RK9A 3O17A 3PSBA 4FKLA 2XM8A 4OTDA 1CKIA 2J0MB 2WTKC 4Q5EA 3H4JA 4YZ9A 3FI3A 1H1QA 1YDSE 5HE2A 4YR8A 4FEUA 4R78A 3R9NA 4D1ZA 3C0IA 4A9YA 1JKKA 5FXQA 2RFDA 4HVHA 3RAHA 4BRXA 2W7XA 4KWPA 4X2JA 3PDTA 3VUKA 3A7IA 3UYTA 4CFNA 3LCOA 4XG4A 5L6OA 1DI9A 2V0DA 3BYVA 3EMGA 4PNKA 3CQEA 5CEMA 3VVHA 2BALA 4U6RA 2BAQA 1OM1A 3AD5A 3TWJA 4CMTA 3R0TA 4FK6A 4PNIA 1YHWA 3ET7A 2GTNA 4B7TA 2QNJA 1PMVA 3IDPA 4EK6A 3OHTA 4TL0A 5CEKA 3PPZA 3T8OA 3RAWA 3TUDA 1IAJA 3I0QA 5CYIA 3E62A 3I5NA 3UGCA 3BGZA 4CFUA 5LOHA 2VGPA 4CKRA 3EH9A 4JJRA 3F2AA 3DLZA 4YJNA 5E90A 2ZV8A 4NWMA 1J1CA 4R6VA 4I41A 4FSNA 2XM9A 2ZV9A 2PPQA 4PL5A 5C8NA 3KMUA 4FT5A 4DGNA 5A4CA 5CF8A 2IW9A 5HCZA 3QX4A 3GEQA 3DBFA 3BGPA 3P7BA 2RKUA 4U9AA 4L44A 5C27A 3VJOA 3UNZA 5ETIA 4BDDA 1YW2A 4W4VA 1VZOA 5DOSA 2VTTA 3BPRA 3PP1A 1BKXA 2G15A 3Q4ZA 5T3QA 2IW8A 3N4UA 2OF2A 2BRGA 3E87A 3WBLA 4O0WA 1Q24A 4CFWA 4EI4A 3G9LX 5CEIA 4EZ7A 3DKFA 4I4FA 4ANOA 5EQEA 5M4IA 2QOOA 5EW3A 3DGKA 1RW8A 2WXVA 3QQHA 4BDCA 5IA0A 4YJOA 5JMSA 3L1SA 5I9XA 2JFMA 3R02A 2XK6A 5HCYA 4GFGA 1U46A 3CD3A 4FIJA 3QZGA 1U4DA 2BTSA 3THBA 3JPVA 3ZM9A 4EOLA 4L9IA 1KUTA 3ULIA 4MXOA 1W83A 4IEBA 3L8PA 4HYUA 4AGWA 3RNIA 3QHRA 5K0XA 3QALE 3OEFX 4CGAA 1BLXA 1OUYA 2V22A 4NJDA 3T9IA 5HBJA 3O96A 4UMQA 5HLNA 3IO7A 5HX6A 1RDQE 1TKIA 2WTVA 2ZDTA 3ORMA 2ZOQA 4I93A 2PSQA 4NM0A 4TZRA 4NTTA 1W8CA 4FTLA 4K18A 5CY3A 3WI6A 1DAWA 4EYJA 1A9UA 1APME 2EU9A 4YSMA 3C5UA 4F9CA 5DYJA 4IFCA 1Z5MA 3UIBA 4D5KA 3PYYA 1ZYCA 3WIKA 4G6NA 4GUBA 2OFUA 3GXLA 3UODA 2WQEA 4PMPA 5IEXA 3I1AA 3DS6A 2PVLA 1H25A 3QQLA 1BI8A 2XNMA 2X2LA 4ZJVA 3AC5A 3MIYA 4L01A 3PLAE 3VO3A 4ITHA 4QMTA 3MIAA 4IM3A 2XB7A 5HKMA 1T45A 2EB3A 2VO6A 4DEGA 4H1MA 2CKQA 4AZSA 4QPSA 1XBCA 2OJ9A 3FWQA 2X9FA 4A9UA 1F0QA 4W4YA 4KIKB 5JRQA 2B0QA 3HA6A 3VS7A 2UW8A 3P0MA 3WZEA 4G5PA 4LL5A 1WMKA 1YI4A 1PYEA 1CM8A 4I0TA 2P2IA 4BICA 3F88A 3DBCA 1RJBA 4DG3E 1A48A 5GNKA 5K4JA 1U54A 2BKZA 2QCSA 3C4EA 1QPEA 5LMBA 4YLJA 3FKLA 3WF9A 5BPYA 3D5XA 4JL9A 3UTOA 4XOYA 4DINA 2HXQA 1ZOEA 3D2KA 3WE8A 5AP2A 4KKGA 1Y6BA 2GS6A 4FI1A 4GFOA 4F99A 1DI8A 4ASDA 2XIZA 2GTMA 4O82A 4DGOA 3DY7A 3UVQA 5DH3A 5CXZA 3F5PA 4XMOA 4C38A 2GHLA 5JSMA 4IVAA 4H3PA 2VO3A 3TIZA 4E4NA 2PVMA 4LOOA 4HW7A 2GS7A 3BYOA 3E3PA 3LLTA 4FKQA 4U97A 2CDZA 2XBAA 4IW0A 4BDAA 5CAUA 1Q8ZA 3FBVA 3BZ3A 4J1RA 1V1KA 4IHPA 4HPUE 5IU2A 3EWHA 2NNWB 3SOAA 3FI8A 3R6XA 1PXIA 4RWJA 4YURA 2Z7SA 4WRSA 1Y6AA 4RJ4A 4TYHA 3HUBA 5A9UA 4UWCA 3E5AA 5D12A 4QMLA 4S31A 5KHXA 5HTCA 5HGIA 2JDVA 2YM3A 3V8TA 2VWUA 5JQ8A 4ZTRA 4E4XA 2AUHA 3R1NA 2OK1A 3HVCA 4L53A 5ANGA 5LVLA 4ZSGA 2HZ4A 3QTXA 3TZ9A 4DAWA 1XH7A 2E9NA 3KXGA 2R3PA 3BKBA 1H8FA 1YWRA 4QP4A 5FEEA 2F9GA 3GNIB 3ZFMA 4TWNA 2WIHA 1YXUA 2WFYA 3UE4A 3AOXA 4FR4A 4E7WA 1KE6A 2XNGA 4ZP5A 2ZMCA 2J9MA 3MY1A 4AFEA 2AC5A 4YSJA 1W98A 5JK3A 5LMKC 4FTTA 4LUDA 4JX3A 4JG8A 3OXIA 2OIDA 4F1MA 3VBQA 2QO2A 1XBAA 4YC8A 3OW3A 4JQ8A 2DUVA 3FYJX 2B53A 4KAOA 3VUTA 2JEDA 4EBVA 4GVAA 4FKVA 3DFCB 4QMSA 1UU3A 3MH1A 5FM2A 2GPHA 3QYZA 1SMHA 3OMVA 4OTPA 3V6SA 5EI6A 5A6NA 4IBMA 1YI6A 1BL6A 3E8NA 5TO8A 5DHJA 2X0GA 4HNIA 4RIXA 5AV1A 5HEZA 3OWLA 4O0XA 4BBEA 5F1ZA 2W17A 1CDKA 1ZYJA 4IX5A 4CYJA 2BDFA 4MBJA 5HU3A 1M7QA 2DWBA 2UZBA 4RA4A 5KZ0A 4NKSA 4RGJA 4K2RA 4PPBA 4RT7A 2LAVA 5KMJA 3JVSA 1YHVA 4C2WA 1RE8A 3ANRA 4UMPA 3AT2A 4IJ9A 3IONA 3U8WA 2W1EA 4FIGA 5HICA 3DKOA 1GZNA 5B2LA 4RIWB 3SXRA 1Q4LA 5LCKA 4FNWA 3OF0A 4C2VA 4FT7A 3FLSA 3POOA 3MY0A 2XCHA 3NIEA 4IANA 5IA3A 4FG9A 2ITUA 1Q5KA 2PUUA 2VX1A 3GC8A 3UBDA 2R3RA 2BAJA 5KMNA 3R9RA 2JDTA 2C6OA 4I24A 4NU1A 4WT6A 3R9HA 4MK0A 2R3GA 3PXFA 4IWOA 4LQMA 5LVMA 3JR1A 4O7WA 2J2IB 3NCGA 3QFVA 5EM5A 3KN6A 2YIWA 3GFWA 4CRSA 1ZYSA 3Q2JA 5EQYA 4M84A 5E1EA 4ACMA 2NRUA 5CNNA 4M0YA 5AUWA 3BHYA 4B8MA 3LXLA 3QA8A 5KBQA 2JFLA 3HEGA 4FTOA 2YA9A 4BIDA 2W5BA 4I6FA 4KRDA 1LR4A 3L8VA 3U9CA 5I9YA 5HOAA 5HE3A 2FSMX 4RJ8A 3BBTB 4OT5A 4XV1A 3MFRA 3P4KA 3KY2A 4IDTA 5DR2A 2HYYA 3D4QA 3R9OA 2YFXA 3QCQA 4EK4A 4PMMA 4IZ7A 4MBIA 4DG0E 3TV4A 3GOPA 3GFEA 3QTZA 1SNXA 3MB6A 5A4LA 1O6KA 3LMGA 2W1HA 2OXDA 5KE0A 3Q3BA 3SG9A 2J90A 2PE2A 1ZY4A 3C4WA 1BL7A 2ERKA 2QO9A 5M57A 5B2KA 4AU8A 2I0EA 4LMNA 1QMZA 3UC4A 4U42A 3MV5A 4PUZA 3P7AA 4YP8A 1UNGA 1CKPA 3FZPA 3P78A 4S34A 1ZMUA 2BDWA 2GNJA 1JPAA 4YJQA 4XUFA 5EOLA 4PPCA 1ZXEA 2ZB0A 1GIHA 3V5WA 4CFVA 3TACA 1Q8TA 4YMJA 4AZEA 4WUNA 4FV6A 4D9TA
chains in the Genus database with same CATH superfamily
3ZBXA 3HDMA 4AT3A 2XS0A 3QL8A 3ZEPA 5FLFA 4P90A 2WMBA 1AQ1A 4GK4A 4HGEA 4IZ5A 3ZUTA 2YM8A 4UV0A 4HZRA 2OICA 4OTIA 4DEDA 3VS5A 1XQZA 3LOKA 4K0YA 4BCHA 5A46A 3A62A 4F08A 4F7LA 3EHAA 3OROA 1FGIA 5KMOA 2QOBA 2F2UA 3CLYA 4FV9A 3RPRA 5K0KA 4A9RA 4CLIA 2QHNA 3D7TB 3KL8A 5H8GA 5I9ZA 3BGQA 4CCBA 2CNQA 5AV2A 2OO8X 3DNDA 4G34A 3GGFA 3PE1A 4S2ZA 3IW8A 3JYAA 2I7QA 4DDGA 3L9LA 4E5AX 4ACCA 5CAPA 4UEUA 3HDNA 3QYWA 4E4LA 2GNFA 1GZOA 1H1WA 3FHRA 1IR3A 3NNXA 3ZXZA 4QDEA 2YABA 4PX6A 3ZZWA 3UP7A 4D5HA 3BIZA 4QP3A 3VN9A 3Q9YA 2F2CB 3HRFA 4K9YA 3RP9A 2W9ZB 1G5SA 3C5IA 2EB2A 3FZ1A 4PF4A 2PYWA 2FA2A 4EOJA 3U6HA 4EH8A 4L68A 3R28A 3P5KA 4DYMA 1FBNA 4J96A 1V0BA 3NLBA 4UYAA 4FNZA 5HG9A 3UG1A 3NUNA 1UWJA 3MVMA 4OTHA 4BI0A 2I1MA 1YKRA 4GMYA 4MQ2A 1Z9XA 4AGCA 2OSCA 5KHWA 3Q9ZA 3TXOA 4EQCA 3T9TA 4UZHA 5BMMA 4LRMA 2PTKA 4YHTA 3OWPA 4XP0A 5E8XA 4FNYA 4NFMA 4CV8A 2PK9A 2R0IA 4YHFA 5JH6A 2ITNA 3OZ6A 4FIHA 4XNEA 3R7GA 4FYOA 1JBPE 4YTFA 5KMKA 5LQFA 3PPKA 1PJKA 5A54A 4K11A 3LW0A 4GG7A 1LUFA 2BFXA 4Z9LA 1JKTA 5JFWA 4FYNA 4IX6A 2WTJA 4D9UA 2X6EA 4E5BA 2QOLA 4NYEA 4G6LA 3QQUA 5HZNA 2JKQA 2W4KA 4PDSA 2R3JA 3CPCA 4L6QA 1IRKA 3RPSA 3FQEA 4CFFA 3TN8A 2WTWA 4FT3A 2P33A 3GB2A 2YN8A 2RFNA 4MXYA 4YZCA 5EHYA 4OT6A 4CSVA 3LQ8A 3EKKA 5JFXA 3POZA 5HU9A 4O7VA 3OY1A 3CTQA 4DFXE 3CPBA 4I21A 2O64A 3K2LA 3O23A 4JDIA 1J7UA 2QI8A 4I92A 2A2AA 5D11A 3A8XA 4R3PA 4ITJA 3QCYA 3UO4A 2PVRA 3GT8A 1R0PA 5D1JA 4ASEA 2WNTA 3PJ2A 3ZFXA 3CQWA 3E63A 3AKJA 3IQ7A 1URCA 2VX0A 5FD2A 4YPDA 3E93A 3LZBA 1H27A 2XK7A 2G2FA 2BZJA 2ZM4A 4JR7A 5HCXA 5BNJA 4C62A 2ZM1A 2HOGA 2RFEA 2OH0E 3QRUA 4I94A 4LFIA 4DGGA 3QAME 3QCSA 2YIRA 4MH7A 4WKQA 3EOCA 2UZEA 3P86A 4E20A 5KX8A 4U8ZA 4QYFA 5M06A 2A4LA 4YNEA 1MP8A 4O6LA 4MXZA 4Y83A 2WEVA 3G6HA 3QLFA 2CJMA 2BHEA 4FC0A 5CSVA 1JAMA 5HIBA 2QD9A 1FVTA 4HGTA 3LFAA 5HO6A 2E9VA 4M97A 4J53A 3PUFC 4APCA 2J0KA 4WUAA 5HE1A 5L6PA 2IPXA 3EQIA 2YM4A 5LCJA 2R3LA 4I6QA 5FP5A 5CVHA 5C26A 3ODZX 5EH0A 3ZO2A 5C01A 4UMTA 4C37A 2YIQA 2Y4PA 5E1SA 2RSVA 4Z7GA 4EJNA 3B8QA 3UOJA 3SA0A 4KIQA 2PZPA 4RIYB 4AGDA 1KE8A 4XJ0A 5EYDA 4ENXA 4Z3VA 3LKMA 3FKOA 2GNHA 2X1NA 3PJ8A 4BJJB 2OH4A 4JQ7A 4MWIA 5K5XA 2QG7A 3EJ1A 4YPSA 1PXPA 2YLEA 3F5XA 3QZIA 4ZSJA 5EYMA 4QQTA 4RRVA 3GCSA 3M42A 2CLQA 5M53A 3C50A 3DZOA 3V5TA 2OZAA 4WG4A 5CQWA 2W5HA 2ZAZA 1E1XA 4RX9A 5FP6A 3GBZA 3VHEA 4G5JA 4MNEA 2OZOA 4R8QA 3I6WA 3M1SA 3O51A 3SGCA 1KE5A 4RJ7A 3IPHA 4FV4A 4BI1A 1BUHA 5GJDA 4ZK5A 3UQFA 4U40A 3RPOA 1YOLA 3Q9WA 4E8AA 2XJ1A 4PDYA 5M55A 4G16A 3Q6WA 5LMAA 4X2GA 1G3NA 4LGGA 3WZUA 4RX5A 3ERKA 1OI9A 1OPKA 4F1TA 3NNWA 2Y0AA 4ZJIA 2PVKA 2W1FA 5EYCA 3RI1A 2WAJA 4U3YA 3GP0A 4BTKA 4D2WA 1PF8A 2AQXA 2UZLA 1HCLA 4K8AA 3MH0A 4QP6A 5EDPA 5J1VA 2R5TA 3FLQA 1B6CB 3ENHA 4Y72A 5G1XA 4ZTMA 2FH9A 3TNHA 1YOMA 4D1SA 4YGAA 4GT5A 5CENA 3ACJA 4ZXTA 2WU7A 3OOMA 4CV9A 4IAKA 3TTJA 1OIQA 3KMWA 3PA5A 5AM7A 2X0PA 1FVVA 3C4CA 3EFKA 3ZFYA 4ZS0A 1BI7A 4M69A 1Q99A 4KBAA 2ZFYA 2P55A 3T3UA 3LE6A 4QP8A 3PIZA 3W1FA 2QOQA 3IW6A 2HENA 3RZBA 1REKA 5GJFA 4CNHA 4U81A 3CC6A 1ERKA 3PLSA 4I23A 4RQVA 2C6LA 4X2NA 5BVNA 2CKOA 3C7QA 1S9IA 2UZUE 3CTHA 2Z60A 4FKJA 4FV8A 4LYNA 3WF7A 4O22A 4QMVA 4DH8A 4RQKA 2PWLA 2HXLA 4X3JA 4CQGA 5JZNA 1M2PA 4RZWA 4L67A 3C0GA 5H2UA 4IX4A 4S30A 1Q8YA 2UZOA 3EFLA 3KA0A 3P08A 4ZZMA 3ZDUA 4K6ZA 1ZMVA 3NUAA 4QP7A 4XBUA 3EZVA 2X39A 3ZLWA 3V8SA 5DT3A 4BDKA 4RC3A 2PL0A 3JUHA 2P2HA 1XR1A 2W9FB 4XS2A 5AAFA 3W16A 3PVWA 3I7BA 4UXQA 2J6MA 3A7GA 5EM8A 5IZFA 3I79A 4U0IA 3ZXTA 5BVOA 1OBDA 3B8RA 2WOUA 3RVGA 2ESMA 5AAGA 3ZSIA 5JEBA 5AP5A 3ORIA 5AP6A 5LVNA 3SRVB 3DB6A 4ITIA 4JQEA 4Y95A 2RIOA 5DG5A 4PMSA 1JKSA 4U41A 3HA8A 2X8IA 3OD6X 4B8LA 2XEYA 4E1ZA 4ZTQA 4NKAA 1J91A 5IUGA 1MRYA 3WZKA 4Z55A 3DT1A 1MRVA 3RBWA 2IN6A 3FMLA 4MVFA 5M56A 3UO5A 4QMXA 3TNWA 3UC3A 2XNOA 3NSZA 3MJ1A 3FUPA 3E92A 3ORNA 3TZ8A 3VRZA 4O0UA 3W2SA 4DEHA 4IWQA 5DRBA 1JSTA 4C58A 3BCEA 3WARA 5M51A 2QOIA 5FXRA 2GNIA 4GK2A 4YBJA 2WQBA 5C4LA 4O1OA 5AIKA 3W8QA 3K54A 4CZTA 2GHGA 3C1XA 3OFMA 2HIWA 1PXLA 4GVJA 4EJ7A 4YTHA 3O8PA 5AEPA 4IH8A 4BIBA 4G3DA 3GCPA 4HPTE 2F4JA 2XNEA 3NCZA 3P7CA 2CGUA 4KINA 1FMOE 4QMPA 4XG3A 1ZYDA 3QTRA 2EXMA 5CZHA 3PA3A 4JRVA 3F5UA 4NW5A 1G8KA 5BYLA 5EM6A 1JSVA 3AXWA 3L9PA 4GV1A 5K5NA 5KUPA 3EQFA 4A4LA 2J0LA 2JKMA 2H34A 4G3CA 4W4WA 5AFVA 2XANA 3LVPA 2C30A 4BGGA 5DMZA 5FQDC 5L2SA 4PP7A 3QBNA 2HW7A 4JBPA 3V8WA 4KSQA 4AXEA 1XHAA 2VWWA 3CTJA 3HLLA 5BVWA 4IQ6A 1OPJA 4XX9A 3E64A 3F9NA 5I9WA 4LOQA 4ZSLA 4ALWA 3VQHA 3MN3A 4R1YA 3UNKA 4UN0C 1OL7A 4DT8A 2PMLX 3IW4A 3JXWA 5IG1A 1XH5A 2GHMA 1ZOHA 1NXKA 3IW7A 3O7LB 2UW4A 4FKSA 4GK3A 5HVKA 5K3YA 4F9WA 5AP7A 4MXAA 5BUEA 4FSZA 2YERA 3PE2A 3R63A 4I4EA 3FSFA 5K9IA 5E8YA 1UKIA 2WGJA 5TR6A 4HVGA 3UPZA 5HTBA 2W99B 3HAVA 2E2BA 3I4BA 4I6LA 3BL9A 4O7ZA 4GL9A 5D7AA 3MW1A 5F95A 3UZPA 1PMNA 3KXZA 1TQPA 2JBPA 3SXSA 4C4GA 3GOKA 4C4JA 4LDTA 1YDRE 3VQUA 4BCNA 1U5RA 3IKAA 4A9TA 3N4VA 1H1PA 2VD5A 3FPQA 3K3JA 4R7HA 3FZRA 3R7UA 3W2RA 3GI3A 4C35A 4JR3A 2IJMA 3R71A 4BDFA 1ZWSA 3F7ZA 2B7AA 5G6VA 1M52A 5DNRA 2XA4A 3SAYA 5ANKA 3MA3A 4IB0A 3PFYA 1OMWA 1OIRA 5KMLA 4XRJA 3MTFA 3F66A 2V55A 5EFQA 3HV6A 5HX8A 2VTRA 4ACHA 4BCMA 1W2DA 1ST0A 1WFCA 1JLUE 3DPKA 4HCVA 4ARKA 4CLJA 4C4IA 5AV4A 4F6SA 2ITTA 4PL3A 4OAUC 4BDHA 3AT4A 4JBVA 4RFYA 3VUIA 4L00A 3P79A 5JFSA 4U5JA 2J4ZA 2C6EA 3LFDA 2V5QA 2WD1A 2B54A 4MNFA 4AW5A 4QQ5A 4C33A 3EN5A 3CBLA 2X0QA 5AUUA 3QZFA 5DWRA 2Y9QA 4EEVA 2ITQA 2EXCX 4Z16A 2JD5A 5AR2A 3QQJA 4M3QA 2PUNA 3O50A 1QPCA 2VTLA 2ZV2A 1U5QA 1F5QA 1URWA 1NT2A 3HV5A 1KOAA 1Z57A 3O71A 3RZFA 3L9MA 5JN2A 4WNMA 4ZTNA 3FMEA 4BTFA 3DAKA 3FPMA 4OTWA 3Q4TA 5IQAA 3NX8A 3EYGA 4RVLA 3VW8A 4G9RA 2V62A 3W32A 2JDRA 3QTSA 2WELA 1UU7A 3V6RA 4D2PA 1OZ1A 1YOJA 2BMCA 3D14A 1Q8UA 3A60A 1SVGA 3KC3A 2OKRA 3HAMA 4L43A 3R7OA 1H28A 2YM5A 5C8KA 4QRCA 1UV5A 2NRYA 1ZARA 3MVLA 5BVFA 2HELA 2B1PA 2OG8A 3FC2A 4IJPA 3RAKA 4UZDA 3SC1A 5E8WA 3LFEA 1GNGA 4I20A 4QMZA 5GIOE 1NA7A 4G6OA 4O0SA 3SD0A 1L8TA 3BYSA 3UMXA 3LHJA 4G17A 3TNQB 3QD3A 3VS4A 3TDVA 2ITWA 4D2VA 3D5VA 1U54B 4M0ZA 2Z02A 3RHXA 4C02A 4EK5A 3NMUF 4E6QA 1KWPA 2R4BA 2Z8CA 1ZLTA 4HYIA 4DHZA 3DA6A 5AUTA 5AV0A 5C4KA 3EZRA 1OL5A 4QT1A 3AC2A 2W1GA 4ACGA 4XRLA 4I5MA 2IW6A 3DKCA 2UVYA 5AUYA 2YCSA 2BRHA 2WQMA 3FKNA 4HGLA 2YAAA 3BE2A 3SOCA 2C5XA 1PXNA 2P3GX 3LJ0A 3Q5IA 4WIHA 2VWIA 2YM6A 1FOTA 2QKRA 5H9BA 3C13A 3BYMA 2CCIA 4BTMA 3NW6A 4BWXA 5A4QA 2CN5A 1T46A 4DEBA 3ULZA 3EN7A 3VJNA 2CN8A 3FE3A 3ZC5A 5DR9A 2XNBA 2F7EE 2GSFA 4I22A 4NCTC 3ANQA 4FGBA 5I9VA 3W0NA 3V5LA 4RC2A 5D41A 4F7NA 3NFGB 3PJCA 2B55A 2VTJA 3NEWA 4S33A 3T3VA 5DEYA 3V5JA 3LXNA 2ITYA 3GU6A 2VAGA 3HUCA 2WMQA 4G9CA 4C61A 3ZUVA 5FEQA 2PU8A 4BKZA 3IOPA 3BHTA 3LCKA 2E9OA 4F4PA 3PY3A 3V04A 2OBJA 3BI6A 4RPVA 4L8MA 2ZJWA 1GOLA 1OECA 4C8BA 4FKIA 4L52A 1ST4A 2B4SB 2BAKA 4OR5A 3BV3A 4MHAA 1H4LA 3HRBA 4YTIA 3DDPA 2F7XE 2QLQA 4FKUA 4FTRA 4S32A 4X7QA 4BCKA 5IA1A 4QYYA 2R9SA 4Q2AA 5J79A 1XMMA 3VW6A 2NP8A 4V01A 4R5SA 3HP5A 2G2IA 4GCJA 5I9UA 3R2YA 4FEXA 4JI9A 4BZNA 5IUHA 4BN1A 2PVJA 2VTMA 3AMYA 4X3FB 3FV8A 3KCKA 3KXMA 1BX6A 1J1BA 1OL6A 1SVEA 1UU8A 4U7ZA 5AMNA 3G0FA 2X2KA 4W4XA 5CU4A 5HESA 4BC6A 1J3HA 3D2IA 4TXCA 4YJSA 4P7EA 5FTOA 4FSMA 3EFJA 3K5UA 3PFQA 2PMOX 4M7IA 4AT5A 2JDSA 2CGWA 1W84A 4B9DA 3FL5A 1OBGA 3V01A 4DFZE 5FTQA 4L7SA 4DG2E 4O0RA 2B9IA 5C9CA 4IVDA 2O3PA 3U6IA 4PTGA 3RJCA 3LPBA 2NYAA 2X7OA 3QD4A 2G1TA 4QQCA 4RIXB 5DRDA 2GQSA 2H96A 2UW0A 3PXZA 4EUTA 4J97A 5CEQA 3GCUA 2UV2A 3WOWA 3G2FA 4LV5A 3PWDA 4WSYA 4E6AA 4C59A 3ORXA 4IX3A 4FEVA 5CLPA 3PXKA 4FV5A 4M67A 5CI7A 1H0VA 3TG1A 4NFNA 5ANOA 3LFQA 3I7CA 4DCEA 3FL4A 3LIJA 4XLVA 4YJTA 2VWVA 1LEWA 3RCDA 3VF8A 3ZM4A 3TV6A 4ANBA 5IA2A 4DHJA 5AR7A 4LRKA 3D15A 4ZSAA 3I81A 5IKWA 1G8AA 5BX0A 3LLAA 2FO0A 4ZOGA 2FGIA 1LP4A 2X0OA 4EQUA 4MWHA 1ZOGA 4R1VA 4RA5A 4YU2A 3MI9A 3O2MA 2XYUA 2BILB 4RJ6A 4AOTA 4CKJA 2R7BA 4PTEA 4U43A 2GDOA 2W1ZA 5ANIA 3PXQA 5EKOA 1OL2A 5F20A 1BYGA 4D0XA 3EN9A 5JT2A 1A06A 2I6LA 4QMMA 4X0MA 4R77A 2C4GA 1H1SA 4WNKA 4R3CA 3MVJA 5ETFA 3TDWA 2ITVA 4DBNA 3UVRA 5T6KA 3EQBA 3TL8A 1KE7A 2QC6A 4A07A 1H08A 4L3PA 4IAFA 4W9XA 2JBOA 4BGQA 2GQRA 4IAYA 2W4OA 5FDPA 4EK8A 5IQCA 4XLIA 4J99A 5EI2A 5TOZA 1OGYA 3KRJA 4YJUA 4C34A 2VTSA 4QTCA 3RTPA 3LFSA 3VBXA 1OIYA 4OLIA 4CG9A 2YWVA 1M14A 2X6DA 3NR9A 5GJGA 4TTHB 2ETMA 4RIWA 1PKDA 4IIRA 1P2AA 1TQIA 3H9RA 3V51A 4AF3A 4NZWB 5CAVA 5CU6A 2GQGA 4I3ZA 3MY5A 4Y5HA 4FICA 4FZFB 5CT7A 3UP2A 2QR8A 1CMKE 5IF1A 1TQMA 5FG8A 3OCGA 3GCQA 4QMQA 4J8MA 2E9PA 5M07A 2XKDA 5H3QA 4BYIA 5AX9A 4BCIA 2P0CA 4ZY6A 2Z7LA 3FI4A 4FBXA 4UALA 2VNYA 4EORA 1JVPP 3I60A 2OGVA 2AC3A 2ONLA 3LFBA 3VAPA 5B2MA 4WBOA 3W0SA 4UMUA 5JGDA 2C3KA 3DXQA 1WBVA 2UZTA 2BIKB 4ZJJA 4BDGA 4WG5A 5A6OA 4TY1A 4FIFA 3TTIA 3S00A 4ZAUA 4QP1A 1XH6A 3CGOA 2R3IA 3E88A 3HRCA 1IEPA 4OGRA 3ZCLA 5JZJA 3NRMA 2O8YA 3VS6A 4YTCA 2A0CX 3DZQA 3E3BX 2VX3A 1H07A 3ORZA 4K77A 5AUVA 4IB5A 2Y6MA 4L3LA 3LCTA 4ZEGA 3R8LA 2OW3A 4CTCA 2WTDA 4NT4A 4HZSA 3SXFA 1KV1A 5BV3A 3R8ZA 4Q9ZA 1Y57A 5EW9A 2IZRA 3A7HA 4CEGA 4A06A 2CKPA 2F7ZE 1ZZ2A 4JBQA 3KIOC 4U79A 4GSBA 3DK6A 2W1IA 3SDJA 4WRGA 4IACA 4BCPA 1U59A 4O4DA 4C0TA 2UZNA 3TEIA 1JWHA 4BYJA 2JITA 2G9XA 3DXNA 3NYOA 1JSUA 2HWOA 3NS9A 1KSWA 3BELA 3NGAA 2X8EA 3PJ3A 3SG8A 5DEWA 4UX9A 3ZRKA 4EC9A 2Q0NA 4IZAA 2CGVA 3RPVA 5E8UA 4DF3A 1ZRZA 2H6DA 1XH9A 2XKFA 4JT3A 3K5VA 3OXZA 2P4IA 4LI5A 2WTIA 4B0GA 2XJ0A 2IVUA 1WVWA 4EBWA 4E4MA 4JDHA 5J87A 3IG7A 4AQKA 5DLSA 5HLPA 3PSCA 4YJRA 2IVVA 1PYXA 3LFCA 5CSWA 3FMDA 3HMOA 4ZZOA 1PMEA 2Z7QA 4P5ZA 4DGMA 4O4BB 4W8EA 5DT4A 1SM2A 3NVKI 3KRWA 4FV1A 3D9VA 3VUGA 3VBVA 3VC4A 3CIKA 4WG3A 3EL7A 2WMAA 4QMOA 4IAAA 2BRNA 2FSTX 3DQWA 4LM5A 4UXLA 2VV9A 1K2PA 2XBJA 1V0OA 2EUFB 4PY1A 5CTPA 3DLSA 4UWBA 5CU0A 3P5JC 4X3FC 3DFAA 4BCFA 3GUBA 4AN3A 3KQ7A 4AOJA 4F1OA 4IAIA 3S95A 4DFLA 3KF7A 1IA9A 3VF9A 3VS1A 2QOCA 2BZKB 3TI1A 4AOIA 1LEZA 3W2QA 3QQGA 4GG5A 4Q5HA 4B4LA 3QWJA 4FVPA 3P9JA 4I6BA 4KIPA 3FI2A 3TT0A 5J1WA 5M4UA 3TMOA 4JOAA 5TT7A 2OJJA 1E1VA 5ANJA 4WHZA 2HW6A 5J5SA 5ITAA 3ZUUA 3FC1X 3UDTA 4I0RA 4X21A 3ZRMA 1Q62A 2UW9A 3MVHA 2FB8A 2GFSA 4XP3A 3C4FA 1H1RA 4GU6A 4IC8A 4YNOA 3UOKA 2Y6OA 2WKMA 4USEA 1X8BA 1JNKA 3GU8A 4CG8A 3IDCA 2C68A 1F3MC 4AFJA 4EWQA 2WMXA 5IEYA 4QYGA 2YEXA 5FDXA 4D2SA 5GIPE 2PE0A 3M2WA 3KF4A 4ZMFA 3OXTA 1PY5A 2DS1A 4QMUA 3TKUA 4CZUA 5BUJA 2RG5A 3BHHA 2JLDA 3IS5A 3Q5ZA 1RQQA 1PXJA 2WZJA 4MKCA 3QKLA 4MXXA 4BWPA 2J50A 4PPAA 5HG7A 5L2QA 5HO8A 2C3IB 4V0GA 3W0MA 3W2PA 3F5GA 2WOTA 4Z7HA 3RKBA 4CT2A 3NUSA 5KBRA 2X4ZA 5AP1A 4R7IA 4BCQA 3KK9A 3F3TA 3PY0A 1XJDA 5AP4A 4EOSA 5HG5A 3QRTA 5CSXA 1GY3A 4PV0A 2XEZA 5KMMA 2SRCA 3CE3A 2REIA 1CTPE 4QP9A 5IDNA 5HNGA 4MD8E 2BUJA 4ID7A 4YO6A 4AP7A 2XALA 3AMAA 3EQPA 4IM0A 2JGZA 4JNWA 4XH6A 4QTBA 2R3MA 2XNNA 4LOPA 4ENYA 1PXOA 3JY9A 2QU5A 5LVOA 3PIXA 4FVQA 4WSQA 4CD0A 2Q83A 2PHKA 3IOKA 3QKMA 2HY0A 3QTUA 4ANNA 1VEBA 2X81A 4AE6A 1J7IA 3PG1A 4YZNA 4MEDA 1JOWB 4FIIA 5AR8A 3CGFA 3RGFA 4FK3A 2BDJA 1J7LA 3DJ5A 4L7FA 1SVHA 5CI6A 3BQRA 4D55A 3NUPA 4FKOA 4QYHA 3P1AA 4R7BA 4TKSA 2C47A 4FZ7A 5CZIA 1MQBA 5L4QA 2PY3A 4FTNA 4FSWA 2WMUA 3FMNA 5IQFA 3F82A 1OKZA 3FLNC 3MWUA 4ZMEA 4HYHA 4MTAA 5HD7A 2B52A 3KB7A 4PQNA 2J0JA 2JIIA 4ZY5A 4FOBA 4NIFA 5CNOA 3FHIA 3FJQE 1UA2A 2YIYA 3F2RA 4MNEB 3RK5A 5AUZA 4TRLA 2NO3A 3MB7A 4DH7A 3VS3A 4FKRA 3MPTA 4IVBA 3KREA 2R3OA 3ORTA 5J7BA 2ACXA 4FTJA 4M14A 4BBMA 3HMPA 4MBLA 3U4UA 5JFVA 5TE0A 4BWKA 5HLWA 4AXFA 4FTIA 1LPUA 4BIEA 5AM6A 4EZ5A 1MRUA 2R3QA 4IZYA 1ZAOA 2O63A 2QODA 5F4NA 2UVZA 5A3XA 3GC9A 2QVSE 2IZSA 3KXXA 3KULB 3OG7A 4WO5A 4L3JA 4GUEA 4XCUA 5HO7A 5HBHA 3AT3A 4TWCA 4WD5A 2QQ7A 4ASXA 2CHLA 4RZVA 5DR6A 5CEOA 4B6LA 3W18A 3MDYA 1UNHA 2CSNA 2WEIA 5FXSA 1IG1A 4FGRA 2O65A 3OBGA 5DA3A 3SX9A 2YHVA 3CP9A 3OBJA 1W7HA 3S0OA 2A19B 4F6UA 2XCKA 3E8EA 4M69B 1M7NA 3R21A 2G01A 1Q41A 3TM0A 5J9ZA 4ONAA 2IZTA 2OU7A 3G51A 4FT9A 4FV0A 4NSTA 2IVTA 2QO7A 2ZM3A 3DKGA 3COHA 4X6QC 5EHOA 4EKKA 3TUBA 5D9HA 2IF8A 2OWBA 3AGLA 4AG8A 4EHZA 3COMA 3UMWA 3NAYA 1OKYA 3OCBA 4I5HA 4JDKA 3MJ2A 4AWIA 5IQHA 5CU2A 2C6TA 3VUDA 3D0EA 1W2FA 4TYEA 4LGDA 3FMMA 1OB3A 3MFTA 2C3JA 5CF4A 4KBKA 4ZIMA 4O7YA 2ERZE 3D7ZA 4DT9A 4KB8A 4XV9A 3L9NA 2XIRA 4DH3A 3OTVA 2E9UA 2XF0A 2JKOA 3BBWA 3JVRA 3GU4A 5BVDA 2R64A 3DCVA 3ETAA 3QF9A 2G2HA 4AA0A 5KCVA 3R7VA 4A7CA 4EUUA 4DC2A 3EQDA 1YXSA 5B0XA 4G2FA 4UYNA 3QTWA 5DN3A 3VWAA 3LAUA 2BFYA 3UJGA 4O7NA 3QXPA 4AGUA 3WILA 2C6IA 5CS6A 2YDJA 3F2NA 4RLKA 2WMRA 3UZRA 4H3BA 2XK4A 4H36A 4AXDA 2Z7RA 4JG6A 4UWYA 3F3ZA 4IE9A 4ZLYA 5AR4A 3I6UA 2XK9A 4GJ2A 5AUXA 5KKRB 4F78A 4G3EA 4ZSEA 3R9DA 5F94A 4ZTLA 1XH8A 1XWSA 5HG8A 4O38A 4APPA 3FEGA 1P5EA 2IVSA 1STCE 3EN4A 3D5WA 2X2MA 4WNPA 3Q53A 4PTCA 1Q97A 4JMQA 2PVFA 4L45A 2QLUA 2EXEA 1FINA 3GU7A 3R22A 2OI4X 4HVIA 2OIQA 4RVTA 5E8VA 2QONA 3AC4A 4F0FA 4FSQA 1GZ8A 4FTAA 4FUYA 5E9EA 2UZVA 3U55A 3Q60A 3ZO4A 4FTQA 3BQCA 4D58A 4E73A 2XZSA 3BRBA 3DBDA 3RK7A 4IB3A 3A7FA 3PZHA 3PRIA 4FODA 1UNLA 5CEPA 4C3FA 3L8XA 3MFUA 4FMQA 2BPMA 2BVAA 1MQ4A 4DTBA 4O83A 3Q52A 4AW0A 1R1WA 1YI3A 3R04A 3QGWA 2WMSA 4FOCA 5BVKA 5CASA 3E8CA 3OP5A 3W0OA 5BVEA 3ZBFA 2CNVA 4NM3A 2GNGA 4EZ3A 3ZMMA 2YDIA 4YZBA 3SRVA 4BF2A 4E3CA 3NUUA 1UWHA 4F09A 1NVSA 4OUCA 3AC8A 2JKKA 2WMWA 3DDQA 4M13A 1CKJA 3U87A 3OC1A 4FSUA 2XRWA 5CXHA 4PDOA 3DAJA 5HNBA 4ANSA 1XH4A 2C1AA 4YLKA 4QQJA 5AWMA 4CCUA 2PVYA 2IEWA 3GQLA 3KKVA 4Y8DA 3QCXA 2VGOA 3R7EA 4FIEA 4XOZA 4CMUA 3IGOA 3BU5A 2X8DA 5LWNA 2XKEA 4KS8A 4M8TA 3UZTA 4JVGA 1FGKA 4M12A 4FTMA 5HI2A 3TV7A 3S1HA 2WU6A 4KABA 3RPYA 3R8PA 2EWAA 1BMKA 3QXOA 3UOHA 4FV2A 3FY0A 3DAEA 3QA0A 4FNXA 5M44A 3KXHA 3LM5A 2VTHA 3PXRA 4ZLZA 5F9EA 4RMZA 2OJGA 3KEXA 2ZDUA 4KD1A 2ITOA 4QMWA 3P23A 4O27B 3B2TA 3QRKA 4FZDB 3PTGA 2QKWB 4TN6A 2WTCA 5EHLA 3VHKA 3PIYA 5ACKA 4ACDA 2PMNX 4EH7A 2YCQA 4OBQA