5DEWA

Crystal structure of pak1 in complex with an inhibitor compound 5
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
DEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Design of Selective PAK1 Inhibitor G-5555: Improving Proper-ties by Employing an Unorthodox Low-pKa Polar Moiety
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5dewA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5dewA01
5HE2A 4MCVA 1UWHA 3FHRA 3F9NA 3FQEA 4AZSA 4BC6A 4DEIA 1UU7A 3GU7A 4EWHA 2IWIA 3D7TB 5EYDA 4TWCA 2VO3A 2YM3A 4QMXA 4DEEA 3MVHA 5CYIA 2UVZA 4DEDA 2RFSA 4H1JA 4AT5A 4C4FA 4CRLA 2G9XA 2YN8A 1OIQA 4CCUA 2QOQA 1YWRA 4HGLA 2O65A 4C4EA 4J1RA 2RSVA 3F6XA 4FVRA 3I5ZA 1H01A 4F6WA 2Z02A 4TYIA 2OF2A 1XQZA 2YITA 4MTAA 1ERKA 3MTFA 5G1XA 5C8MA 4QMLA 3R9HA 4PF4A 4D9UA 4GU6A 3RI1A 2EXCX 3RCJA 4F70A 4U80A 4DINA 2C0OA 3PDTA 1G8SA 3NSZA 2W4KA 5LVPA 5HTIA 2Y6MA 3ZS5A 5AIRA 5CU0A 5IA3A 2WQOA 4L7SA 3ZRMA 2Z7RA 3R7UA 1XH8A 4FKSA 4J98A 4XP2A 3PG3A 3GFEA 5BVKA 3TCPA 4K9YA 3NIZA 3OZ6A 3DXQA 3UDBA 2QO9A 1KV2A 3UODA 5I9ZA 3RAHA 4M3QA 2FYSA 3EWHA 5C01A 2DQ7X 2OGVA 4BTFA 1IAJA 1JWHA 4E4MA 1JLUE 4OAUC 4L67A 4BN1A 4ZMEA 3WF5A 4EZ3A 2I0HA 3UQFA 2UVYA 4KABA 4RIWA 2OWBA 3R63A 1NT2A 3TNWA 3NW6A 3DLSA 3AOXA 4EWQA 4NJ3A 2ZMDA 3QKLA 1P4FA 2QI8A 3HUBA 1FPUA 3ALNA 3R22A 4FYOA 4U81A 5E4HA 2C4GA 1W8CA 4IJ9A 4S32A 2B9FA 3ZM9A 2VNWA 5HNGA 4DAWA 2YM8A 4OTQA 2QR7A 3KFAA 4J53A 4BCIA 1FQ1B 1UKIA 5HLPA 5KMJA 3QUPA 3HA6A 3FE3A 1VYWA 3DDPA 4M8TA 4E26A 3P79A 4RVTA 3TDWA 5JH6A 1PXKA 4FKWA 2BTSA 2XKFA 3EL7A 2PZPA 3I5NA 5AR3A 5FBOA 4DT9A 1MRYA 4MNEB 4NTSA 4R1YA 4YJUA 4FC0A 3U54A 4JAIA 1M2PA 5EW3A 4O27B 3OUKA 1YHSA 4YJSA 3O7LB 2A2AA 5HD7A 3HP5A 4FVQA 1K2PA 3UE4A 4E5WA 1BL6A 4H3PA 3O2MA 4IC8A 4Z9LA 3TACA 3T9TA 4BZNA 3UIXA 5E8YA 1AGWA 1CSNA 2I0EA 3WZUA 2B7AA 3BQRA 3VW8A 4HPTE 4F0FA 5D41A 3TNHA 4OR5A 3C51A 4P2KA 3OWJA 3VBTA 4M14A 3QRUA 3OBGA 3BQCA 3OXTA 2A0CX 4EOJA 3W2QA 3BU6A 4XLIA 3Q96A 3FMEA 4FT3A 4WNPA 3PY1A 3C4FA 4FTMA 3U4WA 2XP2A 3DTCA 2J2IB 1Q8YA 2XM9A 4ZP5A 4EK6A 1H25A 3UC3A 4AP7A 1NY3A 4NIFB 4O1OA 5AAFA 5C4KA 3II5A 4RX7A 4L52A 4PUZA 1ZZLA 4UB7A 3KVXA 3MFSA 4FEQA 4ACHA 2PHKA 3FLQA 3LFBA 2I0VA 3CTJA 5E90A 1SYKA 3AC3A 4YZDA 4C3FA 2BDFA 3L9PA 3VAPA 4KS8A 4OGRA 3V5QA 4AWIA 4R3CA 5M56A 4ERWA 4RWLA 3CD8A 4FNWA 3DXNA 3LHJA 4DFBA 2VRXA 3RPYA 3CKXA 3N4VA 4B0GA 1IEPA 3EQIA 2ITYA 3Q9ZA 3MH2A 3V5TA 1JQHA 3IW4A 3PVBA 5EHYA 5H3QA 3SC1A 4FL1A 5DIAA 4DBXA 3MESA 4WSYA 4PMPA 5M06A 3ZRLA 4E5AX 5LCKA 3K3IA 4RQKA 3P23A 1YI3A 1IASA 4QTDA 4F7SA 2VTPA 3IDCA 2P3GX 1XJDA 1LUFA 3LQ8A 2NRYA 4FG9A 4ONAA 3IQ7A 3DT1A 5KMNA 2WD1A 3L8SA 1Y8YA 4PY1A 3HMNA 1MQBA 1W7HA 2GSFA 3VUIA 4YHJA 3GEQA 2HWPA 4O6EA 4QD6A 4C36A 5E8VA 5KMKA 5L2TA 3QGWA 2ZMCA 2OF4A 4BB4A 4PL3A 1KE9A 1Q3DA 4RIYA 5F95A 5IEXA 2J5FA 4CFFA 5IISA 3KXGA 2IW8A 3AC1A 3WI6A 1OL2A 1YXSA 4FV0A 2PK9A 4GJ3A 4J7BA 3ORPA 2OZAA 3PJ2A 4ID7A 2XJ0A 4MXOA 4E4NA 5CNOA 4CFWA 3QXOA 4EQMA 3SW4A 3RAKA 3QUDA 5EM8A 2ZVAA 1U46A 5BYZA 3EFWA 4W9XA 2G2FA 5AM6A 5JZJA 4ZTHA 3H10A 3NPCA 4G9RA 3LAUA 3QL8A 1J3HA 4AT4A 4DH7A 4OTDA 1OGUA 5IMXA 4V0GB 2WGJA 5CSHA 5IEVA 5CAQA 4LUEA 3I7BA 2J7TA 3K5UA 5FM2A 5AUZA 4BDHA 2WTKC 5EYCA 4MHAA 3PJ1A 4XH6A 2PPQA 3EN4A 2HY0A 2CHLA 5AUVA 1QPJA 3DGKA 2ITQA 3COHA 3NZ0A 4R8QA 1NA7A 2YDIA 3FMJA 2H34A 3FYKX 4ASZA 5AFVA 1M7NA 4KAOA 4X6RA 5IH6A 4E6QA 3PSCA 4BY9E 5H8BA 2G15A 2RF9A 3ELJA 2FH9A 3SRVB 3QYWA 2PVNA 5AP3A 2BFXA 1M2RA 4FX3A 5C1QB 5DG5A 2BRNA 5LMBA 4WBBB 3P86A 3MPAA 4I3ZA 3C9WA 3UMXA 2YM4A 5IA2A 3D5XA 5GZ9A 4E6CA 4EHEA 3UVPA 3KMMA 4X7QA 4AE9A 3VN9A 3VUHA 4PX6A 4AU8A 1PYXA 3VO3A 4AUAA 4XRJA 3SV0A 1CKPA 2J0MB 5CU6A 5HG5A 4PMTA 4DGGA 4GFOA 3NUAA 2UW8A 4XP0A 4CFXA 5KMMA 2I6LA 2VTMA 5IQFA 2C6KA 5E9EA 2PVFA 3FLNC 2QR8A 1RW8A 2C69A 4TTHB 3ZSGA 2PVRA 5I3RA 4QMPA 5K5XA 4QP2A 3VBQA 3TWJA 5IQGA 1OKWA 2NPQA 2CGWA 3D7ZA 2GTMA 3FMDA 4GRBA 4NYEA 3Q3BA 5KKRB 3A7FA 5G6VA 3MH3A 1FGIA 4CFVA 5AR2A 3SGCA 3FLSA 4G17A 4IM0A 4UN0C 3G33A 1M14A 3R7VA 3A7HA 3KCKA 2WQNA 3G90X 5J79A 2OLCA 4L44A 4J8MA 2JC6A 5AX9A 5IQAA 3AMBA 4HW7A 4QYEA 4C4JA 2E9UA 3P7AA 5CI6A 3VUDA 4LI5A 3P0MA 2BAKA 2VGOA 3PVUA 3ZZEA 3TZMA 2E9PA 3Q9XA 4FMQA 5DR2A 3U9NA 5HORA 3HA8A 3MI9A 5JGDA 3DBFA 4J71A 5JGBA 3EQPA 3FMMA 4BYJA 3VNTA 2QQ7A 3KCFA 4NT4A 1PHKA 2AC3A 3MS9A 3N4UA 1YXXA 1Q5KA 4NEUA 5EDPA 3FAAA 4BCNA 1PW2A 2XCKA 4FKUA 4HPUE 4PPBA 2ZV7A 1UWJA 3I60A 3DK3A 3Q4ZA 2WTCA 5KNJA 3FMLA 3OROA 4FTRA 2G01A 5IDPA 3NIEA 1Y6AA 3HP2A 3L9NA 2C30A 2R3LA 1HCKA 3WOWA 3WE8A 5LVOA 1WBWA 2I7QA 3ALOA 4FYNA 4PTEA 3C5UA 5HE3A 4IQ6A 4YR8A 3CE3A 4FF8A 4BDIA 5ANGA 2IVVA 3HV6A 4PDSA 5DN3A 4O0VA 3KXMA 4G3FA 2WMUA 4QP8A 4HVDA 4FNZA 4QPAA 4JBPA 2WIHA 3VBXA 3DPKA 4AW2A 2XYUA 3B8RA 2EXMA 4F9CA 3E7VA 4JR3A 5BVWA 4GUBA 1LR4A 1YOJA 2YAAA 4R6VA 4UBAA 4EI4A 2GQRA 4S2ZA 4D1XA 4G34A 4FTNA 2YHVA 3QD3A 4E7WA 4YNOA 2OG8A 1Y6BA 4FKIA 4JRVA 4KSPA 3VS3A 3BX5A 3CD3A 3ZXZA 4O83A 4RBLA 3F5GA 4EOQA 3UZTA 3ZUUA 3DS6A 3DJ5A 4C35A 4YTIA 4X3FB 2F7ZE 2F57A 4FKLA 5DFPA 3ZLYA 3FEGA 1I44A 2HWOA 3SOAA 1W83A 2EUFB 4EH2A 4DFZE 3HZTA 3QRIA 3HECA 5D9HA 4BBEA 5ITAA 3V5LA 4U3ZA 3PY3A 2HK5A 2YZAA 3KULB 5LMKA 4K1BA 4M97A 3EYHA 4XG8A 5IZFA 2BROA 3BGPA 2C6OA 2UZUE 3E7OA 3VQUA 3ZUTA 2J0LA 4C34A 2BAJA 4C33A 3GCVA 1YDRE 3BBTB 4RC4A 3W2PA 3ZRKA 3G15A 2OFVA 4U43A 2EVAA 3BV3A 4R3RA 3VRZA 1P2AA 3QCQA 3KC3A 4EOPA 2BZKB 1YI4A 5EW9A 3RPSA 1YDTE 1FVRA 5CLPA 4JDHA 4QP6A 4QPMA 4YU2A 4BTJA 1Q8ZA 5AA8A 2UW7A 4U42A 3G6HA 4U3YA 2X6DA 4FIIA 4YNEA 5AEPA 4N6YA 1M2QA 3OD6X 3PE1A 4YJRA 3EMGA 2BUJA 4W4XA 4OW8A 2XM8A 1BMKA 4G9CA 4XG2A 3FL4A 3GCQA 2ZV2A 2R7IA 3QRTA 2PMNX 4R5SA 5FTQA 4D1SA 4L00A 2IJMA 4FTLA 3RINA 3ZFXA 2F2CB 2OJ9A 4NZWB 4V01A 2QKWB 3HRBA 5EM7A 5LARA 1URWA 3O23A 1J7LA 4DA5A 3ZFYA 3RM7A 2YCSA 5H8EA 2VV9A 2YIWA 4IZYA 3ZDIA 5CU3A 5BVEA 5I9XA 3H4JA 4LV8A 4XV2A 4YO4A 3E8NA 3NRMA 1O6YA 3GCPA 4MWIA 3MB7A 4YZNA 4G31A 3DCVA 4IAAA 5FEQA 4MVFA 5FGKA 5FP5A 4BI2A 4FIFA 4KBAA 3QRJA 4RIOA 3RBWA 1CKJA 3DBQA 5CI7A 3DK7A 4ANSA 4MWHA 2Z60A 3PXFA 4CNHA 4FOCA 3DY7A 4F99A 3IONA 2GQGA 3VIDA 2EB2A 4AOJA 4BCGA 3H0YA 4PDOA 3U9CA 4YJVA 4RVLA 2GNGA 4BDDA 3GU5A 3KRJA 4AZWA 1TVOA 4E93A 2Y0AA 3VS1A 4C2WA 1H1SA 1OI9A 3ULZA 3OW3A 4A9UA 4A9RA 5KBRA 4O7NA 2O8YA 3ZFMA 2QU5A 1DI9A 4FTAA 2UZWE 4H3QA 3V8TA 4I24A 4IB1A 3EJ1A 4M69A 1GIHA 3EQGA 4F08A 4FNXA 2PVMA 5F4NA 2C6LA 1KE5A 1KOAA 2WEVA 2C0IA 4PPAA 2ITZA 4U8ZA 5CXZA 4EUTA 3SG8A 4TXCA 4RLKA 1OB3A 3KREA 2ZV8A 3I0QA 4CQGA 4YMJA 4AZFA 3QZGA 2YWPA 3E62A 4FZDB 1V1KA 3MSSA 4MK0A 3QF9A 5DPVA 2C6TA 3LCOA 2OIBA 1ZXEA 1OPJA 3AT2A 4IADA 5HIDA 3JVRA 5IQIA 4NW6A 4BWXA 4WRSA 4CV8A 1WBTA 4UY9A 4XOYA 5IH4A 5HG8A 3PJCA 1P5EA 5A9UA 3K2LA 2DYLA 3W2SA 4U41A 3FY0A 2PMOX 2O64A 3CJGA 4O0WA 3JPVA 5M08A 3DFCB 2QHNA 2HIWA 2VTRA 3MV5A 3RPVA 4CTBA 3OG7A 5EKNA 3GT8A 4KRDA 3SXFA 3ZONA 2QCSA 4P5ZA 4MQ1A 5JGAA 2PULA 1OPKA 3G0EA 2V7OA 1LP4A 4IM3A 3VUKA 3QTZA 4ZZOA 2C0TA 1PYEA 4D5HA 5JQ8A 3JS2A 2OIDA 2Y4IB 2BZJA 3KRXA 4IACA 5BPYA 1YHVA 1BKXA 5HBEA 4IB0A 3NUNA 4TWPA 2UW3A 1J1CA 3NAYA 2RIOA 5IA4A 3OWKA 4YLKA 1KV1A 3HEGA 3RK7A 4D5KA 5CEKA 3OCSA 4DHFA 3QTWA 4I23A 2QOHA 3FXZA 2YFXA 4BL1A 3EQFA 4ZXTA 2CKPA 4F64A 2VWVA 4D0WA 2R5TA 3RMFA 2CLXA 5HG9A 3R7EA 3DKFA 3Q6UA 2C5NA 4CFUA 5A4LA 2XH5A 3TT0A 3VC4A 4O1PA 4L53A 3TM0A 3KXZA 5KBQA 3RNIA 2XEZA 4U97A 2X4ZA 3QQHA 1JPAA 4EUUA 1ZARA 3FSKA 3Q60A 4ZSEA 4H36A 3V04A 3EKKA 5GHVA 3ZEPA 4GH2A 4BGHA 5IU2A 4GFMA 2R3OA 3Q5ZA 5DR6A 5FLFA 3G2FA 5B7VA 4AZEA 4OBOA 2ZB0A 3NMUF 3LM5A 4GT4A 2GS2A 4G5JA 5L2IA 2JDSA 4EHZA 2OI4X 4FIHA 2PUUA 4YHFA 2CCIA 1QCFA 2FGIA 4YJOA 4ZTSA 1PMUA 3NX8A 3U6HA 2B9IA 2BR1A 4KA3A 5HE1A 4PWNA 4JG8A 3NEWA 3IW8A 3D7TA 2WMXA 3QALE 4DH1A 3MPMA 3N4TA 4PMMA 3F3WA 3HLLA 4ZS0A 2XJ1A 3QHRA 4ZJVA 4J95A 2YWVA 4A9YA 1BUHA 3R9DA 5L2SA 5CVGA 4K8AA 5HTBA 4M7IA 3ATTA 1CKIA 2R2PA 5GJGA 2WMQA 4KD1A 3S4QA 4DGNA 2UW5A 5HLNA 4FTOA 4O84A 1IR3A 4FTCA 4U0IA 4RFZA 3P7CA 4GCJA 4F1OA 2ITNA 5LWNA 4ANOA 4FV4A 5LXMA 2XYNA 1YRPA 1YVJA 3RNYA 3HMMA 5IKWA 4JI9A 5LMAA 3F69A 5I3OA 4CLJA 1JBPE 3W1FA 4Z3VA 4FT7A 3POZA 3QD2B 3HL7A 3UP2A 2PMIA 4Y85A 3UG2A 2Q0BA 4A4OA 1O9UA 3I0OA 5EG3A 1A48A 4TYHB 3OHTA 4U5JA 5CASA 4F7LA 3FZ1A 4YJQA 2P2IA 3BLQA 3NCZA 4L9IA 4L3JA 2W05A 4XG7A 4EOSA 5FDXA 5KE0A 3WZDA 3CEKA 3PSDA 3ZH8A 3PA5A 5GZ8A 2OICA 2QVSE 3D5UA 1KE7A 2QNJA 3R01A 2NRUA 1XBAA 3MY1A 4B6LA 4BIBA 4FTTA 5ACBC 3UYTA 4ANMA 3MVMA 5J5TA 3MTLA 1PXPA 2CNQA 3D5VA 3DNEA 4O0SA 1PXLA 2VUWA 2PZIA 2XK3A 3GBZA 2YERA 2V62A 3GC7A 3JXWA 4I6HA 3POOA 4IM2A 4TYJA 3OXZA 4UEUA 5TT7A 3QXPA 3SOCA 4ZLOA 5ETIA 1LEWA 1YQJA 5CVFA 3Q9YA 3OY3A 4I93A 4L68A 5EDQA 5KKRC 5AR4A 5BUEA 4F9BA 2WOUA 4QMQA 1OIRA 5HIEA 3M1SA 4GU9A 2FSMX 4QO9A 3SQQA 4A06A 5CAUA 3F5XA 3D9VA 3HNGA 5E8TA 5TO8A 3VQHA 2O5KA 3S1HA 3U55A 3B2TA 4C3PA 2BALA 1EH4A 1G5SA 4MNEA 2C68A 3ZUVA 4ANLA 4IH8A 4FTQA 3TZ9A 4FTJA 3I6WA 5DRBA 3T9IA 5KO1A 4XCUA 3F2RA 4XG4A 1BI7A 5FBNC 2JAMA 2GNHA 2CGXA 4G2FA 4QTBA 2PZRA 5BMMA 2Z2WA 4I22A 4D2SA 4X2NA 4YC8A 3BELA 2Z7LA 3FQHA 4ZSGA 5FP6A 3ENMA 4IXPA 2OBJA 3NNVA 3R2YA 4Z16A 5GINE 3R7IA 5KX8A 2LGCA 3PYYA 3NUUA 2UZVA 2QHMA 3F2NA 5F1ZA 4FUYA 3IDBA 4RIXA 4EJNA 2J51A 3OT8A 3QCXA 4IWDA 5HG7A 2H96A 4LYNA 2QKRA 4UALA 2XKDA 4LQMA 3Q4UA 3UIMA 4AG8A 4YJNA 4YP8A 3EH9A 4NIFA 3VJNA 5DMZA 3MFTA 1UV5A 3I79A 3TEIA 4G16A 2BRBA 2R3NA 1OL5A 4P90A 3TNQB 4UZHA 4DFNA 5IF1A 4WOVA 4MXAA 4RSSA 4IMYA 4F09A 3IG7A 3E3PA 2PVYA 4D4RA 2VTAA 4KUJA 3GENA 5HU3A 3NLBA 3W8LA 2UW0A 3QZIA 5E8WA 1R39A 5BNJA 3ID6C 2W7XA 4AT3A 3TNPC 4FSRA 4BDEA 3QA0A 5FTGA 2R3JA 4F0IA 4HGSA 5LQFA 4O0UA 5A46A 2PMLX 4FZ6A 3RKBA 2OJFE 4W4WA 2WOTA 5B2LA 4YSMA 4CFMA 4JG6A 3GQLA 5AUUA 3AG9A 1YXUA 4OTIA 4D2TA 2C5XA 4A7CA 2YCFA 3LFSA 5IG1A 1ZZ2A 2YAKA 3QC9A 2J0KA 3WYXA 3LVPA 3UNJA 3OCBA 3Q04A 3GB2A 3AMAA 5HICA 3FKNA 4GYGA 1CDKA 3LFAA 3EQRA 4JRNA 5IQEA 3BHVA 4BBFA 3LKMA 4EOMA 2IZUA 4EHVA 3EHAA 5HO6A 3OC1A 1K9AA 4ZAUA 3VUGA 4CMOA 1G3NA 3QKKA 1GZNA 4K11A 3E5AA 3RGFA 3H9RA 4QYHA 4HZRA 2VWWA 4CG9A 3E8CA 3Q2MA 5HEZA 5A4EA 5I9WA 3B8QA 3IS5A 3HV7A 3FHIA 5HNIX 4RZWA 1SM2A 4H58A 4BDCA 4RLLA 4G3CA 4QPSA 5AWMA 1UNLA 5M4CA 4GIHA 3UPXA 4HVGA 4R1VA 4RWKA 5FD2A 5HGIA 4O7RA 2ZDTA 3Q9WA 4EORA 1FMOE 4IAIA 4IEBA 3OCGA 2W9ZB 4JS8A 3RCDA 4APCA 4B99A 1UVRA 4YPSA 4EH4A 4MBIA 4C2VA 3AT4A 3RK5A 1WBNA 2RG5A 4O82A 5TKDA 4YZMA 5EDRA 4F1TA 1YXTA 3DA6A 2ZV9A 4OT5A 5ANKA 3EZRA 4XEYA 2VWXA 5HESA 3UQCA 4XLVA 2YLFA 3OXIA 5LWMA 1ZMUA 4C4IA 1BI8A 4KIQA 5B0XA 5ETAA 2HZIA 3BHUA 4ZSAA 3RHXA 4DBNA 2AC5A 1OPLA 2YDKA 2VTJA 3BEGA 3KGAA 2J50A 2WMVA 5DOSA 3SRVA 3VVHA 2WMRA 5CY3A 4AN2A 4JDKA 2CN5A 4V05A 2WQMA 5AP2A 4F9AA 4FV9A 3PP0A 5E8UA 4ITIA 4I4FA 2UVXA 4YLLA 2WTDA 3LW0A 4O7VA 3F3UA 4PTGA 3HRFA 2WNTA 4WNOA 1GOLA 2ITUA 2CKEA 5DT4A 3DTWA 3FY2A 1T46A 4DYMA 5KMOA 3VHKA 4ZS4A 2I40A 1STCE 5JZNA 3HDMA 3PXRA 1BX6A 2RFDA 5DT3A 3TJDA 1OKVA 1V0BA 5KHXA 4LM5A 4L6QA 4C38A 5TR6A 3K3JA 2QONA 3JUHA 4FBXA 3KN5A 4YLJA 4HOKA 5LVNA 4I0RA 3ORIA 4AN3A 1R1WA 3CBLA 1SVHA 5A4TA 2W9FB 5C8KA 2CPKE 3CJFA 2C3LA 1O6LA 1UU9A 2GCDA 5E7RA 3ZXTA 3R28A 4B9DA 5K3YA 2A19B 2VWZA 3KRRA 5CXHA 4AZVA 4LFIA 4L01A 5A6OA 4PDYA 4NTTA 3UOJA 4PNKA 4RFMA 4W4YA 2W0JA 1YOLA 2J5EA 4Y73A 2XB7A 5K4IA 3ZBXA 3GOPA 3EKNA 3FMKA 4ASXA 5EI2A 2BTRA 4HGTA 3ZO2A 4CVAA 4N4SA 1W82A 4NJDA 5A4QA 3OUNB 4FNYA 4D2WA 4QMWA 5CU2A 2G1TA 4FV3A 1AQ1A 5A4CA 2VX3A 4I0SA 2WPAA 5LMKC 4XS2A 3LMHA 2KTYA 2FSLX 4GS6A 4MKCA 2G2HA 3MJ1A 3OTVA 4CMUA 4FEWA 3HYHA 3F3ZA 3QAME 4DN5A 4NM3A 5TOZA 3ZDUA 4GK4A 3E63A 4XX9A 4E6DA 1JKSA 4RX9A 4EKLA 1IG1A 1YDSE 3WARA 1QPEA 3FXXA 3TJCA 2GHLA 3Q5IA 4F7NA 3S3IA 4UMRA 1CMKE 4FZ7A 5IA5A 3MY0A 3EN7A 5EI8A 5C9CA 3P9JA 2UUEA 5TE0A 3R6XA 4ANNA 4GYIA 5CWZA 4II5A 4X2JA 5AV4A 5AUYA 3W2CA 2CDZA 1E1VA 1XH9A 2CNUA 3A8WA 3EFKA 5FQDC 5EI6A 1PXOA 5AP7A 3B2WA 5DNRA 2OH4A 4MAOA 4YZ9A 2W4JA 4O21A 1H27A 4W8EA 1OZ1A 3EZVA 5FDPA 5CNNA 3R9RA 4EH6A 4S34A 5AUTA 3LFNA 5I5ZA 2C1AA 5JK3A 3FKLA 4J96A 1OL1A 1YWNA 2OW3A 5CX9A 4UWYA 5CF6A 4U9AA 2EXEA 3V5JA 2JFLA 4ZY4A 1XH4A 4F1MA 3IW7A 3ZBFA 3PVGA 3Q2JA 3UO5A 4MD8E 2JKMA 4O7SA 2HXQA 4JBOA 3PZHA 5DT0A 4HCUA 4UX9A 3R2BA 3BI6A 5HCXA 4AACA 4AS0A 4N57A 2WB8A 1OKYA 4JOAA 2OIQA 4GFGA 4X3FA 4MD7E 3PY0A 4IVAA 3KF7A 3R8LA 2ERZE 3UQGA 5BMSA 5AR8A 4YTCA 3GC0A 2FSOX 2VNYA 3BYMA 4Y83A 2BVAA 3AD5A 2IZRA 4FUXA 2XJ2A 4X0MA 3IGOA 2HENA 3KULA 3W2RA 4QTEA 4D2VA 4AGUA 3H3CA 2UZBA 3QWJA 4TKSA 3MH1A 2WMSA 2YA9A 4MBLA 4XBRA 5LVLA 2P55A 5AAGA 2B9HA 3QX4A 4EYMA 2JDOA 4ANQA 5HX8A 5AP0A 4R5YA 3QTXA 1TQIA 3BKBA 3PJ8A 2J9MA 1OECA 5AIKA 3QZHA 3RPOA 1YWVA 1Y91A 4FTUA 3DOGA 3WZJA 2V0DA 4CSVA 3VWAA 3QTSA 3D2IA 4EH5A 4BZDA 1OVEA 3SA0A 4DITA 3ET7A 5C27A 3JR1A 4CT1A 3SVVA 5JEBA 5C4LA 4AX8A 1PXIA 4NM7A 4WKQA 4C59A 2WMWA 4BCPA 4C61A 3FC2A 1H0VA 2B4SB 3QTQA 4NM0A 4UYAA 2ITXA 3E87A 4I4EA 3DLZA 4FK3A 4FSQA 1ND4A 4RX8A 1YI6A 5KZ0A 2A27A 4AN9A 4ORKA 4QMYA 3ZC6A 4OTPA 2IZTA 3R9OA 1URCA 2HELA 4WG4A 4DEHA 3OOGA 2R3GA 4CEGA 3PUPA 5DA3A 4HVIA 2ITVA 3UJGA 4TYGA 1ZRZA 3QBNA 4AXAA 4NCTA 5EQEA 3FI2A 3NDMA 1F0QA 3NYXA 5IQHA 3EQBA 2R3PA 5GIOE 3ODZX 4G6OA 2CCHA 2ITPA 4JQ7A 5EFQA 3A60A 2NO3A 3BYSA 5AV3A 4E20A 3GU8A 3A7GA 1YKRA 4GG5A 2VX0A 4QQJA 4AOTA 5CU4A 2C6EA 3TTJA 4JIKA 4KIKB 4D58A 4C37A 4LGDA 3ETAA 4UMUA 3O50A 5BVOA 2VAGA 4P7EA 2C6DA 4QP9A 4YZBA 5CAPA 5EQYA 2WQEA 4O0RA 1GAGA 2P4IA 2BZIB 4FVPA 2YIQA 4U45A 3T8OA 2B9JA 1SNUA 4GL9A 4KKGA 4BZOA 3MDYA 4QNYA 1Q62A 2RFEA 1DAWA 4JJRA 2CGUA 3O96A 2AUHA 4I5CA 2VWIA 4LGHA 3UO6A 4BWKA 1FINA 2OZAB 3HV3A 4ZLYA 5L6WL 3KB7A 3ORZA 5DE2A 2YCQA 2WZJA 1OL7A 4IAKA 4GSBA 4J97A 4DTAA 1MRVA 3C1XA 4XRLA 4BI1A 2PY3A 3LLAA 5CAOA 1A06A 4I1ZA 4QMUA 1VR2A 4FZAB 4BCFA 4I5MA 4XV9A 4PP9A 5I9UA 4HGEA 3ENHA 3RK9A 4C4GA 1G8AA 2FA2A 2WQBA 2ZM3A 5CZHA 4ALUA 4X21A 2VTSA 4FOBA 3FZPA 4IAYA 3L1SA 4NWMA 4BHNA 3R7OA 4JDJA 3UC4A 4D2PA 5JRSA 3MN3A 3OY1A 3VW6A 3R00A 1BL7A 2OZOA 4XOZA 2R0IA 4FK6A 4MYGA 3FXWA 3PA3A 4ARKA 4BBMA 4BKYA 4EEVA 2EWAA 5DYJA 3ROCA 4D2RA 4LRJA 2EB3A 3C0GA 3CQWA 1SZMA 4I21A 1XKKA 4IZ7A 2IPXA 2CGVA 3AC2A 4M12A 4QMZA 3IW5A 5GJDA 3O8UA 5M53A 2YJSA 5CSPA 4FTIA 1M7QA 2R3QA 4R7BA 3C7QA 1J7UA 2QD9A 3ACJA 1JSUA 3PIYA 3RM6A 3SDJA 2XZSA 3R0TA 3DXPA 3ZO3A 4DEBA 2PVLA 5EYKA 4DTBA 4O22A 4IX4A 3O17A 2W4OA 3HGKA 3V5PA 4UWCA 3SD0A 4EBVA 5M55A 4Y5HA 1H1PA 5IPJA 4TN6A 2X9FA 5J7BA 3L9MA 5DLSA 3TV7A 3MVLA 4K77A 4YHTA 4EZ5A 4NL0A 3ORTA 4PL4A 4NFMA 1Q4LA 2GDOA 1J1BA 2RKUA 2XK7A 1REJA 3E88A 4NM5A 3UVQA 3UZRA 3NVMB 4TW9A 2W1DA 3FLYA 3I7CA 4BIDA 4I94A 3R7YA 3UVRA 4BGGA 3PXQA 2B0QA 2W5BA 4BDGA 2PZ5A 3GCUA 3R8VA 4OTFA 3IPHA 2PYWA 3TXOA 1UKHA 5FM3A 4IWPA 3DK6A 5EKOA 4AA4A 4QMSA 3UG1A 4U79A 3D14A 2UZTA 3EB0A 3PSBA 5JMSA 2HZNA 3FKOA 2G2IA 4MF0A 3MIYA 5BVFA 2XS0A 5DR9A 4RMZA 2JIVA 2VTNA 4QP7A 1ZYDA 4NK9A 4Q9ZA 4M66A 2R64A 2XK4A 3OTUA 2Y6OA 5LCJA 4UWBA 3VS6A 3OWLA 2B52A 2IVSA 3GI3A 4X2GA 1FVTA 3VF9A 5CF5A 2YM7A 4BGQA 5JFWA 4FV2A 3SW7A 2OJIA 3QD0A 4J52A 1ZMWA 3QQJA 5HVKA 4O86A 3QQGA 5EYMA 4A4LA 4JBVA 3FYJX 3KVWA 4USDA 5DEWA 3U51A 1GIIA 1KE8A 2ERKA 2OXXA 3BHTA 2YIYA 1JNKA 1YOMA 4USEA 4KNBA 4P5QA 3G6GA 2GU8A 1U59A 1H0WA 3UNZA 2PVKA 2VWYA 2PE2A 3KEXA 2J90A 4IX5A 2J0IA 3FI8A 4PV0A 4H3BA 3FSFA 3TUDA 2GFSA 4EJ7A 3A62A 4WNKA 1XO2B 3PXKA 4QMMA 3N9XA 4RFYA 4DGMA 4EOLA 3UP7A 3NYNA 3QYZA 4MX9A 4TYHA 5AR7A 2HW6A 2X7FA 3DZQA 4IWOA 1XH5A 4YZCA 3UGCA 1ZMVA 2OJJA 1B38A 5DRDA 4DH8A 4ZSJA 5D7AA 2IVUA 4FI1A 3GCSA 4BF2A 3C0HA 1QPCA 3WZEA 3U6IA 1OBDA 4NKAA 3EQDA 2V7AA 3EQHA 5KCVA 3NW5A 5CT0A 3GP0A 4LL0A 4BDFA 2SRCA 2W5HA 3R8UA 2YISA 4C0TA 4I6QA 4ZY6A 3NNXA 1ZYJA 3OMVA 5IUIA 3AGLA 4EC9A 5CEPA 2VN9A 1WVXA 1H1RA 3KK8A 5AP1A 3V3VA 2ZM1A 5E8SA 4OT6A 3GOKA 4IIRA 1Q8TA 2C6IA 4YC3A 4MXYA 4K33A 4QP3A 4FSYA 5J9LA 2Y9QA 4Q5HA 4DFLA 4DG0E 2YIRA 3PRFA 4WHZA 2XKEA 3CKWA 4YJTA 1WBSA 2BZHB 2ETMA 3PPJA 3PXYA 4E3CA 2H9VA 3HDNA 3QGYA 3TNIA 4FG7A 5DEYA 4P4CA 4O7TA 5H9BA 3IO7A 5T6KA 3V6RA 5IMEA 3ORLA 3VBWA 2BDJA 4E8AA 4IC7A 2JIIA 3PE2A 3TZ7A 5IA1A 5HHWA 3COMA 2O2UA 3H30A 4HYIA 4XJ0A 5D7VA 4OAVB 1FOTA 4ZJIA 2QO2A 4G6NA 3P1AA 2DWBA 4DE4A 2I1MA 3UNKA 4F9WA 2VO6A 4O0YA 4KINA 4XYFA 3QC4A 5HO7A 3PZEA 4G1WA 4JXFA 3DZOA 4G3GA 1Q41A 2PUIA 4UYNA 3GNIB 2X9EA 5F9EA 2BIYA 2C1BA 1SNXA 4ZTMA 3LJ0A 1H24A 3AC4A 5HOAA 4OTWA 2PL0A 4J8NA 4DG2E 4R77A 4A9TA 3K54A 3HUCA 3PLSA 3RP9A 1PRYA 4QTCA 5EOLA 4FSTA 4L46A 4DF3A 4MQ2A 1KE6A 1H4LA 3UIUA 5FXSA 2JKQA 2X1NA 3V5WA 2Z7QA 4S31A 1S9JA 2XNEA 2JAVA 2WTKB 5GIPE 1H8FA 3WIKA 4EQCA 5K9IA 4ZTNA 3QRKA 4JLCA 2W96B 1H1QA 3ERKA 3R1QA 4I92A 3ZMMA 5M51A 3WE4A 4Y72A 3HX4A 3VUTA 2YM6A 3TG1A 4BI0A 4EZ7A 3ZLSA 3WZKA 3LLTA 2DUVA 2Y7JA 4QMVA 1H00A 2XKCA 1T45A 1JKKA 3E64A 2GNLA 1YHWA 2XBJA 3M11A 3FC1X 4FKOA 3CR0A 1DS5A 2VTTA 1M17A 2VU3A 3DBEA 2RL5A 3IDPA 4RJ5A 1XH6A 4ZTQA 3ZU7A 4RX5A 3LXPA 3LFFA 1HCLA 2BKZA 4XMOA 4AW5A 2B54A 4PTCA 2QODA 3QX2A 4C62A 2QOOA 1AD5A 3C4XA 3REPA 4FA2A 5IUHA 2E9OA 3KKVA 1E1XA 5IDNA 1U5RA 3DKCA 3PVWA 4HYSA 2R7BA 3LIJA 5K0KA 2HZ4A 3C50A 3CXWA 4DCEA 3FZOA 3OP5A 2LAVA 5IA0A 5KMLA 4DG3E 2W1GA 3BLRA 4M0YA 1TKIA 4LV5A 3UOKA 4C4HA 1RJBA 3FWQA 4GW8A 3ZO4A 4L3LA 4IDTA 3SLSA 3ODYX 4AA0A 2F7XE 3QCYA 1OKZA 5E1EA 4FR4A 2WFYA 1WVYA 2WTJA 2UZLA 4BCQA 4BWPA 1PJKA 2OO8X 2X81A 3DU8A 5HVJA 3RVGA 4CZUA 3CC6A 4HJOA 4GVJA 3TZ8A 1JKLA 3QQUA 4LOOA 5ETCA 3FZSA 2BRGA 4ERKA 1BYGA 2XIYA 3KL8A 4BDBA 3CPCA 5KMIA 3LQ3A 1OM1A 3MGYA 3WILA 5CEMA 3FI4A 1APME 2WMTA 2A4LA 5CTPA 2WTWA 2BFYA 3Q32A 1RE8A 4E1ZA 1E9HA 5L8KA 2WEIA 3S0OA 3VUMA 4ITHA 1P14A 2CJMA 4ACCA 1PMEA 2XIZA 4B8MA 4E5BA 3QTRA 4YTFA 2BAQA 4QMTA 1V0OA 4AAAA 4W9WA 1WZYA 2VX1A 5I9YA 3OWPA 3C13A 3G5DA 2HAKA 2E2BA 3UIBA 3IECA 5E91A 4WG3A 2X6EA 4AE6A 3RJCA 3KMUA 4ZK5A 3MBLA 4BDKA 3LXLA 4DFXE 2RFNA 5JKGA 4YGAA 1IRKA 2F2UA 3BBWA 4CLIA 5IH5A 4FSUA 4JNWA 1IA9A 4FGBA 1O6KA 2XIXA 2UZEA 5L2WA 4I0TA 4MD9E 1PF8A 2HW7A 4UXLA 5AADA 2XRUA 1ZOGA 4OLIA 3Q52A 4ZZNA 5C26A 3CGFA 4IVDA 4QMOA 4RJ6A 1VZOA 3R9NA 3AD4A 4EK5A 3NUXA 4OBQA 1UA2A 1NXKA 1UNHA 3GQIA 1GJOA 4WBOA 3OEFX 2VWBA 4RJ3A 3VJOA 2JDRA 1S9IA 3DB8A 4GJ2A 4F9YA 3SXRA 4QYFA 3FLZA 3O71A 2WTIA 2ITTA 3K5VA 4TWNA 4DCAA 5J9ZA 5BUIA 5CANA 4IVCA 3LXNA 4NFNA 3CGOA 4C7TA 3DJ6A 3PXZA 3NUPA 4YTHA 3DKGA 3NUYA 3FZRA 4F63A 4PRJA 3U6JA 2CMWA 4NH1A 1MP8A 3AXWA 2QC6A 4U7ZA 4BICA 5LJJA 2XVDA 4LUDA 3COIA 4BHZA 5CEOA 2X2MA 3TKUA 4XG9A 3A4PA 4ZJJA 1KSWA 1ZWSA 5CSVA 3QQKA 1Q97A 4DGOA 3W55A 4OUCA 4ENYA 2GQSA 4X6QC 3GGFA 4X3FC 3MJ2A 4UXQA 3WF8A 1R0EA 2XEYA 5HIBA 4O7WA 2GS7A 4WD5A 5KZIA 4S33A 4M67A 4BDJA 3PPKA 2XNMA 2V55A 2XIKA 2PWLA 4UMQA 3LCSA 5E92A 2A1AB 3DNDA 3DDQA 4N70A 5JFVA 1GZOA 4IZAA 3NR9A 3SXSA 5B2KA 4L45A 3SKCA 4BCHA 2XRWA 3CQEA 3I81A 1U54B 4XG6A 4AZTA 5AUWA 4FT9A 3ROYA 2P33A 2PTKA 4IHPA 4BCJA 3PIZA 1W0XC 3VBVA 2JIUA 3UYSA 4Y8DA 4KS7A 2O3PA 3GU4A 1PKGA 3FL5A 5CT7A 3LE6A 3DAKA 3LFCA 2BRHA 3KQ7A 3HMPA 2XK9A 4LGGA 4CYJA 4PL5A 1J7IA 4RVMA 3ORXA 5J7HA 4M13A 3I4BA 2IO6A 2E9VA 3C4CA 3QD4A 3S00A 3W32A 4WUNA 1NVRA 1H26A 1OL6A 1ZYSA 3F88A 3CS9A 4FL2A 4FV7A 1R0PA 3MB6A 4IANA 2W1IA 4V0GA 2JEDA 3D5WA 2UZOA 3LMGA 1OMWA 2PUNA 4H05A 1NVSA 1F3MC 2R3IA 5J8IA 4FV1A 3W18A 1Z9XA 5HO8A 1PMNA 3BHYA 3CSVA 4AW0A 1YW2A 5HE0A 4KBCA 2OK1A 4E6AA 5HZNA 2R4BA 3RAIA 4Q9SA 3WIGA 4FKPA 1ZOEA 4EQUA 2PE1A 2I0YA 2QOBA 4FL3A 4BRXA 2CKQA 1YXVA 5D11A 5GZAA 4WO5A 3R8MA 2F49A 4NCTC 4EL9A 4IAZA 4K0YA 3GU6A 4GVAA 4UMTA 2C3KA 3KA0A 3GVUA 5D1JA 4FICA 4HVHA 2QURA 4RT7A 3R83A 3LFEA 3U87A 4BCMA 4JR7A 5ANEA 2HY81 3TV6A 4L43A 1Q61A 4O7ZA 5AP6A 2ACXA 2C5OA 2QU6A 4EOIA 2ETKA 4UMPA 4MNFA 4BCKA 1JVPP 5HU9A 2YEXA 3FLWA 5M07A 2IG7A 4CFNA 4FV6A 4YBJA 4I6FA 3BYVA 3W2OA 5LVMA 2KULA 3MWUA 2VTOA 4APPA 3ZSIA 3R7GA 5CQWA 5ICPA 4N6ZA 3E8DA 1WAKA 5J1VA 4H39A 3THBA 2ETRA 5ETFA 5DHJA 4RIXB 1OBGA 4CGAA 1Q24A 5FRIA 3RZBA 3QQFA 2XF0A 3W33A 3KXHA 3F7WA 4IB5A 4RWJA 3DBCA 4ACMA 5C8NA 4RG0A 4PP7A 4CKRA 1A9UA 3A99A 5L8LA 3EFJA 4JG7A 4I5PA 5HTCA 2JD5A 4D0XA 1V0PA 4TRLA 3ITZA 1P4OA 1XBBA 3F5PA 1FMKA 5AV1A 5A6NA 4FKGA 2XNNA 4LMNA 4XNEA 4MH7A 2HYYA 1FBNA 3DAEA 1OIYA 1PXMA 4ZLZA 4TL0A 3PG1A 3VS7A 1MUOA 4ZTLA 4EH9A 3DFAA 2QLUA 3MFUA 3GXLA 4G6LA 1WCCA 4U44A 4M0ZA 4XUFA 3R21A 4CV9A 1Q8UA 3EN6A 3NVKI 3CLYA 3MA6A 5EH0A 1M52A 2JGZA 5FEDA 3BE9A 3N51A 3ULIA 5CENA 3L8VA 5J95A 3ZM4A 3CP9A 3MIAA 1WMKA 2VD5A 4D1ZA 5A54A 2Y4IC 4D4SA 3KMWA 4IW0A 2W1FA 2OXDA 3G9NA 4FIJA 3QWKA 2VO0A 3KRWA 1XBCA 5DGZA 5IQDA 4K6ZA 4TT7A 4DH3A 2WKMA 3HKOA 2QOCA 3A4OX 4R7HA 3SG9A 2IN6A 3AC5A 5DH3A 4R78A 4ITJA 3ZTXA 4FZFB 4B4LA 4FT0A 4KIKA 3DBDA 5CF8A 2ONLC 3IGGA 3ZZWA 2NNWB 2F4JA 2GNFA 3TN8A 2QG7A 4RJ7A 3QA8A 2R3KA 4FG8A 3ATSA 4EH3A 4O6LA 1K3AA 4RIWB 3H9FA 4FKVA 4CG8A 4DLJA 3ZSHA 3P08A 5HBHA 3LOKA 1JSVA 3C4EA 3C5IA 2QOLA 2XK8A 3O8PA 2ZAZA 1B6CB 1GZ8A 1GZKA 3E92A 4XHKB 4PQNA 1TQPA 3V01A 1CTPE 1L3RE 2Z7SA 3GFWA 2WIPA 4CTCA 4AFJA 3IK3A 4EKKA 3A2CA 4IVBA 3ZEWA 4C57A 4GKIA 3MH0A 2REIA 5HD4A 2FUMA 3MA3A 1XH7A 2X2LA 4A4XA 1VJYA 2F7EE 3DQWA 2B55A 2ITOA 4IJPA 4Q2AA 3NGAA 2XUUA 3UTOA 4L7FA 3NS9A 4I5HA 4CQEA 4DH5A 2BPMA 3CPBA 3QCSA 3IW6A 1LPUA 3VF8A 1SVEA 3TIYA 5CEIA 4RJ4A 3FV8A 4F6UA 5CF4A 5EW8A 1UNGA 1WBPA 3F5UA 3R04A 4BIEA 3PPZA 4X2FA 5M09A 3OS3A 2O63A 2X7GA 3KXXA 3O7LD 4CKIA 3MFRA 5K5NA 1Y8GA 4B7TA 2C5VA 3LXKA 4I20A 1ZY4A 2C47A 4O2PA 4TNDA 4QQTA 2UW4A 1Z5MA 1BLXA 3LPBA 1B39A 1DM2A 5HCYA 3FPMA 2XNPA 2GPHA 3RHKA 1UU3A 3FQSA 3QU0A 3UMWA 3TV4A 3HAMA 4EHGA 4PDPA 2YZLA 5IEYA 5AA9A 4F6SA 3ORNA 3DV3A 2BKKA 3G9LX 5HBJA 4U40A 1IAHA 1ZOHA 2JBOA 4KKEA 4LOPA 2QOKA 3BHHA 4A9SA 1DAYA 2UZNA 3EIDA 4EOOA 3CQUA 4Z7GA 5FXQA 4FSNA 2X8IA 4RWIA 4FKRA 2PUPA 5GJFA 3FDNA 3L8PA 3ANRA 3ORMA 2FB8A 4YC6A 3SHEA 4IB3A 3LCKA 2YACA 3QKMA 4L3PA 4WA9A 2YDJA 4Z7HA 3WYYA 5F20A 3VS5A 4YBKA 4BFMA 4GEOA 4RJ8A 2R0UA 3RPRA 3TL8A 4CYIA 4EH8A 4QT1A 2GHGA 4O0TA 3L8XA 3F2AA 2XCHA 4JDIA 4YSJA 3HVCA 4Y46A 3W16A 1RQQA 2W99B 3BU5A 3PWDA 4XP3A 4D9TA 4D4YA 4DTKA 4K18A 5DBXA 5BVNA 4YPDA 2GTNA 1W98A 3E3BX 4LL5A 2W1CA 1H28A 4KBKA 3RAWA 1FVVA 1ZYCA 2GNIA 4ZY5A 4FSWA 3KN6A 1OIUA 3UOLA 5FUTA 2O0UA 3ZO1A 4CT2A 2UV2A 4RC3A 5A14A 4JX7A 2QLQA 4JQ8A 1Q8WA 3I1AA 3D0EA 4RPVA 1I09A 5HNBA 4ACGA 4NSTA 4WRGA 5M4UA 2WU6A 3VS4A 3FPQA 4IAFA 4BYIA 1PXNA 1OUYA 2PVHA 2ZOQA 4KIOA 5I4NA 2WU7A 2QG5A 2PVJA 4IFCA 2CN8A 3SX9A 1Q99A 3F61A 4XV1A 2X0GA 4O0XA 3CY3A 5EM6A 4RIYB 4S30A 3D4QA 3QHWA 2QO7A 3CIKA 1X8BA 1XHAA 4WSQA 5AV0A 5KHWA 4GUEA 3TUBA 4NU1A 3PLAE 3UBDA 2HCKA 1WBOA 4EC8A 5EHOA 2B1PA 2JBPA 3W10A 4M84A 3DAJA 3U4UA 4YO6A 3IKAA 3VS0A 4O81A 1H1WA 2J6MA 4FKJA 5BVDA 2C3IB 3QQLA 2W1EA 4RZVA 5J1WA 5CEQA 1QPDA 4BR3A 3G0FA 1WVWA 4USFA 3BGQA 5AUXA 3QLGA 4LMUA 4IWQA 2JFMA 4Y95A 5AP4A 4TWOA 4AF3A 1R3CA 4QQ5A 4EONA 3E93A 4TYEA 2XBAA 5T68A 4BTMA 1KUTA 2BMCA 3OVVA 1HOWA 5M4FA 3GUBA 2ITWA 5IUGA 5AV2A 3LMIA 3T3VA 3LQ5A 2C6MA 4R3PA 2X8DA 3MVJA 5AP5A 4G5PA 3M42A 3FBVA 4KWPA 3KRLA 2VWUA 3BZ3A 5BQ0A 4DC2A 3HMOA 2H8HA 1ZAOA 4HNFA 2EU9A 4E4LA 2W1ZA 5ANOA 2W1HA 3R1SA 2OU7A 3DQXA 3EN9A 4PPCA 2OXYA 4EK3A 3RZFA 2DS1A 5IQBA 3A7JA 3F82A 4ZOGA 3OOMA 3SAYA 3AMYA 3D2KA 5AR5A 3BLHA 5HCZA 4AFEA 2AYPA 4W4VA 4C3RA 2ONLA 2PZYA 3R1YA 4FODA 2XK6A 5D10A 4NW5A 2FO0A 1UU8A 2R9SA 3P7BA 4EK8A 2E9NA 5L8JA 3R8ZA 3UZPA 2QOFA 4ZIMA 3JYAA 5HLWA 4V04A 2VTLA 5JT2A 5BUJA 3NUSA 4MBJA 4FKQA 5E8XA 2B53A 4KKHA 3V6SA 4QMNA 4PNIA 2JLDA 3V51A 4E4XA 3NYOA 2QOIA 4FIGA 5CSXA 4EBWA 4IDVA 3AT3A 5AX3A 5L6PA 4ASEA 2CKOA 2RG6A 3DB6A 3MY5A 1DI8A 3VHEA 4ALWA 5D12A 1WFCA 4ASDA 3BEAA 4C02A 2WO6A 4BKZA 4QP1A 3LJ1A 4BTKA 2JDTA 4YURA 3KK9A 1OUKA 4GK3A 4O2ZA 4WT6A 2X8EA 3BV2A 3P78A 3BE2A 4ANBA 2WMBA 2WTVA 1GNGA 2JKOA 4OTHA 4WUAA 4HCVA 3CTHA 4YJPA 4IX3A 2IZSA 4RGJA 5AMNA 5ACKA 5JN2A 4QNAA 5FTOA 2CLQA 3R71A 3G51A 3BCEA 2Y8OA 4NUSA 3OCTA 3A7IA 3KXNA 4H1MA 4XG3A 2P0CA 5HQ0A 5L2QA 5KUPA 4IZ5A 4FKTA 2R3MA 3EQCA 5JFXA 2VGPA 2YABA 1XR1A 2X4FA 2VO7A 3RWPA 4FV8A 4AGWA 2GNJA 2OSCA 3HRCA 4FIEA 3ZLWA 3GC9A 3AD6A 3EN5A 2ZM4A 4U6RA 4GT5A 4ACDA 3W8QA 3QUEA 4F65A 5JSMA 4CZTA 3OEZA 3OF0A 2NP8A 5FEEA 3R8PA 4ALVA 3ZHPC 4FE2A 1JAMA 4GIIA 2BDWA 2BCJA 4QYYA 3RWQA 2R3RA 3EL8A 3R30A 5J87A 5BX0A 3C4WA 2J0JA 5L3AA 3ZCLA 1U5QA 3BRBA 4O91A 5AJQA 2YIXA 3BU3A 5F94A 4ZEGA 5L6OA 3I6UA 4CZYB 5CS6A 3PRIA 4TNBA 1KOBA 3NCGA 4DEAA 2PE0A 3QTIA 4EYJA 4DFYA 3MYGA 4YUQA 4GT3A 4KSQA 3Q6WA 3QFVA 4OTRA 4FEXA 3JY9A 5AAEA 4ZZMA 5LOHA 2J4ZA 4JVGA 5BYLA 5HKMA 3BIZA 4LG4A 4RA5A 2PU8A 3KY2A 5CVHA 5AM7A 3TKHA 5ANJA 5EK7A 3D83A 3LFQA 5FG8A 2FSTX 3R73A 3U8WA 3FMNA 3NAXA 5M44A 3TIZA 2JITA 2JDVA 3V8WA 4K2RA 2Z8CA 4QRCA 2HOGA 1JSTA 4GK2A 4L42A 1SMHA 4MXXA 4HNIA 3A8XA 5EM5A 3F7ZA 4G3EA 2C3JA 1JKTA 5HX6A 3HAVA 5CZIA 3PP1A 4CKJA 4JT3A 4C8BA 2WXVA 5ANIA 2RGPA 2Q83A 3LZBA 2CNVA 4A07A 2XNOA 4HCTA 2R3FA 4FT5A 4QYGA 4LOQA 4IBMA 5H8GA 4F0GA 3QZFA 4WIHA 3ANQA 4TPTA 2WMAA 3OT3A 4I41A 3S2PA 3P5KA 3COKA 4AGCA 1JOWB 2IVTA 3Q53A 5FWKK 2IW9A 3FI3A 4D4VA 2XIRA 3P4KA 2HXLA 4F7JA 1QL6A 4HYHA 5CSWA 4BCOA 2UZDA 3T3UA 3TDVA 3NWWA 4J99A 4FGRA 4GKHA 1PKDA 2YM5A 4RVKA 3CY2A 3E8EA 2GS6A 4QP4A 1PXJA 1QMZA 4Y5QA 4UV0A 5EHLA 1SVGA 3CTQA 4I6BA 1ZY5A 4QTAA 3NNUA 4LRMA 3IOPA 4KB8A 4PMSA 4O7YA 5DI1A 4D28A 4HVSA 2F9GA 3R02A 3NNWA 1OITA 2WELA 2VTIA 2JKKA 2FVDA 2YCRA 3RTPA 1ZYLA 3Q4TA 3BWFA 5H2UA 3AGMA 1MQ4A 2X2KA 4AGDA 3NW7A 5K0XA 3AC8A 3M2WA 4EK4A 5BYYA 3UPZA 3DKOA 3ACKA 4ZSLA 4CXAA 4GMYA 2XMYA 4JQEA 1F5QA 2PSQA 4NKSA 4JX3A 3RALA 5JFSA 5K4JA 1WBVA 4AA5A 2CSNA 1KWPA 5A3XA 4TY1A 4QOXA 4JAJA 2H6DA 5DWRA 3VS2A 4N0SA 5B2MA 5CAVA 4O7LA 1H08A 4FEVA 4BKJA 3MW1A 2X7OA 1U4DA 5TF9A 4Z55A 4ZTRA 2Y4PA 4Q5EA 4WNMA 4AOIA 1TQMA 3OBJA 5E1SA 4M68A 4B8LA 3PIXA 3EFLA 3TUCA 3S95A 2C5YA 2XNGA 4M69B 3VULA 4ENXA 3H9OA 1H07A 2W06A 3F3VA 3PFQA 5J9YA 4RA4A 2GFCA 2XA4A 4EOKA 1NW1A 4OTGA 5I0BA 3AQVA 3A61A 2VTHA 5CALA 2WHBA 4IX6A 4C58A 5I9VA 1XWSA 4TZRA 1REKA 4UZDA 2V5QA 1U54A 3FJQE 1VYZA 5M57A 2X39A 4BVUA 2ZB1A 5T3QA 1FGKA 5EQPA 2P2HA 3R1NA 4O96A 4E73A 3UO4A 1MRUA 5J5SA 1GY3A 5FXRA 2R3HA 4FTKA 3QLFA 4X2KA 3C0IA 3JVSA 3D15A 3LM0A 2BRMA 3OFMA 4M15A 4OBPA 3KF4A 4XV3A 3V8SA 3UOHA 4F4PA 5C03A 3HV5A 2OH0E 5DVRA 3PA4A 4RQVA 1VEBA 5E8ZA 3ZOSA 1GIJA 4DEGA 4R7IA 3Q4CA 4MXCA 4AW1A 4DLIA 2BILB 5CQUA 4DT8A 3ZLXA 3FMHA 3BWJA 3EOCA 3HMIA 3EYGA 3L9LA 3LCDA 4G3DA 2OFUA 4MXZA 3O8TA 2GMXA 2WAJA 3KU2A 4MF1A 1Q3WA 2OKRA 3WF9A 2OJGA 5EOBA 3OW4A 2V22A 3VRYA 5JQ5A 4ZMFA 3LJ2A 3H0ZA 4HYUA 1Z57A 3TI1A 4FSZA 3F66A 3GC8A 3LFDA 4FV5A 4O38A 4HZSA 4W8DA 5L4QA 2BIKB 1ZLTA 3BYUA 3PJ3A 4BDAA 3WF6A 1ATPE 4KIPA 2ZYBA 1R78A 2W5AA 2XNBA 3FZTA 4FEUA 4IE9A 1RDQE 4CMTA 2BHEA 1NVQA 1W84A 3F3TA 5GNKA 1IA8A 4LRKA 4DFUA 2BHHA 3O51A 4FSMA 2UW9A 5IQCA 4D55A 4CCBA 1CM8A 4JL9A 2Q0NA 5HI2A 4GG7A 3C4ZA 4KRCA 5HVYA 2ZDUA 3LCTA 2ZJWA 3DJ7A 4X3JA 3TKIA 3VBYA 1LEZA 2YJRA 3D94A 5ANDA 4WG5A 3PWYA 1Y57A 4GV1A 4RRVA 3BPRA 3CCNA 3ZC5A 4DGLC 2UW6A 2VTQA 3HV4A 2HZ0A 4JBQA 3ZYAA 4CD0A 5M4IA 3O0GA 1J91A 3PTGA 3TTIA 3ORKA 3MPTA 3WBLA 3BGZA 3FUPA 3BYOA 2ESMA 2GHMA 1L8TA 4QQCA 3QTUA 2VZ6A 3NYVA 3WF7A 4AQCA 2W17A 4IFGA 3IOKA 4CRSA 5JRQA 4JIAA 2IW6A 4L8MA 1PY5A 1PMVA 2YLEA 4EH7A 4RC2A 4XBUA 3JY0A 4MEDA
chains in the Genus database with same CATH superfamily
5HE2A 4MCVA 1UWHA 3FHRA 3F9NA 3FQEA 4AZSA 4BC6A 4DEIA 1UU7A 3GU7A 4EWHA 2IWIA 3D7TB 5EYDA 4TWCA 2VO3A 2YM3A 4QMXA 4DEEA 3MVHA 5CYIA 4O4EA 2UVZA 4DEDA 2RFSA 4H1JA 4AT5A 4C4FA 4CRLA 2G9XA 2YN8A 1OIQA 4CCUA 2QOQA 1YWRA 4HGLA 2O65A 1ST4A 4C4EA 4J1RA 2RSVA 3F6XA 4FVRA 3I5ZA 1H01A 4F6WA 2Z02A 4TYIA 2OF2A 1XQZA 2YITA 4MTAA 1ERKA 3MTFA 5G1XA 5C8MA 4QMLA 3R9HA 4PF4A 4D9UA 4GU6A 3RI1A 2EXCX 3RCJA 4F70A 4U80A 4DINA 2C0OA 3PDTA 1G8SA 3NSZA 2W4KA 5LVPA 5HTIA 2Y6MA 3ZS5A 5AIRA 2ZFYA 5CU0A 5IA3A 2WQOA 4L7SA 3ZRMA 2Z7RA 3R7UA 3UDTA 1XH8A 4FKSA 4J98A 4XP2A 3PG3A 3GFEA 5BVKA 3TCPA 4K9YA 3NIZA 3OZ6A 3DXQA 3UDBA 2QO9A 1KV2A 3UODA 5I9ZA 3RAHA 4M3QA 2FYSA 3EWHA 5C01A 2DQ7X 2OGVA 4BTFA 1IAJA 1JWHA 4E4MA 1JLUE 4OAUC 4O84A 4BJJA 4L67A 4BN1A 4ZMEA 3WF5A 4EZ3A 2I0HA 3UQFA 2UVYA 4KABA 4RIWA 2OWBA 3R63A 1NT2A 3TNWA 3NW6A 3DLSA 3AOXA 4O4BB 4EWQA 4NJ3A 2ZMDA 3QKLA 1P4FA 2QI8A 3HUBA 1FPUA 3ALNA 3R22A 4FYOA 4U81A 5E4HA 2C4GA 1W8CA 4IJ9A 4S32A 2B9FA 3ZM9A 2VNWA 5HNGA 4DAWA 2YM8A 4OTQA 2QR7A 3KFAA 4J53A 4BCIA 1FQ1B 1UKIA 5HLPA 5KMJA 3QUPA 3HA6A 3FE3A 1VYWA 3DDPA 4M8TA 4E26A 3P79A 4RVTA 3TDWA 5JH6A 1PXKA 4FKWA 2BTSA 2XKFA 3EL7A 2PZPA 3I5NA 5AR3A 5FBOA 4DT9A 1MRYA 4MNEB 4NTSA 4R1YA 4YJUA 4FC0A 3U54A 4JAIA 1M2PA 5EW3A 4O27B 3OUKA 1YHSA 4YJSA 3O7LB 2A2AA 4DHIB 5HD7A 3HP5A 4FVQA 1K2PA 3UE4A 4E5WA 1TFFA 1BL6A 4H3PA 3O2MA 4IC8A 4Z9LA 3TACA 3T9TA 4BZNA 3UIXA 5E8YA 1AGWA 1CSNA 2I0EA 3WZUA 2B7AA 3BQRA 3VW8A 4HPTE 4F0FA 5D41A 3TNHA 4OR5A 3C51A 4P2KA 3OWJA 3VBTA 4M14A 3QRUA 3OBGA 3BQCA 3OXTA 2A0CX 4EOJA 3W2QA 3BU6A 4XLIA 3Q96A 3FMEA 4FT3A 4WNPA 3PY1A 3C4FA 4FTMA 3U4WA 2XP2A 3DTCA 2J2IB 1Q8YA 2XM9A 4ZP5A 4EK6A 1H25A 3UC3A 4AP7A 1NY3A 4NIFB 4O1OA 5AAFA 5C4KA 3II5A 4RX7A 4L52A 4PUZA 1ZZLA 4UB7A 3KVXA 3MFSA 4FEQA 4ACHA 2PHKA 3FLQA 3LFBA 2I0VA 3CTJA 5E90A 1SYKA 3AC3A 4YZDA 4C3FA 2BDFA 3L9PA 3VAPA 4KS8A 4OGRA 3V5QA 4AWIA 4R3CA 5M56A 4ERWA 4RWLA 3CD8A 2AEGA 4FNWA 3DXNA 3LHJA 4DFBA 2VRXA 3RPYA 3CKXA 3N4VA 4B0GA 1IEPA 3EQIA 2ITYA 3Q9ZA 3MH2A 3V5TA 1JQHA 3IW4A 3PVBA 5EHYA 5H3QA 3SC1A 4FL1A 5DIAA 4DBXA 3MESA 4WSYA 4PMPA 5M06A 3ZRLA 4E5AX 5LCKA 3K3IA 4RQKA 3P23A 1YI3A 1IASA 4QTDA 4F7SA 2VTPA 3IDCA 2P3GX 1XJDA 1LUFA 3LQ8A 2NRYA 4FG9A 4ONAA 3IQ7A 3DT1A 5KMNA 2WD1A 3L8SA 1Y8YA 4PY1A 3HMNA 1MQBA 1W7HA 2GSFA 3VUIA 4YHJA 3GEQA 2HWPA 4O6EA 4QD6A 4C36A 5E8VA 5KMKA 5L2TA 3QGWA 2ZMCA 4QDVA 2OF4A 4BB4A 4PL3A 1KE9A 1Q3DA 4RIYA 5F95A 5IEXA 2J5FA 4CFFA 5IISA 3KXGA 2IW8A 3AC1A 3WI6A 1OL2A 1YXSA 4FV0A 2PK9A 4GJ3A 4J7BA 3ORPA 2OZAA 3PJ2A 4ID7A 2XJ0A 4MXOA 4E4NA 5CNOA 4CFWA 3QXOA 4EQMA 3SW4A 3RAKA 3QUDA 5EM8A 2ZVAA 1U46A 5BYZA 3EFWA 4W9XA 2G2FA 5AM6A 5JZJA 4ZTHA 3H10A 3NPCA 4G9RA 3LAUA 3QL8A 1J3HA 4AT4A 4DH7A 4OTDA 1OGUA 5IMXA 4V0GB 2WGJA 2X0OA 5CSHA 5CAQA 5IEVA 4LUEA 3I7BA 2J7TA 3K5UA 5FM2A 5AUZA 4BDHA 2WTKC 5EYCA 4MHAA 3PJ1A 4XH6A 2PPQA 3EN4A 2HY0A 2CHLA 5AUVA 1QPJA 3DGKA 2ITQA 3COHA 3NZ0A 4R8QA 1NA7A 2YDIA 3FMJA 2H34A 3FYKX 4ASZA 5AFVA 1M7NA 4KAOA 4X6RA 5IH6A 4E6QA 3PSCA 4BY9E 5H8BA 2G15A 2RF9A 3ELJA 2FH9A 3SRVB 3QYWA 2PVNA 5AP3A 2BFXA 1M2RA 4FX3A 5C1QB 5DG5A 2BRNA 5LMBA 4WBBB 3P86A 3MPAA 4I3ZA 3C9WA 3UMXA 4QEBA 2YM4A 5IA2A 3D5XA 5GZ9A 4E6CA 4EHEA 3UVPA 3KMMA 4X7QA 4AE9A 3VN9A 3VUHA 4PX6A 4AU8A 1PYXA 3VO3A 4AUAA 4XRJA 3SV0A 1CKPA 2J0MB 5CU6A 5HG5A 4PMTA 4DGGA 4GFOA 3NUAA 2UW8A 4XP0A 4CFXA 5KMMA 2I6LA 2VTMA 5IQFA 2C6KA 5E9EA 2PVFA 3FLNC 2QR8A 1RW8A 2C69A 4TTHB 3ZSGA 2PVRA 5I3RA 4QMPA 5K5XA 4QP2A 3VBQA 3TWJA 5IQGA 1OKWA 2NPQA 2CGWA 3D7ZA 2GTMA 3FMDA 4GRBA 4NYEA 3Q3BA 5KKRB 3A7FA 4AXEA 5G6VA 3MH3A 1FGIA 4CFVA 5AR2A 3SGCA 3FLSA 4G17A 4IM0A 4UN0C 3G33A 4I6LA 1M14A 3R7VA 1VLRA 3A7HA 3KCKA 2WQNA 3G90X 5J79A 2OLCA 4L44A 4J8MA 2JC6A 5AX9A 5IQAA 3AMBA 4HW7A 4QYEA 4C4JA 2E9UA 3P7AA 5CI6A 3VUDA 4LI5A 3P0MA 2BAKA 2VGOA 3PVUA 3ZZEA 3TZMA 2E9PA 3Q9XA 4FMQA 5DR2A 3U9NA 5HORA 3HA8A 3MI9A 5JGDA 3DBFA 4J71A 5JGBA 3EQPA 3FMMA 4BYJA 3VNTA 2QQ7A 3KCFA 4NT4A 1PHKA 2AC3A 3MS9A 3N4UA 1YXXA 1Q5KA 4NEUA 5EDPA 3FAAA 4BCNA 1PW2A 2XCKA 4FKUA 4HPUE 4PPBA 2ZV7A 1UWJA 3I60A 3DK3A 3Q4ZA 2WTCA 5KNJA 3FMLA 3OROA 4FTRA 2G01A 5IDPA 3NIEA 1Y6AA 3HP2A 3L9NA 2C30A 2R3LA 1HCKA 3WOWA 3WE8A 5LVOA 1WBWA 2I7QA 3ALOA 4FYNA 4PTEA 3C5UA 5HE3A 4IQ6A 4YR8A 3CE3A 4FF8A 4BDIA 5ANGA 2IVVA 3HV6A 4PDSA 5DN3A 4O0VA 3KXMA 4G3FA 2WMUA 4QP8A 4HVDA 4FNZA 4QPAA 4JBPA 2WIHA 3VBXA 3DPKA 4AW2A 2XYUA 3B8RA 2EXMA 4F9CA 4LV7A 3E7VA 4JR3A 5BVWA 4GUBA 1LR4A 1YOJA 2YAAA 4R6VA 4UBAA 4EI4A 2GQRA 4S2ZA 4D1XA 4G34A 4FTNA 2YHVA 3QD3A 4E7WA 4YNOA 2OG8A 1Y6BA 4FKIA 4JRVA 4KSPA 3VS3A 3BX5A 3CD3A 3ZXZA 4O83A 4RBLA 3F5GA 4EOQA 3UZTA 3ZUUA 3DS6A 3DJ5A 4C35A 4YTIA 4X3FB 2F7ZE 2F57A 4FKLA 5DFPA 3ZLYA 3FEGA 1I44A 2HWOA 3SOAA 1W83A 2EUFB 4EH2A 4DFZE 3HZTA 3QRIA 3HECA 5D9HA 4BBEA 5ITAA 3V5LA 4U3ZA 3PY3A 2HK5A 2YZAA 3KULB 5LMKA 4K1BA 4M97A 3EYHA 4XG8A 5IZFA 2BROA 3BGPA 2C6OA 2UZUE 3E7OA 3AKLA 3VQUA 3ZUTA 2J0LA 4C34A 2BAJA 4C33A 3GCVA 1YDRE 3BBTB 4RC4A 3W2PA 3ZRKA 3G15A 2OFVA 4U43A 2EVAA 3BV3A 4R3RA 3VRZA 3W0QA 1P2AA 3QCQA 3KC3A 4EOPA 2BZKB 1YI4A 5EW9A 3RPSA 1YDTE 1FVRA 5CLPA 4JDHA 4QP6A 4QPMA 4YU2A 4BTJA 1Q8ZA 5AA8A 2UW7A 4U42A 3G6HA 4U3YA 2X6DA 4FIIA 4YNEA 5AEPA 4N6YA 1M2QA 3OD6X 3PE1A 4YJRA 3EMGA 2BUJA 4W4XA 4OW8A 2XM8A 1BMKA 4G9CA 4XG2A 3FL4A 3GCQA 2ZV2A 2R7IA 3QRTA 2PMNX 4R5SA 5FTQA 4D1SA 4L00A 2IJMA 4FTLA 3RINA 3ZFXA 2F2CB 2OJ9A 4NZWB 4V01A 2QKWB 3HRBA 5EM7A 5LARA 1URWA 3O23A 1J7LA 4DA5A 3ZFYA 3W0OA 3RM7A 2YCSA 5H8EA 2VV9A 2YIWA 4IZYA 3ZDIA 5CU3A 5BVEA 5I9XA 3H4JA 4LV8A 4XV2A 4YO4A 3E8NA 3NRMA 1O6YA 3GCPA 4MWIA 3MB7A 4YZNA 4G31A 3DCVA 4IAAA 5FEQA 4MVFA 5FGKA 5FP5A 1G8KA 4BI2A 4FIFA 4KBAA 3QRJA 4RIOA 3RBWA 1CKJA 3DBQA 5CI7A 3DK7A 4ANSA 4MWHA 2Z60A 3PXFA 4CNHA 4FOCA 3DY7A 4F99A 3IONA 2GQGA 3VIDA 2EB2A 4AOJA 4BCGA 3H0YA 4PDOA 3U9CA 4YJVA 4RVLA 2GNGA 4BDDA 3GU5A 3KRJA 4AZWA 1TVOA 4E93A 2Y0AA 3VS1A 4C2WA 1H1SA 1OI9A 3ULZA 3OW3A 4A9UA 4A9RA 5KBRA 3AKJA 4O7NA 2O8YA 3ZFMA 2QU5A 1DI9A 4FTAA 2UZWE 4H3QA 3V8TA 4I24A 4IB1A 3EJ1A 4M69A 1GIHA 3EQGA 4F08A 4FNXA 2PVMA 5F4NA 2C6LA 1KE5A 1KOAA 2WEVA 2C0IA 4PPAA 2ITZA 4U8ZA 5CXZA 4EUTA 3SG8A 4TXCA 4RLKA 1OB3A 3KREA 2ZV8A 3I0QA 4CQGA 4YMJA 4AZFA 3QZGA 2YWPA 3E62A 4FZDB 1V1KA 3MSSA 4MK0A 3QF9A 5DPVA 2C6TA 3LCOA 2OIBA 1ZXEA 1OPJA 3AT2A 4IADA 5HIDA 3JVRA 5IQIA 4NW6A 4BWXA 4WRSA 4CV8A 1WBTA 4UY9A 4XOYA 5IH4A 5HG8A 3PJCA 1P5EA 5A9UA 3K2LA 2DYLA 3W2SA 4U41A 3FY0A 2PMOX 2O64A 3CJGA 4O0WA 3JPVA 5M08A 3DFCB 2QHNA 2HIWA 2VTRA 3MV5A 3RPVA 4CTBA 3OG7A 5EKNA 3GT8A 4KRDA 3SXFA 3ZONA 2QCSA 4P5ZA 4MQ1A 5JGAA 2PULA 1OPKA 3G0EA 2V7OA 1LP4A 4IM3A 3VUKA 3QTZA 4ZZOA 2C0TA 1PYEA 4D5HA 5JQ8A 3JS2A 2OIDA 2Y4IB 2BZJA 3KRXA 4IACA 5BPYA 1YHVA 1BKXA 5HBEA 4IB0A 3NUNA 4TWPA 2UW3A 1J1CA 3NAYA 2RIOA 5IA4A 3OWKA 4YLKA 1KV1A 3HEGA 3RK7A 4D5KA 5CEKA 3OCSA 4DHFA 3QTWA 4I23A 2QOHA 3FXZA 2YFXA 4BL1A 3EQFA 4ZXTA 2CKPA 4F64A 2VWVA 4D0WA 2R5TA 3RMFA 2CLXA 5HG9A 3R7EA 3DKFA 3Q6UA 2C5NA 4CFUA 5A4LA 2XH5A 3TT0A 3VC4A 4O1PA 4L53A 3TM0A 3KXZA 5KBQA 3RNIA 2XEZA 4U97A 2X4ZA 3QQHA 1JPAA 4EUUA 1ZARA 3FSKA 3Q60A 4ZSEA 4H36A 3V04A 3EKKA 5GHVA 3ZEPA 4GH2A 4BGHA 5IU2A 4GFMA 2R3OA 3Q5ZA 5DR6A 5FLFA 3G2FA 5B7VA 4AZEA 4OBOA 2ZB0A 3NMUF 3LM5A 4GT4A 2GS2A 4G5JA 5L2IA 2JDSA 4EHZA 2OI4X 4FIHA 2PUUA 4YHFA 2CCIA 1QCFA 2FGIA 4YJOA 4ZTSA 1PMUA 3NX8A 3U6HA 2B9IA 2BR1A 4KA3A 5HE1A 4PWNA 4JG8A 3NEWA 3IW8A 3D7TA 2WMXA 3QALE 4DH1A 3MPMA 3N4TA 4PMMA 3F3WA 3HLLA 4ZS0A 2XJ1A 3QHRA 4ZJVA 4J95A 2YWVA 3O5AA 4A9YA 1BUHA 3R9DA 5L2SA 5CVGA 4K8AA 5HTBA 4M7IA 3ATTA 1CKIA 2R2PA 5GJGA 2WMQA 4KD1A 3S4QA 4DGNA 2UW5A 5HLNA 4FTOA 3NFFB 1IR3A 4FTCA 4U0IA 4RFZA 5BV3A 3P7CA 4GCJA 4F1OA 2ITNA 5LWNA 4ANOA 4FV4A 5LXMA 2XYNA 1YRPA 1YVJA 3RNYA 3HMMA 5IKWA 4JI9A 5LMAA 3F69A 5I3OA 4CLJA 1JBPE 3W1FA 4Z3VA 4FT7A 3POZA 3QD2B 3HL7A 3UP2A 2PMIA 4Y85A 3UG2A 2Q0BA 4A4OA 1O9UA 3I0OA 5EG3A 1A48A 4TYHB 3OHTA 4U5JA 5CASA 4F7LA 3FZ1A 4YJQA 2P2IA 3BLQA 3NCZA 4L9IA 4L3JA 2W05A 4XG7A 4EOSA 3VONA 5FDXA 5KE0A 3WZDA 3CEKA 3PSDA 3ZH8A 3PA5A 5GZ8A 2OICA 2QVSE 3D5UA 1KE7A 2QNJA 3R01A 2NRUA 1XBAA 3MY1A 4B6LA 4BIBA 4FTTA 5ACBC 3UYTA 4ANMA 3MVMA 5J5TA 3MTLA 1PXPA 2CNQA 3D5VA 3DNEA 4O0SA 1PXLA 2VUWA 2PZIA 2XK3A 3GBZA 2YERA 2V62A 3GC7A 3JXWA 4I6HA 3POOA 4IM2A 4TYJA 1W2FA 3OXZA 4UEUA 3QXPA 5TT7A 3SOCA 4ZLOA 5ETIA 1LEWA 1YQJA 5CVFA 3Q9YA 3OY3A 4I93A 4L68A 5EDQA 5KKRC 5AR4A 5BUEA 4F9BA 2WOUA 4QMQA 1OIRA 5HIEA 3M1SA 4GU9A 2FSMX 4QO9A 3SQQA 4A06A 5CAUA 3F5XA 1W2DA 3D9VA 3HNGA 5E8TA 5TO8A 3VQHA 2O5KA 3S1HA 3U55A 3B2TA 4C3PA 2BALA 1EH4A 1G5SA 4MNEA 2C68A 3ZUVA 4ANLA 4IH8A 4FTQA 3TZ9A 4FTJA 3I6WA 5DRBA 3T9IA 5KO1A 4XCUA 3F2RA 4XG4A 1BI7A 5FBNC 2JAMA 2GNHA 2CGXA 4G2FA 4QTBA 2PZRA 5BMMA 2Z2WA 4I22A 4D2SA 4X2NA 4YC8A 3BELA 2Z7LA 3FQHA 4ZSGA 5FP6A 3ENMA 4IXPA 2OBJA 3NNVA 3R2YA 4Z16A 4AXCA 5GINE 3R7IA 1W2CA 5KX8A 2LGCA 3PYYA 3NUUA 2UZVA 2QHMA 3F2NA 5F1ZA 4FUYA 3IDBA 4RIXA 4EJNA 2J51A 3OT8A 3QCXA 4IWDA 5HG7A 4FJVA 2H96A 4LYNA 2QKRA 4UALA 2XKDA 4LQMA 3Q4UA 3UIMA 4AG8A 4YJNA 4YP8A 3EH9A 4NIFA 3VJNA 5DMZA 3MFTA 1UV5A 3I79A 3TEIA 4G16A 2BRBA 2R3NA 1OL5A 4P90A 3TNQB 4UZHA 4DFNA 5IF1A 4WOVA 4MXAA 4RSSA 4IMYA 4F09A 3IG7A 3E3PA 2PVYA 4D4RA 2VTAA 4KUJA 3GENA 5HU3A 3NLBA 3W8LA 2UW0A 3QZIA 5E8WA 3TMOA 1R39A 5BNJA 3ID6C 2W7XA 4AT3A 3TNPC 4FSRA 4BDEA 3QA0A 5FTGA 2R3JA 4F0IA 4HGSA 5LQFA 4O0UA 5A46A 2PMLX 4FZ6A 3RKBA 2OJFE 4W4WA 2WOTA 5B2LA 4YSMA 4CFMA 4JG6A 3GQLA 5AUUA 3AG9A 1YXUA 4OTIA 4D2TA 2C5XA 4A7CA 2YCFA 3LFSA 5IG1A 1ZZ2A 2YAKA 3QC9A 2J0KA 3WYXA 3LVPA 3UNJA 3OCBA 3Q04A 3GB2A 3AMAA 5HICA 3FKNA 4GYGA 1CDKA 3LFAA 3EQRA 4JRNA 5IQEA 3BHVA 4BBFA 3LKMA 4EOMA 2IZUA 4EHVA 3EHAA 5HO6A 3OC1A 1K9AA 4ZAUA 3VUGA 4CMOA 1G3NA 3QKKA 1GZNA 4K11A 3E5AA 3RGFA 3H9RA 4QYHA 4HZRA 2VWWA 4CG9A 3E8CA 3Q2MA 5HEZA 5A4EA 5I9WA 3B8QA 3IS5A 3HV7A 3FHIA 5HNIX 4RZWA 1SM2A 4H58A 4BDCA 4RLLA 4G3CA 4QPSA 5AWMA 1UNLA 5M4CA 4GIHA 3UPXA 4HVGA 4R1VA 4RWKA 5FD2A 5HGIA 4O7RA 2ZDTA 3Q9WA 4EORA 1FMOE 4IAIA 4IEBA 3OCGA 2W9ZB 4JS8A 3RCDA 4APCA 4B99A 1UVRA 4YPSA 4EH4A 4MBIA 4C2VA 3AT4A 3RK5A 1WBNA 2RG5A 4O82A 5TKDA 4YZMA 5EDRA 4F1TA 1YXTA 4QDEA 3DA6A 2ZV9A 4OT5A 5ANKA 3EZRA 4XEYA 3W0SA 2VWXA 5HESA 3UQCA 4XLVA 2YLFA 3OXIA 5LWMA 1ZMUA 4C4IA 1BI8A 4KIQA 5B0XA 5ETAA 2HZIA 3BHUA 4ZSAA 3RHXA 4DBNA 2AC5A 1OPLA 2YDKA 2VTJA 3BEGA 3KGAA 2J50A 2WMVA 5DOSA 3SRVA 3VVHA 2WMRA 5CY3A 4AN2A 4JDKA 2CN5A 4V05A 2WQMA 5AP2A 4F9AA 4FV9A 3PP0A 5E8UA 4ITIA 4I4FA 2UVXA 4YLLA 2WTDA 3LW0A 4O7VA 3F3UA 4PTGA 3HRFA 2WNTA 4WNOA 1GOLA 2ITUA 2CKEA 5DT4A 3DTWA 3FY2A 1T46A 4DYMA 5KMOA 3VHKA 4ZS4A 2I40A 1STCE 5JZNA 3HDMA 3PXRA 1BX6A 2RFDA 5DT3A 3TJDA 1OKVA 1V0BA 5KHXA 4LM5A 4L6QA 4C38A 5TR6A 3K3JA 2QONA 3JUHA 4FBXA 3KN5A 4YLJA 4HOKA 5LVNA 4I0RA 3ORIA 4AN3A 1R1WA 3CBLA 1SVHA 5A4TA 2W9FB 5C8KA 2CPKE 3CJFA 2C3LA 1O6LA 1UU9A 2GCDA 5E7RA 3ZXTA 3R28A 4B9DA 5K3YA 2A19B 2VWZA 3KRRA 5CXHA 4AZVA 4LFIA 4L01A 5A6OA 4PDYA 4NTTA 3UOJA 4PNKA 4RFMA 4W4YA 2W0JA 4DHJA 1YOLA 2J5EA 4Y73A 2XB7A 5K4IA 3ZBXA 3GOPA 3EKNA 3FMKA 4ASXA 5EI2A 2BTRA 4HGTA 3ZO2A 4CVAA 4N4SA 1W82A 4NJDA 5A4QA 3OUNB 4FNYA 4D2WA 4QMWA 5CU2A 2G1TA 4FV3A 1AQ1A 5A4CA 2VX3A 4I0SA 2WPAA 5LMKC 4XS2A 3LMHA 2KTYA 2FSLX 4GS6A 4MKCA 2G2HA 3MJ1A 3OTVA 4CMUA 4FEWA 3HYHA 4AQKA 3F3ZA 3QAME 4DN5A 4NM3A 5TOZA 3ZDUA 4GK4A 3E63A 4XX9A 4E6DA 1JKSA 4RX9A 4EKLA 4F78A 1IG1A 1YDSE 3WARA 1QPEA 3FXXA 3TJCA 2GHLA 3Q5IA 4F7NA 3S3IA 4UMRA 1CMKE 4FZ7A 5IA5A 3MY0A 3EN7A 5EI8A 5C9CA 3P9JA 2UUEA 5TE0A 3R6XA 4ANNA 4O4FA 4GYIA 5CWZA 4II5A 4X2JA 5AV4A 5AUYA 3W2CA 2CDZA 1E1VA 1XH9A 2CNUA 2XAOA 3A8WA 3EFKA 5FQDC 5EI6A 1PXOA 5AP7A 3B2WA 5DNRA 2OH4A 4MAOA 4YZ9A 2W4JA 4O21A 1H27A 4W8EA 1OZ1A 3EZVA 5FDPA 5CNNA 3R9RA 4EH6A 4S34A 5AUTA 3LFNA 5I5ZA 2C1AA 5JK3A 3FKLA 4J96A 1OL1A 1YWNA 2OW3A 5CX9A 4UWYA 5CF6A 4U9AA 2EXEA 3V5JA 2JFLA 4ZY4A 1XH4A 4F1MA 3IW7A 3ZBFA 3PVGA 3Q2JA 3UO5A 4MD8E 2JKMA 4O7SA 2HXQA 4JBOA 3PZHA 5DT0A 4HCUA 4UX9A 3R2BA 3BI6A 5HCXA 4AACA 4AS0A 4N57A 2WB8A 1OKYA 4JOAA 2OIQA 4GFGA 4X3FA 4MD7E 3PY0A 4IVAA 3KF7A 3R8LA 2ERZE 3UQGA 5BMSA 5AR8A 4YTCA 3GC0A 2FSOX 2VNYA 3BYMA 4Y83A 2BVAA 3AD5A 2IZRA 4FUXA 2XJ2A 4X0MA 3IGOA 2HENA 3KULA 3W2RA 4QTEA 4D2VA 4AGUA 3H3CA 2UZBA 3QWJA 4TKSA 3MH1A 2WMSA 2YA9A 4MBLA 4XBRA 5LVLA 2P55A 5AAGA 2B9HA 3QX4A 4EYMA 2JDOA 4ANQA 5HX8A 5AP0A 4R5YA 3QTXA 1TQIA 3BKBA 3PJ8A 2J9MA 1OECA 5AIKA 3QZHA 3RPOA 1YWVA 1Y91A 4FTUA 3DOGA 3WZJA 2V0DA 4CSVA 3VWAA 3QTSA 3D2IA 4EH5A 4BZDA 1OVEA 2X0QA 3SA0A 4DITA 3ET7A 5C27A 3JR1A 4CT1A 3SVVA 5JEBA 5C4LA 2A98A 1PXIA 4AX8A 4NM7A 4WKQA 4C59A 2WMWA 4BCPA 4C61A 3FC2A 1H0VA 2B4SB 3QTQA 4NM0A 4UYAA 2ITXA 3E87A 4I4EA 3DLZA 4FK3A 4FSQA 1ND4A 4RX8A 1YI6A 5KZ0A 2A27A 4AN9A 4LDTA 4ORKA 4QMYA 3ZC6A 4OTPA 2IZTA 3R9OA 1URCA 2HELA 4WG4A 4DEHA 3OOGA 2R3GA 4CEGA 3PUPA 5DA3A 4HVIA 2ITVA 3UJGA 4TYGA 1ZRZA 3QBNA 4AXAA 4NCTA 5EQEA 3FI2A 3NDMA 1F0QA 3NYXA 5IQHA 3EQBA 2R3PA 5GIOE 3ODZX 4G6OA 2CCHA 2ITPA 4JQ7A 5EFQA 3A60A 2NO3A 3BYSA 5AV3A 4E20A 3GU8A 3A7GA 1YKRA 4GG5A 2VX0A 4QQJA 4AOTA 5CU4A 2C6EA 3TTJA 4JIKA 4KIKB 4D58A 4C37A 4LGDA 3ETAA 1XMLA 4UMUA 3O50A 5BVOA 2VAGA 4P7EA 2C6DA 4QP9A 4YZBA 5CAPA 5EQYA 2WQEA 4O0RA 1GAGA 2P4IA 2BZIB 4FVPA 2YIQA 4U45A 3T8OA 2B9JA 1SNUA 4GL9A 4KKGA 4BZOA 3MDYA 4QNYA 1Q62A 2RFEA 1DAWA 4JJRA 2CGUA 3O96A 2AUHA 4I5CA 2VWIA 4LGHA 3UO6A 4BWKA 1FINA 2OZAB 3HV3A 4ZLYA 5L6WL 3KB7A 3ORZA 5DE2A 2YCQA 2WZJA 1OL7A 4IAKA 4GSBA 4J97A 4DTAA 1MRVA 3C1XA 4XRLA 4BI1A 2PY3A 3LLAA 4DDGA 5CAOA 1A06A 4I1ZA 4QMUA 1VR2A 4FZAB 4BCFA 4I5MA 4XV9A 4PP9A 5I9UA 4HGEA 3ENHA 3RK9A 4C4GA 1G8AA 2FA2A 2WQBA 2ZM3A 5CZHA 4ALUA 4X21A 2VTSA 4FOBA 3FZPA 4IAYA 3L1SA 4NWMA 4BHNA 3R7OA 4JDJA 3UC4A 4D2PA 5JRSA 3MN3A 3OY1A 3VW6A 3R00A 1BL7A 2OZOA 4XOZA 2R0IA 4FK6A 4MYGA 3FXWA 3PA3A 4ARKA 4BBMA 4BKYA 4EEVA 2EWAA