5DEWA

Crystal structure of pak1 in complex with an inhibitor compound 5
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
295
Chain Sequence
DEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Design of Selective PAK1 Inhibitor G-5555: Improving Proper-ties by Employing an Unorthodox Low-pKa Polar Moiety
rcsb
source organism Homo sapiens
total genus 100
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5dewA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5dewA01
3TZ8A 2OJJA 3EN5A 4MQ2A 4H1MA 3BBWA 5GIPE 4C02A 4V0GA 1Y6BA 3GU4A 5CAVA 3KF4A 5EM8A 4FR4A 5CF6A 2ZV9A 4M3QA 3POZA 4DFZE 5FQDC 5JQ5A 1Q3DA 2XNGA 4YZ9A 3WE4A 3U4UA 3V3VA 5DMZA 4KRDA 3SXRA 3GNIB 3UNJA 4ZEGA 4NM3A 4AAAA 2IZUA 4FTUA 4LOPA 3F6XA 3FYJX 4U3YA 4KIQA 4K1BA 5GNKA 2BIYA 2HK5A 2CNUA 5ETIA 1GZOA 3OXZA 4AE6A 4XUFA 2JFLA 2PTKA 4RVKA 3CBLA 4TY1A 4AZWA 4O7ZA 5IG1A 2PE2A 3WF6A 3JXWA 2W96B 3QTWA 4TWPA 4YSJA 3ITZA 3QF9A 3F3TA 2C6KA 1GZNA 1LUFA 2YACA 5H8BA 1PYEA 3PPJA 4HCTA 4FSUA 5HBJA 4TNBA 3VJOA 2BZIB 1XH7A 1ZZ2A 4I4FA 3A99A 4ANBA 5IH4A 4HZSA 4HGEA 2XJ1A 5HIBA 3NIEA 4O0VA 4OBQA 3V5JA 4U42A 5IISA 2I0HA 2XKFA 4PP9A 5A54A 2ZAZA 4WG5A 5AX9A 1JKKA 4ZTLA 1KE5A 1ZYJA 1H27A 1PKGA 3UQCA 2CKPA 2G9XA 3KEXA 1QPEA 1ZZLA 2GMXA 2HZ4A 2OJ9A 1P4OA 2P0CA 2QLUA 3HA8A 3VUMA 3MFRA 2RFNA 4FL2A 4GEOA 3ZCLA 1W82A 4KUJA 2WEIA 3E8CA 2W5AA 5FLFA 4YSMA 3IOKA 5AWMA 4GYIA 4DEEA 3HMNA 4EQCA 5LMAA 3C0IA 4HZRA 2YM8A 4O7VA 3HUBA 4IZYA 5TE0A 4B99A 4D55A 1MQ4A 3F2NA 4A06A 1YVJA 2PVKA 5L2QA 2BZHB 3DU8A 3MH0A 3ZZWA 3DJ7A 1Y8YA 2OSCA 2GQGA 2UW8A 1PXOA 4MXOA 4XG2A 3ZC6A 4JR3A 4MXYA 4NT4A 4XYFA 3PZHA 5AIKA 3O71A 5F20A 5FWKK 4A9TA 3POOA 4X2GA 5IA0A 4RMZA 5CU0A 4JI9A 4UALA 2OIQA 2QD9A 1OVEA 2OGVA 5CEMA 2HXLA 3EQBA 4N4SA 4PNKA 3C4CA 1V0OA 4GV1A 2VWBA 3NW7A 2PE1A 4WSYA 3FXXA 1H26A 4IAZA 4MTAA 3MVHA 2VGOA 3LVPA 4O21A 4W4XA 3VS1A 3ZSHA 3PUPA 3UMWA 4GU9A 3C4XA 4FKTA 3NNUA 5F95A 4WRSA 5AUWA 3W1FA 4JAJA 4BDAA 3EQRA 3KN6A 3RPSA 3VF9A 1Z9XA 2PMLX 4I0SA 3NRMA 4EQUA 4PUZA 3IGOA 2CCHA 3ELJA 4II5A 5CAQA 1RJBA 3EL8A 3CTQA 4KAOA 2RG6A 3IGGA 3LJ1A 5TF9A 3SOCA 3LXPA 2WIPA 3TV4A 4E4XA 4UXQA 1KE8A 3PXZA 4EH8A 3EFJA 4QQCA 1FGIA 4RA5A 4BIEA 1UVRA 1F5QA 2Y4IB 4I94A 2O65A 2YABA 4QMXA 4Z7HA 4OTGA 5E8ZA 4ITJA 3VS6A 4EZ3A 2UW3A 2EUFB 4NUSA 3C7QA 5HG7A 3HL7A 3W18A 4X2NA 4DEDA 3LZBA 5E8XA 3OC1A 4XLIA 2C5OA 4XG9A 5JKGA 2R5TA 4QTCA 4E6QA 3CTHA 3QTXA 3IW6A 3TJCA 2HWPA 1V0BA 4IDTA 1H4LA 5HBHA 4JDIA 5KZIA 4S31A 3IW7A 2JD5A 3RCDA 3UO4A 4B8MA 4QTAA 4O1OA 4V0GB 3TACA 4YPSA 3MPAA 5B0XA 3W32A 4F09A 5JZJA 1AQ1A 3ZXZA 2R3QA 3ORIA 4KABA 1E1XA 3QU0A 3GC0A 5EHYA 1WBSA 3WIGA 2XH5A 4JX7A 3RK7A 2DS1A 5FEDA 4GL9A 4Y73A 4OAUC 3FI8A 4C7TA 3CGOA 5EQYA 3U6HA 4ZIMA 2OKRA 5LVMA 4OTQA 3F5GA 2OJGA 3H4JA 2GNIA 2B54A 2F2CB 4TPTA 5HI2A 2IJMA 4I0RA 4ZXTA 4WHZA 3LE6A 2EU9A 3Q9WA 2JIVA 5AAFA 4M7IA 5EYCA 4JOAA 2A4LA 5IUIA 3TN8A 3CQWA 4OT6A 4IVDA 2NPQA 4QMPA 4F1OA 2I0VA 4CZYB 2XIXA 4L3LA 2PWLA 4QYGA 5FUTA 4I6HA 4FF8A 1Q3WA 1G3NA 3U9NA 5BVNA 4D5HA 2WTIA 3I7BA 5E8WA 5HTBA 3C4WA 3EZRA 3NAXA 3R63A 3KMUA 3H0YA 1WBVA 3D15A 4Q2AA 3KMWA 4DFBA 3BE2A 2XK6A 3V5QA 3CC6A 3GU6A 2XUUA 5AR4A 4BTJA 3E8NA 5EM7A 3CPCA 3N4UA 1TQIA 3P86A 4NFMA 2JEDA 3A4PA 4ASEA 3OT8A 5IMXA 5CS6A 4CKIA 4HOKA 4YLJA 2E9PA 3MPTA 4X6RA 4QQJA 4Z3VA 1YI4A 4ZZNA 2QOCA 4FT7A 4QYEA 4J8NA 1I44A 5CAUA 2BAJA 2X2KA 3EN7A 3EQDA 2VV9A 4AT3A 1UU3A 2V5QA 2Y7JA 3QUPA 4MWIA 2A27A 4W9WA 1ZWSA 3GCSA 4QNYA 3OOGA 1VZOA 1CSNA 4LL5A 3F82A 4ZLOA 1BYGA 2GNGA 2ZV2A 4TRLA 3VQUA 4S2ZA 4FEWA 5LQFA 4AA4A 2X4FA 3I6WA 1GZKA 5F94A 3VW8A 4JJRA 1OL6A 5CY3A 4QP3A 4WNKA 3I0OA 3BX5A 4RZVA 4BB4A 3TL8A 2WTVA 4BL1A 1EH4A 4D1XA 4E6AA 2GNHA 2V7OA 3UIMA 4MAOA 5L8LA 2X2MA 4ANOA 4UWBA 5ANOA 4XV1A 2HOGA 1KE9A 1JSUA 3I81A 1HCKA 4I24A 5BVFA 2PULA 4J95A 4D0XA 4PPAA 4FV0A 4HYIA 3UZRA 4M14A 3AC4A 3RPVA 1U54A 4FVPA 3HMIA 3ZHPC 4A9YA 1J7LA 1UV5A 4LGGA 5EYMA 1WVWA 3SX9A 2YIYA 3OP5A 4NL0A 3WYYA 2B53A 3B2WA 4AX8A 4E5BA 3F3VA 3VHKA 4NSTA 3I60A 3DJ5A 3OCTA 3RINA 5LVNA 5M09A 4J99A 3V5PA 5HTCA 5M07A 4M15A 3UIUA 4LL0A 1WFCA 4MD9E 4UWYA 4LYNA 5DG5A 4PV0A 2C68A 2W4OA 2J4ZA 5EQEA 3TNHA 5HE2A 1OUKA 3R73A 1WBWA 3RALA 1H1QA 4W4WA 3ZDUA 2WMXA 1YOLA 4FIIA 3F3UA 4AGDA 3CSVA 5KNJA 5AUVA 3F7ZA 2YISA 5J79A 4C57A 5KMMA 5DPVA 4FL1A 4FV1A 4CVAA 4X6QC 4C37A 3QQKA 4N6YA 2YLEA 3BU6A 5FTGA 2XEYA 5CTPA 1W8CA 4G3DA 1NA7A 4RIYB 2UZDA 3GQIA 1Z5MA 3P0MA 4XP2A 2IW6A 2HIWA 4FTAA 4YZMA 2X9EA 2XP2A 3QQUA 1GZ8A 3PPKA 2CKQA 3V51A 4BZDA 4FEQA 1YW2A 2VTTA 5L8JA 3E7OA 1M52A 5ETFA 4U5JA 2ERKA 2FVDA 2G15A 2XMYA 1GIHA 2C6DA 2R3FA 2Y0AA 3MTLA 3P78A 1YRPA 4G3CA 5IEYA 3DXNA 5ANDA 3NUXA 2BDJA 4ID7A 3UIBA 3QZIA 3VRZA 5CF4A 4HGLA 4CQGA 3C0HA 2Z60A 1ZAOA 5LJJA 4L8MA 2OI4X 4OR5A 5CENA 2CGXA 3R9HA 2C1AA 2C3KA 1Q8TA 2UZOA 2YM6A 3ZLWA 4EK5A 3OG7A 2YDJA 5EI6A 2UW6A 2W1EA 3PE1A 3DK7A 4F6WA 4IC7A 4NJ3A 3DLZA 1E1VA 5LARA 3F7WA 4FNXA 4RZWA 5GJGA 3RHXA 3GFWA 3TKHA 2O2UA 3G90X 3CS9A 3OWJA 3RHKA 4OTFA 3BBTB 4RJ3A 4F9AA 4BDDA 4F9YA 4U44A 1B39A 1SZMA 3NW6A 4QYYA 4RLLA 5M4UA 2UZNA 1XBAA 4HGTA 4XRJA 4AN9A 3UO5A 2W9FB 2P4IA 3PSCA 3BYVA 4TWNA 4F9BA 2HELA 4GT5A 4HPUE 4QYHA 2JFMA 5JZNA 2BMCA 4U81A 2PVNA 3JYAA 4LQMA 3ZBXA 2I6LA 1T46A 3L8PA 4RVLA 2AC3A 3PYYA 3MFTA 4I23A 1PMUA 2Y8OA 4W8EA 5FTQA 4BCKA 2RIOA 4C4HA 3COKA 3LXLA 4JVGA 3ET7A 4XV2A 4ACDA 4ZAUA 1ZYSA 2FA2A 5IDPA 3ZLSA 3QUDA 4C4IA 4WG3A 4YO6A 1PXJA 4MK0A 1GJOA 5IQIA 3OXTA 2R0IA 4RWJA 4DN5A 5JMSA 4ZTNA 5BVOA 2ZDTA 3MY5A 3MVJA 3OEFX 5A4CA 4YZCA 4XV9A 4C38A 3L8XA 1U54B 3P23A 3Q96A 3W33A 5IKWA 1R0PA 1OIQA 3ERKA 4F9WA 5AAEA 1F0QA 3P4KA 2HY81 3WZJA 2YN8A 3U54A 4I6FA 4LUEA 2R3RA 3QLFA 4TN6A 2WMAA 3CLYA 4U43A 4Q5EA 5L2IA 3LQ5A 2BTRA 4C62A 5FD2A 3QCXA 5G1XA 3LW0A 4D2SA 1LEZA 4O0WA 2XIKA 4GKHA 2FGIA 4AOTA 3FY2A 1YXTA 3PXQA 3QGWA 3DKFA 5DGZA 3R1YA 3NGAA 1ZY4A 2BUJA 4IB3A 4M84A 5FBNC 4ZTRA 3G5DA 2XEZA 3LQ8A 3V5TA 2J0IA 2OIBA 2REIA 4C3FA 5CAOA 3ORZA 3O23A 3QRJA 2B55A 1JNKA 3GC9A 3DAEA 4EOKA 3Q5ZA 5CSHA 4QP1A 2FB8A 2C0IA 2ONLA 3MY0A 4HVSA 5I9XA 4MEDA 4BVUA 5M55A 3R6XA 4D2TA 4C4JA 3LFEA 4KSPA 3DY7A 3IOPA 3Q60A 2WNTA 3I79A 5B2LA 1VYWA 2XYNA 5J9YA 5LCJA 4FA2A 3WZDA 4YJVA 4DEGA 2VTOA 4WA9A 5LOHA 3GC8A 3NVKI 4KIKA 2W0JA 1GOLA 3QRKA 4NM5A 5CASA 2VTSA 3DV3A 2VU3A 2B0QA 4MXAA 5E8SA 4YC3A 3KRJA 5D1JA 3CQEA 4QPSA 3WZEA 2ITZA 3AD6A 2WTCA 2IVUA 3CEKA 2X6EA 3O96A 3PJ8A 2HCKA 4O6LA 3UNZA 2EWAA 3D2IA 1JVPP 1KUTA 2B9HA 5T68A 4ZTMA 3DT1A 4YJOA 4HYUA 4CD0A 3UPXA 2R3GA 1KSWA 1Y91A 4KIPA 4CFNA 5M08A 4MWHA 4GK2A 4BCJA 4ENXA 2QO2A 3VN9A 3ORLA 4YJPA 2PVYA 4F70A 3R71A 2WB8A 5E90A 4CFWA 5FRIA 4FSMA 5AP7A 2YM5A 3SG9A 3PIXA 4NCTA 5CQUA 3OWKA 2UZWE 5HG8A 4R77A 4I3ZA 2QNJA 2WMBA 3MFSA 4QQ5A 1Q62A 2RFDA 4KD1A 5DN3A 5EHOA 5EYDA 3DNEA 4G1WA 2J6MA 3NIZA 3BHYA 4J1RA 4OTRA 3L9PA 4DCAA 3F61A 4K9YA 2ESMA 3KXGA 4YC8A 3G33A 4PF4A 3FSKA 4ZS4A 2QG7A 4F64A 2PVJA 3E5AA 3FUPA 1W98A 3OW4A 4H3QA 4JQ7A 3P7BA 1YHVA 3GUBA 1Q8ZA 1M2PA 4MCVA 1Q99A 2X7GA 3IECA 4KRCA 4B9DA 4RVMA 4FKLA 3GT8A 4NM0A 5HICA 3BWFA 5CSPA 5BVWA 3Q5IA 3DQWA 4ERKA 4IAKA 2CN5A 4ASXA 1ZXEA 5DH3A 2YITA 4FK3A 5F4NA 4FE2A 1JSTA 3H0ZA 4YTCA 4O7TA 4U79A 3CPBA 4GS6A 2X7FA 2IVVA 5BVEA 2QKRA 3DKOA 3R7EA 4TW9A 2YAAA 3R2YA 4FKUA 4BDCA 5KE0A 1Q5KA 1UNLA 4GG7A 4MNFA 4QNAA 4XMOA 3KK8A 3R0TA 2HENA 2FO0A 3SG8A 4DBXA 2FUMA 2JLDA 3OZ6A 3EWHA 2V55A 3NR9A 3ZM4A 4IZ7A 2F9GA 4GSBA 2LGCA 4K6ZA 5CNOA 3CXWA 2QHNA 4BTFA 1OB3A 2PZPA 2UW0A 3QTRA 4D4VA 3ODYX 5FDXA 3ANQA 4IVCA 5K4IA 3DTWA 4E4MA 4FSQA 4CSVA 3REPA 2H34A 3D5WA 3FE3A 3G9NA 4FVQA 4P4CA 2ZB1A 4IAYA 2F7XE 3OBJA 4OTHA 3NYOA 4HVHA 3R8MA 2VTAA 4CV9A 4R7HA 1JLUE 5CU3A 4AW2A 3CGFA 3KKVA 5D10A 4DGOA 3SXFA 4MNEA 3B8QA 2QONA 2PE0A 4YNEA 3BLHA 4M69A 1Y57A 2B52A 2C3IB 4MD8E 3TKIA 3ZUVA 5KMIA 4QMTA 1R78A 3OY1A 4U80A 4BCQA 4NIFA 2GDOA 5JK3A 4FKVA 3VW6A 4CT1A 4R78A 1J7UA 2VWWA 2PVLA 2XNPA 3UOKA 3D2KA 2VO0A 3OOMA 3AXWA 3HZTA 2C30A 2OU7A 3CCNA 3FDNA 4PTCA 3GCQA 3K3IA 3ZSGA 3PP1A 2QKWB 4FC0A 2KTYA 3LFNA 2C6TA 3D83A 2YLFA 4EH5A 3ZM9A 4C36A 4FYNA 1CKJA 3QQFA 4KIKB 3FPQA 4FKOA 3FBVA 4H36A 3QRUA 2CPKE 5AIRA 4PMTA 1OIUA 3WF7A 4PL5A 3UOHA 5C8MA 3KCFA 5KKRC 5IQAA 2ACXA 2VWVA 1NXKA 3EQPA 4FZ6A 2VRXA 1SNUA 3P79A 3BU3A 2G01A 3Q4TA 5AP0A 4FX3A 4DH3A 2XKEA 3SOAA 4EOMA 4K8AA 1JSVA 1A06A 3PY1A 3KFAA 4FZDB 3SC1A 1JKLA 4FUXA 3RBWA 1KV1A 2WMUA 1B38A 3QCSA 3TI1A 4AZSA 3IW8A 3MTFA 1FVVA 3NZ0A 3SXSA 5IZFA 5IMEA 3ZC5A 4F63A 2YWPA 4BZOA 3U51A 3WF5A 2ITTA 1GY3A 4O7YA 1PXLA 3FLSA 3IO7A 2PY3A 2WQOA 4YU2A 2VX0A 4A4LA 2W4JA 5K5XA 2XIRA 3R02A 3FMKA 1TQPA 3OMVA 4EYJA 1BI7A 4IIRA 5AA8A 4QMLA 3PXRA 1R1WA 2PZYA 4IDVA 4EWQA 3QTUA 4EJNA 4IADA 2QO9A 2ZV8A 4U3ZA 3VO3A 3II5A 4E26A 1JOWB 4CFXA 3QKKA 3UG1A 4F7LA 1M2QA 4BCNA 4O7RA 1PW2A 1ZLTA 4APCA 3NYNA 4I22A 4L44A 4ANNA 4MXZA 4RWLA 3R01A 3NUSA 4KBCA 3GVUA 4E73A 3TG1A 3SLSA 5AP1A 2W1GA 1JQHA 2P55A 4L6QA 4YBJA 3FHRA 2HW6A 4JRNA 3RAHA 2BZKB 3CY3A 3UYSA 3TUBA 4DFLA 2BDWA 4BY9E 3R00A 3TIZA 2F57A 3UZTA 4OTDA 4CZUA 1ERKA 2X39A 4DGNA 4DTBA 3HDNA 1E9HA 4M8TA 3HRCA 4DBNA 2GFCA 4GH2A 2QLQA 5LMBA 4RIWA 4QPAA 4C58A 3Q9XA 2EB2A 3GU7A 4FEVA 2X81A 1SNXA 2YM4A 3C51A 5EDRA 5AAGA 2J0MB 2X2LA 5JRSA 4N70A 5JFSA 4AFEA 2VO7A 2PVMA 2JDRA 4AF3A 1OUYA 3QQJA 2WTKB 4R8QA 5J7HA 3FEGA 3LAUA 3EIDA 3TDVA 2LAVA 4YTIA 4IJ9A 3R7IA 4WUAA 1OKZA 1K9AA 1WMKA 4Y95A 2QOQA 2WU6A 3MA6A 4XNEA 1RDQE 2C6MA 5IEXA 2B1PA 2JDTA 3H10A 4O0XA 3QLGA 5JFXA 4C2WA 4GVAA 3C4EA 3D7ZA 2Q0BA 2X8EA 3GCUA 3HUCA 4FKQA 4MNEB 4TTHB 4S32A 4W9XA 5GZ8A 5DE2A 5FP6A 1YI3A 4M69B 2Y4IC 4ASZA 5M4FA 2C5YA 2PMOX 3JY0A 4NIFB 1Q97A 2DYLA 3GEQA 3QD2B 3ULZA 4GJ2A 2ETMA 4FSNA 2R3OA 1UU9A 5CSVA 3UO6A 3WYXA 3O7LB 3V8WA 5IQDA 2ZOQA 1VEBA 3FI2A 4FSZA 4I0TA 4NM7A 3L8VA 2X8DA 2OK1A 4FKGA 2NRUA 4K2RA 5E8VA 4B0GA 5HBEA 4XOYA 4ZP5A 4ACMA 3ZH8A 1YWRA 2ITWA 2X8IA 4FMQA 3R9OA 3RK9A 4CT2A 3HVCA 4PNIA 3ULIA 2GS6A 5BVKA 3NWWA 4AOIA 3BHTA 4Q9ZA 4RFMA 4V01A 5J87A 3NAYA 3AT3A 3FY0A 3A60A 5EOLA 1YOMA 3FYKX 3DS6A 4ONAA 4J97A 4OTIA 4AGUA 2CLQA 3TNQB 4WT6A 4O0SA 4MKCA 2GNJA 2W1IA 4QMVA 4D4YA 1NVRA 2GS7A 4JX3A 4X21A 4KA3A 3PSBA 3VBVA 1WZYA 3E8EA 2GHLA 2R3IA 4QP6A 4EH4A 2XM8A 4TYJA 4Q5HA 4PWNA 3CIKA 2QOOA 3AG9A 4WUNA 4YGAA 3HAVA 2WMTA 2ZMCA 4FOBA 3LCDA 4P5ZA 2BKZA 3VBQA 3AGMA 3QTSA 3TJDA 3DLSA 4QMWA 4HCVA 1OITA 3A61A 2VTMA 4O82A 1OL5A 4PX6A 4AN2A 1OPJA 2VTLA 5D7VA 1L3RE 3FXZA 1IA9A 3COHA 4JT3A 4WNPA 4NWMA 2FSOX 1JAMA 4FV5A 4GK4A 4UXLA 3BV2A 3LIJA 4XH6A 1RW8A 2OFUA 3PZEA 4YLLA 5EW8A 2QC6A 3V5LA 5E92A 2C6IA 3DBFA 3ORPA 4WG4A 2O5KA 4FV6A 4L7FA 3MFUA 5EG3A 3TM0A 3R8VA 4IX3A 3VS4A 2RGPA 1PJKA 2PMNX 4YMJA 5E9EA 3DA6A 4O91A 4QP7A 2A19B 4YTFA 1U5QA 2X7OA 4L45A 4BBEA 1NW1A 1ZY5A 4BTKA 3BGZA 3PRFA 4FV8A 3R8LA 3RM7A 3ODZX 4J8MA 4FTOA 1IG1A 2VNYA 1XJDA 2WD1A 3FMMA 3G6HA 3EKNA 3PY3A 4FBXA 4UZDA 4AFJA 4BC6A 1H00A 1UWHA 2NO3A 5A9UA 5CEOA 5KUPA 4OGRA 5IQCA 5KZ0A 3R9DA 3HDMA 2WO6A 4ACHA 5L3AA 4K11A 4WIHA 3R04A 4NFNA 4CMOA 2ITOA 2GTMA 2CHLA 3D5VA 2FSTX 3FZ1A 2F7ZE 3HMOA 4MVFA 3UE4A 4CTBA 2G2IA 3DNDA 1IEPA 1R0EA 4OBOA 5EI8A 3VS7A 4LI5A 4EC8A 5I0BA 3E63A 1OMWA 3P1AA 2YDIA 4EOOA 2J2IB 3QHWA 5A6NA 2Y9QA 4UEUA 4FV2A 4BCFA 4CRSA 3O2MA 4E1ZA 4L67A 2VO3A 3P7AA 3NUPA 5B7VA 1H08A 5AV0A 3Q52A 2XBAA 4XG8A 4HPTE 3HV3A 1JWHA 4GT4A 4GW8A 3QX4A 1O6YA 5A4QA 2VWZA 2VWYA 4R7BA 3NYXA 2R4BA 4JBPA 3AMAA 3VBYA 1K3AA 4D9UA 4GU6A 3GB2A 4FKWA 3R7GA 4OAVB 3O0GA 4TYGA 3EHAA 1W0XC 4G16A 3RPYA 2XCKA 4QTEA 5C26A 2O63A 3H3CA 1GAGA 4BI2A 3BE9A 4UYNA 5L2TA 2HAKA 2C3JA 3VUIA 3W55A 2BHEA 2YZAA 4WD5A 3HP5A 4AWIA 2P2HA 4BDIA 2IVTA 5KMJA 1DI9A 1QPCA 2XKDA 3PJCA 5DFPA 5LVLA 1BL7A 2VWIA 1WBTA 4LMNA 3TDWA 2H9VA 2BZJA 5CEPA 1TVOA 2XNBA 5ICPA 3QFVA 4JNWA 3HKOA 3KREA 1OL2A 3DPKA 3QA0A 5CXHA 4C2VA 3W2CA 2VWXA 1FMOE 4FGRA 4FK6A 5E8YA 2BRBA 3E92A 5GJFA 5CF5A 4BDKA 3C50A 1KV2A 2VO6A 4FUYA 4FG9A 4TNDA 5DR2A 4L7SA 3PJ3A 4M13A 4D58A 3CKXA 3VS5A 4QMOA 3MY1A 4U41A 4ZJVA 2UZUE 3U6IA 3M42A 3W8QA 5M44A 3NMUF 3ZXTA 4IH8A 3TKUA 2QG5A 5E91A 4BCIA 3F9NA 3R1QA 5D12A 3FMEA 3L9LA 5DR9A 3S1HA 4GFOA 5BUIA 2IWIA 1MUOA 3NNVA 1UWJA 2B4SB 2ZM4A 5TKDA 4QPMA 4H3BA 3PVUA 4F0GA 5BYLA 4NK9A 2IZRA 1BX6A 2RG5A 2YIWA 2ZB0A 3LXKA 4RBLA 4OT5A 5FBOA 4DITA 5KMLA 2YM3A 5B2MA 4BRXA 5HU3A 2VTRA 4IVAA 3EQFA 3BCEA 3FC2A 2BRMA 2YWVA 4CG9A 3ALOA 3C0GA 2QQ7A 3TTJA 2H8HA 2WOTA 4C0TA 3ZSIA 1Q24A 5HNBA 1OL1A 2C5NA 4EK4A 4DTAA 5AADA 3TNIA 4FSRA 4G3FA 2JITA 2EXEA 5FG8A 4UX9A 3W2PA 3TZ9A 4AACA 5L6PA 4BGGA 4CYJA 1DAYA 3HP2A 4BCHA 4EH3A 5KHWA 1V0PA 5JRQA 3FQSA 4GIHA 1YWVA 4RGJA 1XH8A 4J98A 4EZ5A 2WKMA 4EOJA 5CEQA 4EEVA 1YXVA 3IQ7A 4X2JA 3P9JA 3GP0A 4PPBA 4N0SA 4WRGA 1H01A 4YHJA 4KKEA 2PUNA 4TL0A 3N51A 1RQQA 4GG5A 4PMMA 4CFUA 2JIIA 3AD5A 5CU6A 3VAPA 4EH2A 5IA2A 4O2PA 1MRYA 2B9IA 1XO2B 2ITQA 1XBBA 3KXZA 4AA0A 2Z02A 3FPMA 5EHLA 2YIRA 3QZHA 5IA4A 2OF4A 5J9LA 4AZVA 2GFSA 3MIAA 1REKA 2AUHA 4WKQA 4NKSA 3ZO1A 4A7CA 3FMHA 4C4GA 3EL7A 2VTPA 2W1FA 3SW7A 3ATSA 3I4BA 3OVVA 2V0DA 4FL3A 3UC3A 4ZLZA 4IAFA 2PYWA 2ZV7A 4KBKA 4DTKA 5DT4A 4G6NA 4EOQA 2E9UA 2QU5A 3ZLYA 2R3MA 5LWNA 4FIEA 4FTKA 3SVVA 1M17A 5IUGA 3R7VA 2WQBA 4L9IA 5HX8A 2J5FA 3M11A 3PP0A 3ZFYA 1JPAA 1P2AA 2OLCA 4JDHA 2XM9A 1PXPA 4U6RA 5H8GA 4L53A 3EZVA 1ZMVA 4DG2E 3C1XA 3LFBA 1CM8A 3FL5A 1V1KA 4JDKA 1APME 2W1HA 3Q53A 2WTJA 3KRRA 3KY2A 1UKIA 3PTGA 4E5AX 5FM3A 4OUCA 2H96A 4ZJJA 2VTJA 5TO8A 3RKBA 2XYUA 4R7IA 3JUHA 3R8PA 3A7FA 1J1BA 3KB7A 4BKYA 4FSWA 3K2LA 3NEWA 4J52A 2UZEA 4L3JA 5CI7A 3S0OA 4F7SA 2IPXA 2JKKA 5HVJA 4IMYA 4FTRA 3AT2A 2XF0A 3ORMA 4X2KA 2QVSE 2I40A 3PSDA 5CYIA 3QGYA 2J50A 4ZY4A 3BEGA 4ZY5A 4CLIA 1TKIA 4ZTQA 3OCSA 3AC8A 4JR7A 5DRBA 4BHNA 1H25A 3ALNA 3VUGA 3BGQA 3UOLA 4OW8A 3AC1A 4CKRA 5A4LA 3R83A 4Z55A 4AG8A 3Q4UA 2XBJA 4ZS0A 3UBDA 4B6LA 3Q6UA 3QRTA 5ANGA 4D2WA 1J7IA 2HWOA 4S34A 3FLNC 2O8YA 1M7QA 2IN6A 3KGAA 2PZ5A 1PY5A 2WZJA 2OJFE 2J0KA 3D7TA 2X1NA 2VNWA 4MXXA 3DB6A 2VTIA 1M14A 5DWRA 3WI6A 5HE3A 1P4FA 3W2OA 5T6KA 4PP7A 5I9WA 3DDQA 5I9VA 3CJGA 5JGBA 5H8EA 3DXPA 4FG8A 4MHAA 2YZLA 2CMWA 3LOKA 4JBVA 2VUWA 2NNWB 3W2SA 4A07A 1T45A 3EFWA 3HV4A 4QMSA 3H9RA 3ORKA 1L8TA 3PXYA 2GHMA 5CSWA 5C01A 4ZK5A 3S3IA 4FTCA 3C13A 4FZAB 4AT5A 4AU8A 5KMKA 3I5NA 3HEGA 4F99A 1VJYA 2WQMA 3D5XA 1ZOGA 2Y6OA 5ANEA 4WSQA 3MYGA 4C33A 4KKGA 4JIKA 1Q41A 5CALA 2RSVA 4GUBA 3BPRA 4JQEA 4AOJA 4JBQA 4RIXA 4JBOA 4XBRA 5FGKA 5IH6A 2QOBA 2R9SA 5LWMA 5DNRA 2C6EA 5DEYA 1MRUA 4BDGA 4N6ZA 1QL6A 4YURA 3WARA 2XRWA 2W5BA 4DH1A 2XNEA 3KVXA 2VD5A 3MV5A 5E8TA 2I1MA 3G0FA 1PRYA 4FNYA 3DKCA 2PSQA 4IB1A 2WOUA 3HV5A 3PVGA 2XIYA 2XNNA 5GHVA 3UVPA 3LMHA 4DFUA 1BL6A 2C6OA 3BYMA 5CQWA 2Q0NA 5IQHA 2R3JA 4IJPA 5FEQA 3S2PA 4BDEA 4BCMA 4CCBA 4RX9A 4X3FA 2R3LA 1NVQA 3QYWA 5EKOA 4XHKB 3LKMA 5DIAA 4L43A 4QMQA 3DBDA 4RWIA 4YNOA 1G8SA 4RPVA 4Z16A 3K54A 4J71A 1A9UA 1PXKA 5K4JA 4CNHA 3UTOA 4RRVA 4NU1A 1SVHA 5BYYA 4XRLA 4IAAA 5C27A 3FZTA 4EONA 2F7EE 3FMJA 3AT4A 4C3PA 5L2SA 3KXNA 1QPDA 2VX1A 2VX3A 4UB7A 1O9UA 4TT7A 4BBMA 4I93A 3VUTA 5TT7A 3Q9ZA 2J0LA 4AA5A 4ALUA 3OD6X 4XG4A 3ZEWA 4EH9A 3LHJA 5AUXA 3VUDA 1B6CB 3UQGA 1PXMA 2GSFA 5CT0A 4BGQA 2FH9A 5LMKA 3F5PA 3FMNA 5LXMA 4QT1A 5AM7A 4XEYA 4RX7A 5IUHA 2OIDA 2OJIA 1NY3A 3BELA 1WBPA 4FODA 1FPUA 1YDSE 2QOKA 1YI6A 4FKJA 4XLVA 5EYKA 4WNOA 4TYHA 2BIKB 4U97A 2WHBA 5AR8A 1SM2A 4EOSA 4AT4A 1OIYA 4UMUA 2JDSA 3ANRA 4KINA 4YJTA 4F0IA 3BHHA 4F4PA 5KMOA 3QWKA 4FT9A 3DBQA 5CVGA 5J1WA 3GQLA 1KWPA 2ZM1A 4ZLYA 3VJNA 4ZSAA 4EOIA 5CLPA 1FINA 3V6SA 2ONLC 4E93A 4V04A 1ZOHA 4R3PA 4HW7A 2WMVA 3Q2JA 4R3CA 5DHJA 5ITAA 1FVTA 3JVRA 1OECA 1FQ1B 4RJ4A 4CZTA 3CD8A 3OXIA 4G5PA 3EN4A 4O0TA 3LMIA 2OH0E 3PLSA 5EOBA 4IM0A 2FYSA 2J5EA 3FLWA 3MA3A 1BUHA 4HGSA 2C3LA 3EJ1A 2ERZE 4GRBA 5I3OA 3U9CA 2WMRA 4QMZA 1JKSA 3DBCA 4ZZOA 3BQCA 3EQHA 3W16A 3V8SA 5E4HA 4DT9A 5DOSA 5BUEA 4CGAA 2UZLA 3QBNA 5I9ZA 1LR4A 5H3QA 3QRIA 4JRVA 5H2UA 3S4QA 2PVFA 3QKMA 2W06A 4DC2A 1JKTA 3D7TB 2YIXA 2ITPA 4IFCA 2CGVA 4KS8A 4RG0A 4WO5A 3ZRKA 3BLRA 5AP5A 4UMRA 4CG8A 3R2BA 5LVPA 2XK8A 3DK3A 4FSYA 4O96A 1JBPE 4EYMA 3KVWA 3OEZA 3RWPA 4FEXA 5DVRA 3RNYA 3TIYA 5L6OA 4RJ6A 1I09A 1DAWA 1YWNA 3LJ0A 3NS9A 4L46A 2EXCX 4J7BA 1W83A 4RVTA 4YBKA 3PRIA 3ZUTA 4EBVA 4NYEA 3BIZA 1VYZA 3LLAA 3I1AA 5AUUA 3UMXA 5HORA 4JG8A 5HLPA 5J7BA 4AE9A 4PY1A 4MBIA 4P90A 5ANKA 5AV1A 4JG7A 2E9NA 4WBBB 2UVYA 4YJRA 5IQEA 4NCTC 4JG6A 4ZTHA 1KE7A 4DH5A 4C4EA 3OW3A 2WXVA 4RIXB 4BCOA 4O7LA 3BGPA 3QTZA 4LGDA 5HO8A 4AP7A 4BBFA 5IU2A 2PVHA 1YDTE 4LGHA 4I92A 2W05A 3EFKA 2OZAA 2CCIA 4Y72A 3MWUA 2W1ZA 4I5HA 1Q8YA 3BEAA 5D7AA 3ZO2A 2OBJA 1XH4A 2HZ0A 3W2RA 2G2HA 3TUCA 2BALA 4NH1A 5HNGA 4ZSLA 4AN3A 3I6UA 4FG7A 2XNOA 3UC4A 1REJA 5CEKA 4HYHA 3E62A 2ZMDA 3FKLA 4FSTA 3IW5A 2HZNA 2ETKA 5HOAA 4B7TA 4X3FB 1QCFA 3PWDA 3EQCA 3PA3A 4D1SA 4NJDA 4FKSA 2HZIA 3U87A 3RPOA 2E2BA 2R0UA 2UW4A 4G9RA 3T3VA 4XG3A 3HAMA 5A6OA 4DGLC 2YDKA 1WVXA 4QMMA 2QOHA 5AUTA 4DLIA 4RQVA 3MVLA 5J9ZA 2UUEA 1SVGA 4X2FA 5HKMA 3RGFA 3TXOA 5FXRA 4XV3A 3NNWA 2J0JA 4FEUA 4ZSEA 2F49A 4GIIA 3ETAA 3O7LD 2YIQA 4YJUA 5A4TA 3SDJA 4AZTA 2BR1A 3TUDA 4CCUA 1IRKA 3LCTA 5G6VA 3PJ1A 5I9UA 4HJOA 4F1TA 2WTKC 4IWPA 4L00A 1U59A 5E7RA 3A8XA 1LPUA 4R1YA 4RJ5A 3TV7A 3WIKA 5KCVA 3RWQA 3OHTA 3NLBA 1H1SA 4ZMEA 3ACKA 1IASA 3T3UA 4BDJA 1H8FA 4JLCA 3FI3A 3ZRLA 2OWBA 3AD4A 1OKYA 3OF0A 2PHKA 3T9IA 2E9VA 5BMSA 1STCE 4FTIA 4TYHB 5IQFA 3NPCA 1SVEA 2VTQA 4AGWA 5HESA 2V22A 1DM2A 3F3WA 2CKOA 1O6KA 3IDBA 4X7QA 4RC4A 5L2WA 2CNQA 3OWPA 5AEPA 5FXSA 2JAVA 4FIFA 5DR6A 4F65A 4MBLA 4FOCA 3UJGA 3H9FA 1Q61A 5LVOA 4O22A 4BYIA 4MF0A 1OBGA 5AP6A 3PG3A 3V6RA 1GNGA 1FGKA 1IA8A 3PPZA 5ANIA 3GOKA 4C34A 1J3HA 4P2KA 3ZYAA 4DHFA 4W8DA 3FL4A 4WNMA 4O27B 3GFEA 4ACGA 4PDSA 4HNIA 3ZDIA 2CDZA 3DZOA 4GMYA 4KS7A 3L9NA 5L6WL 1H28A 4ANSA 4AW5A 4HVGA 4DG0E 4B4LA 4Y5QA 5JQ8A 3UZPA 2XS0A 5TOZA 2C5VA 2OFVA 2BILB 2WMQA 2QHMA 1XQZA 4YTHA 4DEBA 5KO1A 1ZOEA 2YCFA 5AFVA 3IONA 2BDFA 2R3HA 3PFQA 4ZSJA 4CMUA 3AC3A 1CMKE 4V05A 4IZAA 4QQTA 1PMEA 3H9OA 5GIOE 2GTNA 4QTBA 4C59A 2IG7A 4ZOGA 4G17A 3V5WA 2BRGA 2QO7A 4DCEA 2C0OA 4GYGA 4PDOA 3SRVA 4BKJA 3QZGA 2IVSA 4R5SA 1Q8UA 4NEUA 4K33A 3JS2A 4PTEA 5GZAA 2R3KA 2PMIA 2UW5A 5AR7A 4IX6A 5M57A 3MPMA 2C47A 2ZVAA 4QP8A 2GU8A 3A62A 2OZOA 3IKAA 3ZTXA 5HD4A 2JKMA 3OTVA 1UA2A 4YJSA 1HOWA 2WTWA 3FKNA 3RM6A 4RT7A 3JVSA 3VS3A 4IAIA 5F9EA 2Z7QA 2CKEA 2RL5A 5AX3A 3ID6C 2A1AB 3QTIA 4G5JA 1Y6AA 2OZAB 4D2VA 4GK3A 4N57A 5EW3A 3TZ7A 3HECA 1WBNA 1PHKA 2YAKA 4E7WA 5CXZA 3CY2A 3RP9A 2X0GA 2GHGA 4L01A 5DT0A 4TWOA 3QHRA 5HLWA 2V7AA 3D94A 5ETAA 1Q4LA 5JFWA 2XNMA 1OGUA 4ZY6A 2PU8A 3BU5A 1OIRA 5BMMA 4EBWA 3BYUA 4APPA 2VTHA 3KC3A 2CLXA 4AXAA 3UNKA 4Y83A 4GUEA 5A3XA 4BI1A 4R5YA 5AR3A 4O84A 5EDQA 3EMGA 4G34A 4R6VA 2Z2WA 3QQHA 3KU2A 1H1RA 4HCUA 4IX5A 4BIBA 2OH4A 2XIZA 4FT5A 1H0VA 2V62A 4KIOA 4W4VA 2WEVA 5LCKA 3QX2A 5JGAA 4IW0A 3O8UA 3HLLA 3OWLA 4CEGA 2JBPA 4LFIA 4PDPA 2AYPA 4KB8A 4JXFA 4M12A 3Q4CA 2BAKA 4R3RA 4ZJIA 3RAIA 4E4LA 5KX8A 3ZMMA 3CP9A 3PDTA 3JR1A 3DTCA 5A4EA 4FNWA 4BHZA 5KKRB 3TNPC 2FSLX 4BF2A 1MQBA 1PMVA 2BTSA 2XJ2A 4E3CA 3E64A 4BDFA 4EKKA 3ORTA 3QL8A 4DT8A 5D9HA 2J51A 1U4DA 3R28A 5D41A 4IWDA 2ETRA 5E1SA 2BRNA 4DGMA 5ETCA 4KBAA 2Z7SA 5HEZA 3W8LA 5J1VA 3FKOA 3M1SA 3BV3A 3N9XA 3O50A 3OCGA 3L1SA 4XG7A 3R30A 4JQ8A 4O0RA 3G9LX 5JT2A 4A4XA 3AMBA 4XCUA 3DAJA 3FLZA 2ITYA 4U9AA 3NUYA 4EORA 4F1MA 3TZMA 3OY3A 3F3ZA 3DOGA 4PL4A 5HX6A 4QMYA 3PY0A 3O17A 4RFZA 4TWCA 3C5IA 3QCQA 4PL3A 4RSSA 5EW9A 3S00A 1H24A 2WAJA 4KNBA 2P3GX 2XKCA 4RQKA 4XJ0A 2ITXA 4ALWA 5K0XA 2RFEA 3VS2A 3NX8A 4O6EA 4CFMA 3THBA 4CKJA 3QA8A 2A0CX 5CX9A 3G15A 3NUAA 2UZVA 4QTDA 3DDPA 3D5UA 3PLAE 4YJNA 5T3QA 3ZOSA 1H1WA 2XCHA 5CU2A 2R7IA 3K5UA 4RJ7A 3PWYA 5HCZA 5IPJA 1XKKA 3PJ2A 4UMTA 3MH1A 5C4KA 3SRVB 3V01A 2C0TA 4QP9A 1OL7A 5AUZA 3WZKA 3CKWA 4X0MA 3PA5A 2W17A 3R21A 3BKBA 2JDVA 4DG3E 4IEBA 1GIJA 4PRJA 4LV8A 4DYMA 2GPHA 4QO9A 3DXQA 3SW4A 4DAWA 5IQGA 3PIZA 3G6GA 1H0WA 1SMHA 4IQ6A 4I41A 3ZO4A 2PUPA 2ITNA 3ORXA 3FV8A 3NCGA 3PG1A 5CWZA 3RZBA 3C9WA 1URCA 3ZFMA 4O0UA 2XA4A 4FKRA 4UMQA 4CTCA 1PF8A 2G2FA 3LPBA 4OTWA 4R1VA 2J7TA 3QQGA 4PQNA 2PZRA 1YDRE 2YJSA 4NW6A 4RIWB 1O6LA 3F88A 4I6BA 2QU6A 4IM3A 1FBNA 2UW7A 3GENA 4E5WA 4M66A 3AGLA 4CFVA 2GQRA 4DFYA 4XS2A 5AUYA 5DBXA 3E93A 1OZ1A 4IC8A 2XK9A 5C9CA 3LFDA 4HYSA 4BCGA 1G5SA 4DFXE 2FSMX 3EB0A 2ZYBA 3KXHA 3HRFA 4GFMA 1WCCA 4YC6A 3R8ZA 4D4SA 4DINA 5JSMA 2EXMA 4NTTA 4DLJA 3QC9A 2E9OA 3D14A 5AV3A 2GNFA 2QOLA 5HG5A 3CJFA 2BRHA 3FZPA 1FOTA 4FTMA 5HCXA 4ERWA 5HTIA 3U6JA 1YXUA 4QOXA 4A9UA 5AMNA 5CVFA 3ZUUA 2PUUA 4DEHA 3NW5A 4KSQA 3MESA 1YXXA 3CR0A 1BLXA 2XK7A 2GCDA 4FI1A 1ZYCA 3KULA 2CN8A 2OF2A 1HCLA 5CVHA 1ZYLA 4UY9A 5F1ZA 1X8BA 2CGUA 4HVDA 2GS2A 4D5KA 3OS3A 5BQ0A 4U7ZA 5EH0A 3F5UA 2Z8CA 2KULA 2QURA 4BICA 5HE1A 4IB5A 4D0WA 2W1CA 3QXOA 3R7OA 3HMPA 4RIYA 4ZZMA 3EQGA 5EDPA 3WOWA 3OFMA 4ZTSA 1R3CA 2JDOA 3PA4A 4CYIA 4BIDA 3A2CA 1W84A 2PL0A 2Q83A 2GNLA 4YHFA 2X4ZA 5CANA 4ANLA 3PXFA 5HCYA 4CLJA 3FXWA 3EYGA 4KWPA 1AD5A 4G6LA 4ARKA 2ITUA 2W99B 3M2WA 2R7BA 5HE0A 4D2PA 4EK3A 3TWJA 2P2IA 4S30A 3RMFA 3ZFXA 5L4QA 4GFGA 1UNGA 4XG6A 5CI6A 2JGZA 4ORKA 4NKAA 5EQPA 5EI2A 4FIGA 3GC7A 3ENHA 4H05A 4OLIA 3ZEPA 3FSFA 3F2RA 4U40A 4HVIA 3Q9YA 4L3PA 4FZ7A 5D11A 5AM6A 3HMMA 3T9TA 3FI4A 4ANMA 4XX9A 4FGBA 4YZBA 3HA6A 2BHHA 2ZDUA 4X3JA 2JKQA 4H3PA 3GBZA 4H1JA 2OXDA 3D4QA 3RAWA 2CJMA 5K3YA 4FVRA 1XR1A 1Y8GA 1XHAA 1R39A 3LM0A 3FMDA 3GCVA 2UZBA 1UNHA 3BLQA 3Q6WA 4FYOA 3WBLA 3LFQA 4FNZA 4C4FA 4H58A 5M4IA 3FZSA 3KL8A 2IW8A 3SQQA 3GCPA 3HNGA 4MD7E 4Y5HA 2B9JA 4YR8A 3VULA 1PYXA 3GU8A 4JDJA 4LOOA 3A7JA 4IXPA 3UYTA 5IA3A 3AOXA 1QPJA 2GQSA 4BKZA 3R1SA 1S9IA 3IK3A 5IH5A 5DT3A 4RA4A 4EK8A 3VRYA 2YCRA 5AV2A 2DUVA 3CQUA 3OUNB 3TV6A 3GGFA 5FM2A 1UU7A 3QWJA 4C8BA 1J1CA 4CMTA 2CNVA 4Y8DA 3UGCA 3MS9A 5FXQA 3LFCA 3K3JA 2JBOA 2UZTA 3KN5A 3PVBA 4K18A 3T8OA 4GKIA 2HXQA 3QC4A 3FQEA 5M53A 3RCJA 3EQIA 3ZONA 2BCJA 4EHEA 2Y6MA 4FKIA 3WE8A 5CEIA 3MB6A 3OTUA 1H1PA 5K9IA 2PUIA 4BDHA 4LRMA 3VUHA 4EUUA 4BCPA 3RI1A 4FV9A 3MH2A 3LCSA 3G0EA 4HNFA 1IR3A 4E6CA 4QP2A 2QOIA 3A7GA 2H6DA 2OW3A 5BUJA 1YHWA 2XK4A 5EFQA 5HD7A 2C69A 1LEWA 3ZBFA 4AZEA 4D9TA 3K5VA 3QKLA 3NVMB 4FV7A 2OXYA 5J8IA 4O81A 3S95A 2BKKA 3I0QA 1NVSA 2PVRA 1XH5A 4GT3A 4EL9A 4UV0A 4EC9A 1CDKA 5JH6A 4G3EA 4DA5A 3WZUA 1BMKA 3G2FA 4DGGA 4MYGA 5HHWA 3HRBA 5M06A 1YKRA 1OPLA 5IA1A 4M67A 5CZHA 2WGJA 4IHPA 3KULB 2YJRA 3BQRA 3CTJA 5K0KA 4BDBA 4EHVA 1NT2A 4IACA 3RPRA 3R8UA 1ZRZA 3VC4A 3QAME 4MX9A 2C4GA 1FMKA 5CU4A 2IO6A 5FTOA 3QD3A 4RWKA 2VGPA 1CTPE 2BPMA 3DZQA 3Q32A 1UU8A 3W10A 3TEIA 4EZ7A 4USEA 5AJQA 2O0UA 4K0YA 1U5RA 2J9MA 4RJ8A 2YCQA 2JC6A 2WMWA 3KCKA 5IEVA 4ANQA 2YHVA 3ACJA 5M56A 3UPZA 3LQ3A 4OBPA 2I0EA 3DK6A 4ITHA 4XP3A 3U4WA 4A9SA 4BTMA 3SV0A 2QR8A 3I7CA 3MBLA 4FTQA 4EI4A 4ENYA 4C3RA 3FZRA 4YZNA 2I0YA 4FTJA 4J53A 3KRLA 3PE2A 1QMZA 4EQMA 4O2ZA 2OG8A 4EH6A 3ZZEA 2BFXA 1CKIA 3OCBA 4IVBA 4D2RA 4QD6A 3BHUA 2IZTA 1P5EA 3KA0A 3F69A 3VBTA 4F6SA 3VQHA 4XOZA 4D28A 3HX4A 3MH3A 3NUNA 3QUEA 5FEEA 1LP4A 2VAGA 3PIYA 4IZ5A 4XBUA 5HQ0A 3LFFA 4BWPA 2UVXA 3R9NA 3NDMA 4I1ZA 3SA0A 5DRDA 4W4YA 3IDCA 5EKNA 4O38A 5HIDA 5AR2A 1GIIA 2R3NA 4G9CA 4QP4A 2CGWA 3RZFA 3L8SA 3DGKA 3QZFA 3HYHA 5AR5A 3U8WA 4AQCA 2RKUA 4BR3A 3IS5A 2YEXA 3C4FA 1CKPA 1OPKA 4BI0A 1H07A 3F5XA 5JGDA 3JY9A 5J5TA 1OKWA 3MGYA 3AMYA 2QR7A 4FZFB 1M7NA 4QYFA 5AP4A 2WQNA 2WU7A 3R22A 5C8NA 5DYJA 4YHTA 3ROYA 1XH6A 4USFA 5K5NA 4OTPA 5GINE 3R1NA 4O86A 2ZJWA 4E8AA 4NW5A 3GXLA 3DBEA 4MXCA 5BVDA 3BI6A 2AC5A 3TNWA 3W2QA 4EH7A 4EK6A 1IAHA 4F9CA 2A2AA 3NSZA 3R7UA 4M68A 4BYJA 3B2TA 3OT3A 4G3GA 4LV5A 4D4RA 3OROA 2R3PA 3BYOA 3NYVA 4RX8A 5I3RA 3PXKA 3SAYA 1F3MC 3PVWA 4IBMA 4FKPA 4DF3A 1Q8WA 4PMPA 3KRWA 3UQFA 4PMSA 4A9RA 4AW0A 4EHGA 5IDNA 4UN0C 5IQBA 3COIA 4G2FA 1KOBA 3EOCA 5IF1A 2BVAA 3R7YA 2WPAA 3KF7A 3P5KA 4MBJA 4MF1A 3UVRA 5I9YA 5JFVA 4I5CA 3C5UA 4FIHA 4YPDA 5KBQA 3A8WA 4O83A 3A7IA 4UWCA 3RVGA 3G51A 4TXCA 4LUDA 2X9FA 4O1PA 4X3FC 5BYZA 1G8AA 2QCSA 4O7WA 3Q3BA 5CSXA 5ACKA 2SRCA 3QD0A 2R64A 4CV8A 2RF9A 3E3BX 5HIEA 4DH8A 3VVHA 4I21A 5JN2A 1J91A 3EN6A 4DEIA 2HW7A 5AP2A 5DA3A 2IZSA 4FIJA 3D0EA 2EVAA 2WMSA 3HV6A 4G31A 3TT0A 5L8KA 5M4CA 5DI1A 2WIHA 4LOQA 4YUQA 1W7HA 5HO7A 3BHVA 2W1DA 4MH7A 4F08A 2PK9A 3JPVA 1VR2A 5C1QB 1DS5A 3FHIA 4BFMA 5HU9A 5C03A 5KBRA 3UP2A 4RLKA 1U46A 4M97A 1ZYDA 4PTGA 4QRCA 2XB7A 5BPYA 4O7NA 3SGCA 3RNIA 3QD4A 2ITVA 5LMKC 4G6OA 3TCPA 2OXXA 2WTDA 3UDBA 1KE6A 4FV4A 5FP5A 4AGCA 4EWHA 2XJ0A 3LFAA 3SKCA 2XZSA 3KXMA 3N4TA 5KHXA 3Q04A 4C35A 4F7NA 2HYYA 3MJ2A 3NCZA 4WOVA 5E8UA 4JS8A 4UZHA 1KOAA 1YQJA 5B2KA 3RAKA 3UG2A 4ACCA 3F2AA 4FT0A 3DJ6A 3MN3A 3AC5A 2NRYA 4TZRA 3MB7A 3FZOA 1PXIA 4P5QA 4FV3A 4IE9A 4RFYA 1YOJA 4O0YA 5ACBC 4UBAA 3EYHA 1URWA 3MJ1A 3Q2MA 4IFGA 1YXSA 3O8TA 1S9JA 2Y4PA 4RC3A 3GOPA 5AA9A 3EKKA 3LLTA 3EFLA 2Z7LA 1SYKA 2JKOA 4QMNA 3A7HA 2VN9A 5H9BA 3VNTA 3KXXA 4BWXA 5M51A 2JAMA 3C4ZA 3QALE 4ZMFA 3AC2A 5CAPA 2PPQA 5HVYA 3HV7A 2UW9A 2VWUA 4E6DA 3MSSA 3BRBA 4O7SA 4ITIA 1WAKA 3MW1A 2VTNA 2XVDA 4NTSA 4P7EA 3E3PA 3RK5A 2Z7RA 3ROCA 3ZS5A 2F2UA 2W4KA 4F0FA 2JIUA 3DKGA 3LCOA 4K77A 5GJDA 2YFXA 4Z7GA 4EUTA 5EM6A 3VUKA 4YJQA 3WILA 1RE8A 1PMNA 4JIAA 4E4NA 5HO6A 4EJ7A 4C61A 3U55A 4U8ZA 5KMNA 2CSNA 3B8RA 2YM7A 3OUKA 4GJ3A 4S33A 4M0ZA 5FDPA 1M2RA 2C6LA 3FLYA 3QYZA 3R9RA 5HG9A 2UVZA 3VBWA 3LCKA 4LRJA 5C8KA 2BFYA 4GCJA 3E88A 3O51A 2WFYA 4IWOA 2BROA 1OI9A 2QOFA 5J5SA 3E7VA 1XBCA 2R2PA 4L52A 4U0IA 4A4OA 5AV4A 4EHZA 3FJQE 4TYEA 2DQ7X 4QMUA 4IANA 4CFFA 4FTTA 4Y46A 3UVQA 3KQ7A 3NNXA 4LM5A 2YCSA 4EKLA 1OBDA 2OICA 4YLKA 3MDYA 3V04A 4U45A 4RIOA 4AZFA 3LM5A 2YA9A 4B8LA 4CXAA 4Z9LA 4EOLA 2X6DA 4ASDA 3DCVA 3DFCB 5J95A 4PDYA 4L42A 5JEBA 4DEAA 4RC2A 3COMA 3D9VA 2WQEA 4IM2A 3AQVA 4E20A 1ATPE 3KRXA 4DH7A 2O3PA 2RFSA 3VWAA 3EN9A 4AS0A 3TTIA 1Z57A 3ORNA 3FWQA 3WF8A 4UYAA 4UMPA 4BWKA 2OO8X 3N4VA 4TYIA 3A4OX 1ZMUA 4YP8A 1ZARA 3ZLXA 2J90A 4I6QA 4FICA 4FT3A 4I5PA 3RJCA 4I4EA 2I7QA 3VBXA 3VIDA 4H39A 2O64A 4PPCA 5BNJA 2XK3A 3GI3A 3P08A 3KMMA 4IB0A 5EM5A 3NUUA 5BX0A 4Y85A 5AP3A 3Q4ZA 3KK9A 4BN1A 1TQMA 4L68A 1DI8A 2QODA 2DWBA 5DLSA 3DAKA 5DEWA 3BYSA 4YO4A 3IPHA 3EH9A 3ENMA 3F66A 3GU5A 5HVKA 1MP8A 1PKDA 1WVYA 5TR6A 5IA5A 1WBOA 2W5HA 3FC1X 4WBOA 4JAIA 1FVRA 3MI9A 1YHSA 2F4JA 3FQHA 2PZIA 3E87A 4DFNA 5C4LA 3DQXA 5CZIA 3DFAA 5HGIA 2C1BA 3V8TA 3CD3A 4I5MA 4ALVA 4M0YA 3UIXA 4AW1A 2W7XA 2WELA 3VF8A 5A46A 4DE4A 3P7CA 2G1TA 5A14A 3ZO3A 4IX4A 1OKVA 5E1EA 3OBGA 4ZSGA 2VZ6A 3CE3A 2BAQA 2YERA 4BZNA 1XWSA 4MQ1A 1MRVA 4TKSA 3SHEA 3LMGA 2QI8A 2IW9A 5I4NA 1PXNA 5EK7A 2NP8A 5HNIX 3L9MA 3WF9A 2P33A 4KKHA 4IWQA 3I5ZA 5CT7A 2ZM3A 1UKHA 3FAAA 4JL9A 4GVJA 4YZDA 1A48A 3LFSA 4F7JA 4LG4A 1ND4A 1BI8A 1P14A 3H30A 4LMUA 3FLQA 3QTQA 4D1ZA 2C5XA 4I20A 3QCYA 3UP7A 3QQLA 3O8PA 4F6UA 3LJ2A 3RTPA 3BWJA 1IAJA 1OM1A 4FTNA 5CF8A 3BZ3A 2XRUA 3IG7A 3SD0A 4CQEA 3DB8A 3IDPA 5ANJA 4USDA 4LRKA 5HLNA 2EB3A 5HZNA 3HGKA 3UODA 3VHEA 4EOPA 2B7AA 1BKXA 1AGWA 3MIYA 1ZMWA 2W9ZB 2HY0A 3IW4A 4RX5A 4AUAA 3ZRMA 4FTLA 4NZWB 2UV2A 5CNNA 4CRLA 3QXPA 4Q9SA 4BGHA 5I5ZA 1XH9A 4XP0A 3VS0A 3LXNA 3ATTA 4J96A 3UOJA 2B9FA 3MVMA 5GZ9A 3ZU7A 3FMLA 3E8DA 1K2PA
chains in the Genus database with same CATH superfamily
3TZ8A 2OJJA 3EN5A 4MQ2A 4H1MA 3BBWA 5GIPE 4C02A 4V0GA 1Y6BA 3GU4A 5CAVA 3KF4A 5EM8A 4FR4A 5CF6A 2ZV9A 4M3QA 3POZA 4DHIB 4DFZE 5FQDC 5JQ5A 1Q3DA 2XNGA 4YZ9A 3WE4A 3U4UA 3V3VA 5DMZA 4KRDA 3SXRA 3GNIB 3UNJA 4ZEGA 4NM3A 4AAAA 2IZUA 4FTUA 4LOPA 3F6XA 3FYJX 4U3YA 4KIQA 4K1BA 5GNKA 2BIYA 2HK5A 2CNUA 5ETIA 1GZOA 3OXZA 4AE6A 4XUFA 2JFLA 2PTKA 4RVKA 3CBLA 4TY1A 4AZWA 4O7ZA 5IG1A 2PE2A 3WF6A 3JXWA 2W96B 3QTWA 4TWPA 4YSJA 3ITZA 3QF9A 3F3TA 2C6KA 1GZNA 1LUFA 2YACA 5H8BA 1PYEA 3PPJA 4HCTA 4FSUA 5HBJA 4TNBA 3VJOA 2BZIB 1XH7A 1ZZ2A 4I4FA 3A99A 4ANBA 5IH4A 3UDTA 4HZSA 4HGEA 2XJ1A 5HIBA 3NIEA 4O0VA 4OBQA 3V5JA 4U42A 5IISA 2I0HA 2XKFA 4PP9A 5A54A 2ZAZA 4WG5A 5AX9A 1JKKA 4ZTLA 1KE5A 1ZYJA 1H27A 1PKGA 3UQCA 2CKPA 3W0QA 2G9XA 3KEXA 1QPEA 1ZZLA 2GMXA 2HZ4A 2OJ9A 1P4OA 2P0CA 2QLUA 3HA8A 2AEGA 3VUMA 3MFRA 2RFNA 4FL2A 4GEOA 3ZCLA 1W82A 4KUJA 2WEIA 3E8CA 2W5AA 5FLFA 4YSMA 3IOKA 5AWMA 4GYIA 4DEEA 3HMNA 4EQCA 5LMAA 3C0IA 4HZRA 2YM8A 4O7VA 3HUBA 4IZYA 5TE0A 4B99A 4D55A 1MQ4A 3F2NA 4A06A 1YVJA 2PVKA 5L2QA 2BZHB 3DU8A 3MH0A 3ZZWA 2IEWA 1Y8YA 2OSCA 3DJ7A 2GQGA 2UW8A 1PXOA 4MXOA 4XG2A 3ZC6A 4JR3A 4MXYA 4NT4A 4XYFA 3PZHA 5AIKA 3O71A 5F20A 5FWKK 4A9TA 3POOA 4X2GA 5IA0A 4RMZA 5CU0A 4JI9A 4UALA 2OIQA 2QD9A 1OVEA 2OGVA 5CEMA 2HXLA 3EQBA 4N4SA 4PNKA 3C4CA 1V0OA 4GV1A 2VWBA 3NW7A 2PE1A 4WSYA 3FXXA 1H26A 4IAZA 4MTAA 3MVHA 2VGOA 3LVPA 4O21A 4W4XA 3VS1A 3ZSHA 3PUPA 3UMWA 4GU9A 3C4XA 4FKTA 3NNUA 5F95A 4WRSA 5AUWA 3W1FA 4JAJA 4BDAA 3EQRA 3KN6A 3RPSA 3VF9A 1Z9XA 2PMLX 4I0SA 3NRMA 4EQUA 4PUZA 3IGOA 2CCHA 3ELJA 4II5A 5CAQA 1RJBA 3EL8A 3CTQA 4KAOA 2RG6A 3IGGA 3LJ1A 5TF9A 3SOCA 3LXPA 2WIPA 3TV4A 4E4XA 4UXQA 3BL7A 1KE8A 3PXZA 4EH8A 3EFJA 4QQCA 1FGIA 4RA5A 4BIEA 1UVRA 1F5QA 2Y4IB 4I94A 2O65A 2YABA 4QMXA 4Z7HA 4OTGA 5E8ZA 4ITJA 3VS6A 4EZ3A 2UW3A 2EUFB 4NUSA 3C7QA 5HG7A 3HL7A 3W18A 4X2NA 4DEDA 3LZBA 5E8XA 3OC1A 4XLIA 2C5OA 4XG9A 5JKGA 2R5TA 4QTCA 4E6QA 3CTHA 3QTXA 3IW6A 3TJCA 2HWPA 1V0BA 4IDTA 1H4LA 5HBHA 4JDIA 5KZIA 4S31A 3IW7A 2JD5A 3RCDA 3UO4A 4B8MA 4QTAA 4O1OA 4V0GB 3TACA 4YPSA 3MPAA 5B0XA 3W32A 4F09A 5JZJA 1AQ1A 3ZXZA 2R3QA 3ORIA 4KABA 1E1XA 3QU0A 3GC0A 5EHYA 1WBSA 3WIGA 2XH5A 4JX7A 2X0QA 3RK7A 2DS1A 5FEDA 4GL9A 4Y73A 4OAUC 3FI8A 4C7TA 3CGOA 5EQYA 3U6HA 4ZIMA 2OKRA 5LVMA 4OTQA 3F5GA 2OJGA 3H4JA 2GNIA 2B54A 2F2CB 4TPTA 5HI2A 2IJMA 4I0RA 4ZXTA 4WHZA 2XANA 3LE6A 2EU9A 3Q9WA 2JIVA 5AAFA 4M7IA 5EYCA 4JOAA 2A4LA 5IUIA 3TN8A 3CQWA 4OT6A 3TYKA 4IVDA 2NPQA 4QMPA 4F1OA 2I0VA 4CZYB 2XIXA 4L3LA 2PWLA 4QYGA 5FUTA 4I6HA 4FF8A 1Q3WA 1G3NA 3U9NA 5BVNA 4D5HA 2WTIA 3I7BA 5E8WA 5HTBA 3C4WA 3EZRA 3NAXA 3R63A 3KMUA 3H0YA 1WBVA 3D15A 4Q2AA 3KMWA 4DFBA 3BE2A 2XK6A 3V5QA 3CC6A 3GU6A 2XUUA 5AR4A 4BTJA 3E8NA 5EM7A 3CPCA 3N4UA 1TQIA 3P86A 4NFMA 2JEDA 3A4PA 4ASEA 3OT8A 5IMXA 5CS6A 4CKIA 4HOKA 4YLJA 2E9PA 3MPTA 4X6RA 4QQJA 4Z3VA 1YI4A 4ZZNA 2QOCA 4FT7A 4QYEA 4J8NA 1I44A 5CAUA 2BAJA 2X2KA 3EN7A 3EQDA 2VV9A 4AT3A 1UU3A 2V5QA 2Y7JA 3QUPA 4MWIA 2A27A 4W9WA 1ZWSA 3GCSA 4QNYA 3OOGA 1VZOA 1CSNA 4LL5A 3W0NA 3F82A 4ZLOA 1BYGA 2GNGA 2ZV2A 4TRLA 3VQUA 4S2ZA 4FEWA 5LQFA 4AA4A 2X4FA 3I6WA 1GZKA 5F94A 3VW8A 4JJRA 1OL6A 5CY3A 4QP3A 4WNKA 3I0OA 3BX5A 4RZVA 4BB4A 3TL8A 2WTVA 4BL1A 1EH4A 4D1XA 4E6AA 2GNHA 2V7OA 3UIMA 4MAOA 5L8LA 2X2MA 4ANOA 4UWBA 5ANOA 4XV1A 2HOGA 1KE9A 1JSUA 3I81A 1HCKA 4I24A 5BVFA 2PULA 4J95A 4D0XA 4PPAA 4FV0A 4HYIA 3UZRA 4M14A 3AC4A 3RPVA 1U54A 2X0OA 4FVPA 3HMIA 3ZHPC 4A9YA 1J7LA 1UV5A 4LGGA 5EYMA 1WVWA 3AKLA 3SX9A 2YIYA 3OP5A 4NL0A 3WYYA 2B53A 3B2WA 4AX8A 4E5BA 3F3VA 3VHKA 4NSTA 3I60A 3DJ5A 3OCTA 3RINA 5LVNA 5M09A 4J99A 3V5PA 5HTCA 5M07A 4M15A 3UIUA 4LL0A 1WFCA 3NFGB 4MD9E 4UWYA 4LYNA 5DG5A 4PV0A 2C68A 2W4OA 2J4ZA 5EQEA 3TNHA 5HE2A 1OUKA 3R73A 1WBWA 3RALA 1H1QA 4W4WA 3ZDUA 2WMXA 1YOLA 4FIIA 3F3UA 4AGDA 3CSVA 5KNJA 5AUVA 3F7ZA 2YISA 5J79A 4C57A 5KMMA 5DPVA 4FL1A 4FV1A 4CVAA 4X6QC 4C37A 3QQKA 4N6YA 2YLEA 3BU6A 5FTGA 2XEYA 5CTPA 1W8CA 4G3DA 1NA7A 4RIYB 2UZDA 3GQIA 1Z5MA 3P0MA 4XP2A 2IW6A 2HIWA 2A98A 4FTAA 2X9EA 4YZMA 2XP2A 3QQUA 1GZ8A 3PPKA 2CKQA 3V51A 4BZDA 4FEQA 1YW2A 2VTTA 5L8JA 3E7OA 1M52A 5ETFA 4U5JA 2ERKA 2FVDA 2G15A 2XMYA 1GIHA 2C6DA 2R3FA 2Y0AA 3MTLA 3P78A 1YRPA 4G3CA 5IEYA 3DXNA 5ANDA 3NUXA 2BDJA 4ID7A 3UIBA 3QZIA 3VRZA 5CF4A 4HGLA 4CQGA 3C0HA 2Z60A 1ZAOA 5LJJA 4L8MA 2OI4X 4DDGA 4OR5A 5CENA 2CGXA 3R9HA 2C1AA 2C3KA 1Q8TA 2UZOA 2YM6A 3ZLWA 4EK5A 2X0PA 3OG7A 2YDJA 5EI6A 2UW6A 2W1EA 3PE1A 3DK7A 4F6WA 4IC7A 4NJ3A 3DLZA 1E1VA 5LARA 3F7WA 4FNXA 4RZWA 5GJGA 3RHXA 3GFWA 3TKHA 2O2UA 4QDEA 3G90X 3CS9A 3OWJA 3RHKA 4OTFA 3BBTB 4RJ3A 4F9AA 4BDDA 4F9YA 4U44A 1B39A 1SZMA 3NW6A 4QYYA 4RLLA 5M4UA 2UZNA 1XBAA 4HGTA 4XRJA 4AN9A 3UO5A 2W9FB 2XAOA 2P4IA 3PSCA 3BYVA 4TWNA 4F9BA 2HELA 4GT5A 4HPUE 4QYHA 2JFMA 5JZNA 2BMCA 4U81A 2PVNA 3JYAA 4LQMA 3ZBXA 2I6LA 1T46A 3L8PA 4RVLA 2AC3A 3PYYA 3MFTA 4I23A 1PMUA 2Y8OA 4W8EA 5FTQA 4BCKA 2RIOA 4C4HA 3COKA 3LXLA 4JVGA 3ET7A 4XV2A 4ACDA 4ZAUA 1ZYSA 2FA2A 5IDPA 3ZLSA 3QUDA 4C4IA 4WG3A 4YO6A 1PXJA 4MK0A 1GJOA 5IQIA 3OXTA 2R0IA 4RWJA 4DN5A 5JMSA 4ZTNA 5BVOA 2ZDTA 3MY5A 3MVJA 3OEFX 5A4CA 4YZCA 4XV9A 4C38A 3L8XA 1U54B 3P23A 3Q96A 3W33A 5IKWA 1G8JA 1R0PA 1OIQA 3ERKA 4F9WA 5AAEA 4O4CA 1F0QA 3P4KA 2HY81 3WZJA 2YN8A 3U54A 4I6FA 4LUEA 2R3RA 3QLFA 4TN6A 2WMAA 3AKKA 3CLYA 4U43A 4Q5EA 5L2IA 3LQ5A 2BTRA 4C62A 5FD2A 3QCXA 5G1XA 3LW0A 4D2SA 1LEZA 4O0WA 2XIKA 4GKHA 2FGIA 4AOTA 3W0RA 3FY2A 1YXTA 3PXQA 3QGWA 3DKFA 5DGZA 3R1YA 3NGAA 1ZY4A 2BUJA 4IB3A 4M84A 5FBNC 4ZTRA 3G5DA 2XEZA 3LQ8A 3V5TA 2J0IA 2OIBA 2REIA 4C3FA 5CAOA 3ORZA 3O23A 3QRJA 2B55A 1JNKA 3GC9A 3DAEA 4EOKA 3Q5ZA 5CSHA 4QP1A 2FB8A 2C0IA 2ONLA 3MY0A 4HVSA 5I9XA 4MEDA 4BVUA 5M55A 3R6XA 4D2TA 4C4JA 3LFEA 4KSPA 3DY7A 3IOPA 3Q60A 2WNTA 3I79A 5B2LA 1VYWA 2XYNA 5J9YA 5LCJA 4FA2A 3WZDA 4YJVA 4DEGA 2VTOA 4WA9A 5LOHA 3GC8A 3NVKI 4KIKA 2W0JA 1GOLA 3QRKA 4NM5A 5CASA 2VTSA 3DV3A 2VU3A 2B0QA 4MXAA 5E8SA 4YC3A 3KRJA 5D1JA 3CQEA 4QPSA 3WZEA 2ITZA 3AD6A 2WTCA 2IVUA 3CEKA 2X6EA 1TZDA 3O96A 3PJ8A 2HCKA 4O6LA 3UNZA 2EWAA 3D2IA 1JVPP 1KUTA 2B9HA 5T68A 4ZTMA 3DT1A 4YJOA 4HYUA 4CD0A 3UPXA 2R3GA 1KSWA 1Y91A 4KIPA 4CFNA 5M08A 4MWHA 4GK2A 4BCJA 4ENXA 2QO2A 3VN9A 3ORLA 4YJPA 2PVYA 4F70A 3R71A 2WB8A 5E90A 4CFWA 5FRIA 4FSMA 5AP7A 2YM5A 3SG9A 3PIXA 4NCTA 5CQUA 3OWKA 2UZWE 5HG8A 4R77A 4I3ZA 2QNJA 2WMBA 3MFSA 4QQ5A 1Q62A 2RFDA 4KD1A 5DN3A 5EHOA 5EYDA 3DNEA 4G1WA 2J6MA 3NIZA 3BHYA 4J1RA 4OTRA 3L9PA 4DCAA 3F61A 4K9YA 2ESMA 3KXGA 4YC8A 3G33A 4PF4A 3FSKA 4ZS4A 2QG7A 4F64A 2PVJA 3E5AA 3FUPA 1W98A 3OW4A 4H3QA 4JQ7A 3P7BA 1YHVA 3GUBA 1ST4A 1Q8ZA 1M2PA 4MCVA 1Q99A 2X7GA 3IECA 4KRCA 4B9DA 4RVMA 4FKLA 3GT8A 4NM0A 5HICA 3BWFA 5CSPA 5BVWA 3Q5IA 3DQWA 4ERKA 4IAKA 2CN5A 4ASXA 1ZXEA 5DH3A 2YITA 4FK3A 2XARA 5F4NA 4FE2A 1JSTA 3H0ZA 4YTCA 4O7TA 4U79A 3CPBA 4GS6A 2X7FA 2IVVA 5BVEA 2QKRA 3DKOA 3R7EA 4TW9A 2YAAA 3R2YA 4FKUA 4BDCA 5KE0A 1Q5KA 1UNLA 4GG7A 4MNFA 4QNAA 4XMOA 3KK8A 3R0TA 2HENA 2FO0A 3SG8A 4DBXA 2FUMA 2JLDA 3OZ6A 3EWHA 2V55A 3NR9A 3ZM4A 4IZ7A 2F9GA 4GSBA 2LGCA 4K6ZA 5CNOA 3CXWA 2QHNA 4BTFA 1OB3A 2PZPA 2UW0A 3QTRA 4D4VA 3ODYX 5FDXA 3ANQA 4IVCA 5K4IA 3DTWA 4E4MA 4FSQA 4CSVA 3REPA 2H34A 3D5WA 3FE3A 3G9NA 4FVQA 4P4CA 2ZB1A 4IAYA 2F7XE 3OBJA 4OTHA 3NYOA 4HVHA 3R8MA 2VTAA 4CV9A 4R7HA 1JLUE 5CU3A 4AW2A 3CGFA 3KKVA 5D10A 4DGOA 3SXFA 4MNEA 3B8QA 2QONA 2PE0A 4YNEA 3O5AA 3BLHA 4M69A 1Y57A 2B52A 2C3IB 4MD8E 3TKIA 3ZUVA 5KMIA 4QMTA 1R78A 3OY1A 4U80A 4BCQA 4NIFA 2GDOA 5JK3A 4FKVA 3VW6A 4CT1A 4R78A 1J7UA 2VWWA 2PVLA 2XNPA 3UOKA 3D2KA 2VO0A 3OOMA 3AXWA 3HZTA 2C30A 2OU7A 3CCNA 3FDNA 4PTCA 3GCQA 3K3IA 3ZSGA 3PP1A 4DDIA 2QKWB 4FC0A 2KTYA 3LFNA 2C6TA 3D83A 2YLFA 4EH5A 3ZM9A 4C36A 4FYNA 1CKJA 3QQFA 4KIKB 3FPQA 4FKOA 3FBVA 4H36A 3QRUA 2CPKE 5AIRA 4PMTA 1OIUA 3WF7A 4PL5A 3UOHA 5C8MA 4AXCA 3KCFA 5KKRC 5IQAA 2ACXA 2VWVA 1NXKA 3EQPA 4FZ6A 2VRXA 1SNUA 3P79A 3BU3A 2G01A 3Q4TA 5AP0A 4FX3A 4DH3A 2XKEA 3SOAA 4EOMA 4K8AA 1JSVA 1A06A 3PY1A 3KFAA 4FZDB 3SC1A 1JKLA 4FUXA 3RBWA 1KV1A 2WMUA 1B38A 3QCSA 3TI1A 4AZSA 3IW8A 3MTFA 1FVVA 3NZ0A 3SXSA 5IZFA 5IMEA 3ZC5A 4F63A 2YWPA 4BZOA 3U51A 3WF5A 2ITTA 1GY3A 4O7YA 1PXLA 3FLSA 3IO7A 2PY3A 2WQOA 4YU2A 2VX0A 4A4LA 2W4JA 5K5XA 2XIRA 3R02A 3FMKA 1TQPA 3OMVA 4EYJA 1BI7A 4IIRA 5AA8A 4QMLA 3PXRA 1R1WA 2PZYA 4IDVA 4EWQA 4MUQA 3QTUA 4EJNA 4IADA 2QO9A 2ZV8A 4U3ZA 3VO3A 3II5A 4E26A 1JOWB 4CFXA 3QKKA 3UG1A 4F7LA 1M2QA 4BCNA 4O7RA 1PW2A 1ZLTA 4APCA 3NYNA 4I22A 4L44A 4ANNA 4MXZA 4RWLA 3R01A 3NUSA 4KBCA 4O4DA 3GVUA 4E73A 3TG1A 3SLSA 5AP1A 2W1GA 1JQHA 2P55A 4L6QA 4YBJA 3FHRA 2HW6A 4JRNA 3RAHA 2BZKB 3CY3A 3UYSA 3TUBA 4DFLA 2BDWA 4BY9E 3R00A 3TIZA 2F57A 3UZTA 4OTDA 4CZUA 1ERKA 2X39A 4DGNA 4DTBA 3HDNA 1E9HA 4M8TA 3HRCA 4DBNA 2GFCA 4GH2A 2QLQA 5LMBA 4RIWA 4QPAA 4C58A 3Q9XA 2EB2A 3GU7A 4FEVA 2X81A 1SNXA 2YM4A 3C51A 5EDRA 5AAGA 2J0MB 2X2LA 5JRSA 4N70A 5JFSA 4AFEA 2VO7A 2PVMA 2JDRA 4AF3A 1OUYA 3QQJA 2WTKB 4R8QA 5J7HA 3FEGA 3LAUA 3EIDA 3TDVA 2LAVA 4YTIA 4IJ9A 3R7IA 4WUAA 1OKZA 1K9AA 1WMKA 4Y95A 2QOQA 2WU6A 3MA6A 4XNEA 1RDQE 2C6MA 5IEXA 2B1PA 2JDTA 3H10A 4O0XA 3QLGA 5JFXA 4C2WA 4GVAA 3C4EA 3D7ZA 2Q0BA 2X8EA 3GCUA 3HUCA 4FKQA 4MNEB 4TTHB 4S32A 4W9XA 5GZ8A 4AQKA 5DE2A 5FP6A 1YI3A 4M69B 2Y4IC 4ASZA 5M4FA 2C5YA 2PMOX 3JY0A 4NIFB 1Q97A 2DYLA 3GEQA 3QD2B 3ULZA 4GJ2A 2ETMA 4FSNA 2R3OA 1UU9A 5CSVA 3UO6A 3WYXA 3O7LB 3V8WA 5IQDA 2ZOQA 1VEBA 3FI2A 4FSZA 4I0TA 4NM7A 3L8VA 2X8DA 2OK1A 4FKGA 2NRUA 4K2RA 5E8VA 4B0GA 4AXFA 5HBEA 4XOYA 4ZP5A 4ACMA 3ZH8A 1YWRA 2ITWA 2X8IA 4FMQA 3R9OA 3RK9A 4CT2A 3HVCA 4PNIA 3ULIA 2GS6A 5BVKA 3NWWA 4AOIA 3BHTA 4Q9ZA 4RFMA 4V01A 5J87A 3NAYA 3AT3A 3FY0A 3A60A 5EOLA 1YOMA 3FYKX 3DS6A 4ONAA 4J97A 4OTIA 4AGUA 2CLQA 3TNQB 4WT6A 4O0SA 4MKCA 2GNJA 2W1IA 4QMVA 4D4YA 1NVRA 2GS7A 4JX3A 4X21A 4KA3A 3PSBA 3VBVA 1WZYA 3E8EA 2GHLA 2R3IA 4QP6A 4EH4A 2XM8A 4TYJA 4Q5HA 4PWNA 3CIKA 2QOOA 3AG9A 4WUNA 4YGAA 3HAVA 2WMTA 2ZMCA 4FOBA 3LCDA 4P5ZA 2BKZA 3VBQA 3AGMA 3QTSA 3TJDA 3DLSA 4QMWA 4HCVA 1OITA 3A61A 2VTMA 4O82A 1OL5A 4PX6A 4AN2A 1OPJA 2VTLA 5D7VA 1L3RE 3FXZA 1IA9A 3COHA 4JT3A 4WNPA 4NWMA 2FSOX 1JAMA 4FV5A 4GK4A 4UXLA 3BV2A 3LIJA 4XH6A 1RW8A 2OFUA 3PZEA 4YLLA 5EW8A 2QC6A 3V5LA 5E92A 2C6IA 3DBFA 3ORPA 4WG4A 2O5KA 4FV6A 4L7FA 3MFUA 5EG3A 3TM0A 3R8VA 4IX3A 3VS4A 2RGPA 1PJKA 2PMNX 4YMJA 5E9EA 3DA6A 4O91A 4QP7A 2A19B 4YTFA 1U5QA 2X7OA 4L45A 4BBEA 1NW1A 1ZY5A 4BTKA 3BGZA 3PRFA 4FV8A 3R8LA 3RM7A 3ODZX 4J8MA 4FTOA 1IG1A 2VNYA 1XJDA 2WD1A 3FMMA 3G6HA 3EKNA 3PY3A 4FBXA 4UZDA 4AFJA 4BC6A 1H00A 1UWHA 2NO3A 5A9UA 5CEOA 5KUPA 4OGRA 5IQCA 5KZ0A 3R9DA 3HDMA 2WO6A 4ACHA 5L3AA 4K11A 4WIHA 3R04A 4NFNA 4CMOA 2ITOA 2GTMA 2CHLA 3D5VA 2FSTX 3FZ1A 2F7ZE 3HMOA 4MVFA 3UE4A 4CTBA 2G2IA 3DNDA 1IEPA 1R0EA 4OBOA 5EI8A 3VS7A 4LI5A 4EC8A 5I0BA 3E63A 1OMWA 3P1AA 2YDIA 4EOOA 2J2IB 3QHWA 5A6NA 2Y9QA 4UEUA 4FV2A 4BCFA 4CRSA 3O2MA 4E1ZA 4L67A 2VO3A 3P7AA 3NUPA 5B7VA 1H08A 5AV0A 3Q52A 2XBAA 4XG8A 4HPTE 3HV3A 1JWHA 4GT4A 4GW8A 3QX4A 1O6YA 5A4QA 2VWZA 2VWYA 4R7BA 3NYXA 2R4BA 4JBPA 3AMAA 3VBYA 1K3AA 4D9UA 4GU6A 3GB2A 4FKWA 3R7GA 4OAVB 3O0GA 4TYGA 3EHAA 1W0XC 4G16A 3RPYA 2XCKA 4QTEA 5C26A 2O63A 3H3CA 1GAGA 4BI2A 3BE9A 4UYNA 5L2TA 2HAKA 2C3JA 3VUIA 3W55A 2BHEA 2YZAA 4WD5A 3HP5A 4AWIA 2P2HA 4BDIA 3W0MA 2IVTA 5KMJA 1DI9A 1QPCA 2XKDA 3PJCA 5DFPA 5LVLA 1BL7A 2VWIA 1WBTA 4LMNA 3TDWA 2H9VA 2BZJA 5CEPA 1TVOA 2XNBA 5ICPA 3QFVA 4JNWA 3HKOA 3KREA 1OL2A 3DPKA 3QA0A 5CXHA 4C2VA 3W2CA 2VWXA 1FMOE 4FGRA 4FK6A 5E8YA 2BRBA 3E92A 5GJFA 5CF5A 3AKJA 4BDKA 3C50A 1KV2A 2VO6A 4FUYA 4FG9A 4TNDA 5DR2A 4L7SA 3PJ3A 4M13A 4D58A 3CKXA 3VS5A 4QMOA 3MY1A 4U41A 4ZJVA 2UZUE 3U6IA 3M42A 3W8QA 5M44A 3NMUF 3ZXTA 4IH8A 3TKUA 2QG5A 5E91A 4BCIA 3F9NA 3R1QA 5D12A 3FMEA 3L9LA 5DR9A 3S1HA 4GFOA 5BUIA 2IWIA 1MUOA 3NNVA 1UWJA 2B4SB 2ZM4A 5TKDA 4QPMA 4H3BA 3PVUA 4F0GA 5BYLA 4NK9A 2IZRA 1BX6A 2RG5A 2YIWA 2ZB0A 3LXKA 4RBLA 4OT5A 5FBOA 4DITA 5KMLA 2YM3A 5B2MA 4BRXA 5HU3A 2VTRA 4IVAA 3EQFA 3BCEA 2IF8A 3FC2A 2BRMA 2YWVA 4CG9A 3ALOA 3C0GA 2QQ7A 3TTJA 2H8HA 2WOTA 4C0TA 3ZSIA 1Q24A 5HNBA 1OL1A 2C5NA 4EK4A 4DTAA 5AADA 3TNIA 4FSRA 4G3FA 3BL9A 2JITA 2EXEA 5FG8A 4UX9A 3W2PA 3TZ9A 4AACA 5L6PA 4BGGA 4CYJA 1DAYA 3HP2A 4BCHA 4EH3A 5KHWA 1V0PA 5JRQA 3FQSA 4GIHA 1YWVA 4RGJA 1XH8A 4J98A 4EZ5A 2WKMA 4EOJA 5CEQA 4EEVA 1YXVA 3IQ7A 4X2JA 3P9JA 3GP0A 4PPBA 4N0SA 4WRGA 1H01A 4YHJA 4KKEA 2PUNA 4TL0A 3N51A 1RQQA 4GG5A 4PMMA 4CFUA 2JIIA 3AD5A 5CU6A 3VAPA 4EH2A 5IA2A 4O2PA 1MRYA 2B9IA 1XO2B 2ITQA 1XBBA 3KXZA 4AA0A 2Z02A 3FPMA 5EHLA 2YIRA 3QZHA 5IA4A 2XALA 2OF4A 5J9LA 4AZVA 2GFSA 3MIAA 1REKA 2AUHA 4WKQA 4NKSA 3ZO1A 4A7CA 3FMHA 4C4GA 3EL7A 2VTPA 2W1FA 3SW7A 3ATSA 3I4BA 3OVVA 2V0DA 4FL3A 3UC3A 4ZLZA 4IAFA 2PYWA 2ZV7A 4KBKA 4DTKA 5DT4A 4G6NA 4EOQA 2E9UA 2QU5A 3ZLYA 2R3MA 5LWNA 4FIEA 4FTKA 3SVVA 1M17A 5IUGA 3R7VA 2WQBA 4L9IA 5HX8A 2J5FA 3M11A 3PP0A 3ZFYA 1JPAA 1P2AA 2OLCA 4JDHA 2XM9A 1PXPA 4U6RA 5H8GA 4L53A 3EZVA 1ZMVA 4DG2E 3C1XA 3LFBA 1TFFA 1CM8A 3FL5A 1V1KA 4JDKA 4LV7A 1APME 2W1HA 3Q53A 2WTJA 3KRRA 3KY2A 1UKIA 3PTGA 4E5AX 5FM3A 4OUCA 2H96A 4ZJJA 2VTJA 5TO8A 3RKBA 2XYUA 4R7IA 3JUHA 3R8PA 3A7FA 1J1BA 3KB7A 4BKYA 4FSWA 3K2LA 3NEWA 4J52A 2UZEA 4L3JA 5CI7A 3S0OA 4F7SA 2IPXA 2JKKA 5HVJA 4IMYA 4FTRA 3AT2A 2XF0A 3ORMA 4X2KA 2QVSE 2I40A 3PSDA 5CYIA 3QGYA 2J50A 4ZY4A 3BEGA 4ZY5A 4CLIA 1TKIA 4ZTQA 3OCSA 3AC8A 4JR7A 5DRBA 4BHNA 1H25A 3ALNA 3VUGA 3BGQA 3UOLA 4OW8A 3AC1A 4CKRA 5A4LA 3R83A 4Z55A 4AG8A 3Q4UA 2XBJA 4ZS0A 3UBDA 4B6LA 3Q6UA 3QRTA 5ANGA 4D2WA 1J7IA 2HWOA 4S34A 3FLNC 2O8YA 1M7QA 2IN6A 3KGAA 2PZ5A 1PY5A 2WZJA 2OJFE 2J0KA 3D7TA 2X1NA 2VNWA 4MXXA 3DB6A 2VTIA 1M14A 5DWRA 3WI6A 5HE3A 1P4FA 2NYAA 3W2OA 5T6KA 4PP7A 5I9WA 3DDQA 5I9VA 3CJGA 5JGBA 5H8EA 3DXPA 4FG8A 4MHAA 2YZLA 2CMWA 3LOKA 4JBVA 2VUWA 2NNWB 3W2SA