2GFCA

Camp-dependent protein kinase pka catalytic subunit with pki-5-24
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural Analysis of Protein Kinase A Mutants with Rho-kinase Inhibitor Specificity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 109
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gfcA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gfcA02
3QLGA 4ITHA 3KA0A 5HI2A 4FZFB 3CKWA 2WTIA 3IK3A 1PJKA 4M68A 2W9FB 3C7QA 3QTRA 3C13A 3VUMA 2HAKA 2Z2WA 4MXOA 2B52A 4PMPA 5AUVA 4PDYA 2BIYA 2R0UA 4WUNA 4FYOA 5KMKA 3UNZA 4F64A 1OIQA 5AP6A 4N4SA 5G6VA 4CKIA 5EI6A 2IN6A 4AOTA 3RKBA 2ITNA 2VN9A 1APME 3MY5A 4ZAUA 5CAOA 1CKJA 2H34A 1H1PA 4UZDA 4LL5A 5A6OA 3TZMA 2FB8A 3R7EA 4AE6A 4ZY4A 3HV6A 3ZONA 2VTJA 1MRYA 4IVDA 4LQMA 4RJ4A 4V0GA 3W2PA 4AFEA 2Y6OA 3E87A 4DEEA 2WB8A 2VTMA 2ITZA 2JDVA 4ERWA 5HIEA 1WAKA 3POZA 5FXRA 2OJ9A 5IA0A 2XEZA 4IWOA 2R3IA 3BHUA 1TVOA 3QQUA 1OPKA 2R2PA 4PP9A 4ZXTA 5LMAA 4FIGA 4I5MA 2IZRA 3UO6A 3NUXA 3PTGA 4YZMA 2HZIA 3Q53A 2Y0AA 4WHZA 5DVRA 4BCQA 4USEA 2EB3A 1H1RA 3F5XA 4D0XA 4RX9A 4NYEA 3DXNA 3VVHA 5J7BA 4O2ZA 3PJ2A 3R8UA 4UMRA 3DBEA 1GY3A 2F49A 2J5FA 2ZV2A 2QOKA 4IIRA 2UW3A 4P4CA 2YJSA 1I09A 2BAKA 5EYCA 4FGRA 3O96A 4HVSA 5HG8A 4DEBA 3V3VA 3BHVA 3I0OA 3VS6A 1JQHA 1Z5MA 4LYNA 3UBDA 1LPUA 2W4JA 1IEPA 3DK7A 4QTDA 2R3LA 1GIHA 4QT1A 2XVDA 2V7AA 3CPCA 3DPKA 4FSZA 4HYUA 3NAYA 4IB3A 5AX9A 2B7AA 2XIRA 2ETMA 5IUIA 1YWRA 4LOPA 4D2PA 2ZB1A 3VC4A 5KMIA 3VUHA 1M2RA 3DFAA 1SMHA 5KMLA 3GCUA 2GSFA 3QF9A 4EH8A 4YC8A 3ALNA 1YHVA 3N9XA 1LEZA 3BKBA 3ENMA 1SNXA 2LGCA 3QTWA 5ANKA 4BF2A 4CZUA 4D1XA 3P0MA 3QFVA 3VHKA 3MTFA 4P5QA 5M07A 4QYFA 1R1WA 2BKKA 3ORXA 4GJ3A 2X4FA 2XUUA 3Q4TA 4BBFA 1W83A 4C2WA 4I23A 4CFMA 3LMHA 4IC7A 2F2UA 3UP2A 3VF9A 2C6TA 1HCLA 4MXYA 1OKYA 4OTRA 1WBWA 1XO2B 4NFMA 3MFSA 3S2PA 5CF6A 4ZLYA 4F63A 2BRHA 3GVUA 4F1OA 1XH7A 5L2SA 2R0IA 4II5A 2DQ7X 4EYJA 3MJ1A 4LGHA 3E3PA 3KXZA 2PMOX 5H9BA 3IOPA 2YDIA 4NM7A 4ZSGA 4MWIA 3ATSA 4IX6A 4OTIA 4ORKA 4CCUA 4IH8A 2PHKA 2YA9A 2H96A 2I6LA 2QQ7A 2BTSA 1YWNA 4JR7A 2YCQA 3AC4A 4R1VA 4C4HA 2Z02A 3L1SA 1Q3DA 2C6KA 4FTIA 5M56A 4H05A 4ALWA 2OU7A 2JBOA 5HOAA 4ARKA 2QONA 3MJ2A 4L44A 3R21A 4UEUA 4JAJA 4DFUA 3DB6A 3FXXA 2F7ZE 4KD1A 4MWHA 4BHNA 4O0UA 3AG9A 4DH5A 4PF4A 4EL9A 1H08A 5JEBA 2PMLX 2BROA 3LQ8A 4NIFA 1H24A 3VN9A 4WD5A 1XHAA 3QC4A 4U8ZA 4C61A 4DAWA 3OZ6A 4DBXA 2PUNA 2R3FA 1JSVA 2BCJA 3BYMA 3WF8A 4ENYA 2UV2A 2OICA 2QR8A 3AGMA 1IASA 1LR4A 3D9VA 4M3QA 4AW0A 1DS5A 4L01A 4ID7A 4IAZA 4MCVA 3Q9XA 4DH3A 5AIKA 4PPCA 5HICA 4HZRA 1OL7A 1H25A 4FF8A 4MD8E 5HE2A 3KCKA 5J87A 4BIDA 4ZJIA 5DFPA 4AGUA 3AT2A 3FZ1A 3QYWA 1GJOA 3W33A 4G16A 4PX6A 4Y85A 5K0KA 4IX5A 3ZFMA 5AA8A 3ZHPC 3WF5A 3NIZA 3FJQE 1OIRA 2B9HA 2XK9A 2ZJWA 3ZO1A 1BL7A 5DH3A 3KN6A 5BVDA 2PPQA 1JSTA 5IQDA 3U4UA 3EQRA 3FDNA 3COKA 4BWPA 3LM0A 2WMVA 3OY1A 2HWOA 4FV5A 5HNIX 3VW8A 3FSFA 3D7TB 2BVAA 4LMNA 1ZWSA 4I6HA 1IA8A 2QI8A 4ENXA 2JBPA 1UNLA 2ITVA 3G0EA 4C34A 2BPMA 5FM2A 5CY3A 4R7HA 1FMKA 3ZC5A 4BC6A 5GIOE 2UZLA 3KCFA 2C3LA 2XM9A 3R1NA 3RPVA 3GNIB 2X8IA 3ACKA 3ITZA 3I6UA 2YLFA 3FUPA 4RIYB 4YTFA 4LUDA 4QMTA 1ND4A 3OCTA 3QA8A 2YEXA 2YHVA 3DS6A 4LRJA 3VJNA 3TM0A 4I0SA 4UX9A 5JQ5A 4EZ3A 2VWYA 4AACA 3UIMA 1PMUA 5D11A 5HIBA 4PDOA 4NM5A 2Y4PA 2XNBA 5BVWA 2QVSE 2GHGA 3QRTA 1YKRA 4KIPA 3PG3A 2A0CX 2QURA 3ORZA 2B0QA 1NVRA 4I1ZA 3TTJA 4C57A 5BVNA 3PVWA 2KULA 3VRZA 4HPUE 1KE9A 2YN8A 3MBLA 5G1XA 4R77A 5AP0A 2VWIA 3KMUA 4MNFA 5AR5A 3ZBFA 3OW3A 3ZM4A 4YC3A 2XCHA 4Z7HA 1KSWA 3I5NA 4KABA 5DEYA 1YHWA 4EK3A 1GZNA 4XP3A 4JVGA 4ZK5A 3PLAE 4HZSA 3UIBA 1NVSA 1QL6A 4IMYA 3ZRKA 2V55A 3QU0A 1JOWB 4FSYA 4KBCA 4PWNA 5FBNC 3MWUA 1DI9A 2C5XA 3LJ1A 3CD3A 2ERZE 3ZZEA 4CFWA 5IUGA 4PY1A 2PULA 2FSLX 4OGRA 2QKWB 5J1VA 1YOJA 1YXTA 3D5UA 4F70A 2W9ZB 1TQPA 2ITUA 2PVJA 2VD5A 2R3QA 5I9WA 3FQSA 5FTGA 4M67A 4TW9A 4RC2A 5GZ9A 2XZSA 5EHLA 4RX8A 3VQHA 1ZZ2A 3O8UA 4K11A 5J95A 4U5JA 2GNFA 3ORTA 5E90A 3F66A 4XRJA 4ANQA 4YUQA 2ZMCA 5EHYA 3DAJA 3GT8A 3K5UA 4EK6A 4GT5A 3LJ0A 3M1SA 4LV8A 2JDOA 1CKPA 5DT3A 1ZYCA 4AOJA 2VGPA 4QQCA 2PZYA 4O7ZA 4ANOA 1FVRA 3Q52A 4FTNA 4FIJA 1Q61A 3TJCA 3UIUA 3GC9A 4AN2A 4AA0A 4S2ZA 4CQEA 5FP5A 5DMZA 4XV1A 1NVQA 4G2FA 3B8QA 3N4UA 2B9JA 1WFCA 5AAFA 3DK3A 2Y9QA 3RNIA 4K1BA 4I5HA 3NEWA 2WMRA 4FSMA 4QQJA 3UOKA 1RJBA 4J52A 1WVXA 4K8AA 4Y83A 1R78A 2CCHA 4FKQA 5IF1A 2PVLA 5K9IA 1SZMA 1PYEA 3GCQA 2E9VA 3LFFA 5J9ZA 4QNYA 4UXLA 2F57A 4FG7A 2BDWA 2WQOA 4CG9A 4WA9A 3CTQA 1REJA 5FBOA 3ZS5A 1JAMA 3OROA 4CRLA 2IG7A 5BMSA 4L42A 4PUZA 3CSVA 2WHBA 1URCA 2CCIA 4DHFA 5A46A 3LXNA 3ERKA 1U54B 4NTTA 3EQBA 3R9OA 4BB4A 5D7VA 2WGJA 4I22A 3PP1A 5GHVA 1WBPA 2I40A 2V5QA 3COHA 5DGZA 4GIHA 2UZDA 3ZFXA 1O6YA 1B6CB 3D14A 4XBUA 1OPLA 3CTHA 3QRJA 4IM0A 4Z55A 5AUYA 3QAME 2GS6A 3UO4A 1XBCA 2YM4A 2EB2A 4YHTA 5E8TA 2XEYA 2ZM4A 3VIDA 1UWHA 2UZBA 4FTCA 3W2QA 4UWYA 3QRKA 2C6MA 1S9IA 3FY2A 3H3CA 5JZNA 4DBNA 2XB7A 4O21A 5D9HA 5AUWA 1UWJA 4FV1A 4YZCA 4EYMA 1JWHA 5CXZA 2LAVA 4AW1A 3UIXA 4EH6A 2OLCA 3QCYA 5BYYA 4CQGA 3W2RA 4RA4A 3LQ3A 2C1BA 4H36A 4KKGA 4BKYA 4CNHA 4ZTNA 3SA0A 3HDMA 3KK9A 3PY0A 2ITQA 5HE1A 2P0CA 3AD6A 4MBLA 4YHFA 5DT0A 5CVGA 3UQCA 4CG8A 4HCUA 3MB6A 3KXMA 2PVYA 3R9NA 5GINE 2OJJA 2O64A 3MA3A 5AR2A 5HNGA 2OW3A 2XYUA 4LUEA 5L2TA 4GRBA 4L7FA 3MESA 4P7EA 4YJVA 4E4NA 5TO8A 4ANLA 4JDJA 4LOQA 3E8EA 5CEQA 3OBGA 4BCMA 2W5AA 4I3ZA 5HCZA 2O3PA 4CYJA 5EI2A 3EYGA 3GC8A 3MFTA 3NPCA 3L8XA 2FYSA 2WU6A 4OTDA 4LGDA 5DNRA 4I4FA 3SXFA 4MYGA 5E8VA 1VJYA 2VTAA 2CLXA 1CM8A 1A9UA 5CEIA 3O2MA 3PXZA 3EJ1A 4U40A 3F2NA 4RBLA 3ZXTA 3TUCA 3V51A 5IU2A 4W4WA 1YDRE 2CJMA 3BRBA 4O6LA 3JS2A 5DR9A 5B2KA 4DFXE 4BGHA 2GTMA 4D0WA 4DFLA 1KV2A 3DJ5A 4L7SA 3RNYA 4E5WA 2V7OA 3EN9A 4GSBA 5D7AA 4JIAA 2JC6A 2YJRA 2B1PA 1ZYSA 3QA0A 5LMBA 3NUSA 1FBNA 4UYNA 5JK3A 2XBAA 3FLYA 1M2PA 1BMKA 3LLTA 2WMSA 3G6GA 3Q3BA 3Q9ZA 3MW1A 3MFUA 1U59A 4M66A 4ZP5A 4FKIA 4BZNA 4DLJA 4FEUA 3IPHA 4H3QA 5DIAA 4FI1A 4FOCA 4M0ZA 3QGWA 5C4LA 2GQGA 3SG9A 3H4JA 1L8TA 3P7AA 1W8CA 3ANRA 3T9IA 4TY1A 4BCGA 2EWAA 3G33A 3HAMA 3MPMA 3F61A 3HZTA 4ALUA 2BTRA 5LVNA 4L67A 2JDTA 4JBVA 5AP1A 4I21A 1AGWA 4MX9A 2VZ6A 1G8AA 2UZEA 5LVMA 4AS0A 3DQWA 1U5RA 4FTRA 4GK2A 4O0XA 1ZXEA 3V6RA 4EOJA 3II5A 4IWPA 4W9WA 3MSSA 3OW4A 3PY1A 3EQPA 4R3CA 4UWCA 2XNPA 1PXKA 4I94A 5HBHA 5HNBA 4B0GA 4UZHA 5JFSA 3KRXA 1A48A 2WOTA 4WNKA 4EOOA 5EM5A 4AW5A 4BDHA 3TZ9A 4QYEA 3EIDA 4IVBA 4JLCA 4JBQA 4FKLA 3U8WA 2J4ZA 4EH2A 5F4NA 1P5EA 1YDTE 4A4LA 3VUTA 4U97A 2W1IA 1OI9A 3WYXA 2BDJA 2YM5A 3LHJA 4DTKA 3FC1X 3EB0A 4ANMA 2YM6A 2XK3A 3O51A 3GUBA 4RZWA 3PVUA 3DKOA 1SYKA 4KRCA 3RI1A 4E6QA 1SVGA 5AV1A 3OVVA 3FXWA 1R3CA 3FMMA 4YJPA 3MH1A 3UP7A 4EWQA 4FX3A 4G3DA 3OT3A 5I9UA 4FT5A 2C30A 4WNMA 4EC9A 3A4OX 4XV3A 2B4SB 2OJFE 3TKUA 3UVQA 1O9UA 3P23A 5CI6A 3QTSA 4B4LA 4O0VA 4U80A 2JIUA 5BQ0A 2WIPA 5HO6A 2PVMA 3QKKA 5EOLA 3BI6A 5K3YA 4IDTA 2RG6A 3KULA 1SNUA 4ZSLA 4IJ9A 4ACDA 2HXLA 5HU3A 5HU9A 4F9BA 1ZYLA 5KBQA 4YTHA 4TYHB 2VWBA 3BELA 5BNJA 4FZ7A 3ZUTA 4PNIA 3MB7A 5FEEA 4C0TA 2OIDA 3KXXA 3H9OA 3LXKA 4AZTA 3NNWA 2CN5A 4IE9A 4IDVA 2ESMA 3FLSA 3MGYA 4PP7A 4G17A 5HVKA 2OJIA 2VGOA 4QP2A 3QD3A 1VZOA 5J79A 4CMTA 3V8WA 4AU8A 5JRSA 4ASDA 1Q8UA 3DKCA 3UMXA 2X1NA 5H8EA 4ZSAA 4YC6A 1MRUA 4MQ1A 2Y6MA 1IG1A 3ODZX 4FE2A 2QOBA 4O1PA 3CY3A 4YP8A 1CDKA 2R7IA 4L8MA 5BVKA 4DN5A 2XIXA 3FMDA 4J53A 4QMVA 3RWQA 4E6CA 5ICPA 3MFRA 3HA8A 5I3OA 5L6PA 4LFIA 3F69A 4R5YA 5IDPA 4C59A 4L53A 4PTEA 3FQHA 5FQDC 1KWPA 5E8XA 3C5UA 2ZB0A 3NRMA 4L3PA 4EUTA 4M69B 5ANIA 2VO7A 3M42A 3D2IA 4XNEA 1OBDA 3LFNA 3QQHA 4G6NA 4JQEA 3MDYA 4ACGA 2RKUA 3D5VA 3RWPA 4E4MA 3SLSA 1FGKA 1Q97A 4P2KA 5CU4A 1GIJA 4UB7A 3NUPA 4IXPA 1ZYJA 4EHGA 4FTJA 2CSNA 4WOVA 1M14A 2JIVA 3ELJA 3PJ8A 3RCJA 5BUJA 2NRUA 4BDIA 2DS1A 2UZNA 3KMMA 3FPQA 5E9EA 5EH0A 4NKSA 3QZIA 3TNQB 2ZOQA 5EQYA 4TWCA 4U42A 3VBXA 1Z57A 5E8UA 2YAKA 4L43A 3FI2A 2RIOA 3BYVA 4WBOA 2XNEA 4FT9A 3LKMA 4FZ6A 3C5IA 3B8RA 3P79A 3BWJA 3CIKA 4QYGA 4PMMA 2GMXA 4EH7A 5A54A 2R3RA 4O0WA 2BKZA 3BBTB 4ZZNA 5JFWA 3MIAA 4Y72A 4KINA 5CENA 1G8SA 4YSJA 4J7BA 5A14A 3EL7A 3GQLA 4Q9SA 4RJ6A 3RZFA 3H0YA 2BHEA 2C1AA 1T45A 3CD8A 2FO0A 3VUGA 2WU7A 2W1CA 3I0QA 1XH8A 4M15A 3TEIA 1Q8YA 3BWFA 3N4TA 3L9PA 4MXCA 4XUFA 5CNOA 4ZTRA 5FRIA 1FOTA 3TI1A 3ZYAA 1PF8A 4RX5A 3TV7A 3W1FA 3PVBA 1Q5KA 4J96A 5DR2A 3D94A 3U51A 2BZIB 2JGZA 2VWXA 4C4FA 5LMKA 3ZLXA 1LP4A 2CNVA 2YABA 3DK6A 3RHXA 2UVZA 4IM2A 5HVYA 3NDMA 5IKWA 2GQRA 4JG7A 4XP0A 3V5WA 3NWWA 5FD2A 4XV9A 3EFKA 2EXEA 4F1MA 1R0PA 3FYKX 2WZJA 3E7VA 4H58A 3VUIA 4BYJA 4ONAA 4KIKB 5L8JA 3V5PA 1OB3A 3GI3A 4FEXA 2ZYBA 4JDHA 4OUCA 4FVRA 3C50A 5EQEA 4GL9A 4IBMA 5ITAA 2BAQA 4D28A 1Q4LA 2UZWE 1WBSA 4G6OA 4N57A 2JAMA 5J9LA 2C5OA 2AYPA 3ATTA 4IX4A 4M12A 3LXLA 3ZDUA 4BDFA 4F6UA 2HZ4A 2ZV9A 4EOIA 4TPTA 3QUDA 3BU5A 3EN6A 5L4QA 2CKQA 1OVEA 1Y91A 3VF8A 4CLIA 2QCSA 5CANA 4RA5A 4O38A 4MTAA 4BDJA 3ANQA 3OS3A 5BYZA 1JSUA 2WMWA 4FL1A 3UNJA 2HWPA 4I93A 3V5TA 3RPYA 4F7SA 4FSRA 4FSTA 4W4VA 4I6FA 2OSCA 1J1CA 3O0GA 2Q0BA 2H9VA 3DLSA 5EHOA 3F3UA 4QPSA 5AR7A 2C6LA 4YLJA 3FC2A 5C8MA 1Y6AA 3KRWA 4YZBA 5FXSA 4BKZA 3PE1A 5FEDA 2IZSA 4RQVA 2BZHB 3R01A 3ID6C 4EHEA 3OHTA 5D10A 4AG8A 2BR1A 3I5ZA 3P78A 3R71A 3OT8A 2ITXA 4U81A 2YCFA 3HMIA 3ULZA 2R4BA 1E1XA 1LEWA 4ALVA 4A9SA 4YZDA 3NW6A 3UMWA 3R7GA 3HUBA 3TNWA 3RAIA 5HLWA 4C3PA 3IG7A 4EH3A 1PMVA 1Z9XA 3U6JA 2IVSA 2OH4A 2YIXA 3DZOA 4RC3A 4AZFA 4M13A 5DE2A 1JKKA 1H1SA 3E64A 2XKCA 2XBJA 3EZVA 4EOQA 1U4DA 2PE1A 2PVHA 4FODA 3RK7A 4ZY5A 3CR0A 3QHWA 3ZBXA 2VX1A 2KTYA 2ITWA 3CS9A 3EFJA 3LVPA 5K5XA 4O83A 3LFAA 4MHAA 3RZBA 1J91A 2RSVA 3KVWA 4G3FA 4W8EA 5BUEA 2OFVA 3JUHA 2YITA 4FT7A 3F3ZA 2VTOA 3R8PA 3G15A 5CSHA 4DA5A 1JPAA 4BL1A 2QODA 4UMTA 3COIA 4O96A 3UODA 4CVAA 4F9WA 5E8ZA 1XBAA 5HCYA 4M7IA 4DFNA 3U54A 1KOAA 3BE9A 3KFAA 4ZIMA 3FXZA 5ANDA 3TNHA 3R83A 5CF4A 2PUIA 1MQ4A 4FT3A 1F5QA 4ZJVA 4JNWA 2W1HA 3AOXA 2E2BA 4RIYA 4FSWA 3PWDA 4C3FA 2W06A 4FNYA 2VTQA 5LQFA 4DCAA 3RINA 3PXFA 4GUEA 4C3RA 4CMUA 1UVRA 3V5LA 1RW8A 3MVLA 1H0VA 4RMZA 4EHVA 1VR2A 4FZAB 3O23A 4GS6A 3SAYA 4O27B 3A99A 2B53A 4ITIA 5KE0A 1WBTA 4DITA 3RCDA 3MYGA 2J5EA 4A9UA 2CKEA 2G01A 5HTIA 4QMMA 4D1SA 2C0IA 5CWZA 2PVFA 4JR3A 2CDZA 4JQ7A 3U4WA 4S34A 3QL8A 4FSQA 2V22A 5AM7A 4YJRA 1BLXA 4PTGA 3FZPA 1CSNA 4BTJA 2B54A 2XKDA 3R7VA 3UDBA 3PRIA 3ALOA 2W4OA 2BRBA 2BMCA 2EXCX 2VRXA 5HBEA 1XJDA 1OIYA 5AMNA 1RQQA 4PTCA 1Q8ZA 4MXZA 4G3EA 3TZ7A 4IACA 3ET7A 1HCKA 5ETIA 4BCPA 2YCSA 3FQEA 4QYYA 3QCQA 2PVKA 4F09A 3D0EA 4XG3A 2WKMA 3PFQA 3R7YA 5F9EA 4P90A 3EOCA 4QTBA 1OM1A 3SRVA 5K0XA 4J99A 4DTBA 1UU3A 4AWIA 2Z7RA 2BRMA 2BILB 4BDAA 3TG1A 3OWJA 4WRSA 3LFBA 3RALA 4R7BA 1PXOA 5CEOA 2VTHA 3WZKA 4ZZOA 1PRYA 3W55A 5CEKA 4EZ5A 4FT0A 5GZ8A 2OWBA 3PPKA 4AZEA 4W8DA 5J7HA 4RPVA 4QMXA 1CMKE 3QCSA 2EU9A 3SD0A 1YXUA 3OD6X 3OUNB 2VO6A 5D12A 3BU3A 3UTOA 4MBJA 3R9DA 3HYHA 4XH6A 4O22A 4EBWA 1KUTA 5E4HA 4IQ6A 3CGOA 4IB5A 4CZYB 3QC9A 4LOOA 3QX4A 4U7ZA 2OKRA 3KXHA 5JGBA 2OFUA 5HD4A 5BYLA 1YI6A 1FVVA 4HOKA 4I6BA 4JL9A 4FK3A 2EUFB 4X3FB 4AGDA 3NYNA 3R30A 3SDJA 1X8BA 3R0TA 2GNLA 2J0JA 2RFEA 5HG7A 1T46A 4D4RA 4BDBA 4YGAA 4GVJA 2V0DA 5CT7A 5AP2A 2XK4A 4QTEA 1WMKA 2CPKE 4IHPA 3OEZA 4NT4A 3PSBA 2YLEA 1YXSA 3QZHA 4Y8DA 5DEWA 4MNEA 3WF6A 3KXGA 5HZNA 2BAJA 1MQBA 2PVNA 2W4KA 3HEGA 4YSMA 4UYAA 3OXZA 3F5PA 2VWVA 4UMPA 2G2FA 4IZAA 3HLLA 3QZFA 3Q5IA 3HUCA 2OG8A 1ZMUA 3CJFA 5EYKA 5DWRA 3W16A 3DJ7A 3QRIA 4DEHA 5KKRB 2JKKA 3AMBA 1M7NA 3DZQA 4EKLA 3L9NA 2YFXA 4V0GB 3G90X 3KC3A 4Z3VA 3EN7A 1J7IA 2ZV8A 4M14A 3A8WA 2ITYA 3O7LD 3PIXA 3W8LA 4AX8A 3ZC6A 2IW8A 4ZLOA 3TUDA 4AT4A 4NKAA 3R02A 4NUSA 4TWPA 4HVHA 2FSMX 2G1TA 4YLKA 3ORIA 3NUUA 4BCNA 4F7NA 4CXAA 4OAVB 3UG1A 5A4TA 4Y5QA 4L68A 5AX3A 1E1VA 3PRFA 4KBAA 3BPRA 4KA3A 3GC7A 3CCNA 3SXSA 5FM3A 3NZ0A 2XRUA 3OEFX 4Z9LA 4V04A 5L2QA 4FEWA 4FVQA 5HIDA 1YVJA 4XEYA 2J90A 5ANJA 4EUUA 3HV5A 3MVJA 4K18A 4NCTC 4C4EA 5TR6A 3RJCA 1PMEA 2J51A 2X4ZA 4O7NA 5LJJA 3FI4A 2FVDA 3AT4A 5T3QA 3WIKA 5JMSA 4O91A 3L8VA 5IQGA 2PZIA 4WO5A 1H8FA 3C51A 5KMJA 5A3XA 4ASZA 2C47A 3JVSA 4RGJA 5FG8A 4G3GA 4FA2A 3PZHA 4BFMA 3DTCA 3KREA 4U45A 2UZUE 3UZPA 2ONLC 2I0HA 4Q2AA 4R1YA 4BCHA 3AD4A 4H39A 5I3RA 2QLQA 1GAGA 3NCZA 1ZOEA 4O1OA 4DC2A 3KF7A 4O7LA 1OL1A 1ZARA 2VTSA 2P4IA 4QP6A 1Q41A 2ETRA 4BCKA 3DT1A 4APPA 3QKLA 4AZWA 4AZSA 2RGPA 3HMMA 5AV2A 2OF2A 4TZRA 2ITPA 4XG2A 3MPAA 3R9HA 1SVHA 2C5NA 4V01A 4RRVA 3FYJX 2HK5A 3GU7A 4N6ZA 1H0WA 4X6RA 2W1ZA 2Z60A 4C7TA 4CLJA 5I9ZA 1H07A 2UW7A 5EG3A 3OTUA 5KMNA 2XNOA 3DNDA 4PV0A 3R8VA 4AXAA 4O7TA 1E9HA 2VWUA 5CXHA 3UPZA 3PDTA 3RM6A 4EJ7A 4J71A 4IANA 4CRSA 4MKCA 4C62A 3FMKA 4Z7GA 3RK9A 3BHHA 1DI8A 2HZNA 1WBNA 4M84A 3L9MA 4EQUA 1WVYA 1NT2A 2J0LA 2C5YA 4CGAA 4QMYA 4M0YA 3NMUF 2HW7A 1BKXA 4YHJA 1H01A 3E62A 2OXYA 3VJOA 3BLHA 3MN3A 4MVFA 3ZTXA 4C4GA 2OBJA 3GU4A 4JX7A 3VW6A 2BZJA 4OR5A 4R7IA 2GPHA 3TWJA 5A4QA 2X6EA 4DFYA 4XG6A 4KSPA 2WMQA 3ZRLA 1DM2A 2YACA 4Q9ZA 3CXWA 4NIFB 4EQCA 2JLDA 3EQCA 5C8NA 2CLQA 3R00A 4QMSA 3OP5A 3JR1A 1OKWA 3AC2A 3DJ6A 4GMYA 4NW6A 1ZY5A 1GNGA 4BR3A 3GFWA 3ROYA 2JFMA 1IAHA 3FZSA 2OJGA 4LI5A 5M51A 2HY81 4JJRA 5AWMA 5JSMA 2WPAA 3E63A 5ANOA 5FUTA 4QMQA 3LCSA 3TCPA 3T8OA 3WBLA 3KKVA 4XG7A 4BBMA 5IQHA 2PZRA 3BYSA 3CJGA 3QBNA 4FG9A 4U0IA 3T3VA 4ZLZA 3CPBA 3S1HA 2GQSA 4HYHA 3E7OA 5EI8A 3RPOA 4OTFA 5M4UA 4XYFA 1ZY4A 5CTPA 2UW4A 2X8DA 4KSQA 4DCEA 4D5KA 3POOA 4GG5A 1H28A 2GDOA 4X3JA 5CVFA 1J1BA 3VS3A 2XF0A 1OPJA 4EH9A 5HLNA 4IM3A 3L9LA 4W9XA 4X2JA 2IVVA 4WKQA 2ACXA 4WSQA 3PPJA 4HVGA 1NXKA 4DEGA 2OO8X 3ZO3A 3LFQA 3TV6A 5IEYA 3FMLA 2W0JA 2W17A 4HW7A 2BHHA 1JKLA 2PU8A 3AC1A 3U87A 3CE3A 2X2LA 5L6OA 3U9CA 2YZLA 5KCVA 4EC8A 3NVMB 4X2GA 2A4LA 3BLQA 5JFXA 4ZTMA 4PPBA 4NM3A 3DAEA 3F5GA 3KGAA 3F5UA 3O17A 5ETAA 1OGUA 4IVAA 3DBQA 4UMUA 5A9UA 4BBEA 4IEBA 4EZ7A 4XBRA 4CTBA 1PXMA 4YR8A 1O6LA 2ETKA 2HZ0A 4CZTA 4O7RA 1Q62A 2GNJA 4FZDB 5LCKA 2E9PA 4RWKA 4BCFA 4IZ5A 3QQJA 1SM2A 3DU8A 4J8NA 4XS2A 2XJ1A 5IDNA 4UXQA 4Y95A 4ZMFA 2WTJA 4YPSA 1IAJA 3WE8A 1G5SA 3BZ3A 3QHRA 5C03A 5AAGA 2Z7QA 2YM8A 4Y73A 4CYIA 2WO6A 4RIWA 2VWZA 3ZLSA 4RWLA 2A19B 3AC5A 3MY1A 2A2AA 2G2IA 5K5NA 3OBJA 5B2LA 2W96B 3HX4A 2GTNA 4C37A 4DG2E 5EK7A 4FL3A 4MXXA 5DLSA 4XJ0A 3PJCA 2I1MA 3DKGA 4HNIA 4OTQA 4WNOA 4CFUA 4XG4A 5EFQA 4E6DA 2WTVA 2WD1A 5JGDA 2WELA 4JQ8A 3SQQA 4M8TA 5FXQA 2EXMA 4U41A 5IQEA 4RT7A 4YBKA 2C6IA 3ZSIA 3Q6UA 2CGVA 4X3FC 3TZ8A 1UU9A 3FKNA 2X2KA 4DFBA 3W10A 4AAAA 3R8ZA 1W84A 4QMPA 3LPBA 2DUVA 5EOBA 1XH5A 3V8SA 5M4CA 5CSVA 5L3AA 4RJ8A 4YO6A 2QHNA 2HOGA 1YW2A 3PA4A 4I41A 5AP5A 4EK8A 1K2PA 4WG4A 4USFA 3SV0A 1PXIA 2YWPA 4IAKA 1OKZA 3TT0A 3UGCA 1H1WA 4GFOA 4PDSA 1UU8A 3KVXA 4U3ZA 5DR6A 4D9TA 4F6WA 3JXWA 2WTDA 4MXAA 2UW6A 4FKPA 1FQ1B 4JXFA 2BRGA 2ZVAA 2WXVA 2R9SA 4BTMA 3R63A 4HPTE 5KHWA 1QPJA 2PY3A 3CP9A 3EWHA 3KL8A 3OWLA 4H1JA 2QU5A 5EYDA 3SHEA 2QNJA 4I24A 5KKRC 4HJOA 4JRNA 4KS8A 2IPXA 4MBIA 5D41A 4MD7E 3TV4A 4C2VA 3L8PA 4B7TA 4RSSA 3LCKA 4FYNA 4J98A 1AD5A 1GZKA 1OL5A 3EQGA 3M11A 4HCVA 4QP8A 2W99B 4IC8A 2XNNA 3OCGA 2IW9A 5IQBA 1GIIA 3RGFA 2VO0A 1V1KA 3F3VA 3Q5ZA 2F4JA 3E3BX 1QMZA 1B38A 2J0KA 3CQEA 3E92A 3CTJA 4FR4A 4DEDA 4GKIA 2C6OA 5HKMA 3R2BA 4EEVA 1GZOA 1MRVA 3CY2A 2RL5A 5CU3A 2OXDA 4WNPA 3FV8A 5CQUA 1Q24A 3NW7A 3REPA 5AR8A 3F2AA 3IKAA 4FG8A 4KAOA 1XBBA 2Z7LA 4IZ7A 4F6SA 5IA3A 5EYMA 1QPCA 2ZMDA 2P2IA 3GOPA 1BI7A 4RJ7A 5H2UA 3V01A 5L8LA 3JY9A 4G9CA 2GS7A 3C4XA 4E4XA 1HOWA 5C01A 4LM5A 3UQGA 3UQFA 1XH6A 4USDA 5I5ZA 5AR4A 3SXRA 1V0BA 3Q32A 4RIXB 5M06A 1IR3A 4FKWA 3ZDIA 4BTKA 3E8DA 2WEIA 2CNUA 5JH6A 5AR3A 5EDRA 4CV9A 1JKTA 4AN9A 2XMYA 3ZZWA 5IEVA 3OY3A 3PG1A 4FEQA 3EQDA 2UW0A 3ACJA 4BRXA 3A7HA 3PUPA 2XIZA 4WBBB 4WIHA 5GJDA 4KIKA 3VBQA 4ERKA 3QTIA 1BYGA 2W1FA 3IGGA 5CAUA 4RVKA 2V62A 1UKIA 4RJ3A 2R3JA 4DEAA 4BI0A 4R5SA 4CKJA 2PVRA 4YNEA 5LVPA 3V6SA 3VBVA 3R9RA 2VUWA 2W5BA 3NGAA 5HCXA 4JOAA 4AA5A 2B55A 3E88A 4TXCA 3WARA 5FTQA 3QWJA 1LUFA 3RTPA 4AGCA 1PHKA 3W2OA 1M2QA 4PPAA 5CEMA 3UG2A 1KOBA 2QG5A 2R3PA 4QNAA 2C6DA 4U3YA 4G9RA 4KWPA 4QO9A 5ANEA 1Y57A 4C58A 5HQ0A 1OKVA 2YM3A 2WQNA 2RG5A 2WQMA 4O0SA 5E8WA 1PY5A 1UNGA 5EW8A 3DTWA 5C8KA 1Q99A 3LCDA 4KIOA 5HGIA 3I60A 5KUPA 1UU7A 2EVAA 3O7LB 3EQFA 3H9FA 3HMNA 3I6WA 4JDKA 3WZDA 3UE4A 4EK5A 5CSWA 3HV3A 2RFNA 4UY9A 4YMJA 5HE0A 1JVPP 3RPRA 5BUIA 2QKRA 2C5VA 4FSUA 1XR1A 4BDEA 3N51A 3VWAA 5CZHA 4H1MA 4FV6A 3OTVA 1OL6A 3COMA 3UJGA 4KNBA 2XIKA 3D5XA 2VX3A 3AC3A 3EQIA 3IW8A 3ZO2A 2ITOA 3B2TA 5FTOA 3KMWA 3PXRA 3WF7A 1UNHA 1XKKA 3ZLYA 2IJMA 4TL0A 5A4LA 4C02A 5AADA 3CQUA 3OC1A 4K33A 3AMYA 3KY2A 4O0RA 4OLIA 4O86A 5IQAA 3I79A 4E5BA 4I5PA 4BIEA 4L46A 3QALE 1OZ1A 2Y7JA 3PIZA 4JS8A 3LFCA 3EMGA 2W05A 3F7ZA 4EJNA 2X0GA 1PXPA 4RIOA 3GCVA 3IS5A 4WRGA 3HV4A 3DAKA 3GXLA 4AE9A 3MY0A 2NP8A 3F2RA 3R2YA 1REKA 4KUJA 2R3GA 4YO4A 1AQ1A 3DOGA 3DCVA 3TNPC 4TWNA 3PA5A 4N0SA 4B8MA 3SOCA 4IAFA 5GJFA 3LFDA 1V0PA 2OXXA 5LVOA 2XJ2A 2YIWA 1V0OA 3FHRA 3FI8A 5EQPA 3A7GA 1H00A 3QQGA 4ZJJA 1FGIA 2WIHA 3FY0A 3K3JA 4A4XA 4BTFA 2OIBA 2JITA 5K4JA 2I0EA 5F94A 4TN6A 3DY7A 2ZM1A 3BGZA 3QQKA 4BDDA 5CX9A 3K2LA 2JFLA 2P2HA 4ACCA 3OOMA 4FOBA 3HV7A 4YURA 3KRJA 2FA2A 4D9UA 4O0TA 3DXPA 3NUAA 3DBCA 1G3NA 2WMUA 2HYYA 2XK8A 4TYJA 3KRLA 3GCSA 3IW4A 4BDGA 1SVEA 4CV8A 3WILA 3PXYA 3BQCA 4D2RA 3NVKI 4X2FA 3H9RA 4BWKA 4I20A 4IWDA 2YIRA 4S32A 4C4IA 5LVLA 4FIIA 3NAXA 2F7XE 4FTAA 3P7BA 4JI9A 4AT5A 3EL8A 2IW6A 5M09A 3I1AA 5EKOA 3QUEA 4GH2A 4TYEA 3NX8A 4XG9A 5H8GA 4Q5HA 2P3GX 4QQ5A 4BICA 4YU2A 3F3TA 3GBZA 4ANBA 3GU5A 5AUTA 3BYOA 5IMXA 3O8PA 3TL8A 5HX6A 3P9JA 4RVMA 2PL0A 1U5QA 5TT7A 3MH3A 3QTZA 4IVCA 2VO3A 2W1DA 3VAPA 2WTCA 4CD0A 5KBRA 5HORA 4G34A 4JBPA 3A62A 3U55A 3G2FA 3I7BA 3NR9A 4NH1A 4WT6A 1GZ8A 4JX3A 2X2MA 3QTUA 3C0IA 4ZTLA 3AGLA 2E9NA 4QMUA 5IH5A 4FGBA 4O82A 3PSCA 3OCBA 5FGKA 3R7UA 1P14A 2NPQA 3W8QA 4DEIA 1PW2A 5FDPA 3ZOSA 4GYIA 3NW5A 4DGLC 4BCOA 2OIQA 4EQMA 5CNNA 4FEVA 4FV7A 2GCDA 3C1XA 2WQEA 3MVMA 4AN3A 4HGTA 1MUOA 4FVPA 5H8BA 1XH9A 3RAHA 5L8KA 4H3PA 4P5ZA 5IG1A 3KULB 4J1RA 2OZAB 4OT6A 5IA2A 4GW8A 4O7VA 5CAVA 3HDNA 5E91A 3LFEA 3KU2A 4CEGA 2O5KA 2PK9A 1O6KA 3AD5A 3S95A 3EN4A 3JY0A 4F1TA 4OTWA 3F88A 2VNWA 4TNBA 4XV2A 5BVEA 4R8QA 3ORLA 5TE0A 3PXKA 4CFVA 3UOLA 3R73A 3TKIA 5EKNA 1PYXA 2QOLA 3Q9WA 3PA3A 4HGSA 4IAAA 4PMTA 4O84A 3ORKA 4AT3A 2YDKA 5IUHA 3RVGA 4G6LA 4B8LA 4QP1A 4CT1A 1KE6A 4FKOA 3HP5A 1WZYA 3LZBA 1Y8GA 3FLZA 4ZZMA 1OITA 3O50A 2X9EA 1H4LA 4U44A 5C9CA 3SGCA 4ZS4A 4U43A 4X3FA 3R28A 5CS6A 3A61A 3RPSA 5HO7A 5IEXA 2QU6A 4G31A 2R3NA 4R3RA 3DV3A 3TXOA 4F0GA 4EOKA 5HVJA 1PKGA 4FNZA 3NIEA 4TKSA 4FNXA 5FEQA 5FDXA 2XKEA 4N70A 4UWBA 3QCXA 5M4FA 3A7JA 3DDPA 2GNHA 2NO3A 1UKHA 2R3OA 3F7WA 4ZSEA 2YIYA 2P33A 5DA3A 2ERKA 3M2WA 4JAIA 3DGKA 3D7TA 2WTWA 3DKFA 3PYYA 4IADA 4W4XA 2QC6A 2QO7A 1OIUA 3FL5A 4GV1A 3LW0A 4FK6A 4FTKA 5E8YA 5KMMA 3PP0A 5AFVA 4DE4A 5DOSA 1M7QA 4BI2A 2WEVA 4FIEA 4ZTQA 3D83A 2BFXA 3RAWA 3BGQA 2G15A 4F7LA 4O81A 3PIYA 4GK4A 4ZMEA 2OH0E 3I7CA 3PE2A 4YJTA 2JKMA 4FMQA 5CQWA 3A7IA 5I4NA 3ENHA 5IQIA 4EOSA 2IWIA 3W2CA 2PUPA 3NNXA 2ZDTA 2B9IA 4GT4A 2GFCA 1YOMA 2O0UA 4C36A 5IMEA 2VU3A 2Z8CA 1YI3A 4GYGA 1ATPE 3Q2MA 5JZJA 2PWLA 3MIYA 5CU2A 3ZFYA 4GCJA 4EORA 4FKUA 3ZU7A 2GNIA 4BI1A 5CF8A 3BHYA 5EW9A 3VULA 4Y46A 1L3RE 4QMWA 5KZIA 5HBJA 1R39A 3AC8A 3T3UA 4AW2A 5IA5A 4Z16A 1KV1A 1PXJA 3QX2A 4FV8A 4QPAA 3WZUA 5AA9A 4DG0E 4FL2A 3HRCA 4HGEA 3Q4CA 4LMUA 3DA6A 4FV0A 4DF3A 4X21A 1W7HA 3BLRA 2J0IA 2XP2A 4D2WA 4EHZA 2PSQA 1OUYA 5JT2A 2X81A 5AV3A 2Z7SA 4N6YA 5CAQA 1ZOHA 3C4ZA 1P4FA 4K2RA 1W82A 3VS5A 3IW6A 4G5JA 3UOJA 1K3AA 4X0MA 1YHSA 2H8HA 4NM0A 2XNMA 5IA4A 2SRCA 3G51A 4IJPA 4GIIA 4ZOGA 5ETCA 5HD7A 3ZXZA 2CMWA 3BIZA 4EBVA 3RM7A 3BE2A 4E3CA 3HMOA 5DRDA 5M55A 3HL7A 4L45A 2H6DA 4YTIA 3WIGA 1W0XC 4W4YA 2VWWA 5JRQA 4FICA 3HVCA 5LOHA 3OCSA 4M97A 3WZEA 4BWXA 2WTKB 2QR7A 4MF1A 3C4CA 4FTLA 4FNWA 2O8YA 2I0YA 2HELA 4FIHA 3QGYA 2YDJA 5AP7A 4TYGA 4YNOA 3RMFA 2JDRA 4RLKA 3SW4A 4NU1A 3FWQA 4QOXA 3VO3A 1YXVA 4ITJA 5L2WA 4DT8A 2BALA 3IDBA 2WNTA 3LQ5A 3EYHA 4I0TA 4U9AA 1Y8YA 3PXQA 4TTHB 5A4CA 4EKKA 1YXXA 2A27A 3BQRA 3NSZA 4RWIA 2VTLA 3IQ7A 3H0ZA 3FKOA 4FIFA 2C68A 2Y4IB 3LAUA 5HLPA 3TTIA 4D58A 2QHMA 5BPYA 3Q2JA 3LE6A 2FSOX 5CASA 3S00A 4EK4A 4L52A 4DYMA 4DINA 4DGGA 1NA7A 2FGIA 4JG8A 4AUAA 1YWVA 3D4QA 3HGKA 3Q4ZA 2ZM3A 3AMAA 4XLVA 5HESA 3VS0A 5JQ8A 2YIQA 3P7CA 2WMTA 2CGWA 4E20A 4JT3A 4U6RA 2R64A 3C0GA 4FV3A 3UYTA 3UVRA 3C4EA 4YPDA 3R04A 3IECA 5EM6A 2ZV7A 3TJDA 4FTUA 3LCOA 3W32A 2HXQA 5I0BA 2JAVA 3D15A 3PZEA 2A1AB 1WCCA 4BYIA 3HKOA 3VS4A 3GEQA 2C69A 3OOGA 5TF9A 3MH2A 4J8MA 5A6NA 4LG4A 4FUYA 2UZVA 2HENA 2C3KA 1U54A 1XQZA 2X7FA 4IW0A 4YLLA 1CKIA 4GUBA 5T68A 3ZO4A 4A9YA 4F99A 4OBQA 3CQWA 2HW6A 2GNGA 3KF4A 2ZAZA 4B6LA 4E7WA 3QUPA 4GKHA 5JFVA 3D5WA 4X2KA 3IO7A 4I0RA 3E8NA 4XG8A 4AFJA 5CAPA 1FINA 4DH7A 3SC1A 3ZUVA 2PZ5A 2FSTX 4EH5A 2VX0A 4C38A 2PYWA 5LXMA 4FV4A 4O7YA 3I81A 3DNEA 3OWPA 2O2UA 3FZOA 1W98A 4E1ZA 4TT7A 4FKJA 4D1ZA 4ACMA 5FP6A 1Y6BA 2P55A 4D5HA 1P4OA 3DXQA 3FLQA 4PL5A 4MEDA 3PPZA 3EFWA 3K5VA 2XYNA 4IFGA 4IB1A 3TN8A 4FSNA 3DFCB 4IWQA 2XJ0A 3IOKA 3VUDA 5CYIA 3VNTA 5JGAA 3CBLA 4D4SA 4MH7A 3DQXA 4KBKA 3UC4A 4GVAA 4PRJA 3QD4A 4JG6A 2XKFA 4RWJA 5CLPA 3V5QA 3GQIA 4NJDA 4EOPA 3NS9A 4YJNA 3OF0A 4ACHA 3TNIA 4EI4A 3VQUA 3TIYA 3S0OA 4QQTA 1UV5A 2QOQA 5AIRA 1M17A 1TQIA 2VTTA 4EOLA 4AF3A 3UNKA 4TWOA 2W7XA 5CSPA 3EFLA 2VTPA 3EKKA 4KIQA 5AP3A 1BUHA 2QD9A 3R22A 2J6MA 2PTKA 3LFSA 2JKOA 5GIPE 1J7UA 2QOFA 3KEXA 4A07A 4QD6A 1DAWA 3VUKA 4CKRA 5M44A 3IDPA 4BIBA 4IFCA 3R8MA 4TNDA 2QO2A 3UOHA 4NL0A 3QD2B 1B39A 3QRUA 2XNGA 4HGLA 4JDIA 1CTPE 1XWSA 3AT3A 1JLUE 3F82A 3TDWA 3NNVA 4NEUA 4NFNA 4RJ5A 3MTLA 5IH6A 4PL3A 2B9FA 3WF9A 3LMGA 4K0YA 2VTIA 3A7FA 5EW3A 4DGOA 2WMAA 5BVFA 2X7OA 3O8TA 2UVYA 4R3PA 5E7RA 5C27A 5LARA 4BZDA 2ITTA 2UW5A 3EQHA 2IVTA 2WMBA 4UALA 2CN8A 3EN5A 2OF4A 3MVHA 5J5TA 4R78A 3VS7A 5CU6A 3ZSHA 4E26A 4B9DA 3IONA 5FLFA 5K4IA 4QTCA 4C4JA 4YJSA 3ZLWA 4S31A 3SRVB 1ZYDA 5AP4A 4KB8A 4FUXA 3ORPA 3FMEA 4X2NA 5F1ZA 2R3KA 3QZGA 4EOMA 2QOCA 4DLIA 4BZOA 5CVHA 4WG5A 2JD5A 3FLWA 4GFGA 2QO9A 5H3QA 3NYOA 5BVOA 1IRKA 4GFMA 2C0OA 4IX3A 4ZTSA 5IH4A 1S9JA 3R1YA 4K6ZA 4GK3A 2Y8OA 4O0YA 3E8CA 3ZH8A 4RC4A 5LWMA 5HEZA 2BFYA 2OK1A 5EDQA 3VBYA 5EM8A 2UZTA 2VAGA 2QOIA 3QQFA 4F4PA 5CF5A 1KE5A 2DYLA 3VS1A 3GFEA 4UBAA 4UMQA 4CFNA 4UN0C 2IZUA 4RQKA 4BDKA 2J9MA 4D2TA 3Q9YA 2IZTA 1QPDA 2UZOA 2YCRA 4L3JA 3A4PA 1WVWA 3G9NA 3EKNA 3PWYA 4BGQA 4D2SA 2CNQA 5IQCA 5HX8A 3Q04A 4QMOA 4V05A 5F20A 4GT3A 5HO8A 1BI8A 2PZPA 4BKJA 2XCKA 3NUNA 4ANSA 1PXLA 4NW5A 4MNEB 4ZTHA 5AJQA 1YOLA 3A8XA 3EZRA 4B99A 4C33A 3OWKA 3ZM9A 5HTCA 4BY9E 2WMXA 4G5PA 2G9XA 3MH0A 3FPMA 4RIXA 4BHZA 3CKXA 3JPVA 4BCJA 1IA9A 2UUEA 5TOZA 3UYSA 3SKCA 5J1WA 4F0FA 4S33A 5LMKC 4YJQA 3TDVA 4J97A 4PL4A 4LV5A 5ACKA 2F9GA 5AEPA 3RP9A 4D4VA 3CGFA 4HNFA 4D55A 3IW5A 4L00A 5M53A 2DWBA 1QPEA 4MQ2A 4RG0A 5B2MA 3C4WA 4MF0A 1F3MC 4O7SA 2C4GA 5M57A 5EDPA 2WTKC 4HCTA 5DBXA 2R7BA 3KB7A 4NZWB 1M52A 3MS9A 4TYHA 2VV9A 4X6QC 3RBWA 3UO5A 2UW9A 1OBGA 4XOZA 3K54A 3U9NA 3FLNC 3VBWA 1I44A 3ODYX 3G6HA 4APCA 2YWVA 4PQNA 5HE3A 4UV0A 4MK0A 3KRRA 1PMNA 2GU8A 3QYZA 4RFYA 4U79A 4YZNA 1FVTA 1P2AA 1TQMA 2YZAA 3GENA 3HMPA 3BCEA 3P08A 4YZ9A 5AM6A 5HG5A 3C0HA 4FKGA 4YBJA 3LIJA 3V8TA 1Q3WA 4AGWA 1H26A 2X7GA 2Y4IC 5J9YA 5ANGA 2XK6A 2WQBA 3BV3A 3LM5A 1OUKA 1ZZLA 4F9CA 3QXOA 3DB8A 5FWKK 1PKDA 4DH1A 3UPXA 5E92A 4F9AA 3OG7A 3FE3A 3R7IA 2O63A 3CLYA 3FKLA 4E5AX 5GNKA 4A9TA 3RHKA 1VYWA 3ZMMA 4EH4A 4QRCA 2ZDUA 3R1QA 5CT0A 3FEGA 4QP7A 5EM7A 2PE0A 1FPUA 4QMNA 2JKQA 4WUAA 2AUHA 5AUZA 5F95A 2JDSA 1KE7A 3V04A 2X6DA 4X7QA 4K9YA 2PE2A 1YDSE 2G2HA 3FSKA 4KS7A 3MV5A 4M69A 3OXTA 3FZTA 4OT5A 4OTHA 3DBFA 4GEOA 4QP4A 5DHJA 2W1GA 3IW7A 3OMVA 3ROCA 4C35A 2C0TA 3BGPA 4FC0A 4PNKA 1ZMVA 2PMIA 3KXNA 3UZTA 2UVXA 4YTCA 5DN3A 4FKRA 3C9WA 2R3HA 2BZKB 4FKVA 2CKOA 4CFXA 2HCKA 3MI9A 2BUJA 4NWMA 3SG8A 3WI6A 4DH8A 3NUYA 4HYIA 4QYHA 3GP0A 4IAIA 5ACBC 5B0XA 2WAJA 3HP2A 3QQLA 1UA2A 4I92A 5B7VA 2QG7A 4OTGA 2C6EA 1TKIA 2F7EE 4Q5EA 5E1EA 5M08A 5M4IA 1J3HA 2CGUA 2GS2A 3R7OA 2RFDA 4ZY6A 5T6KA 5CZIA 3WYYA 1H1QA 4FKTA 2C3IB 5E1SA 3U6HA 5KX8A 3FL4A 2OZOA 5DPVA 3HRFA 4DG3E 5AUXA 1URWA 3PY3A 2R3MA 5HG9A 3TKHA 3VS2A 5C26A 3S3IA 3N4VA 5AV4A 4O2PA 4RVLA 3R1SA 2F2CB 3GU8A 3LMIA 1MP8A 1STCE 3QKMA 4E6AA 2AC3A 2CGXA 4CMOA 3W2SA 4AP7A 4CTCA 4RFZA 3T9TA 3HAVA 4BDCA 3GOKA 3I4BA 4FV2A 3FAAA 3FMJA 3LJ2A 1GOLA 2PUUA 4R6VA 1EH4A 4S30A 4D4YA 3OFMA 5AV0A 1ZRZA 4MAOA 3BHTA 3GB2A 4RLLA 3BBWA 3F9NA 5DT4A 3ORMA 3G0FA 4MD9E 1KE8A 3ORNA 2CKPA 4QP9A 2QLUA 2J2IB 5IZFA 3K3IA 3KQ7A 3TACA 3C4FA 4BN1A 4BCIA 3FBVA 2BDFA 5ETFA 4NCTA 3V5JA 4BVUA 4DGMA 4D2VA 1JKSA 2JEDA 3A2CA 3BU6A 4G3CA 1NW1A 4QPMA 4RX7A 1YQJA 4FKSA 3P4KA 3LLAA 5TKDA 5KZ0A 5L6WL 3THBA 3RAKA 2E9UA 5CSXA 4YJUA 4QP3A 4O7WA 2HY0A 5KMOA 3BX5A 3W18A 5KHXA 1ZLTA 4PMSA 4OTPA 3ULIA 4AQCA 2OZAA 2XH5A 2YM7A 5CI7A 5GZAA 5IPJA 1RDQE 1K9AA 4IZYA 1BL6A 2ONLA 3FHIA 3SW7A 3EHAA 5GJGA 3VRYA 3ETAA 3G9LX 4E73A 2REIA 4GU9A 4A9RA 4CFFA 4RFMA 4EONA 5DI1A 3U6IA 4YJOA 4G1WA 3S4QA 1DAYA 1QCFA 4TYIA 3JVRA 4FTMA 1U46A 4WSYA 4RIWB 2YAAA 4AA4A 3HECA 3H30A 2J0MB 4JRVA 4CCBA 3NNUA 3D2KA 3BV2A 2PMNX 4XRLA 3PVGA 4J95A 4Y5HA 3SX9A 3UC3A 2VNYA 4QMZA 1JNKA 3D7ZA 3FMNA 5JKGA 1XH4A 2NRYA 4L3LA 4FTOA 3VBTA 2I0VA 2XA4A 3AQVA 2J7TA 4I6QA 5E8SA 3VHEA 2R5TA 4A4OA 4E93A 3L8SA 3PJ1A 2Q0NA 5AUUA 4LRMA 1ZAOA 5I9VA 1WBOA 3LXPA 4CSVA 1VEBA 3AXWA 5HTBA 3FI3A 4XHKB 4XMOA 2IO6A 4DGNA 3P1AA 4XCUA 4E4LA 3QWKA 4LL0A 4F9YA 4AOIA 5IA1A 3OXIA 2W1EA 1OMWA 3DDQA 5C4KA 3MPTA 3G5DA 2C3JA 2OI4X 4OW8A 2WOUA 1PXNA 3NCGA 5J8IA 3DLZA 3QLFA 1Q8TA 2GFSA 4HYSA 4KRDA 3FZRA 3Q60A 3R6XA 1F0QA 1ERKA 2WFYA 4JBOA 4NK9A 3P5KA 4IAYA 3SOAA 3GGFA 4GJ2A 4XOYA 4GU6A 4WG3A 1RE8A 3Q4UA 5I9YA 5LCJA 3A60A 4H3BA 4HVDA 4HVIA 3ZEPA 1R0EA 3GU6A 1OECA 3WZJA 4NTSA 3O71A 1VYZA 4QMLA 5DRBA 2CHLA 4IB0A 4QTAA 4BGGA 5C1QB 2GHMA 3IDCA 3QXPA 3HA6A 4F08A 5AAEA 3SVVA 4L6QA 5BMMA 3QTQA 4K77A 5BX0A 2BRNA 5JN2A 2XRWA 4DT9A 2QOHA 1ZMWA 4KKEA 3R8LA 1J7LA 2GHLA 2BIKB 3WE4A 5KO1A 1FMOE 1OL2A 2I7QA 3QTXA 3F3WA 1YRPA 3H10A 1BX6A 2HIWA 3EH9A 4CT2A 2RFSA 5CU0A 4OBPA 2NNWB 4PDPA 3ZCLA 3TUBA 4RZVA 3WOWA 2FH9A 3ZUUA 2X39A 4F7JA 3FMHA 4TRLA 2UW8A 3ZRMA 5CALA 1JBPE 2E9OA 2YISA 3BEGA 3LOKA 2RF9A 3NYXA 5IQFA 2J50A 4I4EA 3DBDA 3F6XA 3HRBA 5D1JA 3QD0A 4EWHA 3BYUA 3CC6A 3GC0A 3GCPA 4JIKA 4LRKA 3KN5A 3RK5A 2XS0A 5IISA 5CEPA 2O65A 3PSDA 4A06A 3B2WA 3NYVA 2IVUA 2QOOA 2X9FA 4NJ3A 4AZVA 3Q96A 4GG7A 3P86A 2W5HA 4E8AA 1H27A 3HNGA 4L9IA 4DTAA 3UZRA 3TIZA 4FV9A 2XM8A 3PJ3A 2VTNA 3PLSA 2Q83A 2XIYA 3KK8A 4OAUC 2JIIA 4F65A 1YI4A 2OGVA 5HHWA 4ASEA 3ZEWA 3CEKA 3OUKA 4O6EA 3E5AA 3JYAA 4DFZE 5KNJA 4ZS0A 3UVPA 2X8EA 4NSTA 4RVTA 4ANNA 1Q8WA 3Q6WA 5A4EA 3BEAA 4XLIA 4F0IA 4ZEGA 1A06A 3ZSGA 2YERA 1NY3A 5J5SA 5LWNA 4KKHA 2FUMA 5DYJA 1ZOGA 4LGGA 4ASXA 5I9XA 3E93A 3MA6A 5L2IA 4I5CA 4ZSJA 5DG5A 4C8BA 1WBVA 4A7CA 4XX9A 2AC5A 3NLBA 2XK7A 4XP2A 3IGOA 3LCTA 2VTRA 4FTTA 4FTQA 4OBOA 4FBXA
chains in the Genus database with same CATH superfamily
3QLGA 4ITHA 1XMMA 3KA0A 5HI2A 4FZFB 3CKWA 2WTIA 3IK3A 1PJKA 4M68A 2W9FB 3C7QA 3QTRA 3C13A 3VUMA 2HAKA 2Z2WA 4MXOA 2B52A 4PMPA 5AUVA 4PDYA 2BIYA 2R0UA 4WUNA 4FYOA 5KMKA 3UNZA 4F64A 1OIQA 5AP6A 4N4SA 5G6VA 4CKIA 5EI6A 2IN6A 4AOTA 3RKBA 2ITNA 2VN9A 1APME 3MY5A 4ZAUA 5CAOA 1CKJA 2H34A 1H1PA 4UZDA 4LL5A 5A6OA 3TZMA 2FB8A 3R7EA 4AE6A 4ZY4A 3HV6A 3ZONA 2VTJA 1MRYA 4IVDA 4LQMA 4RJ4A 4V0GA 3W2PA 4AFEA 2Y6OA 3E87A 4DEEA 2WB8A 2VTMA 2ITZA 2JDVA 4ERWA 5HIEA 1WAKA 3POZA 5FXRA 2OJ9A 5IA0A 2XEZA 4IWOA 2R3IA 3BHUA 1TVOA 3QQUA 1OPKA 2R2PA 4PP9A 4ZXTA 5LMAA 4FIGA 4I5MA 2IZRA 3UO6A 3NUXA 3PTGA 4YZMA 2HZIA 3Q53A 2Y0AA 4WHZA 5DVRA 4BCQA 4USEA 2EB3A 1H1RA 3F5XA 4D0XA 4RX9A 4NYEA 3DXNA 3VVHA 5J7BA 4DHJA 4O2ZA 3PJ2A 3R8UA 4UMRA 3DBEA 1GY3A 2F49A 2J5FA 2ZV2A 2QOKA 4IIRA 2UW3A 4P4CA 2YJSA 1I09A 2BAKA 5EYCA 4FGRA 3O96A 4HVSA 5HG8A 4DEBA 1W2DA 3V3VA 3BHVA 3I0OA 3VS6A 1JQHA 1Z5MA 4LYNA 3UBDA 1LPUA 2W4JA 1IEPA 3DK7A 4QTDA 2R3LA 1GIHA 4QT1A 2XVDA 2V7AA 3CPCA 3DPKA 4FSZA 4HYUA 3NAYA 4IB3A 5AX9A 2B7AA 4DHIB 2XIRA 2ETMA 5IUIA 1YWRA 4LOPA 4D2PA 2ZB1A 3VC4A 5KMIA 3VUHA 1M2RA 3DFAA 1SMHA 5KMLA 3GCUA 2GSFA 3QF9A 4EH8A 4YC8A 3ALNA 1YHVA 3N9XA 1LEZA 3BKBA 3ENMA 1SNXA 2LGCA 3QTWA 5ANKA 4BF2A 4CZUA 4D1XA 3P0MA 3QFVA 3VHKA 3MTFA 4P5QA 5M07A 4QYFA 1R1WA 2BKKA 3ORXA 4GJ3A 2X4FA 2XUUA 3Q4TA 4BBFA 1W83A 4C2WA 4I23A 4CFMA 3LMHA 4IC7A 2F2UA 3UP2A 3VF9A 2C6TA 1HCLA 4MXYA 1OKYA 4OTRA 1WBWA 1XO2B 4NFMA 3MFSA 3S2PA 5CF6A 4ZLYA 4F63A 2BRHA 3GVUA 4F1OA 1XH7A 5L2SA 2R0IA 4II5A 2DQ7X 4EYJA 3MJ1A 4LGHA 3E3PA 3KXZA 2PMOX 5H9BA 3IOPA 2YDIA 4NM7A 4ZSGA 4MWIA 3ATSA 4IX6A 4OTIA 4ORKA 4CCUA 4IH8A 2PHKA 3KIOC 2YA9A 2H96A 2I6LA 2QQ7A 2BTSA 1YWNA 4JR7A 2YCQA 3AC4A 4R1VA 4C4HA 2Z02A 3L1SA 1Q3DA 2C6KA 4FTIA 5M56A 4H05A 4ALWA 2OU7A 2JBOA 5HOAA 4ARKA 2QONA 3MJ2A 4L44A 3R21A 4UEUA 4JAJA 4DFUA 3DB6A 3FXXA 2F7ZE 4KD1A 4MWHA 4BHNA 4O0UA 3AG9A 4DH5A 4PF4A 4EL9A 1H08A 5JEBA 2PMLX 4O4CA 2BROA 3LQ8A 4NIFA 1H24A 3VN9A 4WD5A 1XHAA 3QC4A 4U8ZA 4C61A 4DAWA 3OZ6A 4DBXA 2PUNA 2R3FA 1JSVA 2BCJA 3BYMA 3WF8A 4ENYA 2UV2A 2OICA 2QR8A 3UDTA 3AGMA 1IASA 1LR4A 3D9VA 4M3QA 4AW0A 1DS5A 4L01A 4ID7A 4IAZA 4MCVA 3Q9XA 4DH3A 5AIKA 4PPCA 5HICA 4HZRA 1OL7A 1H25A 4FF8A 4MD8E 5HE2A 3KCKA 5J87A 4BIDA 4ZJIA 5DFPA 4AGUA 3AT2A 3FZ1A 3QYWA 1GJOA 3W33A 4G16A 4PX6A 4Y85A 5K0KA 4IX5A 3ZFMA 5AA8A 3ZHPC 3WF5A 4I6LA 3NIZA 3FJQE 1OIRA 2B9HA 2XK9A 3VONA 2ZJWA 3ZO1A 1BL7A 5DH3A 3KN6A 5BVDA 2PPQA 1JSTA 5IQDA 3U4UA 3EQRA 3FDNA 3COKA 4BWPA 3W0SA 3LM0A 2WMVA 3OY1A 2HWOA 4FV5A 5HNIX 3VW8A 3FSFA 3D7TB 2BVAA 4LMNA 1ZWSA 4I6HA 1IA8A 2QI8A 4ENXA 2JBPA 1UNLA 2ITVA 3G0EA 4C34A 2BPMA 5FM2A 5CY3A 4R7HA 1FMKA 3ZC5A 4BC6A 5GIOE 2UZLA 3KCFA 2C3LA 2XM9A 3R1NA 3RPVA 3GNIB 2X8IA 3ACKA 3ITZA 2XAOA 3I6UA 2YLFA 3FUPA 4RIYB 4YTFA 4LUDA 4DDIA 4QMTA 1ND4A 3OCTA 3QA8A 2YEXA 2YHVA 3DS6A 4LRJA 3VJNA 3TM0A 4I0SA 4UX9A 5JQ5A 4EZ3A 2VWYA 4AACA 3UIMA 1PMUA 5D11A 5HIBA 4PDOA 4NM5A 2Y4PA 2XNBA 5BVWA 2QVSE 2GHGA 3QRTA 1YKRA 4KIPA 3PG3A 2A0CX 2QURA 3ORZA 2B0QA 1NVRA 4I1ZA 3TTJA 4C57A 5BVNA 3PVWA 2KULA 3VRZA 4HPUE 1KE9A 2YN8A 3MBLA 5G1XA 4R77A 5AP0A 3UDZA 4AAYA 2VWIA 3KMUA 4MNFA 5AR5A 3ZBFA 3OW3A 3ZM4A 4YC3A 2XCHA 4Z7HA 1KSWA 3I5NA 4KABA 5DEYA 1YHWA 4EK3A 1GZNA 4XP3A 4JVGA 4ZK5A 3PLAE 4HZSA 3UIBA 1NVSA 1QL6A 4IMYA 3ZRKA 2V55A 3QU0A 1JOWB 4FSYA 4KBCA 4PWNA 5FBNC 3MWUA 1DI9A 2C5XA 3LJ1A 3CD3A 2ERZE 3ZZEA 4CFWA 5IUGA 4PY1A 2PULA 2FSLX 4OGRA 3UDSA 2QKWB 5J1VA 1YOJA 1YXTA 3D5UA 4F70A 2W9ZB 1TQPA 2ITUA 2PVJA 2VD5A 2R3QA 5I9WA 3FQSA 5FTGA 4M67A 4TW9A 4RC2A 5GZ9A 2XZSA 5EHLA 4RX8A 3VQHA 1ZZ2A 3O8UA 4K11A 5J95A 4U5JA 2GNFA 3ORTA 5E90A 3F66A 4XRJA 4ANQA 4YUQA 2ZMCA 5EHYA 3DAJA 3GT8A 3K5UA 4EK6A 4GT5A 3LJ0A 3W0PA 3M1SA 4LV8A 2JDOA 1CKPA 5DT3A 1ZYCA 4AOJA 2VGPA 4QQCA 2PZYA 4O7ZA 4ANOA 1FVRA 3Q52A 4FTNA 4FIJA 1Q61A 3TJCA 3UIUA 3GC9A 4AN2A 4AA0A 4S2ZA 4CQEA 5FP5A 5DMZA 4XV1A 1NVQA 4G2FA 3B8QA 3N4UA 2B9JA 1WFCA 5AAFA 3DK3A 2Y9QA 3RNIA 4K1BA 4I5HA 3NEWA 2WMRA 4FSMA 4QQJA 3UOKA 1RJBA 4J52A 1WVXA 4K8AA 4Y83A 1R78A 2CCHA 4FKQA 5IF1A 2PVLA 5K9IA 1SZMA 1PYEA 3GCQA 2E9VA 3LFFA 5J9ZA 4QNYA 4UXLA 2F57A 4FG7A 2BDWA 2WQOA 4CG9A 4WA9A 3CTQA 1REJA 5FBOA 3ZS5A 4AXDA 1JAMA 3OROA 4CRLA 2IG7A 5BMSA 4L42A 4PUZA 3CSVA 2WHBA 1URCA 2CCIA 4DHFA 5A46A 3LXNA 3ERKA 1U54B 4QEBA 4NTTA 3EQBA 3R9OA 4BB4A 5D7VA 2WGJA 4I22A 3PP1A 5GHVA 1WBPA 2I40A 2V5QA 3COHA 5DGZA 4GIHA 2UZDA 3ZFXA 1O6YA 1B6CB 3D14A 4XBUA 1OPLA 3CTHA 3QRJA 4IM0A 4Z55A 5AUYA 3QAME 2GS6A 3UO4A 1XBCA 2YM4A 2EB2A 4YHTA 5E8TA 2XEYA 2ZM4A 3VIDA 1UWHA 2UZBA 4FTCA 3W2QA 4UWYA 3AKKA 3QRKA 2C6MA 1S9IA 3FY2A 3H3CA 5JZNA 4DBNA 2XB7A 4O21A 5D9HA 5AUWA 1UWJA 4FV1A 4YZCA 4EYMA 1JWHA 5CXZA 2LAVA 4AW1A 3UIXA 4EH6A 4AXEA 2OLCA 3QCYA 5BYYA 4CQGA 3W2RA 4RA4A 3LQ3A 2C1BA 4H36A 4KKGA 4BKYA 4CNHA 4ZTNA 3SA0A 3HDMA 3KK9A 3PY0A 2ITQA 5HE1A 2P0CA 3AD6A 4MBLA 4YHFA 5DT0A 5CVGA 3UQCA 4CG8A 4HCUA 3MB6A 3KXMA 2PVYA 3R9NA 5GINE 2OJJA 2O64A 3MA3A 5AR2A 5HNGA 2OW3A 2XYUA 4LUEA 5L2TA 4GRBA 4L7FA 3MESA 4P7EA 4YJVA 4E4NA 5TO8A 4ANLA 3ML1A 4JDJA 4LOQA 3E8EA 5CEQA 3OBGA 4BCMA 2W5AA 4I3ZA 5HCZA 2O3PA 4CYJA 5EI2A 3EYGA 3GC8A 3MFTA 3NPCA 3L8XA 2FYSA 2WU6A 4OTDA 4LGDA 5DNRA 4I4FA 3SXFA 4MYGA 5E8VA 1VJYA 2VTAA 4QDVA 2CLXA 1CM8A 1A9UA 5CEIA 3O2MA 3PXZA 3EJ1A 4U40A 3F2NA 4RBLA 3ZXTA 3TUCA 3V51A 5IU2A 4W4WA 1YDRE 2CJMA 3BRBA 4O6LA 3JS2A 5DR9A 5B2KA 4DFXE 4BGHA 2GTMA 4D0WA 4DFLA 1KV2A 4AQKA 3DJ5A 4L7SA 3RNYA 4E5WA 2V7OA 3EN9A 4GSBA 5D7AA 4JIAA 2JC6A 2YJRA 2B1PA 1ZYSA 3QA0A 5LMBA 3NUSA 1FBNA 4UYNA 5JK3A 2XBAA 3FLYA 1M2PA 1BMKA 3LLTA 2WMSA 3G6GA 3Q3BA 3Q9ZA 3MW1A 3MFUA 1U59A 4M66A 4ZP5A 4FKIA 4BZNA 4DLJA 4FEUA 2X0PA 4F78A 3IPHA 4H3QA 5DIAA 4FI1A 4FOCA 4M0ZA 3QGWA 5C4LA 2GQGA 3SG9A 3H4JA 1L8TA 3P7AA 1W8CA 3ANRA 3T9IA 4TY1A 4BCGA 2EWAA 3G33A 3HAMA 3MPMA 3F61A 3HZTA 4ALUA 2BTRA 5LVNA 4L67A 2JDTA 4JBVA 4QDEA 5AP1A 4I21A 1AGWA 4MX9A 2VZ6A 1G8AA 2UZEA 5LVMA 4AS0A 3DQWA 1U5RA 4FTRA 4GK2A 4O0XA 1ZXEA 3V6RA 4EOJA 3II5A 4IWPA 4W9WA 3MSSA 3OW4A 3PY1A 3EQPA 4R3CA 4UWCA 2XNPA 1PXKA 4I94A 5HBHA 5HNBA 4B0GA 4UZHA 5JFSA 1TFFA 3KRXA 1A48A 2WOTA 4WNKA 4EOOA 5EM5A 4AW5A 4BDHA 3TZ9A 4QYEA 3EIDA 4IVBA 4JLCA 4JBQA 4FKLA 3U8WA 2J4ZA 4EH2A 5F4NA 1P5EA 1YDTE 4A4LA 3VUTA 4U97A 2W1IA 4FJVA 1OI9A 3WYXA 2BDJA 2YM5A 3LHJA 4DTKA 3FC1X 3EB0A 4ANMA 2YM6A 2XK3A 3O51A 3GUBA 4RZWA 3PVUA 3DKOA 1SYKA 4KRCA 3RI1A 4E6QA 1SVGA 5AV1A 3OVVA 3FXWA 1R3CA 3FMMA 4YJPA 3MH1A 3UP7A 4EWQA 4FX3A 4G3DA 3OT3A 5I9UA 4FT5A 2C30A 4WNMA 4EC9A 3A4OX 4XV3A 2B4SB 2OJFE 3TKUA 3UVQA 1O9UA 3P23A 5CI6A 3QTSA 3BL7A 4B4LA 4O0VA 4U80A 2JIUA 5BQ0A 2WIPA 5HO6A 2PVMA 3QKKA 5EOLA 3BI6A 5K3YA 4IDTA 2RG6A 3KULA 1SNUA 4ZSLA 4IJ9A 4ACDA 2HXLA 5HU3A 5HU9A 4F9BA 1ZYLA 5KBQA 4YTHA 4TYHB 2VWBA 3BELA 5BNJA 4FZ7A 3ZUTA 4PNIA 3MB7A 5FEEA 4C0TA 2OIDA 3KXXA 3H9OA 3LXKA 4AZTA 3NNWA 2CN5A 4IE9A 4IDVA 2ESMA 3FLSA 3MGYA 4PP7A 4G17A 5HVKA 2OJIA 2VGOA 4QP2A 1W2CA 3QD3A 1VZOA 5J79A 4CMTA 3V8WA 4AU8A 5JRSA 4ASDA 1Q8UA 3DKCA 2IF8A 2X1NA 5H8EA 3UMXA 4ZSAA 4YC6A 1MRUA 4MQ1A 2Y6MA 1IG1A 3ODZX 4FE2A 2QOBA 4O1PA 3CY3A 4YP8A 1CDKA 2R7IA 4L8MA 5BVKA 4DN5A 2XIXA 3FMDA 4J53A 4QMVA 3RWQA 4E6CA 5ICPA 3MFRA 3HA8A 5I3OA 5L6PA 4LFIA 2X0OA 3F69A 4R5YA 5IDPA 4C59A 4L53A 4PTEA 3FQHA 5FQDC 1KWPA 5E8XA 3C5UA 2ZB0A 3NRMA 4L3PA 4EUTA 4M69B 5ANIA 2VO7A 3M42A 3D2IA 4XNEA 1OBDA 3LFNA 2A98A 3QQHA 4G6NA 4JQEA 3MDYA 4ACGA 2RKUA 3D5VA 3RWPA 4E4MA 3SLSA 1FGKA 1Q97A 4P2KA 5CU4A 1GIJA 4UB7A 3NUPA 4IXPA 1ZYJA 4EHGA 4FTJA 2CSNA 4WOVA 1M14A 2JIVA 3ELJA 3PJ8A 3RCJA 5BUJA 2NRUA 4BDIA 2DS1A 2UZNA 3KMMA 3FPQA 5E9EA 5EH0A 4NKSA 3QZIA 3TNQB 2ZOQA 5EQYA 4TWCA 4U42A 3VBXA 3PUFC 1Z57A 5E8UA 2IEWA 2YAKA 4L43A 3FI2A 2RIOA 3BYVA 4WBOA 2XNEA 4FT9A 3LKMA 4FZ6A 3C5IA 3B8RA 3P79A 3BWJA 3CIKA 4QYGA 4PMMA 2GMXA 4EH7A 5A54A 2R3RA 4O0WA 2BKZA 3BBTB 4ZZNA 5JFWA 3MIAA 4Y72A 4KINA 5CENA 1G8SA 4YSJA 4J7BA 5A14A 3EL7A 3GQLA 4Q9SA 4RJ6A 3RZFA 3H0YA 2BHEA 2C1AA 1T45A 3CD8A 2FO0A 3VUGA 2WU7A 2W1CA 3I0QA 1XH8A 4M15A 3TEIA 1Q8YA 3BWFA 3N4TA 3L9PA 4MXCA 4XUFA 5CNOA 4ZTRA 5FRIA 1FOTA 3TI1A 3ZYAA 1PF8A 4RX5A 3TV7A 3W1FA 3PVBA 1Q5KA 4J96A 5DR2A 3D94A 3U51A 2BZIB 2JGZA 2VWXA 4C4FA 5LMKA 3ZLXA 1LP4A 2CNVA 2YABA 3DK6A 3RHXA 2UVZA 4IM2A 5HVYA 3NDMA 5IKWA 2GQRA 4JG7A 4XP0A 3V5WA 3NWWA 5FD2A 4XV9A 3EFKA 1G8KA 2EXEA 4F1MA 1R0PA 3FYKX 2WZJA 3E7VA 4H58A 3VUIA 4BYJA 4ONAA 4KIKB 5L8JA 3V5PA 1OB3A 3GI3A 4FEXA 2ZYBA 4JDHA 4OUCA 4FVRA 3C50A 5EQEA 4GL9A 4IBMA 5ITAA 2BAQA 4D28A 1Q4LA 2UZWE 1WBSA 4G6OA 4N57A 2JAMA 5J9LA 2C5OA 2AYPA 3ATTA 4IX4A 4JMQA 4M12A 3LXLA 3ZDUA 4BDFA 4F6UA 2HZ4A 2ZV9A 4EOIA 4TPTA 3QUDA 3BU5A 3EN6A 5L4QA 2CKQA 1OVEA 1Y91A 3VF8A 4CLIA 2QCSA 5CANA 4RA5A 4O38A 4MTAA 4BDJA 3ANQA 3OS3A 5BYZA 1JSUA 2WMWA 4FL1A 3UNJA 2HWPA 4I93A 3V5TA 3RPYA 4F7SA 4FSRA 4FSTA 4W4VA 4I6FA 3TMOA 2OSCA 1J1CA 4AXCA 3O0GA 2Q0BA 2H9VA 3DLSA 3O5AA 5EHOA 3F3UA 4QPSA 5AR7A 2C6LA 4YLJA 3FC2A 5C8MA 1Y6AA 3KRWA 4YZBA 5FXSA 4BKZA 3PE1A 5FEDA 2IZSA 4RQVA 2BZHB 3R01A 3ID6C 4EHEA 3OHTA 4O4BB 5D10A 4AG8A 2BR1A 3I5ZA 3P78A 3R71A 3OT8A 2ITXA 4U81A 2YCFA 3HMIA 3ULZA 2R4BA 1E1XA 1LEWA 4ALVA 4A9SA 4YZDA 3NW6A 3UMWA 3R7GA 3HUBA 3TNWA 3RAIA 5HLWA 4C3PA 3IG7A 4EH3A 1PMVA 1Z9XA 3U6JA 2IVSA 2OH4A 2YIXA 3DZOA 4RC3A 4AZFA 4M13A 5DE2A 1JKKA 1H1SA 3E64A 2XKCA 2XBJA 3EZVA 4EOQA 1U4DA 2PE1A 2PVHA 4FODA 3RK7A 4ZY5A 3CR0A 3QHWA 3ZBXA 2VX1A 2KTYA 2ITWA 3CS9A 3EFJA 3LVPA 5K5XA 4O83A 3LFAA 4MHAA 3RZBA 1J91A 2RSVA 3KVWA 4G3FA 4W8EA 5BUEA 2OFVA 3JUHA 2YITA 4FT7A 3F3ZA 2VTOA 3R8PA 4DHZA 3G15A 5CSHA 4DA5A 1JPAA 4BL1A 2QODA 4UMTA 3COIA 4O96A 3UODA 4CVAA 5BV3A 4F9WA 5E8ZA 1XBAA 5HCYA 4M7IA 3W0MA 4DFNA 3U54A 1KOAA 3BE9A 3KFAA 4ZIMA 3FXZA 5ANDA 3TNHA 3R83A 5CF4A 2PUIA 1MQ4A 4FT3A 1F5QA 4ZJVA 4JNWA 2W1HA 3AOXA 2E2BA 4RIYA 4FSWA 3PWDA 4C3FA 2W06A 4FNYA 2VTQA 5LQFA 4DCAA 3RINA 3PXFA 4GUEA 4C3RA 4CMUA 1UVRA 3V5LA 1RW8A 3MVLA 1H0VA 4RMZA 4EHVA 1VR2A 4FZAB 3O23A 4GS6A 3SAYA 4O27B 3A99A 2B53A 4ITIA 5KE0A 1WBTA 4DITA 3RCDA 3MYGA 2J5EA 4A9UA 2CKEA 2G01A 5HTIA 4QMMA 4D1SA 2C0IA 5CWZA 2PVFA 4JR3A 2CDZA 4JQ7A 3U4WA 4S34A 3QL8A 4FSQA 2V22A 5AM7A 4YJRA 1BLXA 4PTGA 3FZPA 1CSNA 4BTJA 2B54A 2XKDA 3R7VA 3UDBA 3PRIA 3ALOA 2W4OA 2BRBA 2BMCA 2EXCX 2VRXA 5HBEA 1XJDA 1OIYA 5AMNA 1RQQA 4PTCA 1Q8ZA 4MXZA 4G3EA 3TZ7A 4IACA 3ET7A 1HCKA 5ETIA 4BCPA 2YCSA 3FQEA 4QYYA 3QCQA 2PVKA 1G8JA 4F09A 3D0EA 4XG3A 2WKMA 3PFQA 3R7YA 5F9EA 4P90A 4BJJA 3EOCA 4QTBA 1OM1A 3SRVA 5K0XA 4J99A 4DTBA 1UU3A 4AWIA 2Z7RA 2BRMA 2BILB 4BDAA 3TG1A 3OWJA 4WRSA 3LFBA 3RALA 4R7BA 1PXOA 5CEOA 2VTHA 3WZKA 4ZZOA 1PRYA 3W55A 5CEKA 4EZ5A 4FT0A 5GZ8A 2OWBA 3PPKA 4AZEA 4W8DA 5J7HA 4RPVA 4QMXA 1CMKE 3QCSA 2EU9A 3SD0A 1YXUA 3OD6X 3OUNB 2VO6A 5D12A 3BU3A 3UTOA 4MBJA 3R9DA 3HYHA 4XH6A 4O22A 4EBWA 1KUTA 5E4HA 4IQ6A 3CGOA 4IB5A 4CZYB 3QC9A 4LOOA 3QX4A 4U7ZA 2OKRA 3KXHA 5JGBA 2OFUA 5HD4A 5BYLA 1YI6A 1FVVA 4HOKA 4I6BA 4JL9A 4FK3A 2EUFB 4X3FB 4AGDA 3NYNA 3R30A 3SDJA 1X8BA 3R0TA 2GNLA 2J0JA 2RFEA 5HG7A 1T46A 4D4RA 4BDBA 4YGAA 4GVJA 2V0DA 5CT7A 5AP2A 2XK4A 4QTEA 1WMKA 2CPKE 4IHPA 3OEZA 4FRFA 4NT4A 3PSBA 2YLEA 1YXSA 3QZHA 4Y8DA 5DEWA 4MNEA 3WF6A 3KXGA 5HZNA 2BAJA 1MQBA 2PVNA 2W4KA 3HEGA 4YSMA 4UYAA 3OXZA 3F5PA 2VWVA 4UMPA 2G2FA 4IZAA 3HLLA 3QZFA 3Q5IA 3HUCA 3W0QA 2OG8A 1ZMUA 3CJFA 5EYKA 5DWRA 3W16A 3DJ7A 3QRIA 4DEHA 5KKRB 2JKKA 3AMBA 1M7NA 3DZQA 4EKLA 3L9NA 2YFXA 4V0GB 3G90X 3KC3A 4Z3VA 3P5JC 3EN7A 1J7IA 2ZV8A 4M14A 3A8WA 2ITYA 3O7LD 3PIXA 3W8LA 4AX8A 3ZC6A 2IW8A 4ZLOA 3TUDA 4AT4A 4NKAA 3AKLA 3R02A 4NUSA 4TWPA 4HVHA 2FSMX 2G1TA 4YLKA 3ORIA 3NUUA 4BCNA 4F7NA 4CXAA 4OAVB 3UG1A 5A4TA 4Y5QA 4L68A 5AX3A 1E1VA 3PRFA 4KBAA 3BPRA 4KA3A 3GC7A 3CCNA 3SXSA 5FM3A 3NZ0A 2XRUA 3OEFX 4Z9LA 4V04A 5L2QA 4FEWA 4FVQA 5HIDA 1YVJA 4XEYA 2J90A 5ANJA 4EUUA 3HV5A 3MVJA 4K18A 4NCTC 4C4EA 5TR6A 3RJCA 1PMEA 2J51A 2X4ZA 4O7NA 5LJJA 3FI4A 2FVDA 3AT4A 5T3QA 3WIKA 5JMSA 4O91A 3BLAA 3L8VA 5IQGA 2PZIA 4WO5A 1H8FA 3C51A 5KMJA 5A3XA 4ASZA 2C47A 3JVSA 4RGJA 5FG8A 4G3GA 4FA2A 3PZHA 4BFMA 3DTCA 3KREA 4U45A 2UZUE 3UZPA 2ONLC 2I0HA 4Q2AA 4R1YA 4O4FA 4BCHA 3AD4A 4H39A 5I3RA 2QLQA 1GAGA 3NCZA 1ZOEA 4O1OA 1TZDA 3KF7A 4DC2A 4O7LA 1OL1A 1ZARA 2VTSA 2P4IA 4QP6A 1Q41A 2ETRA 4BCKA 3DT1A 4APPA 3QKLA 4AZWA 4AZSA 2RGPA 3HMMA 5AV2A 2OF2A 4TZRA 2ITPA 4XG2A 3MPAA 3R9HA 1SVHA 2C5NA 4V01A 4RRVA 3FYJX 2HK5A 3GU7A 4N6ZA 1H0WA 4X6RA 2W1ZA 2Z60A 4C7TA 4CLJA 5I9ZA 1H07A 2UW7A 5EG3A 3OTUA 5KMNA 2XNOA 3DNDA 4PV0A 3R8VA 4AXAA 4O7TA 1E9HA 2VWUA 5CXHA 3UPZA 3PDTA 3RM6A 4EJ7A 4J71A 4IANA 4CRSA 4MKCA 4C62A 3FMKA 4Z7GA 3RK9A 3BHHA 1DI8A 2HZNA 1WBNA 1VLRA 4M84A 3L9MA 4EQUA 1WVYA 1NT2A 2J0LA 2C5YA 4CGAA 4QMYA 4M0YA 3NMUF 2HW7A 1BKXA 4YHJA 1H01A 3E62A 2OXYA 3VJOA 3BLHA 3MN3A 4MVFA 3ZTXA 4C4GA 2OBJA 3GU4A 4JX7A 3VW6A 2BZJA 4OR5A 4R7IA 2GPHA 3TWJA 5A4QA 2X6EA 4DFYA 4XG6A 4DDGA 4KSPA 2WMQA 3ZRLA 1DM2A 2YACA 4Q9ZA 3CXWA 4NIFB 4EQCA 2JLDA 3EQCA 5C8NA 2CLQA 3R00A 4QMSA 3OP5A 3JR1A 1OKWA 3AC2A 3DJ6A 4GMYA 4NW6A 1ZY5A 1GNGA 4BR3A 3GFWA 3ROYA 2JFMA 1IAHA 3FZSA 2OJGA 4LI5A 5M51A 2HY81 4JJRA 5AWMA 5JSMA 2WPAA 3E63A 5ANOA 5FUTA 4QMQA 3LCSA 3TCPA 3T8OA 3WBLA 3KKVA 4XG7A 4BBMA 5IQHA 2PZRA 3BYSA 3CJGA 3QBNA 4FG9A 4U0IA 3T3VA 4ZLZA 3CPBA 3S1HA 2GQSA 4HYHA 3E7OA 5EI8A 3RPOA 4OTFA 5M4UA 4XYFA 1ZY4A 5CTPA 2UW4A 2X8DA 4KSQA 4DCEA 4D5KA 3POOA 4GG5A 1H28A 2GDOA 4X3JA 5CVFA 1J1BA 3VS3A 2XF0A 1OPJA 4EH9A 5HLNA 4IM3A 3L9LA 4W9XA 4X2JA 2IVVA 4WKQA 2ACXA 4WSQA 4LV7A 3PPJA 4HVGA 1NXKA 4DEGA 2OO8X 3ZO3A 3LFQA 3TV6A 5IEYA 3FMLA 2W0JA 2W17A 4HW7A 2BHHA 1JKLA 2PU8A 3AC1A 3U87A 3CE3A 2X2LA 5L6OA 3U9CA 2YZLA 5KCVA 4EC8A 3NVMB 4X2GA 2A4LA 3BLQA 5JFXA 4ZTMA 4PPBA 4NM3A 3DAEA 3F5GA 3KGAA 3F5UA 3O17A 5ETAA 1OGUA 4IVAA 3DBQA 4UMUA 5A9UA 4BBEA 4IEBA 4EZ7A 4XBRA 4CTBA 1PXMA 4YR8A 1O6LA 2ETKA