2GFCA

Camp-dependent protein kinase pka catalytic subunit with pki-5-24
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
335
Chain Sequence
b'SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural Analysis of Protein Kinase A Mutants with Rho-kinase Inhibitor Specificity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 109
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gfcA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gfcA02
5ETIA 3N4UA 2C3LA 3P5KA 3ULZA 1W83A 1Q3WA 3MY5A 4FL3A 4FYOA 3KK8A 5DN3A 2UZOA 3D2IA 4M13A 4M69A 3FMKA 4DCEA 2IZRA 1ZMVA 4K0YA 4AG8A 5CS6A 3DLZA 4C38A 3Q4UA 3WZUA 2PVJA 3UTOA 1OITA 3VHEA 5M56A 4IM3A 2VWVA 4I4EA 5FTOA 3SOAA 3MFSA 3AGMA 1P4FA 2C3KA 4GU6A 1W82A 2PMOX 3FL4A 3UO4A 4QTDA 4C3FA 4CVAA 3O8TA 3OTVA 2GFCA 5HD4A 5M4FA 3VHKA 5H8BA 3UG2A 5C01A 4BC6A 5J9LA 2X4FA 4MBJA 3VBXA 2PHKA 3FMHA 3FMNA 4KABA 4KIOA 1HCLA 4P4CA 3CTJA 3F9NA 5FBOA 5TT7A 4KA3A 5LCJA 2HK5A 3KREA 4JNWA 4Z9LA 3V5PA 1ZARA 4YR8A 1TQMA 3GQIA 3R00A 5C4LA 4HVIA 4APPA 3W2SA 1URWA 5AM6A 4TKSA 2X6DA 3V5JA 4QP7A 3COKA 4JX7A 5I3OA 3HYHA 4IFGA 4QMNA 4TYHB 4EYMA 4EWHA 2CKPA 4BZDA 3F5UA 1ZYDA 4TPTA 5ETAA 3ZUUA 3HUBA 3H9OA 4NWMA 3OBGA 4FTUA 5FM3A 5HTCA 3FWQA 3CCNA 4JQ8A 4QMYA 3KY2A 2JBOA 4G31A 3ZXTA 4ONAA 4TNDA 4WNPA 5CSXA 3WE4A 1ZMUA 4C8BA 4UX9A 4ANLA 5E8TA 3LFQA 1OZ1A 2B9JA 3GB2A 2UZWE 1YI4A 1IASA 5K3YA 2XBAA 2YIWA 2X9FA 5HQ0A 4HYHA 3PVWA 5A4TA 4N57A 2ITNA 3TKHA 5KMOA 4CFMA 2FUMA 4WUNA 3QHWA 4NCTA 1SZMA 3S95A 2W5HA 1Y6AA 2KULA 3LXPA 4QMMA 4ASDA 4EK3A 4ZXTA 3GU4A 3SX9A 4BDBA 1YW2A 2F49A 2UW8A 1Q5KA 5ETFA 1T46A 2VTMA 5IZFA 3P23A 1NVSA 1UVRA 5AX9A 4LGDA 2GNIA 3F5XA 2XZSA 5EG3A 3D5UA 3KVWA 2E9VA 1UU3A 4MVFA 4EBVA 5KMNA 2VTAA 2C3IB 1SM2A 4MCVA 4KWPA 3NNWA 4BWKA 4L45A 4TYEA 1ZZ2A 2VWBA 4IADA 1ZY4A 2I0HA 5CSVA 1GIIA 3VW6A 2J5FA 4M0YA 2C47A 3EJ1A 3NGAA 4CKRA 5HHWA 1KV2A 1ZY5A 2CNQA 2ERZE 4USDA 4YZMA 4EI4A 5IA2A 1J7IA 4BDKA 4YTCA 3MDYA 3EYGA 5CF8A 3BYVA 3UIBA 4ACMA 3EQCA 4U3YA 5DT3A 3DXQA 3ACKA 4P7EA 3MIAA 3NCZA 5EFQA 5A14A 2VN9A 4FV9A 2H34A 4QYFA 3EYHA 4QMVA 2G01A 3F3TA 3PXQA 4IJ9A 2X39A 3FKOA 5ACKA 5AR4A 3T3UA 2HZIA 2WMXA 3KN6A 5J5SA 3N4TA 3C4EA 2BAKA 5EYKA 5I9UA 4L00A 4XG9A 4CNHA 4FOCA 3DZOA 1NXKA 3EFKA 4O6LA 4F6WA 4R5YA 3DT1A 2HCKA 5CEIA 4C7TA 2PVYA 3ETAA 3P7AA 2JIIA 4CMOA 5BVNA 4MD7E 4L44A 1G8SA 2J6MA 2XCHA 2R5TA 1YDRE 3HRFA 3NUSA 5DR2A 5FGKA 4JI9A 4ALWA 4H1MA 2V7OA 4O27B 4CKIA 1REKA 4B99A 5JMSA 4XP2A 2JC6A 2PVHA 3DDPA 3UMXA 2UZTA 3O7LB 5CSWA 5HBHA 3SXFA 4CZUA 1OL2A 4C34A 4FGRA 5BMMA 4B8MA 1YVJA 3KXHA 4AT3A 2YERA 5AIRA 1PYEA 3ALOA 3BHHA 4GU9A 4M84A 4ZSGA 3RPOA 3UBDA 2WMBA 4KIKA 1OKWA 4A9UA 4EC8A 3R71A 3NDMA 4JL9A 3DKCA 4PL5A 3WZJA 2EUFB 1UKHA 4FEVA 5DOSA 4M67A 4UMTA 2QD9A 3NAYA 4GH2A 2JLDA 2CNUA 3UQFA 3O8UA 1PXKA 4B4LA 5BYYA 4MEDA 5IISA 2B1PA 3SHEA 3CY2A 3NIZA 4O81A 4HVDA 4MNFA 4D2WA 4RQKA 3DJ5A 4TW9A 3RK9A 3BZ3A 4F70A 2BTSA 1IA9A 4NW5A 4O22A 4LL5A 4CMTA 2XK6A 5EDPA 4Z7HA 1L8TA 4AQCA 5CU3A 2PPQA 5EKOA 3SG8A 4WA9A 3SLSA 3CY3A 5A54A 1UWJA 2BPMA 4FKPA 3HMNA 2IVSA 5DR6A 4R3CA 4XBRA 5D1JA 2A27A 4O0YA 3QQHA 1SNXA 4ASZA 1FGIA 4X3FC 3BBWA 4MBLA 5AV0A 2CKQA 4DEGA 5K5NA 4H58A 5M55A 2QO2A 1L3RE 4YJVA 4E6QA 5CF5A 4IEBA 4QYYA 4GT3A 4AA0A 4DFUA 2Z8CA 3D94A 3PA3A 4XLVA 4IVDA 2R3OA 4AOTA 5IQAA 2QOBA 4V0GA 1UNGA 1AQ1A 5IDPA 4RC3A 1JSVA 3GP0A 4JT3A 3F61A 4MHAA 3Q04A 3KXXA 4W9WA 3UO6A 4IAAA 2Y8OA 4GVJA 4WG5A 4K2RA 3L9MA 4BCKA 2CJMA 3TNWA 4R6VA 3TKIA 1BYGA 1DAYA 3FQEA 3F2NA 3Q9ZA 3KXMA 2Q0BA 2OBJA 5CNNA 5HLPA 3TZ7A 4ENYA 4EOMA 4W4XA 4Q9SA 2GQSA 1DI9A 2J50A 4Q5HA 3VUMA 5HCZA 5HVYA 4CXAA 4ZIMA 2C30A 3QTXA 4RLLA 3TI1A 4ZJVA 2IZUA 2HOGA 2ITTA 4I6BA 5KO1A 4PDYA 3W32A 3L9LA 4AF3A 2VTIA 4RWLA 4RG0A 3SGCA 1O6YA 5CI6A 4RIYB 1LP4A 4E20A 4F9YA 4OR5A 4EYJA 3HX4A 3IS5A 3R73A 2YN8A 4F08A 3W2QA 3LCTA 3V8SA 5CF4A 1ZLTA 5AM7A 2PSQA 2ZM1A 3UMWA 4V04A 2C0IA 4F6UA 2G2HA 3QYZA 3V5QA 3OW4A 4GFMA 5I9VA 4DHFA 2ZB1A 2X8DA 3NYOA 4R5SA 4FT5A 2YACA 4IWQA 2VWUA 4EHZA 2HWPA 4BN1A 5DYJA 3PA5A 4LMNA 2C68A 2QR7A 2F7EE 1ZAOA 3SKCA 4BYJA 1PKGA 4AWIA 3COIA 3EOCA 3F69A 3RGFA 5CQWA 2X9EA 3F3ZA 3D9VA 3CE3A 4I22A 3FZ1A 5CWZA 5CVFA 2OZAB 5IQEA 2E9PA 2HYYA 4D5KA 5HNGA 4IBMA 4OTHA 2ZDUA 5FLFA 1OBDA 2CLXA 1PXOA 2ZB0A 4JAIA 2J7TA 4KRCA 1P2AA 2UW3A 4EOQA 5GINE 2C5XA 2Y7JA 3PXRA 5AMNA 4O0WA 5C27A 5LVOA 5EM5A 2JDSA 3Q5ZA 4JR3A 4GFOA 4FTRA 2VUWA 3I4BA 4TZRA 3DNDA 3FY2A 3TG1A 4R1VA 4R3PA 3TNPC 3ZM4A 1V0OA 3FMMA 4KKHA 4C4HA 3ORPA 3ZFMA 1OPLA 4FEWA 1WZYA 5A4QA 1YHWA 4QTCA 2C6DA 4DFNA 4ITIA 3TWJA 2VNYA 3UODA 3ATTA 1BKXA 4E26A 1HCKA 4DG2E 5E91A 5EKNA 3D15A 1VJYA 3D7TA 4PMPA 3FSKA 3NUXA 5T3QA 4KB8A 3CIKA 3LFSA 2YCQA 3KRXA 3QTIA 4JG8A 3SAYA 1H26A 3KXZA 4A4OA 4BDHA 3U8WA 3MPTA 3E93A 3P4KA 3Q2MA 2PVFA 4CV8A 4FKWA 4X6RA 3NVMB 4Q2AA 4OT6A 2GFSA 2PUPA 5BYZA 5IEYA 3VVHA 3IGOA 1H1PA 4O0XA 1U59A 5F94A 4YHFA 3C13A 3Q52A 5AUVA 2OXYA 3VQHA 2AC5A 2IVTA 5B2KA 4GCJA 2Y4IB 4K1BA 4EK8A 2GPHA 1CKPA 4I0TA 2FVDA 5M44A 4HOKA 3O50A 3OVVA 5CT7A 5FUTA 4MQ2A 2BMCA 2W7XA 1OKYA 3ERKA 3NNXA 2PZYA 4HYSA 3ZO4A 1F0QA 3Q96A 4IZ5A 3UZRA 4CZTA 4L7SA 4BCOA 5EI2A 5AV2A 3CR0A 1PF8A 1UA2A 2WB8A 2Q83A 1FQ1B 4JDIA 5F1ZA 4M7IA 3ZFXA 4FI1A 3Q2JA 4BKZA 4IDTA 5JFWA 3O7LD 4I23A 4LGHA 1ZOGA 2C69A 2O63A 2VX0A 4IANA 4II5A 2FSOX 4DEHA 4LOQA 4Y95A 5BNJA 3ZO3A 2HY81 1APME 1NY3A 1XR1A 3CC6A 4FV0A 4DN5A 3PLAE 3DAKA 1RQQA 4A9SA 2XYUA 2VTSA 3LCSA 3BCEA 3HV4A 4W9XA 4UB7A 4IWDA 5A4LA 4L3PA 5IH4A 2OO8X 3FY0A 1Y8YA 3DFCB 4C33A 3JY0A 4YP8A 3KRLA 2DQ7X 3PJ3A 3PVBA 4CSVA 4O21A 5H2UA 4BB4A 3WIKA 4TN6A 5FWKK 4EOLA 4MWIA 3G90X 4NT4A 1OI9A 4CFUA 5GIPE 4Z7GA 2G1TA 2WTKC 5HIDA 4CCBA 1IR3A 4E4NA 2XK3A 1SNUA 5M09A 3DOGA 3TACA 4O82A 1LEZA 4YZBA 1W0XC 5CY3A 3T9IA 4PDOA 4RC4A 3ZO2A 4I20A 2XCKA 3H3CA 5D41A 2NNWB 3QQLA 5EK7A 3SXSA 3HECA 5AUYA 4BWPA 3VBTA 4HPUE 4DEBA 3DB8A 3BE9A 2PTKA 4ID7A 1QMZA 1XQZA 5ICPA 3SV0A 2VGPA 1PXNA 1LR4A 4KINA 3QC4A 4P5ZA 4PDPA 3P1AA 2HENA 4ZK5A 5AP7A 5AAEA 4O1PA 4D2RA 5K4IA 4U79A 5IQFA 2RFEA 1V0BA 3U51A 2VWXA 1U4DA 3HP5A 1YOLA 4FICA 4I94A 3KMWA 2JDOA 4RPVA 3EZVA 4D2PA 4ZSAA 3I5ZA 4X2JA 2CHLA 3FMJA 4QO9A 3QUEA 5AA8A 4FE2A 4O84A 5CT0A 5CZHA 4BZNA 4RFZA 3VC4A 3EN5A 4DH1A 2R3JA 4FKRA 3GC0A 4Y46A 4YTIA 3ALNA 3DTCA 4D4YA 2GHGA 2QG7A 2C5YA 4NZWB 5HBEA 4CEGA 1PXLA 4DGGA 3I81A 5CAUA 4FIFA 3DS6A 4OBPA 3Q9XA 4XG6A 5AUZA 5GZ8A 4J98A 3NMUF 4GIHA 3QD3A 3MA6A 4ERKA 3MFTA 4DEAA 3LFCA 4M0ZA 3RALA 3F2RA 4MNEB 1GIJA 4IB0A 4CFWA 4D4RA 3PIZA 4L53A 5BMSA 3OWLA 4XV9A 3O23A 2QG5A 5EYMA 2YIYA 4AXAA 3KCFA 2XKCA 5BVDA 4C58A 1GOLA 3I60A 5HEZA 3QL8A 3Q5IA 2PYWA 3CPBA 2UW0A 3QFVA 1OIRA 5FTGA 3ZTXA 1Y6BA 4ACCA 2P55A 3PXZA 4P2KA 3ITZA 3DLSA 3CTQA 2NP8A 2QLQA 5ANJA 1E1XA 1JKTA 3W10A 2OXDA 4EJ7A 3QQJA 2EXCX 4FKGA 4K77A 3ZBXA 4PQNA 3UIMA 1PKDA 2REIA 3R9HA 3LQ3A 2WELA 3ZC5A 3AC2A 5A4CA 4Y85A 2W1GA 3LHJA 4FX3A 4OTWA 4U81A 4DBXA 4I6FA 4EZ5A 4XG7A 1WBOA 3II5A 4WRSA 2IW9A 3NVKI 3KMMA 4L67A 5DT4A 4E4XA 3PY0A 3VBWA 2YM5A 1LPUA 2SRCA 2J0MB 3MVJA 3MV5A 3CS9A 1ZOHA 4ZAUA 1E9HA 4FODA 4W4VA 2W99B 4JS8A 2B9FA 1CDKA 3OFMA 4IIRA 4ZJJA 3ZSIA 4ZTNA 5LWMA 3SA0A 3PSBA 2BTRA 3LJ0A 4YC3A 5L8LA 4QRCA 5IG1A 1YXXA 4A9YA 5CEQA 2W96B 2VTHA 4UMPA 4FYNA 4F65A 4N6ZA 4ZTRA 2GTMA 4YHJA 4YBKA 3LE6A 4BDAA 2WMRA 1KOAA 4J96A 5B0XA 3FE3A 3UNKA 2OLCA 2OJJA 4LRMA 5GJGA 3CSVA 4X2FA 3CP9A 4ZLOA 3P7CA 3U6HA 1I44A 2B7AA 4TNBA 2XIRA 2BCJA 3MYGA 4AAAA 3TM0A 4F1MA 4FG7A 3CKXA 5DEYA 2BZIB 3BIZA 3BHYA 1IRKA 4QYHA 4TYHA 3DBCA 3GCPA 3K5VA 3REPA 2XA4A 5CEOA 2GHLA 4AZFA 5FDPA 3AT2A 2GU8A 1ATPE 2W5BA 3DPKA 1Q8ZA 4DF3A 3HA6A 4PTCA 3R22A 3W1FA 2XB7A 3FC1X 4IAFA 3RPSA 4I5MA 4YPSA 4U3ZA 5JSMA 2WTDA 4YZNA 2AC3A 4A07A 4JG6A 4I5PA 4BIEA 3E8NA 3QKKA 4Z55A 3EN6A 4ZTSA 4YJSA 3AGLA 3A4OX 3V04A 2CKEA 2ZV2A 5HG8A 1FVRA 2FSLX 2YITA 3MFUA 1YXUA 3P78A 2YJRA 4E4LA 5KMJA 2PMLX 4F0FA 3OC1A 3MTLA 4RX7A 4FEXA 3BLRA 4ITJA 3V01A 3EFJA 2IZTA 5E90A 4IFCA 2WMVA 3NW7A 3MW1A 3PXYA 2YLEA 3QTSA 2I0VA 4UWYA 2XM8A 2QKRA 3OCGA 4CQEA 1Z57A 3QD4A 3TNQB 5B2LA 4LOPA 2JEDA 3Q6WA 3C9WA 4YLJA 2OIBA 2HIWA 3I1AA 3DK7A 4RWIA 1OVEA 2Y6OA 3GU6A 4QMSA 2B9HA 1XWSA 1RDQE 2P33A 2WTCA 1EH4A 3K3IA 3LFDA 3LVPA 4UBAA 3CEKA 3AMAA 4M66A 5E7RA 3U6JA 4O0TA 4EHEA 3HUCA 1H0WA 1OUKA 3BLQA 4FZFB 3G51A 5CASA 4OTRA 2PZRA 2VNWA 2XJ1A 5K0KA 3EMGA 2B0QA 3QCQA 2WIHA 5C8NA 3B8QA 3LFBA 3R9RA 5HLWA 1FPUA 3VS2A 3VUKA 3D14A 2A19B 1B38A 1XO2B 5BUEA 2BRGA 2VTPA 5CI7A 4AFJA 4D58A 3OF0A 3L8PA 4IM2A 5HG5A 3QGYA 1PXPA 2J2IB 3FZSA 4DH8A 1KE8A 3OUKA 3VIDA 1H1QA 2XKFA 2C6KA 3PSCA 4J97A 2WTVA 4FSMA 4XUFA 3NRMA 4CG9A 4TWOA 3DCVA 2XKEA 4K6ZA 2JFLA 3UOKA 2BALA 4EH6A 3FZRA 5IDNA 4CT2A 2PVMA 2YHVA 3JY9A 2I0EA 2QCSA 4ENXA 1KV1A 4Q9ZA 1IA8A 4LYNA 5AAGA 2QO9A 5IQCA 4DTBA 3LZBA 4E5AX 3U9CA 4CFFA 1OL7A 3JXWA 3UPZA 4E5BA 4FR4A 3W2OA 3R28A 4M15A 3ET7A 1W84A 1GIHA 5CYIA 2ITWA 3DBEA 4MH7A 4PP7A 4WSYA 3BELA 4X6QC 4LL0A 3O71A 4C0TA 2XJ2A 4BI1A 4D9TA 2JKQA 3PY1A 2X2KA 4O0RA 5J9YA 2KTYA 3QC9A 2XMYA 4O1OA 4AA5A 4U40A 3FLQA 2JGZA 3OXIA 1MQ4A 3QXPA 4UALA 2H8HA 3BYMA 3QA0A 3BU5A 1E1VA 1KOBA 4BI2A 3QGWA 4M8TA 4I0RA 5EW9A 4HNIA 4RBLA 3UP7A 3TV6A 3V8TA 5I9YA 2QKWB 3KK9A 3RNIA 4DTAA 1K2PA 3BQCA 3A7JA 4RJ3A 1PJKA 3N9XA 2QU5A 4EOJA 3H10A 4ITHA 1GNGA 3CGFA 4O0UA 5FG8A 2UZEA 4D0XA 4DFXE 4FIJA 3ZDIA 4BGQA 4UMRA 4CD0A 4IB5A 4BCMA 5M4UA 4KAOA 4OGRA 3UC3A 3DXPA 4O7RA 4NKSA 1OL6A 2YCSA 4XG2A 2OJGA 2YDIA 3GNIB 3IDPA 4GG5A 4S2ZA 5D7VA 3ACJA 4NM3A 5EM8A 4YU2A 3Q3BA 4QQCA 3R8VA 4EHGA 5HX8A 4YZCA 3R9OA 4YJNA 3MH0A 3UYSA 3LMGA 1GAGA 3SQQA 3ORZA 2RFSA 2XH5A 4U44A 2R7IA 4JG7A 1H25A 2E9UA 5DIAA 5CAVA 3QKLA 3U4UA 1Z9XA 2QOQA 3W55A 4YSJA 4F9AA 5HGIA 3QKMA 3MB6A 5H8GA 3RAKA 1Q8WA 3C1XA 3R1QA 2BDJA 1QL6A 3BHVA 4F63A 1G8AA 2W4KA 3HMOA 3HP2A 1RJBA 2A1AB 5DPVA 4O7NA 4Y73A 3BWJA 5HD7A 5G6VA 4IX3A 3AT3A 3UYTA 2UW6A 3COMA 3HLLA 5LARA 1H28A 2VWZA 2WIPA 3ORLA 3ZSHA 4C57A 4DAWA 3L9PA 5JFXA 4GVAA 3BGQA 3OY1A 2Y0AA 3M11A 4L46A 5EYCA 2PE0A 2BAJA 1J1CA 2GNHA 3ZC6A 5FQDC 3ZCLA 4C37A 3NS9A 5GJDA 3R21A 4UV0A 3KL8A 4E3CA 4BCNA 4RIYA 2E2BA 4EKLA 4TRLA 3ENHA 4PPCA 4HVSA 2X2MA 3F3WA 4J7BA 3VW8A 5KMLA 3BYUA 4ZS4A 4FNYA 5L2TA 4M14A 4A9TA 2VRXA 3QD0A 5K9IA 4KKGA 3RJCA 3BGPA 4QMZA 2UW5A 3E7VA 4ANSA 2ONLA 4QPAA 1IG1A 1ZYLA 3QZHA 4OBOA 5CNOA 3R9DA 4DT9A 3VS7A 4QYGA 1RE8A 1R39A 5DR9A 5J7HA 1VEBA 3F3VA 3BV2A 1BLXA 3DTWA 3MY0A 3KU2A 3OROA 5CU6A 1GZNA 3QALE 3UQCA 4RVLA 2OZAA 4ALUA 3PRFA 4X0MA 4EUTA 4PDSA 1W7HA 1A9UA 2ZYBA 1OKZA 2G2IA 2UVXA 3AQVA 3R8UA 1XH7A 5J1WA 1R0PA 3S0OA 1YRPA 1KE5A 4I6QA 3ZLXA 4O86A 3G9NA 3NUYA 3PLSA 3Q6UA 3FUPA 1JKSA 3G6HA 4LGGA 3WARA 4FKLA 2HY0A 2ITUA 2IVVA 5EM6A 5GIOE 1W8CA 3FLZA 5CANA 4D4SA 3C4XA 2W4OA 4LG4A 4LM5A 3EKNA 3CGOA 4U43A 1WVXA 4FIEA 1Q8TA 4JRNA 5J7BA 4OAVB 4ZJIA 3LIJA 2BDFA 4GKIA 4FKOA 2WNTA 4MYGA 2LAVA 3FXZA 3EQIA 2Y9QA 1OUYA 4GK2A 2QOIA 3E5AA 4FG8A 4MWHA 3PJ8A 2QR8A 2DYLA 5AP2A 3RAHA 4BTKA 5KNJA 3BHUA 3FKNA 3FXWA 5JFVA 2P2HA 2YCRA 4MD8E 4RX9A 3E3BX 5CZIA 2XJ0A 4I93A 5DE2A 2ZMCA 3QTQA 4WNOA 4LFIA 3WZDA 5AJQA 4RZVA 1OECA 4P90A 4AU8A 5A46A 4MXZA 2FB8A 3GOPA 4YZ9A 4EBWA 5AWMA 5GZ9A 4FG9A 4EEVA 2V7AA 4IAKA 2JDVA 1FMKA 3F7ZA 3OCTA 1B39A 3KF7A 5EHOA 5AR3A 5KZ0A 1JPAA 3GGFA 5LCKA 4LV5A 5IEXA 3QQUA 4Q5EA 1OGUA 3EB0A 3H9FA 1U54B 1WBVA 2PVNA 5JZNA 3SW7A 4NSTA 4ZTLA 3EQFA 2GNJA 4O91A 3UIXA 5JFSA 3LFAA 3L9NA 2HXLA 2QOFA 3CD8A 4FKSA 4N0SA 1YQJA 4A7CA 3A8WA 4E6DA 4DG3E 4QP4A 3OOMA 5CALA 2O3PA 2XNGA 3OT8A 3PG3A 2IN6A 2XBJA 2GNFA 3NW5A 5AIKA 3ZLYA 5H3QA 1XH6A 3L8VA 2P4IA 1PY5A 4L01A 1MQBA 4ZOGA 2A0CX 4F4PA 4DEIA 2WMQA 4F7LA 4GJ2A 4FSYA 4QQ5A 5JGAA 4I6HA 3UC4A 5KHXA 3EQHA 4RJ7A 5EM7A 4CFNA 5DNRA 4AW0A 5EQPA 5DRDA 3C0GA 5CXZA 4G3EA 3HA8A 4IB3A 2UW4A 4G2FA 2PU8A 5FXRA 5D7AA 3E8EA 3C50A 3WILA 2C3JA 3R83A 5IA0A 3U6IA 1XBBA 4BYIA 3FLYA 5IKWA 2W1EA 3ORMA 3GEQA 4K9YA 2QHMA 5F95A 5EI6A 3G9LX 3PTGA 4Y8DA 4EOIA 4FEQA 3LMHA 4HVHA 3PP0A 3OWKA 3PSDA 5BVWA 4F9WA 5KBRA 2W5AA 4AN9A 5HOAA 4RWJA 3AC1A 1DI8A 3L8XA 4R1YA 1PXJA 1M2RA 2CPKE 4W8EA 3DY7A 4EQMA 4F7NA 3VRYA 5HX6A 3IONA 1DS5A 5JGDA 2GS6A 5IQDA 4RX8A 2YZAA 4O7YA 3A99A 4ZEGA 3RBWA 4TWCA 4RQVA 2XKDA 3VBYA 2W9ZB 1U46A 2ZJWA 3IK3A 3GBZA 3PJ2A 4GL9A 3R8MA 3AXWA 2OG8A 4XV3A 4D9UA 4UN0C 3R2YA 2XRWA 5I9ZA 1QPJA 2WMTA 3V51A 4MX9A 1JLUE 1YOMA 4AT4A 4CKJA 2J0KA 3PDTA 1Q99A 5CAOA 2LGCA 1IAHA 4QP3A 2VO7A 4USEA 4NEUA 2ZV8A 3SRVB 4B9DA 3FC2A 3QTRA 3HMMA 4E93A 3EQRA 3PP1A 3QUDA 4CZYB 3NX8A 4RWKA 1Q4LA 3OS3A 3UOLA 4AZSA 3Q60A 5I5ZA 1VZOA 2YLFA 4O7VA 2XNEA 4MNEA 2R2PA 1WCCA 4KIPA 4ANNA 5AADA 4RJ6A 2VTJA 4DLJA 4UMUA 4AW2A 2XEZA 2P2IA 3KGAA 4NTTA 5BVFA 3NNUA 3WF5A 3RAWA 4CCUA 2OIDA 1H4LA 4YJOA 3DAJA 4BKYA 1TKIA 3CD3A 3GFEA 1FGKA 4A4LA 2CGUA 3UZTA 2B55A 4F1TA 4IM0A 3LFFA 4BY9E 5C9CA 5HCYA 3F88A 3P9JA 4FTOA 4OTGA 4PL4A 5AP4A 1RW8A 4YNEA 3E8DA 3TL8A 3AD4A 2QURA 5AUUA 2BKZA 4DA5A 4G9RA 5JQ5A 4UMQA 2XM9A 2J9MA 2I40A 3QA8A 2B52A 3IDCA 4GJ3A 4BHNA 5AAFA 3UOHA 3DJ7A 3MA3A 4FKJA 4GIIA 1UKIA 3W8LA 4FTMA 3MFRA 2FH9A 3COHA 5HLNA 4FTIA 4D0WA 4KKEA 5CVGA 4B0GA 4UYAA 5D9HA 3QZFA 1VYWA 2I0YA 3GU7A 5HIEA 4YO4A 2JIUA 3HV3A 3S1HA 3DU8A 5JGBA 2UV2A 4FIGA 5E8SA 1JAMA 5IQHA 4BDFA 3RZFA 5HKMA 3HV5A 3LM0A 4QD6A 4IACA 3JVRA 3K5UA 1ZYJA 3QZGA 1OKVA 2RG5A 3MPAA 3UQGA 4F1OA 1YI6A 3ZBFA 2IW8A 4ZTMA 1R3CA 3HGKA 2VTOA 2EXEA 5E1EA 5KBQA 2W0JA 2WTJA 2HW7A 3FHIA 2P3GX 3PY3A 4HGSA 4QQJA 2YM6A 4FSZA 4FMQA 5DWRA 3VN9A 1FVVA 2X2LA 4BL1A 5EW3A 3QX2A 3PG1A 5FM2A 1H24A 4EJNA 3N4VA 5KX8A 3DA6A 1A48A 2QLUA 2VZ6A 3ZEWA 3QYWA 4CQGA 4FVRA 4BTFA 4IZAA 2NO3A 2VU3A 3BEAA 4RJ5A 5FXSA 2EWAA 3FXXA 4NW6A 3I7CA 3R8PA 1P5EA 3RCDA 2CCIA 2VO0A 3H4JA 5HI2A 4KSPA 4EH7A 3RK7A 5D11A 2ITVA 2F4JA 2GQGA 1JWHA 4FV5A 4BI0A 3EWHA 3OEZA 4QQTA 1FMOE 1URCA 4JDJA 4A4XA 3AMYA 3DFAA 3W16A 3G6GA 2B54A 2ETMA 3R02A 3V8WA 1GJOA 1R78A 2XK4A 2PUUA 5IQBA 1VR2A 4FTTA 1LEWA 1JKKA 2QQ7A 1KE6A 4ZLYA 4X3FA 2GSFA 3E63A 3IGGA 1WBWA 2XRUA 4ASEA 5M07A 4C4EA 2WMWA 4C35A 2RIOA 2VO6A 3VUDA 4ZZNA 3KQ7A 4M3QA 3FPMA 4X2NA 4YZDA 5I3RA 5A6OA 3QLFA 4IC7A 3HKOA 2VX3A 3LXKA 4KSQA 3LAUA 1VYZA 1OL5A 4OUCA 2R0UA 3IOPA 2VD5A 4X3JA 3IDBA 3THBA 4EKKA 5KE0A 4AZTA 4U45A 4KRDA 2R64A 4ANOA 3OWJA 4E1ZA 1YI3A 4RJ4A 4E4MA 5KKRC 1WAKA 3FI2A 3D5VA 4FTNA 1YXTA 2V5QA 3ZOSA 2ITPA 1ZXEA 2UUEA 3FMDA 3KFAA 5DGZA 3ZMMA 4AE9A 3U4WA 4L8MA 4N4SA 5E92A 2OJIA 3UDBA 4KUJA 4G3GA 3SW4A 5BVOA 3QF9A 3R1NA 4QTAA 4YUQA 2BZJA 2WTIA 3S2PA 3FBVA 2UZDA 3ZZWA 4G6OA 5HE1A 4WBOA 4ALVA 4UY9A 1UNLA 3R7UA 4PTEA 4FNZA 1MRUA 2G9XA 4M68A 3U55A 3DB6A 4WRGA 2R3RA 4FV8A 5M4IA 4F6SA 5L8JA 4N6YA 5FEDA 3ZYAA 2YWPA 3QTUA 4H3BA 1FBNA 3F66A 3AMBA 2W06A 5IPJA 4JIAA 4O7LA 4TWPA 4TXCA 5CF6A 3LQ5A 2UZNA 2OH4A 4D2TA 4MXXA 3ZFYA 3ANQA 1WFCA 5L4QA 5J1VA 1ZWSA 3TDWA 5LVMA 3TDVA 3D5WA 3EFWA 4ARKA 3NLBA 4XRLA 5HO6A 3W2CA 4GT5A 4G34A 4ORKA 4WT6A 4L52A 5HESA 3B8RA 4H3PA 3PFQA 3WZKA 4ACDA 2WQMA 2PVRA 4NJDA 2UZUE 3CQUA 3FZOA 4N70A 4U6RA 4XCUA 5E8XA 5E9EA 2C5OA 4FL1A 5EI8A 2OFVA 4OBQA 3R04A 5DLSA 2Q0NA 2YM8A 4R7HA 1QPEA 2WZJA 2PVKA 5CSPA 2PUIA 2C6LA 1WBNA 4NIFB 3LKMA 4JDHA 2O2UA 2PE1A 4DT8A 2GQRA 3FDNA 4G16A 4HW7A 2R3LA 3OXTA 3FI4A 4WOVA 2X4ZA 4IX5A 2OSCA 1Q8YA 1Q24A 3UE4A 1NW1A 3O2MA 4LV8A 2IG7A 4RIOA 4ASXA 2UVYA 3H30A 2DUVA 4BTJA 4NUSA 4TTHB 3KB7A 4BICA 5DA3A 3TZ9A 4EC9A 1YXVA 3P86A 3PXFA 3FZTA 3C5UA 5JRSA 4TY1A 3U87A 3LLAA 2OICA 4ZSLA 2WQBA 3GCSA 4MTAA 3Q4TA 4FSUA 2F2UA 3EN9A 5GNKA 5EHLA 2Z7QA 3VS1A 4HCTA 3ZS5A 2BHHA 3CTHA 3RVGA 1WMKA 5AP1A 4R7IA 3KMUA 5HVKA 2QOLA 4FK3A 4AP7A 5AP3A 5FTQA 2O0UA 5BVKA 4YJRA 4P5QA 4EH9A 5H8EA 2X8IA 3QCXA 2BZKB 3PZHA 4QMWA 2QHNA 1O6LA 3TUCA 3HMPA 5E8VA 3WYXA 3P7BA 4ANQA 4FA2A 3AOXA 2XNMA 1OL1A 5J95A 1G5SA 4NL0A 3AC8A 3QRUA 1W98A 4J95A 4X21A 4NJ3A 3G0EA 5A4EA 3PJ1A 2IJMA 4DTKA 3EQDA 2WFYA 2JAVA 4DH5A 3BU6A 4IMYA 1FOTA 1T45A 3ZONA 2YM4A 3G2FA 4D2VA 4BCJA 4BDJA 2VV9A 4FZDB 1ZMWA 1OB3A 2J51A 3CQWA 5DG5A 3GCUA 3BRBA 3IW8A 3PPZA 1J7UA 4R77A 2C4GA 3BBTB 3BQRA 2R3KA 4GV1A 4BCHA 4EH5A 1H1WA 2FSMX 5HG7A 3M42A 4Z3VA 4BBMA 2FSTX 1Y8GA 1KWPA 3NIEA 3TCPA 4QMOA 3UVQA 4FT9A 4EOPA 4TYJA 5J9ZA 1M2QA 2XNNA 4FV2A 3R30A 5JZJA 3IECA 4PP9A 1DAWA 5I4NA 3E64A 2XNBA 4Y5QA 3OG7A 4BKJA 3TZ8A 4AW1A 5C26A 2YZLA 1GZKA 1XH4A 2EU9A 2RF9A 5IUGA 2VWYA 5GZAA 2RSVA 2RFDA 3C4WA 5IMEA 3VJNA 4IZ7A 2WXVA 3UJGA 3EQPA 4RT7A 3OXZA 1Z5MA 3V5WA 4AGDA 2IW6A 5E8ZA 4DYMA 5IU2A 3FV8A 4IVCA 3NCGA 3RM7A 4EONA 4G3CA 3FEGA 2OFUA 3PWDA 3R1SA 4X3FB 4D1ZA 2QI8A 4EZ7A 3G15A 3C5IA 4FV6A 1OMWA 4U41A 3ANRA 5C8KA 1HOWA 3HV7A 2ZVAA 4D4VA 3F3UA 4OLIA 5ITAA 3R8LA 2WQEA 3LCOA 2HZ0A 3VF9A 4CRSA 3FYKX 4UYNA 3RKBA 2OI4X 5G1XA 4F7SA 3W18A 3ENMA 2WGJA 4JBQA 4QMTA 3AD5A 3D5XA 4FKVA 1CKIA 5HVJA 2C0OA 3BYSA 5LMKA 1ZRZA 3R7GA 1NA7A 4OTPA 1KUTA 3TNIA 3O17A 3BLHA 2PVLA 4GK3A 2RGPA 4JAJA 1MUOA 1S9JA 2JD5A 4RVMA 4AA4A 2BILB 4C36A 3AC5A 2CNVA 2PK9A 3HVCA 2CN5A 2X7OA 3AD6A 3ZO1A 4BTMA 5LVPA 1SVEA 4YJPA 4TYGA 2GS2A 3SC1A 4R8QA 1H1SA 2WOUA 3O8PA 2XS0A 4C4IA 5AR5A 3KRJA 2R3MA 2XP2A 3I6UA 3FI3A 4RLKA 1H27A 3LM5A 4FL2A 4IAIA 4NFNA 4KS8A 4UZHA 4M97A 4O2PA 4RZWA 1YWNA 2OK1A 4BBFA 3FHRA 2XIKA 4I5CA 4LUEA 1YXSA 4RGJA 1GZOA 3AG9A 3NZ0A 4BF2A 5AV1A 1H00A 5HE2A 3HV6A 5T6KA 2GDOA 4NU1A 3K54A 4D2SA 4BDDA 4G1WA 5CX9A 4QMLA 4FV4A 4BFMA 1PMNA 2GTNA 5DH3A 2DWBA 1U54A 3Q4CA 3ULIA 3TXOA 4F0IA 3QWKA 2QOHA 3QBNA 2JDTA 4ZSEA 3MS9A 2VX1A 3UNZA 5KHWA 3JYAA 1SVGA 1UWHA 3R7EA 4MF0A 1JBPE 3NR9A 4LRJA 4NCTC 3R7IA 4AFEA 2P0CA 2PZPA 4JQ7A 3IQ7A 2ETRA 4JBOA 3LOKA 3ODZX 4HGTA 3Q9WA 1BX6A 5CXHA 4K8AA 5LVLA 2R3GA 4QMQA 1PMUA 4PWNA 4G5PA 5F9EA 4W4YA 3I0OA 2XK7A 1GY3A 2OH0E 3BPRA 2WKMA 4AACA 4U42A 4DEDA 4E6CA 3NYNA 4ZZMA 4CFVA 3A60A 3DK3A 4FTQA 2OJ9A 4PNIA 5IUIA 3KRRA 3RHXA 2RFNA 2H6DA 4FT7A 3S3IA 4BCQA 4EOSA 2BZHB 5A6NA 2W1ZA 4IHPA 3S00A 1Q62A 3MSSA 2I6LA 4JIKA 1STCE 2VWWA 3OY3A 5CU4A 2OGVA 4EH3A 4RIXB 5E8UA 2CGXA 3VO3A 1NT2A 5GHVA 5CSHA 3MJ1A 4XJ0A 3P79A 4FZAB 4HZRA 4FSNA 2CGVA 4OTDA 4DITA 1J1BA 3ROYA 1R1WA 1SYKA 1OM1A 2F57A 1XH8A 3R6XA 4FKIA 5ANIA 5AP6A 2Y4IC 5DEWA 3VBQA 3C4CA 2B9IA 4AOIA 5IQIA 3NUPA 3MB7A 5AR7A 2W17A 5C1QB 4O7ZA 3GENA 4I5HA 4FSTA 2JIVA 2NPQA 4WG4A 3NNVA 4I0SA 3FAAA 2OF4A 3RPYA 4FNWA 4BVUA 5ANDA 2F9GA 3V5TA 5CTPA 3O51A 3KF4A 3PA4A 4C4GA 4IH8A 4WUAA 3GCVA 4O7WA 3QTZA 5M08A 3DQXA 5HIBA 1YHSA 4ACHA 4MQ1A 2C6EA 5IA1A 2C6OA 5TOZA 4XH6A 1KSWA 4CMUA 3GOKA 3SRVA 1OIQA 3R2BA 3ORTA 4TWNA 2BRNA 3ORKA 4UWCA 3MI9A 5DI1A 2W1CA 3MGYA 4C02A 2YIXA 4Y83A 4IVAA 4F9CA 5L6PA 3VAPA 2HWOA 4QMPA 3DV3A 4R78A 3ZRKA 3OOGA 4LQMA 3TTJA 3NUAA 1O9UA 3D0EA 4FUXA 2J0LA 2R3FA 4GMYA 5BVEA 4BRXA 2C5NA 3UG1A 2GMXA 2WU6A 3QCYA 4GK4A 2W1FA 1UU8A 2C6TA 3DK6A 5E4HA 4EH8A 4ZTHA 4QPSA 2QOCA 3WIGA 1JSTA 4FGBA 4YJQA 3CLYA 5AR8A 3U54A 5CU2A 3BYOA 2RG6A 4PPBA 5KKRB 4FTLA 3R0TA 4DGMA 3TUBA 3DQWA 4GYGA 4J8NA 3EQGA 4DFLA 4EOKA 5K0XA 4MD9E 5HE0A 4JJRA 3UGCA 4FSQA 4EK5A 3W8QA 4PNKA 1OIUA 2WTKB 1ERKA 1H07A 2QOOA 3UOJA 2QONA 3OUNB 3DKFA 3QAME 3T3VA 5AUTA 5JK3A 2UW9A 4E7WA 5K4JA 2JKOA 3BWFA 3QRKA 4F7JA 2JITA 3SXRA 4WHZA 4UZDA 4USFA 3RAIA 4RIWB 4EK4A 1NVRA 3MH2A 1GZ8A 4HCVA 4J53A 3RMFA 4ANBA 4I41A 4J52A 5M06A 4XRJA 4HPTE 1XJDA 3DAEA 5C4KA 1TQPA 2ZM4A 3DKGA 4YNOA 5LMBA 3E88A 3UIUA 4QTEA 3G5DA 2BFYA 3CXWA 1V1KA 4FNXA 4YLLA 4FUYA 4XEYA 3HAVA 2GCDA 3JUHA 3CQEA 4DC2A 4NH1A 4BCGA 3DZQA 4YC8A 3RK5A 3ZXZA 4UXQA 4L43A 5LXMA 5KMIA 2WPAA 1H0VA 4H05A 4RSSA 5M57A 2O5KA 4DEEA 3DNEA 5J8IA 2B4SB 3F2AA 3GC8A 5IH6A 2AYPA 3IOKA 3Q32A 1WBSA 2WO6A 3CPCA 5IEVA 2EVAA 4GT4A 3C4ZA 4EOOA 3FYJX 2YA9A 2G2FA 2FA2A 2J0IA 4QMXA 2ETKA 2QU6A 2OWBA 2YFXA 2QC6A 2ZMDA 3GC9A 5DBXA 1PMEA 4R7BA 4U80A 3JS2A 4ZY4A 3I0QA 3NYXA 4QP9A 2EXMA 4RRVA 4OTQA 2H96A 1XHAA 3KC3A 4YBJA 2AUHA 3U9NA 3MPMA 4XX9A 4QPMA 4QP6A 2A2AA 2YJSA 3DBQA 4J99A 4YGAA 2O65A 3A7FA 5ANGA 4BDIA 4M12A 3B2WA 2BIYA 2Z60A 3W2PA 3M2WA 3MIYA 3RINA 2XK9A 3V3VA 1K3AA 3GCQA 3OT3A 4EH2A 3ID6C 3F5GA 4U97A 3GT8A 2PWLA 5TE0A 4EL9A 3PXKA 2X1NA 3ZU7A 3G33A 4CLJA 1M7QA 5I9WA 3FQHA 4QOXA 3FQSA 3WYYA 3BHTA 3LXNA 5L6WL 3ZZEA 4ZY6A 3MTFA 3QQGA 3G0FA 4BDCA 3OP5A 4C4JA 1REJA 3NPCA 4GS6A 1YWVA 3TV4A 4RA4A 4S30A 4J71A 1V0PA 3SD0A 5HU3A 2W4JA 3PE1A 2WOTA 5HTIA 4L6QA 4O7TA 3EQBA 2WMUA 2VWIA 2BVAA 3HAMA 4J1RA 3C0HA 3PZEA 3TKUA 4ZY5A 4BBEA 4PF4A 3EIDA 2NRUA 4FVQA 4PY1A 2GHMA 3L1SA 4JVGA 4U9AA 4X2KA 3VS5A 1O6KA 5D10A 5IA5A 1XH9A 4FTJA 4U5JA 2F7XE 1U5RA 5EHYA 4B6LA 5EDQA 1ZZLA 3KULB 4FTAA 2O64A 4KBAA 5HE3A 5LJJA 4HYUA 3KCKA 5FBNC 2XIYA 3FI8A 3PWYA 4BIBA 1JOWB 3MWUA 3ORIA 4DBNA 1PMVA 2PZ5A 3OD6X 1YDSE 2UZLA 3HMIA 1H01A 2WQNA 3V6RA 5CAPA 2W9FB 4BCPA 2BKKA 2IO6A 5L2QA 3WBLA 3VBVA 5CU0A 4BIDA 5LMAA 1MP8A 4IDVA 4QP8A 4YJTA 3RPRA 4ACGA 5M4CA 4FTKA 2R3NA 4FKUA 5KMKA 2C1AA 5DHJA 4MAOA 3GVUA 5ANEA 1BMKA 3K2LA 3DBDA 3VNTA 1XH5A 5AR2A 5HNBA 3TZMA 5L3AA 4MBIA 2C5VA 3ORNA 4W8DA 3WF6A 4LOOA 3DJ6A 3KRWA 4AZWA 4XV1A 5BUIA 3GI3A 4G6LA 4AN2A 2YIQA 4FBXA 4BCFA 3RWPA 4XOZA 1J91A 3VS0A 3A2CA 4BDEA 2JDRA 2BHEA 3I79A 3UPXA 4NM5A 2Z7LA 3ODYX 4RFYA 4CTBA 4XG8A 5FP5A 3W33A 4AZVA 2CMWA 5KZIA 3GU8A 5EOBA 4JX3A 1JSUA 1X8BA 4QNAA 2VO3A 3LFEA 3W2RA 2FGIA 3TNHA 4EORA 3NYVA 4NYEA 3TIZA 4CFXA 3IPHA 3UZPA 4M69B 3PPKA 3GUBA 5AEPA 3ZLWA 2Y6MA 3POOA 3ZDUA 4ZZOA 5L6OA 3VS4A 1QCFA 1AGWA 5K5XA 3OWPA 4GSBA 5I9XA 2DS1A 3E3PA 2RL5A 3BE2A 1PYXA 3FLSA 3MVLA 3OCBA 2PULA 3PE2A 4Z16A 2CCHA 2ITOA 3MESA 3KA0A 5DVRA 4NIFA 4NFMA 4XMOA 2ITQA 5DMZA 2BROA 1F3MC 1M52A 3PUPA 2GNLA 4I1ZA 5FP6A 3VJOA 3GFWA 5HBJA 3SG9A 2ZV7A 3LJ1A 1XBCA 5I0BA 2X8EA 4U8ZA 5HTBA 3A7HA 2OZOA 4G17A 5FD2A 4QYEA 4MXAA 4I92A 4HGLA 5M53A 4FT0A 1BL6A 3CJFA 4WSQA 1WVYA 3MH1A 2JBPA 4I4FA 4IQ6A 3ZRMA 3FKLA 4GW8A 4ZSJA 4KNBA 1UU9A 5BX0A 1Q61A 3GXLA 2JAMA 3A4PA 3DGKA 3QUPA 3PVUA 1BL7A 2OJFE 4XP0A 3POZA 4K18A 3ZLSA 5B7VA 2HZ4A 4CLIA 3VS3A 3VUTA 4BGHA 3QU0A 4PL3A 3BGZA 3AC4A 3CJGA 5KCVA 2I7QA 1G3NA 5JEBA 2ITZA 3UP2A 1YOJA 4YPDA 2X0GA 1TQIA 3WZEA 4Y72A 4A06A 3OTUA 2YDJA 2X7GA 2Z2WA 3FLWA 4B7TA 2E9OA 4C2WA 1M14A 3FJQE 4AW5A 4I3ZA 4C59A 5FDXA 2ZM3A 3C7QA 5F4NA 1PXIA 2Y4PA 4AT5A 2HZNA 4ANMA 4C2VA 5CQUA 3R9NA 2ESMA 4FT3A 2XYNA 3IKAA 5EW8A 4DFZE 5C03A 5L2IA 3NEWA 3WF8A 4F0GA 2YDKA 3PVGA 4WO5A 4DGLC 3OZ6A 4WNKA 5IF1A 4C4FA 3OEFX 3WE8A 4EK6A 3A7GA 5E8WA 2XEYA 2FO0A 4AX8A 5B2MA 4UEUA 3NAXA 4OT5A 3IW7A 1A06A 1YWRA 4RFMA 5LOHA 1UV5A 4Y5HA 3ORXA 4O96A 1OBGA 3PPJA 2FYSA 3GU5A 4PPAA 3NUNA 3EN7A 3FZPA 3HRBA 4O38A 3QQFA 2WEVA 5A9UA 3A7IA 4IJPA 2QNJA 5AV4A 3R8ZA 1WBPA 4L7FA 5EQEA 3R7OA 5TF9A 5IMXA 3TUDA 3MH3A 1B6CB 3ROCA 4H39A 4CTCA 4BR3A 4UWBA 5AV3A 5C8MA 5LQFA 2BIKB 5EOLA 2PUNA 4QT1A 4HNFA 4AE6A 3IO7A 3SOCA 4FV7A 4H3QA 3VWAA 5T68A 2JKKA 4KBKA 3MY1A 1TVOA 2V55A 4D28A 2ERKA 1KE7A 3D83A 3BX5A 3WI6A 2JFMA 3L8SA 5F20A 3K3JA 3E8CA 4JOAA 3ATSA 3HEGA 4O6EA 2XNPA 4L42A 3BEGA 4CRLA 3VUGA 3EH9A 4TYIA 5ANOA 1SMHA 3GC7A 4XG3A 1PRYA 5HG9A 4NTSA 4ZMFA 3R7VA 5ACBC 4E8AA 2WU7A 4I24A 3QQKA 4O83A 1JQHA 1OPJA 2V62A 1FVTA 3NW6A 4GEOA 5CEMA 5AP5A 1WVWA 3DBFA 5J87A 3R1YA 5BQ0A 4L68A 5AX3A 2ZDTA 5EQYA 5CVHA 3MN3A 3RNYA 4C3PA 3PYYA 3JVSA 5ETCA 2WEIA 3QWJA 4HVGA 4DCAA 2XF0A 5TKDA 5TR6A 3TJDA 4YTFA 2VTRA 4KD1A 2E9NA 2IWIA 2PY3A 4FZ7A 3FSFA 4GUEA 4I21A 3RWQA 4BZOA 1CSNA 1SVHA 4KIKB 3NWWA 4AGUA 1J3HA 4D5HA 2XVDA 3WOWA 4GYIA 2R7BA 1P14A 3OW3A 1S9IA 2J5EA 3H9RA 3KEXA 3MVMA 2QOKA 1UU7A 2ZOQA 1R0EA 3KXNA 4AZEA 4WNMA 4JRVA 2ZV9A 4NK9A 2ACXA 4YMJA 4IB1A 4G9CA 4DGOA 1QPCA 3C0IA 4GG7A 3P08A 5IA3A 2UZVA 4JBPA 5LVNA 3EL7A 3NUUA 3UO5A 2OF2A 3QXOA 3ZEPA 4PMMA 1H8FA 5AP0A 3C51A 2CGWA 1IEPA 4E6AA 4JBVA 4ZP5A 3LXLA 2YM3A 3F6XA 3LLTA 4AOJA 4APCA 2BFXA 4FV1A 5BUJA 2J0JA 3QLGA 2PL0A 3RHKA 3F5PA 4OTFA 5IH5A 1YDTE 4FZ6A 2F7ZE 3TTIA 5J5TA 4BGGA 4HYIA 1Q8UA 3HDNA 4O2ZA 4FIHA 4AUAA 1ZOEA 3CBLA 3V5LA 5L2WA 3SVVA 4IE9A 2R9SA 4CV9A 4G3DA 3VF8A 3LCKA 4KS7A 4V0GB 1NVQA 3D7ZA 5CAQA 5M51A 4IWPA 2BDWA 4A9RA 2Z02A 4KIQA 3ZUTA 1Q97A 4MK0A 3D2KA 4XS2A 2OW3A 4D1SA 3KKVA 3B2TA 3FMLA 5LMKC 4CGAA 3O0GA 3WF7A 4TT7A 1YHVA 4FTCA 2WD1A 1AD5A 2CDZA 2YCFA 3R01A 2RKUA 2R3PA 1ZYCA 4RIXA 4IXPA 1Y57A 4MXCA 1MRVA 4ZTQA 4LRKA 4YO6A 2R4BA 2GS7A 3QRJA 2BRBA 4QMUA 1J7LA 3Q53A 4YJUA 5BPYA 2X6EA 1IAJA 1ND4A 3A8XA 4WG3A 3PIYA 2JKMA 2YEXA 2QO7A 5E8YA 3VRZA 3ZSGA 1PHKA 1JVPP 3DDQA 4IWOA 4B8LA 3OHTA 4JQEA 2Z7SA 3H0ZA 4FIIA 2CLQA 5HU9A 4WD5A 5AA9A 4KBCA 2VTTA 4H1JA 2OXXA 2V22A 3EKKA 1CM8A 4FC0A 2HXQA 4PUZA 4JXFA 3TJCA 4FVPA 1DM2A 4RA5A 3VUHA 2WHBA 3H0YA 3EZRA 1M2PA 2BR1A 3UVPA 3ZRLA 5ANKA 4EUUA 4CG8A 2I1MA 4W4WA 4AGCA 4XOYA 2IZSA 5H9BA 3LFNA 1CKJA 4QTBA 1H1RA 4AGWA 3BI6A 3EN4A 1F5QA 3ZHPC 2VAGA 4MKCA 4XLIA 4PV0A 4G5JA 3E87A 4QP1A 5J79A 2EB3A 2XIZA 3V6SA 3UVRA 3I7BA 4NM0A 1PXMA 1M17A 4IVBA 4AN3A 4LI5A 4PMSA 2WMAA 4FEUA 5L8KA 3JR1A 1PW2A 2CN8A 4JR7A 5D12A 2W1DA 4FSWA 3F7WA 3HL7A 4G6NA 3C4FA 4J8MA 3UNJA 3TT0A 3DXNA 3VUIA 3ELJA 2F2CB 4BDGA 4RVTA 2YAKA 2WTWA 2ITYA 2R0IA 4ZLZA 4G3FA 2WAJA 4XBUA 4L3JA 4S32A 5A3XA 2H9VA 4PX6A 4ERWA 3LW0A 4DG0E 3RM6A 3WF9A 1I09A 4IW0A 3HNGA 3Q9YA 4PRJA 4RVKA 1XKKA 3QHRA 4CT1A 4GKHA 3A61A 5KMMA 2HW6A 4IAZA 5CLPA 4GFGA 3ZM9A 3TN8A 4XP3A 4FF8A 3D7TB 4S33A 3EHAA 2OKRA 2OIQA 1QPDA 4QP2A 2J90A 4XHKB 3RCJA 5JRQA 4PTGA 2CKOA 4EH4A 3E92A 3D4QA 4O7SA 4IX6A 3LJ2A 3KN5A 3MBLA 1OIYA 4C3RA 4C62A 5JT2A 3T9TA 2W1IA 1UNHA 4RC2A 3TV7A 4DINA 2OU7A 4GRBA 4WBBB 4HCUA 5CEPA 3SDJA 4EWQA 4C61A 2X7FA 4HJOA 3LPBA 4RIWA 1ZYSA 4DLIA 4EHVA 5HNIX 5KUPA 3OBJA 4IZYA 4OTIA 3I5NA 4HGEA 2GNGA 2R3HA 3I6WA 2ITXA 3BU3A 3FL5A 3PIXA 4YLKA 1FINA 2XNOA 1WBTA 1KE9A 4V01A 2YWVA 4NKAA 5HO7A 4DH7A 3BV3A 4BWXA 2IVUA 2C6IA 3F82A 4K33A 3BKBA 4FSRA 2R3IA 4YHTA 5EDRA 4DFYA 3HDMA 3QD2B 5EYDA 4E5WA 2VTLA 3EL8A 3AT4A 4FKQA 5BYLA 4UXLA 2CSNA 3RZBA 1U5QA 4FKTA 3DKOA 5HICA 4D55A 4RJ8A 4S34A 3QRIA 4YSMA 3N51A 5GJFA 3JPVA 5EH0A 3RPVA 3IW6A 2VTNA 4L9IA 4F99A 2C6MA 5AFVA 3QZIA 1BUHA 4BCIA 2VGOA 4DE4A 4XG4A 4H36A 2VTQA 2W1HA 1P4OA 1CTPE 2HELA 3P0MA 4FK6A 2QVSE 3E7OA 2ONLC 1OPKA 4L3LA 4O0SA 1XBAA 4PMTA 4R3RA 5DT0A 2UZBA 2BAQA 2PMIA 2BUJA 4GUBA 4FV3A 3IW5A 3RI1A 2XUUA 3T8OA 4QNYA 2PZIA 3QRTA 4F64A 3IW4A 1CMKE 3FPQA 4LMUA 4ZMEA 3A62A 4BHZA 4U0IA 3LMIA 4AS0A 4NM7A 2X81A 3ZUVA 1Q3DA 1JNKA 1YKRA 2J4ZA 3PJCA 5AUXA 4YC6A 1Y91A 2PMNX 3EFLA 1LUFA 2YIRA 4CYIA 4E73A 2C0TA 4XYFA 1BI7A 3TEIA 4IC8A 2V0DA 3M1SA 3O96A 2IPXA 4MXOA 4EQCA 1JKLA 2YABA 5IUHA 5CENA 4S31A 5IQGA 2UVZA 4YTHA 3HZTA 3OCSA 4EZ3A 2BRMA 4JDKA 3ZH8A 3KXGA 2B53A 2QODA 4D1XA 3R63A 4U7ZA 3FLNC 3QX4A 4YURA 3IG7A 4WIHA 4K11A 3VS6A 2NRYA 2XIXA 3VULA 3KULA 5E1SA 4MXYA 4ZS0A 5HORA 2A4LA 3MJ2A 4RX5A 3CKWA 3AC3A 4LUDA 5DRBA 5IA4A 3R7YA 3NSZA 5HO8A 4XNEA 4OW8A 1M7NA 5FEQA 3FMEA 3MVHA 4O0VA 1K9AA 3E62A 5FRIA 4V05A 2YAAA 2PE2A 3LCDA 4X7QA 2WQOA 1Q41A 5AUWA 5HZNA 5L2SA 4MF1A 3GQLA 4JLCA 1BI8A 4RMZA 3TIYA 5LWNA 4EQUA 2W05A 4HZSA 5JKGA 1H08A 3VQUA 3Q4ZA 4TL0A 2YISA 5JH6A 2UW7A 5FXQA 5HCXA 5TO8A 2YM7A 2ZAZA 3QTWA 4X2GA 3RTPA 5CEKA 5JQ8A 1MRYA 4F9BA 4DFBA 4DGNA 3S4QA 2G15A 4OAUC 2C1BA 4IX4A 3OMVA 2HAKA 4IAYA 3RP9A 3LQ8A 4WKQA 2Z7RA 3QCSA 2BRHA 4F09A 4CYJA 4XV2A 3HRCA 5DFPA 5FEEA 5JN2A 3KVXA 3PRIA 2O8YA 2R3QA 2XK8A 4DH3A 4FOBA 2WMSA 2EB2A
chains in the Genus database with same CATH superfamily
5ETIA 3N4UA 2C3LA 4FJVA 3P5KA 3ULZA 1W83A 1Q3WA 3MY5A 4FL3A 4FYOA 3KK8A 5DN3A 2UZOA 3D2IA 4M13A 4M69A 3FMKA 4DCEA 2IZRA 1ZMVA 4K0YA 4AG8A 5CS6A 3DLZA 4C38A 3Q4UA 3WZUA 2PVJA 3UTOA 1OITA 3VHEA 5M56A 4IM3A 2VWVA 4I4EA 5FTOA 3SOAA 3MFSA 3AGMA 1P4FA 2C3KA 4GU6A 1W82A 2PMOX 3FL4A 3UO4A 4QTDA 4C3FA 4CVAA 3O8TA 3OTVA 2GFCA 5HD4A 5M4FA 3VHKA 5H8BA 3UG2A 5C01A 4BC6A 5J9LA 2X4FA 4MBJA 3VBXA 2PHKA 3FMHA 3FMNA 4KABA 4KIOA 1HCLA 4P4CA 3CTJA 3F9NA 5FBOA 5TT7A 4KA3A 5LCJA 2HK5A 3KREA 4JNWA 4Z9LA 3V5PA 1ZARA 4YR8A 1TQMA 3GQIA 3R00A 5C4LA 4HVIA 4APPA 3W2SA 1URWA 5AM6A 4TKSA 2X6DA 3V5JA 4QP7A 3COKA 4JX7A 5I3OA 3HYHA 4IFGA 4QMNA 4TYHB 4EYMA 4EWHA 2CKPA 4BZDA 3F5UA 1ZYDA 4TPTA 5ETAA 3ZUUA 3HUBA 3H9OA 4NWMA 3OBGA 4FTUA 5FM3A 5HTCA 3FWQA 3CCNA 4JQ8A 4QMYA 3KY2A 2JBOA 4G31A 3ZXTA 4ONAA 4TNDA 4WNPA 5CSXA 3WE4A 1ZMUA 4C8BA 4UX9A 4ANLA 5E8TA 3LFQA 1OZ1A 2B9JA 3GB2A 2UZWE 1YI4A 1IASA 5K3YA 2XBAA 2YIWA 2X9FA 5HQ0A 4HYHA 3PVWA 5A4TA 4N57A 2ITNA 3TKHA 5KMOA 4CFMA 2FUMA 4WUNA 3QHWA 4NCTA 1SZMA 3S95A 2W5HA 1Y6AA 2KULA 3LXPA 4QMMA 4ASDA 4EK3A 4ZXTA 3GU4A 3SX9A 4BDBA 1YW2A 2F49A 2UW8A 1Q5KA 5ETFA 1T46A 2VTMA 5IZFA 3P23A 1NVSA 1UVRA 5AX9A 4LGDA 2GNIA 3AKLA 3F5XA 2XZSA 5EG3A 3D5UA 3KVWA 2E9VA 1UU3A 4MVFA 4EBVA 5KMNA 2VTAA 2C3IB 1SM2A 4MCVA 4KWPA 3NNWA 4BWKA 4L45A 4TYEA 1ZZ2A 2VWBA 4IADA 1W2FA 1ZY4A 2I0HA 1GIIA 5CSVA 2J5FA 4M0YA 2C47A 3EJ1A 3NGAA 3VW6A 5HHWA 1KV2A 1ZY5A 4CKRA 2CNQA 2ERZE 4USDA 4YZMA 4EI4A 5IA2A 1J7IA 4BDKA 4YTCA 3MDYA 3EYGA 5CF8A 3BYVA 3UIBA 4ACMA 3EQCA 4U3YA 5DT3A 3DXQA 3ACKA 4P7EA 3MIAA 3NCZA 5EFQA 5A14A 2VN9A 4FV9A 2H34A 4QYFA 3EYHA 4QMVA 2G01A 3F3TA 3PXQA 4IJ9A 2X39A 3FKOA 5ACKA 5AR4A 3T3UA 2HZIA 2WMXA 3KN6A 5J5SA 3N4TA 3C4EA 2BAKA 5EYKA 5I9UA 4L00A 4XG9A 4CNHA 4AXCA 4FOCA 3DZOA 1NXKA 3EFKA 4O6LA 4F6WA 4R5YA 3DT1A 2HCKA 5CEIA 4C7TA 2PVYA 3ETAA 3P7AA 2JIIA 4CMOA 5BVNA 4MD7E 4L44A 1G8SA 2J6MA 2XCHA 2R5TA 1YDRE 3HRFA 3NUSA 5DR2A 5FGKA 4JI9A 4ALWA 4H1MA 2V7OA 4O27B 4CKIA 1REKA 4B99A 5JMSA 4XP2A 2JC6A 2PVHA 3DDPA 3UMXA 2UZTA 3O7LB 5CSWA 5HBHA 3SXFA 4CZUA 1OL2A 4C34A 4FGRA 5BMMA 4B8MA 1YVJA 3KXHA 4AT3A 2YERA 5AIRA 1PYEA 3ALOA 3BHHA 4GU9A 4M84A 4ZSGA 3RPOA 3UBDA 2WMBA 4KIKA 1OKWA 4A9UA 4EC8A 3R71A 3NDMA 4JL9A 3DKCA 4PL5A 3WZJA 2EUFB 1UKHA 4FEVA 5DOSA 4M67A 4UMTA 2QD9A 3NAYA 4GH2A 2JLDA 2CNUA 3UQFA 3O8UA 1PXKA 4B4LA 5BYYA 4MEDA 5IISA 2B1PA 3SHEA 3CY2A 3NIZA 4O81A 4HVDA 4MNFA 4D2WA 4RQKA 3DJ5A 4TW9A 3RK9A 3BZ3A 4F70A 2BTSA 1IA9A 4NW5A 3UDSA 4O22A 4LL5A 4CMTA 2XK6A 5EDPA 4Z7HA 1L8TA 4AQCA 5CU3A 2PPQA 5EKOA 3SG8A 4WA9A 3SLSA 3CY3A 5A54A 1UWJA 2BPMA 4FKPA 3HMNA 2IVSA 5DR6A 4R3CA 1G8JA 4XBRA 5D1JA 2A27A 4O0YA 3QQHA 1SNXA 4ASZA 1FGIA 4X3FC 3BBWA 4MBLA 5AV0A 2CKQA 4DEGA 5K5NA 4H58A 5M55A 2QO2A 1L3RE 4YJVA 4E6QA 5CF5A 4IEBA 4QYYA 4GT3A 4AA0A 4DFUA 2Z8CA 3D94A 3PA3A 4XLVA 4IVDA 2R3OA 4AOTA 5IQAA 2QOBA 4V0GA 1UNGA 1AQ1A 5IDPA 4RC3A 1JSVA 3GP0A 4JT3A 3F61A 4MHAA 3Q04A 3KXXA 4W9WA 3UO6A 4IAAA 2Y8OA 4GVJA 4WG5A 4K2RA 3L9MA 4BCKA 2CJMA 3TNWA 4R6VA 3TKIA 1BYGA 1DAYA 3FQEA 3F2NA 3Q9ZA 3KXMA 2Q0BA 2OBJA 5CNNA 5HLPA 3TZ7A 4ENYA 4EOMA 4W4XA 4Q9SA 2GQSA 1DI9A 2J50A 4Q5HA 3VUMA 5HCZA 5HVYA 4CXAA 4ZIMA 2C30A 3QTXA 4RLLA 3TI1A 4ZJVA 2IZUA 2HOGA 2ITTA 4I6BA 5KO1A 4PDYA 3W32A 3L9LA 4AF3A 2VTIA 4RWLA 4RG0A 3SGCA 1O6YA 5CI6A 4RIYB 1LP4A 4E20A 4F9YA 4OR5A 4EYJA 3HX4A 3IS5A 3R73A 2YN8A 4F08A 3W2QA 3LCTA 3V8SA 5CF4A 1ZLTA 5AM7A 2PSQA 2ZM1A 3UMWA 4V04A 2C0IA 4F6UA 2G2HA 3QYZA 3V5QA 3OW4A 4GFMA 5I9VA 4DHFA 2ZB1A 2X8DA 3NYOA 4R5SA 4FT5A 2YACA 4IWQA 2VWUA 4EHZA 2HWPA 4BN1A 5DYJA 3PA5A 4LMNA 2C68A 2QR7A 2F7EE 1ZAOA 3SKCA 4BYJA 1PKGA 4AWIA 3COIA 3EOCA 3F69A 3RGFA 5CQWA 2X9EA 3F3ZA 3D9VA 3CE3A 4I22A 3FZ1A 5CWZA 5CVFA 2OZAB 5IQEA 2E9PA 2HYYA 4D5KA 5HNGA 4IBMA 4OTHA 2ZDUA 5FLFA 1OBDA 4LDTA 2CLXA 1PXOA 2ZB0A 4JAIA 2J7TA 4KRCA 1P2AA 2UW3A 4EOQA 4BJJB 5GINE 2C5XA 2Y7JA 3PXRA 5AMNA 4O0WA 5C27A 5LVOA 5EM5A 2JDSA 3Q5ZA 4JR3A 4GFOA 4FTRA 2VUWA 3I4BA 4TZRA 3DNDA 3FY2A 3TG1A 4R1VA 4R3PA 3TNPC 3ZM4A 1V0OA 3FMMA 4KKHA 4C4HA 3ORPA 3ZFMA 1OPLA 4FEWA 1WZYA 4MUQA 2AQXA 5A4QA 1YHWA 4QTCA 2C6DA 4DFNA 4ITIA 3TWJA 2VNYA 3UODA 3ATTA 1BKXA 4E26A 1HCKA 4DG2E 5E91A 5EKNA 3D15A 1VJYA 3D7TA 4PMPA 3FSKA 3NUXA 2XAMA 5T3QA 4KB8A 3CIKA 3LFSA 2YCQA 3KRXA 3QTIA 4JG8A 3SAYA 1H26A 3KXZA 4A4OA 4BDHA 3U8WA 3MPTA 3E93A 4QDVA 3P4KA 3Q2MA 2PVFA 4CV8A 4FKWA 4X6RA 3NVMB 4Q2AA 4OT6A 2GFSA 2PUPA 5BYZA 5IEYA 3VVHA 3IGOA 1H1PA 4O0XA 1U59A 5F94A 4YHFA 3C13A 3Q52A 5AUVA 2OXYA 3VQHA 1ST0A 2AC5A 2IVTA 5B2KA 4GCJA 2Y4IB 4K1BA 4EK8A 2GPHA 1CKPA 4I0TA 2FVDA 5M44A 4HOKA 3O50A 3OVVA 3AKJA 5CT7A 5FUTA 4MQ2A 2BMCA 2W7XA 1OKYA 3ERKA 3NNXA 2PZYA 4HYSA 3ZO4A 1F0QA 3Q96A 4IZ5A 3UZRA 4CZTA 4L7SA 4BCOA 5EI2A 5AV2A 3CR0A 1PF8A 1UA2A 2WB8A 2Q83A 1FQ1B 4JDIA 5F1ZA 4M7IA 3ZFXA 4FI1A 3Q2JA 4BKZA 4IDTA 5JFWA 3O7LD 4I23A 4LGHA 1ZOGA 2C69A 2O63A 2VX0A 4IANA 4II5A 2FSOX 4DEHA 4LOQA 4Y95A 5BNJA 3ZO3A 2HY81 1APME 1NY3A 1XR1A 3CC6A 4FV0A 4DN5A 3PLAE 3DAKA 1RQQA 4A9SA 2XYUA 2VTSA 3LCSA 3BCEA 3HV4A 4W9XA 4UB7A 4IWDA 5A4LA 4L3PA 5IH4A 2OO8X 3FY0A 1Y8YA 3DFCB 4C33A 3JY0A 4YP8A 3KRLA 2DQ7X 3PJ3A 3PVBA 4CSVA 4O21A 5H2UA 4BB4A 3WIKA 4TN6A 5FWKK 4EOLA 4MWIA 3G90X 4NT4A 1OI9A 4CFUA 5GIPE 4Z7GA 2G1TA 2WTKC 5HIDA 4CCBA 1IR3A 4E4NA 2XK3A 1SNUA 5M09A 3DOGA 3TACA 4O82A 1LEZA 4YZBA 1W0XC 5CY3A 3T9IA 4PDOA 4RC4A 3ZO2A 4I20A 2XCKA 3H3CA 5D41A 2NNWB 3QQLA 5EK7A 3SXSA 3HECA 5AUYA 4BWPA 3VBTA 4HPUE 4DEBA 3DB8A 3BE9A 2PTKA 4ID7A 1QMZA 1XQZA 5ICPA 3SV0A 2VGPA 1PXNA 1LR4A 4KINA 3QC4A 4P5ZA 4PDPA 3P1AA 2HENA 4ZK5A 5AP7A 5AAEA 4O1PA 4D2RA 5K4IA 4U79A 5IQFA 2RFEA 1V0BA 2X0PA 3U51A 2VWXA 1U4DA 3HP5A 1YOLA 4FICA 4I94A 3KMWA 2JDOA 4RPVA 3EZVA 4D2PA 4ZSAA 3I5ZA 4X2JA 2CHLA 3FMJA 4QO9A 3QUEA 5AA8A 4FE2A 4O84A 5CT0A 5CZHA 4BZNA 4RFZA 3VC4A 3EN5A 4DH1A 3VONA 2R3JA 4FKRA 3GC0A 4Y46A 4YTIA 3ALNA 3DTCA 4D4YA 2GHGA 2QG7A 2C5YA 4NZWB 5HBEA 4CEGA 1PXLA 4DGGA 3I81A 3KIOC 5CAUA 4FIFA 3DS6A 4OBPA 3Q9XA 4XG6A 5AUZA 5GZ8A 4J98A 3NMUF 4GIHA 3QD3A 3MA6A 4ERKA 3MFTA 4DEAA 4O4EA 3LFCA 4M0ZA 3RALA 3F2RA 4MNEB 1GIJA 4IB0A 4CFWA 4D4RA 3PIZA 4L53A 5BMSA 3OWLA 4XV9A 3O23A 2QG5A 5EYMA 2YIYA 4AXAA 3KCFA 2XKCA 5BVDA 4C58A 1GOLA 3I60A 5HEZA 3QL8A 3Q5IA 2PYWA 3CPBA 2UW0A 3QFVA 1OIRA 5FTGA 3ZTXA 1Y6BA 4ACCA 2P55A 3PXZA 4P2KA 3ITZA 3DLSA 3CTQA 2NP8A 2QLQA 5ANJA 1E1XA 1JKTA 3W10A 2OXDA 2ZFYA 4EJ7A 3QQJA 2EXCX 4FKGA 4K77A 3ZBXA 4PQNA 3UIMA 1PKDA 2REIA 3R9HA 3LQ3A 2WELA 3ZC5A 3AC2A 5A4CA 2XAOA 4Y85A 2W1GA 3LHJA 4FX3A 4OTWA 4U81A 4DBXA 4I6FA 4EZ5A 4XG7A 1WBOA 3II5A 1VLRA 4WRSA 2IW9A 3NVKI 3KMMA 4L67A 5DT4A 4E4XA 3PY0A 3VBWA 2YM5A 1LPUA 2SRCA 2J0MB 3MVJA 3MV5A 3CS9A 1ZOHA 4ZAUA 1E9HA 4FODA 4W4VA 2W99B 4JS8A 2B9FA 1CDKA 3OFMA 4IIRA 4ZJJA 3ZSIA 4ZTNA 5LWMA 3SA0A 3PSBA 2BTRA 3LJ0A 4YC3A 5L8LA 4QRCA 5IG1A 1YXXA 4A9YA 5CEQA 2W96B 2VTHA 4UMPA 4FYNA 4F65A 4N6ZA 4ZTRA 2GTMA 4YHJA 4YBKA 3LE6A 4BDAA 2WMRA 1KOAA 4J96A 5B0XA 3FE3A 3UNKA 2OLCA 2OJJA 4LRMA 5GJGA 3CSVA 4X2FA 3CP9A 4ZLOA 3P7CA 3U6HA 1I44A 2B7AA 4TNBA 2XIRA 2BCJA 3MYGA 4AAAA 3TM0A 4F1MA 4FG7A 3CKXA 5DEYA 2BZIB 3BIZA 3BHYA 1IRKA 4QYHA 4TYHA 3DBCA 3GCPA 3K5VA 3REPA 2XA4A 5CEOA 2GHLA 4AZFA 5FDPA 3AT2A 2GU8A 1ATPE 2W5BA 3DPKA 1Q8ZA 4DF3A 3HA6A 4PTCA 3R22A 3W1FA 2XB7A 3FC1X 4IAFA 3RPSA 4I5MA 4YPSA 4U3ZA 5JSMA 2WTDA 4YZNA 2AC3A 4A07A 4JG6A 4I5PA 4BIEA 3E8NA 3QKKA 4Z55A 3EN6A 4ZTSA 4YJSA 3AGLA 3A4OX 3V04A 2CKEA 2ZV2A 5HG8A 1FVRA 2FSLX 2YITA 3MFUA 1YXUA 3P78A 2YJRA 4DHIB 4E4LA 5KMJA 2PMLX 4F0FA 3OC1A 3MTLA 4RX7A 4FEXA 3BLRA 4ITJA 3V01A 3EFJA 2IZTA 5E90A 4IFCA 2WMVA 3NW7A 3MW1A 3PXYA 2YLEA 3QTSA 2I0VA 4UWYA 2XM8A 2QKRA 3OCGA 4CQEA 1Z57A 3QD4A 3TNQB 5B2LA 4LOPA 2JEDA 3Q6WA 3C9WA 4YLJA 2OIBA 2HIWA 3I1AA 3DK7A 4RWIA 1OVEA 2Y6OA 3GU6A 4QMSA 2B9HA 1XWSA 1RDQE 2P33A 2WTCA 1EH4A 3K3IA 3LFDA 3LVPA 4UBAA 3CEKA 3AMAA 4M66A 5E7RA 3U6JA 4O0TA 4EHEA 3HUCA 1H0WA 1OUKA 3BLQA 4FZFB 3G51A 5CASA 4OTRA 2PZRA 2VNWA 2XJ1A 5K0KA 3EMGA 2B0QA 3QCQA 2WIHA 5C8NA 3B8QA 3LFBA 3R9RA 5HLWA 1FPUA 3VS2A 3VUKA 3D14A 2A19B 1B38A 1XO2B 5BUEA 2BRGA 2VTPA 5CI7A 4AFJA 4D58A 3OF0A 3L8PA 4IM2A 5HG5A 3QGYA 1PXPA 2J2IB 3FZSA 4DH8A 1KE8A 3OUKA 3VIDA 1H1QA 2XKFA 2C6KA 3PSCA 4J97A 2WTVA 4FSMA 4XUFA 3NRMA 4CG9A 4TWOA 3DCVA 2XKEA 4K6ZA 2JFLA 3UOKA 3PFYA 2BALA 4EH6A 3FZRA 5IDNA 4CT2A 2PVMA 2YHVA 3JY9A 2I0EA 2QCSA 4ENXA 1KV1A 4Q9ZA 1IA8A 4LYNA 5AAGA 2QO9A 3PUFC 5IQCA 4DTBA 3LZBA 4E5AX 3U9CA 4CFFA 1OL7A 3JXWA 3UPZA 4E5BA 4FR4A 3W2OA 3R28A 4M15A 3ET7A 1W84A 1GIHA 5CYIA 2ITWA 3DBEA 4MH7A 4PP7A 4WSYA 3BELA 4X6QC 4LL0A 3O71A 4C0TA 2XJ2A 4BI1A 4D9TA 2JKQA 3PY1A 2X2KA 4O0RA 4F78A 5J9YA 2KTYA 3QC9A 2XMYA 4O1OA 4AA5A 3TMOA 4U40A 3FLQA 2JGZA 3OXIA 1MQ4A 3QXPA 4UALA 2H8HA 3BYMA 3QA0A 3BU5A 1E1VA 1KOBA 4BI2A 3QGWA 4M8TA 4I0RA 5EW9A 4HNIA 4RBLA 3UP7A 3TV6A 3V8TA 5I9YA 2QKWB 3KK9A 3RNIA 4DTAA 1K2PA 3BQCA 3A7JA 4RJ3A 1PJKA 3N9XA 2QU5A 4EOJA 3H10A 4ITHA 1GNGA 3CGFA 4O0UA 5FG8A 2UZEA 4D0XA 4DFXE 4FIJA 3ZDIA 4BGQA 4UMRA 4CD0A 4IB5A 1TZDA 4BCMA 5M4UA 4KAOA 4OGRA 3UC3A 3DXPA 4O7RA 4NKSA 1OL6A 2YCSA 4XG2A 2OJGA 2YDIA 3GNIB 3IDPA 4GG5A 4S2ZA 5D7VA 3ACJA 4NM3A 5EM8A 4YU2A 3Q3BA 4QQCA 3R8VA 4EHGA 5HX8A 4YZCA 3R9OA 3W0MA 4YJNA 3MH0A 3UYSA 3LMGA 1GAGA 3SQQA 3ORZA 2RFSA 2XH5A 4U44A 2R7IA 4JG7A 1H25A 2E9UA 5DIAA 5CAVA 3QKLA 3U4UA 1Z9XA 2QOQA 3W55A 4YSJA 4F9AA 5HGIA 3QKMA 3MB6A 5H8GA 3RAKA 1Q8WA 3C1XA 3R1QA 2BDJA 1QL6A 3BHVA 4F63A 1G8AA 2W4KA 3HMOA 3HP2A 1RJBA 2A1AB 5DPVA 4O7NA 4Y73A 3BWJA 5HD7A 5G6VA 4IX3A 3AT3A 3UYTA 2UW6A 3COMA 3HLLA 5LARA 1H28A 2VWZA 2WIPA 3ORLA 3ZSHA 4C57A 4DAWA 3L9PA 5JFXA 4GVAA 3BGQA 3OY1A 2Y0AA 1G8KA 3M11A 4L46A 5EYCA 2PE0A 2BAJA 1J1CA 2GNHA 3ZC6A 5FQDC 3ZCLA 4C37A 3NS9A 5GJDA 3R21A 4UV0A 3KL8A 4E3CA 4BCNA 4RIYA 2E2BA 4EKLA 4TRLA 3ENHA 4PPCA 4HVSA 2X2MA 3F3WA 4J7BA 3VW8A 5KMLA 3BYUA 4ZS4A 4FNYA 5L2TA 4M14A 4A9TA 2VRXA 3QD0A 5K9IA 4KKGA 3RJCA 3BGPA 4QMZA 2UW5A 3E7VA 4ANSA 2ONLA 4QPAA 1IG1A 1ZYLA 3QZHA 4OBOA 5CNOA 3R9DA 2IF8A 4DT9A 3VS7A 4QYGA 1RE8A 1R39A 5DR9A 5J7HA 1VEBA 3F3VA 3BV2A 1BLXA 3DTWA 3MY0A 2IEWA 3KU2A 3OROA 5CU6A 1GZNA 3QALE 3UQCA 4RVLA 2OZAA 4ALUA 3PRFA 4X0MA 4EUTA 4PDSA 1W7HA 1A9UA 2ZYBA 1OKZA 2G2IA 2UVXA 3AQVA 3R8UA 1XH7A 5J1WA 1R0PA 3S0OA 1YRPA 1KE5A 4I6QA 3ZLXA 4O86A 3G9NA 3NUYA 3PLSA 3Q6UA 4BJJA 3FUPA 1JKSA 3G6HA 4LGGA 3WARA 4FKLA 2HY0A 2ITUA 2IVVA 5EM6A 1OGYA 5GIOE 1W8CA 3FLZA 5CANA 4D4SA 3C4XA 2W4OA 4LG4A 4LM5A 3EKNA 3CGOA 4U43A 4JMQA 1WVXA 4FIEA 1Q8TA 4JRNA 5J7BA 4OAVB 4ZJIA 3LIJA 2BDFA 4GKIA 4FKOA 2WNTA 4MYGA 2LAVA 3FXZA 3EQIA 2Y9QA 1OUYA 4GK2A 2QOIA 3E5AA 4FG8A 4MWHA 3PJ8A 2QR8A 2DYLA 5AP2A 3RAHA 4BTKA 5KNJA 3BHUA 3FKNA 3FXWA 5JFVA 2P2HA 2YCRA 4MD8E 4RX9A 3E3BX 5CZIA 2XJ0A 4I93A 5DE2A 2ZMCA 3QTQA 4WNOA 4LFIA 3WZDA 5AJQA 4RZVA 1OECA 4P90A 4AU8A 5A46A 4MXZA 2FB8A 3GOPA 4YZ9A 4EBWA 5AWMA 5GZ9A 4FG9A 4EEVA 2V7AA 4IAKA 2JDVA 1FMKA 3F7ZA 3OCTA 1B39A 3KF7A 5EHOA 5AR3A 5KZ0A 1JPAA 3GGFA 5LCKA 4LV5A 5IEXA 3QQUA 4Q5EA 1OGUA 3EB0A 3H9FA 1U54B 1WBVA 2PVNA 5JZNA 3SW7A 2NYAA 4NSTA 4ZTLA 3EQFA 2GNJA 4O91A 3UIXA 5JFSA 3LFAA 3L9NA 2HXLA 2QOFA 3CD8A 4FKSA 4N0SA 1YQJA 4A7CA 3A8WA 4E6DA 4DG3E 4QP4A 3OOMA 5CALA 2O3PA 2XNGA 3OT8A 3PG3A 2IN6A 2XBJA 2GNFA 3NW5A 5AIKA 3ZLYA 5H3QA 1XH6A 3L8VA 1XMMA 2P4IA 1PY5A 4L01A 1MQBA 4ZOGA 2A0CX 4F4PA 4DEIA 2WMQA 4F7LA 4GJ2A 4FSYA 4QQ5A 5JGAA 4I6HA 3UC4A 5KHXA 3EQHA 4RJ7A 5EM7A 4CFNA 5DNRA 4AW0A 5EQPA 5DRDA 3C0GA 5CXZA 4G3EA 3HA8A 4IB3A 2UW4A 4G2FA 2PU8A 5FXRA 5D7AA 3E8EA 3C50A 3WILA 2C3JA 3R83A 5IA0A 3U6IA 1XBBA 4BYIA 3FLYA 5IKWA 2W1EA 3ORMA 3GEQA 4K9YA 2QHMA 5F95A 5EI6A 3G9LX 3PTGA 4Y8DA 4EOIA 4FEQA 3LMHA 4HVHA 3PP0A 3OWKA 3PSDA 5BVWA 4F9WA 5KBRA 2W5AA 4AN9A 5HOAA 4RWJA 3AC1A 1DI8A 3L8XA 4R1YA 1PXJA 1M2RA 2CPKE 4W8EA 3DY7A 4EQMA 4F7NA 3VRYA 5HX6A 3IONA 1DS5A 5JGDA 2GS6A 5IQDA 4RX8A 2YZAA 4O7YA 3A99A 4ZEGA 3RBWA 4TWCA 4RQVA 2XKDA 3VBYA 2W9ZB 1U46A 2ZJWA 3IK3A 3GBZA 3PJ2A 4GL9A 3R8MA 3AXWA 2OG8A 4XV3A 4D9UA 4UN0C 3R2YA 2XRWA 5I9ZA 1QPJA 2WMTA 3V51A 4MX9A 1JLUE 1YOMA 4AT4A 4CKJA 2J0KA 4FRFA 3PDTA 1Q99A 5CAOA 2LGCA 1IAHA 4QP3A 2VO7A 4USEA 1TFFA 4NEUA 2ZV8A 3SRVB 4B9DA 3FC2A 3QTRA 3HMMA 4E93A 3EQRA 3PP1A 3QUDA 4CZYB 3NX8A 4RWKA 1Q4LA 3OS3A 3UOLA 4AZSA 3Q60A 5I5ZA 1VZOA 2YLFA 4O7VA 2XNEA 4MNEA 2R2PA 1WCCA 4KIPA 4ANNA 5AADA 4RJ6A 2VTJA 4DLJA 4UMUA 4AW2A 2XEZA 2P2IA 3KGAA 4NTTA 5BVFA 3NNUA 3WF5A 3RAWA 4CCUA 2OIDA 1H4LA 4YJOA 3DAJA 4BKYA 1TKIA 3CD3A 3GFEA 1FGKA 4A4LA 2CGUA 3UZTA 2B55A 4F1TA 4IM0A 3LFFA 4BY9E 5C9CA 5HCYA 3F88A 3P9JA 4FTOA 4OTGA 4PL4A 5AP4A 4AXFA 1RW8A 4YNEA 3E8DA 3TL8A 3AD4A 2QURA 5AUUA 4LV7A 2BKZA 4DA5A 4G9RA 5JQ5A 4UMQA 2XM9A 2J9MA 2I40A 3QA8A 2B52A 3IDCA 4GJ3A 4BHNA 5AAFA 3UOHA 3DJ7A 3MA3A 4FKJA 4GIIA 1UKIA 3W8LA 4FTMA 3MFRA 2FH9A 3COHA 5HLNA 4FTIA 4D0WA 4KKEA 5CVGA 4B0GA 4UYAA 5D9HA 3QZFA 1VYWA 2I0YA 3GU7A 5HIEA 4YO4A 2JIUA 3HV3A 3S1HA 3DU8A 5JGBA 2UV2A 4FIGA 5E8SA 1JAMA 5IQHA 4BDFA 3RZFA 5HKMA 3HV5A 3LM0A 4QD6A 4IACA 3JVRA 3K5UA 1ZYJA 3QZGA 1OKVA 2RG5A 3MPAA 3UQGA 4F1OA 1YI6A 3ZBFA 2IW8A 4ZTMA 1R3CA 3HGKA 2VTOA 2EXEA 5E1EA 5KBQA 2W0JA 2WTJA 2HW7A 3FHIA 2P3GX 3PY3A 4HGSA 4QQJA 2YM6A 4FSZA 4FMQA 5DWRA 3VN9A 1FVVA 2X2LA 4BL1A 5EW3A 3QX2A 3PG1A 5FM2A 1H24A 4EJNA 3N4VA 5KX8A 3DA6A 1A48A 2QLUA 2VZ6A 3ZEWA 3QYWA 4CQGA 4FVRA 4BTFA 4IZAA 2NO3A 2VU3A 3BEAA 4RJ5A 5FXSA 2EWAA 3FXXA 4NW6A 3I7CA 3R8PA 1P5EA 3RCDA 2CCIA 2VO0A 3H4JA 5HI2A 4KSPA 4EH7A 3RK7A 5D11A 2ITVA 2F4JA 2GQGA 1JWHA 4FV5A 4BI0A 3EWHA 3OEZA 4QQTA 1FMOE 1URCA 4JDJA 4A4XA 3AMYA 3DFAA 3W16A 3G6GA 2B54A 2ETMA 3R02A 3V8WA 3W0QA 1GJOA 1R78A 2XK4A 2PUUA 5IQBA 1VR2A 4FTTA 1LEWA 1JKKA 2QQ7A 1KE6A 3O5AA 4ZLYA 4X3FA 2GSFA 3E63A 3IGGA 1WBWA 2XRUA 4ASEA 5M07A 4C4EA 2WMWA 4C35A 2RIOA 2VO6A 3VUDA 4ZZNA 3KQ7A 4M3QA 3FPMA 4O4CA