3CQWA

Crystal structure of akt-1 complexed with substrate peptide and inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
318
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMIERRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Synthesis and structure based optimization of novel Akt inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 318
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cqwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cqwA01
2XBJA 3E87A 3FLQA 2PZPA 4KIPA 5IDNA 1Y91A 3ITZA 4L45A 5AR2A 3U4WA 3CR0A 3UC3A 4LG4A 2JIUA 4RT7A 2QOBA 1PXLA 3VUIA 3QC4A 3NNXA 3Q9YA 4EQCA 3CD8A 1PYEA 4O1OA 5D12A 5J9LA 1SVGA 4EYMA 3PZEA 3D5VA 1JBPE 4BHZA 1R1WA 3C50A 3SXFA 2OW3A 2C47A 3QF9A 1VR2A 1IA9A 4ENYA 3SW7A 3VRZA 1W83A 4UV0A 1R3CA 1FVVA 5EW8A 5CU4A 5E8VA 3CE3A 3OOMA 4IWPA 4YZNA 4ERWA 4F70A 4MCVA 4HCVA 1HCKA 2HY81 4CTCA 4FKUA 4LM5A 1YXVA 2PVKA 3OCGA 2PYWA 3P7CA 4RBLA 1M17A 3G6HA 1MUOA 2PUUA 3FI2A 3DZQA 3QX2A 3DAKA 4APPA 4L7FA 1Q41A 1SVEA 1XH8A 2XH5A 3RHXA 3VS1A 4YJOA 3GC0A 1PW2A 4RWJA 3TDWA 4RX8A 4MQ2A 4CKRA 4GFOA 1JKKA 4QMPA 4I6BA 2OF4A 2P33A 2R3RA 4TWNA 3P9JA 4IB3A 4QYHA 4D9UA 1CKPA 4F1OA 1IAHA 2HZNA 4APCA 4BDKA 3PWDA 1FPUA 3S95A 2WU6A 2XJ0A 4YJVA 1H27A 2OO8X 4X2GA 2OU7A 5E92A 5DGZA 5FP6A 4W8EA 5CZIA 4HVHA 1KE8A 4AACA 4C59A 2XNBA 3C4ZA 5KE0A 4IACA 4BKZA 4EK6A 4FSQA 4ZSAA 2J0KA 3MVHA 4CKIA 5AX3A 1E1VA 4FSMA 3ZFXA 4RIOA 4X2KA 1OB3A 1Q8YA 4FTRA 1JAMA 5JRQA 2W1CA 4OBPA 3UIUA 5GJGA 3IQ7A 4GFGA 1XR1A 1L8TA 4DH7A 3NDMA 5F4NA 3N4VA 1Q97A 3QXOA 5J8IA 3GEQA 3R30A 5LARA 2WPAA 1XQZA 2BAKA 4R3PA 4XV3A 2VO3A 5LJJA 5B2KA 4BDIA 3SA0A 2O64A 2R4BA 1DS5A 2UZVA 3BWJA 4PTGA 3FPQA 4BI0A 4H39A 3SHEA 4BZNA 2YWVA 4D1XA 4MNEB 3NAXA 1Q99A 2ITWA 4G1WA 4BCNA 4BTMA 3CXWA 3TJDA 5AP0A 2QG5A 4CNHA 2IJMA 3BPRA 1YQJA 5LMBA 4BRXA 2PMIA 4OTWA 4F0FA 4IZ5A 4CFXA 5KKRC 4G34A 3RPSA 5L3AA 4BDBA 1YHWA 3KRWA 3LCSA 2YM7A 3AXWA 4USEA 3C1XA 4X3FA 3WE8A 4JL9A 3QD0A 5FWKK 3OUKA 3Q5ZA 4FV4A 3RK5A 2G2FA 4C62A 2RFDA 3TI1A 4FKGA 5IZFA 4L6QA 4G6NA 2ONLC 4JRVA 4O0YA 4GUBA 2PY3A 3DPKA 5L8JA 1REJA 4O7LA 4ZMEA 3ETAA 4EC8A 5HU9A 4BFMA 2W17A 4TPTA 3WZDA 4H3PA 3TV4A 3DK6A 1Q3WA 1SNXA 2P2IA 2W05A 2XIZA 3F88A 3OY3A 4HZSA 3DK3A 5CI6A 5LVLA 4BCFA 5FTGA 2GCDA 4K18A 4WO5A 5HNBA 4D4RA 1GIJA 5IA5A 3R73A 5EYMA 2VGOA 4EZ5A 3O0GA 1OIQA 2V62A 3POOA 3QCSA 4AT4A 4U97A 3BEAA 3IS5A 2WO6A 3E8NA 3ALNA 4UWYA 4PF4A 2J9MA 4NT4A 5IF1A 4AFEA 3ACJA 2RFSA 5AM7A 4NJ3A 3P0MA 4RFMA 5E8TA 1UWJA 2R3JA 3PXYA 2E9PA 2XIYA 4TXCA 3U4UA 4GVJA 2XM8A 5CSVA 2EXEA 5AUWA 2BZJA 3JVSA 5FEEA 1PRYA 3R01A 2W5BA 2QURA 2RGPA 2UW5A 5EOBA 3TCPA 1JKTA 4C4EA 3LAUA 2QC6A 4D5HA 4EH4A 4CG8A 4OLIA 2OG8A 1H1QA 4FSWA 1JWHA 1STCE 3HMPA 2W1DA 2X39A 4CD0A 4DG2E 4YMJA 1OM1A 4XEYA 1LR4A 2YIQA 4RX5A 4MXXA 4TNDA 1H1RA 4BB4A 4PP7A 1XH6A 4L53A 3PFQA 4ZIMA 1TQIA 2R3IA 4GS6A 1GY3A 2JBOA 5KZIA 5CS6A 4JG6A 2V0DA 5CX9A 4JAIA 4I41A 3ZZWA 3OEFX 4FV0A 2A27A 3F3UA 3AC3A 4RA4A 4WUAA 3NYOA 4AZTA 3D2KA 3NLBA 2PULA 2R3MA 3DAEA 3GUBA 2HYYA 2X9FA 2WEIA 1UNGA 1XH7A 2XKFA 3A8WA 4GRBA 4CSVA 3ZRMA 4F08A 4XOZA 5FXSA 2P4IA 3JYAA 3PVUA 4YTCA 4BDHA 3CSVA 3MPMA 4EEVA 4E93A 2ZVAA 2VU3A 1H1WA 4AZFA 3T8OA 4EJNA 2QO2A 3HECA 4NCTA 3O8UA 1WBTA 4YZ9A 2O0UA 5A9UA 1FMOE 3UO4A 5AIRA 3ZC5A 1H07A 1FMKA 1MP8A 4CEGA 1GZKA 4EONA 2YIYA 4DEEA 2GNHA 3MSSA 4DH5A 3H9RA 4Y83A 5EYKA 3FUPA 5GIOE 3V01A 3BYMA 3POZA 4IHPA 4YURA 3RTPA 1KV2A 1JLUE 4Z16A 2R5TA 1W82A 5EYCA 4TYJA 4QOXA 3O96A 4ORKA 3TZ8A 1NT2A 3QQUA 2Y6MA 2E9NA 4GVAA 4I94A 2BRHA 3VUGA 4IC7A 4IX4A 5IPJA 1LUFA 2CNQA 4N57A 4QTEA 3A4PA 5JN2A 2XZSA 3LOKA 4PPAA 3VUMA 2Y7JA 3C0GA 4NFMA 4TYGA 5EOLA 3LMHA 3H30A 3QZFA 3RAWA 3HVCA 2R3LA 4DEDA 2BTRA 2Y9QA 2QOIA 4P7EA 5DIAA 1Q3DA 4ZXTA 2C0IA 1V0BA 3CCNA 4GJ3A 5JGBA 2BFYA 2WTIA 2WEVA 4YZDA 2QO7A 2GNFA 3B2TA 3LXLA 3PJ2A 1DAWA 5CEKA 5JH6A 1SMHA 2XJ2A 5IMEA 3QWJA 4PL4A 3FAAA 3PPJA 3QCQA 2VWZA 2ZDTA 3MIAA 2I6LA 3LCKA 3TG1A 3BU3A 3TNIA 3NYXA 3T3UA 4PMPA 2ITQA 4U79A 2W1GA 5KX8A 2ONLA 4FT0A 2J5FA 3RJCA 1ZZ2A 3C5UA 4HGTA 5L8LA 3HDMA 2YZAA 5M4FA 4RJ4A 4DFXE 2VTOA 4GFMA 3MI9A 4PMMA 3I4BA 3AD6A 4IJ9A 4IIRA 4E7WA 3CIKA 2Y4IB 3R1NA 4DGMA 5TT7A 4FKWA 1BL7A 3BKBA 4C3RA 4EC9A 4L68A 3DJ5A 4G9CA 4W4WA 4BYIA 4WNOA 4YJPA 4PTEA 1M52A 2YITA 5A54A 3GQLA 4ZJVA 3I5NA 3Q53A 4XG9A 4F7LA 4IVBA 4U45A 2FSOX 5HTCA 3C13A 4RVKA 2OH0E 2XNOA 4G2FA 4IAAA 2LGCA 3ZO2A 2B7AA 4G3DA 2EUFB 2O65A 2VX1A 5FXQA 2IN6A 4FSNA 2PU8A 2W1EA 3VS3A 4IWQA 3R21A 3C4CA 3NIZA 4I22A 4ANSA 1M7NA 1FOTA 3QQKA 4BBFA 2XKCA 4DFYA 4ZY5A 4TL0A 5IQGA 5AR7A 4ACDA 1PXKA 1ZZLA 3WIKA 4Q9ZA 2DYLA 2WMVA 2OF2A 4CFUA 2UZNA 3EFLA 1XBCA 1QCFA 5M51A 3ZS5A 3ZLXA 1GNGA 5AUYA 4R77A 3VUDA 3DXPA 4X2NA 5M08A 1YWNA 2YM6A 1OPJA 2BZHB 3KGAA 3DKOA 4G3CA 2BROA 3WF7A 2YLFA 1U46A 3TUDA 3BU6A 2PE1A 3ULIA 5IQIA 4BCMA 4DEIA 1W98A 4FTKA 3G9NA 4XLIA 3V6SA 2JAVA 3BU5A 1SZMA 4HYUA 3PVWA 5DVRA 3HRCA 3RK7A 5A4QA 3UOLA 3MH3A 4CV8A 1XBAA 5C03A 4EQUA 3HMOA 4L52A 5HE2A 4FC0A 4JRNA 2ZOQA 3IG7A 4S34A 2ZV8A 5IA3A 3FY2A 2JDRA 5FLFA 1UNLA 3UMWA 2WQOA 3DBCA 3GI3A 1JKSA 2QOOA 5ANEA 4M14A 5FBNC 3W18A 4ZLYA 4CGAA 1Y8YA 4M67A 3RCDA 3ACKA 3VC4A 4XUFA 4F65A 1J91A 5AEPA 5IH5A 3QHWA 4DEGA 5KMOA 3WYXA 3LHJA 3VF9A 4DHFA 5C8KA 3FQSA 3E8EA 1YXXA 3K5UA 3WF5A 4FKTA 2ESMA 3AC4A 1OPKA 5M09A 4MTAA 1WBOA 5HE3A 3UC4A 3LQ3A 5EYDA 4ONAA 3JUHA 5AAEA 4O0VA 5HLWA 3BYUA 2VTAA 4H1JA 4N6YA 5G6VA 4DFLA 5EHLA 2JEDA 4D4SA 2ZM4A 3SG8A 5IU2A 3QAME 4FG7A 4DH1A 4KD1A 4DBNA 5EI2A 4U5JA 2F7EE 3CKWA 4WT6A 4IWOA 4F0IA 2PHKA 3BV3A 1OL7A 2AC3A 4AN2A 4BVUA 4X2JA 5K0XA 4L7SA 3WF6A 4AN9A 3F6XA 2CCIA 2H96A 4QTAA 4U6RA 3V5TA 5CF8A 4D2VA 3JY9A 3MGYA 1G3NA 4BCOA 2F49A 5HO6A 5IKWA 5AAGA 3HP2A 3QCXA 3TZ9A 4BI1A 4BTKA 3QQGA 4KS8A 2X8DA 3FZPA 3I6UA 4TRLA 3Q4ZA 1O6LA 4F7JA 4J71A 3VBWA 2HW6A 3NW6A 4OT6A 4R5YA 3D7TA 3VUTA 5CEIA 2JAMA 2WIHA 3ZO3A 4F9BA 5M57A 1QPJA 3FPMA 5IQHA 1YXUA 4ZZOA 4FUXA 5KMLA 4AE6A 1BMKA 4PRJA 3UZPA 2ZB1A 4J98A 3VAPA 4AF3A 4AS0A 3P1AA 4QMSA 3BGZA 4FZ7A 3I7CA 3HAVA 3KULB 4PTCA 4QYGA 3ZSGA 5L8KA 4H05A 3LFEA 4E26A 4F1MA 3D5UA 2QCSA 5HTBA 5HIEA 3C5IA 2IZRA 4GCJA 2HW7A 3PG1A 3AC2A 3R22A 1OI9A 2WTWA 3B8QA 3W2CA 2VTPA 4LRKA 4EKLA 4EHZA 1FVRA 3MYGA 4PWNA 1Q61A 4M12A 3KMMA 5CVGA 5T3QA 4AUAA 5LMKA 1JOWB 5GHVA 1GOLA 3QALE 5J95A 1ZOGA 2ZDUA 1SVHA 3LCDA 3BHVA 3E5AA 4FSRA 3FXWA 3RP9A 5CAUA 5IEXA 1AD5A 2Z7QA 3UVPA 4FE2A 5IUHA 1Y6BA 4RQVA 3P5KA 4RJ8A 5D7VA 5DE2A 2WIPA 4FGRA 4EKKA 2CKPA 2YZLA 5A46A 2OSCA 3RZFA 2WMXA 3PZHA 3MH0A 4JI9A 3R00A 5HLNA 3KY2A 4RC4A 3EQHA 3AOXA 2F57A 4TW9A 4CLJA 2BKZA 4FX3A 5DWRA 3H10A 2XNNA 3FLYA 4QT1A 3IKAA 3BYVA 4YZCA 2R3OA 4NYEA 2UW4A 2I1MA 3ODZX 4M13A 5HORA 3UQCA 2GS7A 2JKMA 4RIXA 3EN6A 2GQRA 2WMQA 4U8ZA 5BUIA 4JBQA 4TY1A 2JC6A 2C6IA 5J5TA 1JSVA 3FZOA 3GC9A 5CSWA 3FI3A 4U0IA 5LVPA 4C58A 2WTCA 3B2WA 4MD8E 2PVFA 4O0XA 3WZEA 1H28A 3QLFA 5HHWA 4AZSA 3AGMA 3ZH8A 3NX8A 4NK9A 4YO4A 1W0XC 3F7ZA 3TTIA 1XWSA 4FL2A 2EB3A 3FMNA 3VO3A 4LUDA 2DWBA 3ZOSA 4O7SA 5DR9A 3QYWA 2EB2A 3IW8A 5JFWA 3G5DA 5K4IA 4R3RA 3RGFA 1BUHA 5L2WA 2PVYA 4OTRA 2WQEA 3ZM9A 3VJNA 4ZY4A 4E6CA 3NSZA 3ZUUA 4UX9A 2XKEA 3AD4A 3IW5A 1GIHA 4OAVB 4ZMFA 4USFA 3W2QA 2BIYA 4EYJA 3DAJA 2ITPA 4DGOA 2X4FA 3C51A 4KB8A 4QQ5A 3GCQA 4F1TA 5B7VA 2EXMA 3Q5IA 4L43A 3PA4A 3GOKA 4FKLA 3OMVA 5AUUA 3LFFA 3LM0A 1URCA 1YW2A 2XEYA 4F9AA 4BI2A 3EMGA 4YR8A 3FL4A 3QRUA 4O6EA 5DBXA 3UP7A 4BCKA 4E73A 5DNRA 2CN8A 3FYKX 3UYTA 3O23A 3DLZA 4FV8A 4FNZA 2J0LA 1YI3A 4J8MA 1OL5A 3NUAA 2YIWA 4EWQA 3UPZA 2PE2A 2WNTA 2CKQA 2C6TA 4FT5A 4O7WA 5HE1A 3BGPA 3PSDA 5IQBA 3R9NA 4E8AA 3QHRA 4FKVA 3IO7A 5AR5A 4GW8A 1OUKA 2C5VA 3AC1A 3LE6A 1P2AA 3W1FA 1ZOEA 4TTHB 3MTFA 4N0SA 4HCTA 1PXOA 3U6HA 3MBLA 1Y57A 4IZYA 2C30A 3KL8A 2J51A 4S31A 4M7IA 4OBOA 4YZMA 5LWNA 5KO1A 4AOJA 3LFDA 2FB8A 4YJQA 5AJQA 4DH8A 4CCBA 5A6NA 5ANOA 5CNOA 3UIMA 3VBXA 4NW6A 2BALA 3FKNA 3HLLA 3I0QA 3DDPA 1P4OA 2F9GA 4FGBA 3TZ7A 4BY9E 3DV3A 4B8LA 5BVEA 3AMYA 3M2WA 5EG3A 3UG1A 3AMAA 1B38A 2R3KA 3LJ2A 4YLKA 4EK8A 3EN4A 1RDQE 4IH8A 4UN0C 3GFWA 1BYGA 4C61A 4M97A 4L44A 1YRPA 2O3PA 4AW2A 1ZOHA 5HX6A 4UXQA 4ITJA 2A19B 4HJOA 3L8XA 3HP5A 2BVAA 1RE8A 5CVFA 1WBSA 1CSNA 4CT2A 3NPCA 3EJ1A 4RIYB 3GP0A 4KBAA 2W4KA 4C34A 4D2WA 4R1VA 5BVDA 3UNKA 2IVUA 2B9JA 2YABA 2X6DA 3PSCA 4IX5A 4OGRA 5HD7A 4ALUA 3QTZA 1KSWA 2ZMDA 4C8BA 2AC5A 4FYOA 3NS9A 4QP6A 3CKXA 3CPBA 5I9UA 4J7BA 5JGAA 4IM2A 2PTKA 4BBMA 3KVXA 3FY0A 3VNTA 4ASDA 5HGIA 4ANQA 4MBIA 3GCPA 4G3EA 4CRSA 1CM8A 1M2QA 3LFQA 3DT1A 5I9XA 3EHAA 5J7HA 4EOQA 3QTUA 4C57A 5F95A 2O2UA 4MXZA 3V5QA 4PL3A 2YFXA 2W7XA 4GEOA 4KABA 1H0VA 5AP7A 4LRMA 3VULA 1BL6A 3FZRA 5ACBC 4I6QA 5A4EA 3PLAE 3GOPA 5HEZA 3R9DA 2HOGA 4O2PA 4GT5A 3RK9A 3GT8A 2ERKA 4UZHA 2W06A 2BIKB 1ZLTA 2GDOA 4XV2A 4YLLA 3UPXA 5IA4A 4DA5A 4O91A 4O7ZA 3QUEA 5EDRA 3ZRKA 3MY5A 1GIIA 4XOYA 2ITZA 3GNIB 2W9ZB 4AAAA 3MW1A 4RIXB 1KOBA 2PZYA 4EH2A 3QA8A 4B7TA 4DCEA 2Q0BA 3HMMA 4GK4A 4N70A 4MF0A 4YUQA 4ACGA 5L6WL 3KXMA 3FWQA 4IMYA 5CEPA 2YJRA 2WMRA 2JIIA 4RIWB 4S33A 4O21A 5EKOA 4KSPA 3SOCA 2E9UA 3A99A 3FLZA 3R6XA 4PMTA 5FTOA 3QTQA 4G6LA 3LM5A 5FBOA 2YDJA 5CF6A 3LXNA 1KUTA 3FLNC 3K3JA 3ORMA 2ZMCA 5LMAA 3ZM4A 1OGUA 4RLKA 1NXKA 4JIAA 3ZUVA 3I7BA 4I23A 3U6JA 3ZC6A 2WMTA 3PE1A 5AUVA 4ZSLA 2YN8A 1ZYCA 3OROA 5F9EA 3AC8A 2PUPA 3CGFA 5CSXA 2IZSA 1PJKA 5IUGA 3TDVA 3PYYA 2XEZA 3KXXA 4XBUA 1FBNA 5I9VA 2Z7LA 4KA3A 2YAAA 4QMTA 4U9AA 1Q24A 3QFVA 4UBAA 4RJ3A 4YZBA 3VHKA 3D5XA 3A8XA 1TQMA 4E5WA 5JFVA 4L67A 5CYIA 1NVSA 1YI4A 3V8WA 3RAKA 3NUNA 4O38A 3TACA 5M44A 3P08A 3DCVA 3HX4A 3P7BA 1U59A 3E8CA 1U54B 2C3JA 5GZ8A 2NO3A 4FBXA 2LAVA 4V0GB 4QP9A 3KRRA 4QMQA 1OKZA 2IVSA 4GMYA 3NZ0A 3S00A 3UVQA 5CU3A 4AA5A 4AP7A 5C4KA 5G1XA 4JJRA 2WFYA 3QL8A 3OXTA 5E8WA 4CG9A 4IX6A 4KS7A 4KIKA 2ERZE 5H3QA 4GK3A 3PXRA 4JQ7A 4WSYA 4YHTA 3E93A 5LOHA 5ACKA 5HNIX 3G15A 3BQCA 4S30A 4NSTA 5GIPE 4C33A 3NVMB 3MESA 3K3IA 4NKAA 2FGIA 4GT3A 2XCKA 3C4FA 3OXZA 2QHMA 2YCQA 3N51A 4K1BA 4UYAA 3G90X 4LV5A 2WMSA 3ENMA 4QRCA 4WNPA 5DFPA 4M15A 2GNJA 5AP4A 4GK2A 5J79A 4Z7GA 1VEBA 4MK0A 2V7AA 5BVKA 5HVJA 3SC1A 5EQEA 2HWOA 4IDTA 3OUNB 3PXFA 4GV1A 1YKRA 3SRVA 3VS2A 1H01A 3DGKA 3L8PA 3EH9A 4FV1A 2R3FA 1URWA 3RALA 1J7LA 3RPVA 4DN5A 3HYHA 3FHRA 5BVFA 4D55A 2YA9A 2WTKB 4B8MA 4ASEA 5IA1A 2J0IA 4A9SA 4IE9A 2UZLA 5HNGA 4IANA 3O8TA 1O6YA 1WBVA 5HE0A 1UNHA 3U8WA 5HX8A 4P2KA 3V8TA 4M69A 2Z2WA 4WNKA 2JDOA 4KIOA 3PPKA 2VTNA 4NIFA 3E3BX 2F7ZE 4QNYA 2C0OA 2G1TA 5AR3A 1U5RA 1YXTA 5M4CA 4QTBA 4IB0A 5AUTA 4R78A 4M8TA 1ND4A 4XNEA 5M55A 3JXWA 3VQHA 4HYIA 3L9PA 3F5PA 3MDYA 4W4YA 4FI1A 4QTCA 2QLQA 3LXPA 3COIA 2CMWA 4I5HA 2ITVA 3MVLA 3OTUA 4DT8A 4ALVA 2YCSA 4FVRA 5AWMA 4K9YA 3QCYA 3VW8A 3BYSA 4PV0A 4AW5A 3VS0A 4MBJA 4EI4A 4D5KA 3KU2A 4ENXA 2G15A 3QQLA 3IGOA 4I6FA 4LMNA 4C7TA 1CKJA 4R7IA 3AG9A 3L1SA 4ZK5A 4IB5A 3ZDUA 5J7BA 3O8PA 2GFSA 3PA3A 4C4FA 3EIDA 3VWAA 4R7HA 2C6LA 3KA0A 4FA2A 4GT4A 3G2FA 4C38A 4IQ6A 5E8SA 5M07A 1XBBA 2X2KA 4FIEA 4UMTA 1P4FA 2A0CX 3UOJA 4WRSA 4AG8A 1NVQA 1GJOA 4JDIA 4ZTHA 2ZV7A 1DAYA 4DINA 5B2MA 3FXZA 3DBFA 3KREA 5ETAA 5EKNA 4O0TA 2OZOA 2VTLA 3IDPA 5EHYA 2QR7A 4EK5A 5CI7A 4J53A 2GS6A 4O7TA 2B9IA 4DC2A 2YIRA 4CMOA 4JG7A 1XKKA 2O63A 5CF5A 3QA0A 3ZDIA 3ZCLA 4HPTE 2C6DA 3UOKA 3OXIA 1OUYA 3KF7A 3P4KA 2NRUA 2VTTA 5D10A 3R7UA 4DGLC 3KEXA 4EOIA 4WIHA 2HAKA 1OMWA 1BX6A 2X4ZA 4JDHA 4FG9A 4X2FA 5J87A 4EBWA 5CSHA 4AXAA 4ASXA 5KCVA 4MD9E 5DRBA 5DT3A 4C3PA 2R64A 1WVWA 4XV9A 4D1ZA 1PKGA 2OIDA 5AP3A 2CDZA 3MY1A 3OT8A 3L9MA 2H9VA 4A7CA 4ZTSA 2XUUA 3WARA 4I0RA 2JDSA 5AV2A 4JDJA 1OPLA 3ZUTA 3HV6A 4MQ1A 1NVRA 3E88A 1QL6A 3TTJA 4AZVA 1RJBA 1ZMVA 3UJGA 3A7JA 4FTTA 2HZ0A 3ZTXA 4EL9A 2J90A 2WXVA 4FV7A 2OK1A 2IZTA 3I60A 1KE7A 3R8MA 4DYMA 5BYYA 3PSBA 2W4OA 4ANOA 2UVXA 3Q2JA 1WCCA 1APME 4JIKA 2HY0A 2B52A 2JKQA 2WD1A 3U55A 4XG6A 3AC5A 2WZJA 4E4MA 2OICA 4F6UA 4B9DA 5AV4A 3GC7A 1K2PA 3OCSA 4GG5A 3CQEA 4I4FA 1OKVA 1JSUA 2PMOX 3DBEA 5TKDA 3TNQB 3EZVA 4JT3A 4D1SA 4KRCA 4DTAA 1OIYA 3TEIA 4HOKA 4EJ7A 4KSQA 2XRUA 5HLPA 5CEOA 3IDCA 3MJ1A 4LQMA 3C0HA 1YOMA 5CY3A 4YU2A 4BTJA 1VYWA 4BICA 5CNNA 3RHKA 3E8DA 3P86A 4WRGA 4RVLA 4FEWA 4BR3A 4YSMA 1PMUA 3VQUA 3ZHPC 4DLJA 2OWBA 2R3QA 4AFJA 2X2LA 1MQBA 4S32A 2VTHA 4CYJA 2O5KA 3QRIA 2C5NA 3OC1A 3WZJA 2YM4A 3R8UA 3OWKA 3V04A 3VS4A 3LJ1A 3D9VA 3NRMA 3NUUA 4BBEA 4D4YA 3QZGA 2W1HA 3ORKA 4H3QA 4RZWA 1FQ1B 3CBLA 3M1SA 3FI8A 4IM0A 5DEYA 1XH9A 3REPA 3SAYA 5DMZA 3EFJA 4FV5A 4ANNA 4O7YA 3IW4A 5ANGA 1H08A 2X8EA 4G3GA 3IGGA 4IWDA 4UB7A 2BMCA 4JX3A 3RPYA 2HELA 5AR4A 4D58A 4DGGA 2WMAA 4NZWB 4QNAA 3K54A 3RNYA 4FV6A 5JEBA 2XVDA 3SKCA 2BTSA 5J9YA 3TKUA 4XG7A 5E7RA 4FTAA 1OIRA 4G31A 4LRJA 3EKKA 2VO6A 3ZO1A 2BDFA 3EQIA 3IDBA 4O7VA 1Y8GA 4E4LA 2C69A 4IAFA 4F9CA 2YCRA 2Q0NA 3SQQA 3OY1A 4HW7A 1H26A 4AW0A 5CU6A 3EB0A 3A7IA 3QTIA 1YWRA 2W5AA 4EUTA 3JS2A 3PRIA 3W32A 2CN5A 3ROYA 4ZTNA 2Y0AA 3D83A 3Q04A 3RNIA 4E5BA 1PMEA 4IBMA 4CZYB 3HDNA 1Q5KA 3D94A 4QMYA 2GHMA 4L3PA 1O6KA 2FO0A 2R3PA 5M4IA 4V04A 3OD6X 3CJFA 3R04A 1Q8WA 2Z7RA 3C9WA 4I0TA 4TYHA 3TIYA 4QMZA 5IQFA 2XK3A 4BIEA 2VX0A 3BHYA 4X3FB 4PDSA 4FTUA 1UU3A 3FSFA 2IW6A 3OF0A 2RFNA 3I0OA 2X9EA 4XRLA 4MNFA 2B54A 1J1BA 3D7ZA 3CS9A 3GENA 3QTSA 3FBVA 3GVUA 4CMTA 3W2SA 3O7LD 3W55A 1FVTA 1VJYA 4XX9A 1GAGA 2WHBA 4N6ZA 1ZWSA 3OOGA 4XHKB 3BV2A 4BWXA 2IG7A 3KQ7A 2ETMA 5C8MA 3DU8A 2OZAA 3ORXA 2ITNA 2YDIA 5AR8A 4F7SA 1P5EA 2C6KA 2JLDA 2R9SA 3DQWA 3ORLA 5HO7A 4XCUA 3GCVA 2OJIA 2YCFA 4FKRA 4GL9A 4PDOA 4IJPA 2QODA 3MV5A 3BYOA 4HNIA 3ET7A 1WAKA 3OS3A 4WD5A 5C8NA 3CD3A 3ORIA 5KMIA 5IQEA 1J3HA 5FM2A 2ZAZA 4LOOA 4MF1A 3ZLYA 1CDKA 3MFTA 4Y73A 4LGGA 2J0JA 2P2HA 2QO9A 4DFBA 4JR7A 4YBJA 4DITA 4NJDA 4E4XA 3ZLSA 3DLSA 2CLQA 3KKVA 4IM3A 3W2PA 3RAIA 5CAOA 3M11A 4LI5A 3PA5A 3QX4A 4O2ZA 4CFNA 3G9LX 4MEDA 3KN5A 3NYNA 4RJ7A 2VNYA 4A07A 3E7VA 4EOKA 4FZDB 3DJ7A 2HZ4A 3GBZA 4EH5A 3OVVA 5HBJA 2X6EA 4D2TA 4O27B 3MB7A 4NKSA 1OKYA 1IG1A 4WUNA 3WF9A 3Q6UA 2BZIB 2FYSA 2QKWB 4GIHA 4JBVA 4AZEA 4FVQA 2C5XA 4U44A 2W1IA 3TJCA 3COMA 4RGJA 5K9IA 3RVGA 2QONA 3ODYX 4K11A 4BDDA 3FMHA 2UZTA 2YDKA 1R78A 1FGKA 1ZYJA 4LUEA 1H0WA 2PUIA 2GU8A 3BE2A 3BGQA 3PVGA 3ZEPA 4QPMA 3EQDA 4EK4A 2QOHA 5AP5A 3WZKA 2QU6A 2W1ZA 3QXPA 3Q4TA 5A4LA 4CRLA 3BQRA 1Q62A 2ITOA 2VX3A 3LZBA 2W0JA 3ZONA 4F63A 3CY3A 3KMUA 2W99B 5AA8A 2WTJA 3RZBA 2CSNA 5LCKA 4BDCA 4DTKA 2PL0A 3I6WA 4EZ7A 3GB2A 5AV1A 3E63A 5DEWA 1UU9A 2IVTA 3GCSA 4PNIA 4WBOA 4YLJA 5TE0A 5CASA 2VNWA 4FTLA 1L3RE 1ATPE 1B39A 4O7NA 4XG3A 4FSZA 4JDKA 4AE9A 2FVDA 3GU6A 4QQTA 3WYYA 3THBA 5BUJA 4J96A 2VTMA 5HG7A 3SXRA 3FZSA 5J1VA 3DB6A 3AT3A 2V55A 1J1CA 2W5HA 2I40A 1RQQA 4QYFA 5TO8A 5BUEA 3DOGA 3EKNA 5HD4A 3FMLA 5M56A 4BF2A 1UU8A 2XIRA 4GH2A 4QMVA 5BVOA 2XNEA 5D11A 1G8SA 2X81A 4ZZMA 3JR1A 1ZMWA 2JGZA 5FEDA 4G6OA 1KE6A 3ZLWA 2PMLX 5ANDA 3UVRA 5A4CA 5M4UA 4NU1A 4AZWA 5K4JA 2UZUE 5E9EA 5ITAA 2XB7A 4DGNA 2QD9A 3QBNA 1KWPA 3MFRA 4L8MA 3L9NA 4G5PA 5LVNA 1OECA 2C1AA 4ACCA 5A6OA 3NMUF 4S2ZA 3B8RA 3KN6A 3FLWA 3UOHA 1BI7A 2QKRA 4JXFA 3KK8A 4NM7A 3WOWA 1JSTA 4PL5A 3TV6A 2BHHA 2CHLA 3GCUA 1RW8A 4JR3A 4W9XA 3SG9A 4FNXA 4UMPA 4E1ZA 3MFSA 4FG8A 3HL7A 4TYHB 3EYGA 4UZDA 1YDTE 4JVGA 3F3WA 4L00A 3AGLA 5AP6A 5LQFA 3ENHA 4HGSA 2DUVA 3AMBA 3F5UA 3FV8A 3QRKA 5EFQA 1QPCA 4PQNA 4A9YA 2UZBA 2BFXA 4J1RA 3L8VA 4E6AA 4X6RA 2YAKA 4TN6A 2DS1A 3EQRA 3JPVA 2FSLX 5C26A 2Y4PA 4QP1A 4O81A 3HUBA 3EQFA 4BKJA 1R39A 4CQEA 4D2RA 4KNBA 4NH1A 4WG5A 1ZXEA 5C1QB 4R7BA 3KRXA 4FIJA 4PX6A 3N4TA 2NPQA 4HVGA 4O0WA 5E8YA 4YJUA 4FT7A 5F20A 4YNOA 2A2AA 3UGCA 1LPUA 1OITA 5ETCA 3O71A 3CGOA 4IB1A 4M84A 4AA4A 2OIBA 2B4SB 2OLCA 2VUWA 5FP5A 4FICA 4FMQA 4WHZA 3RPRA 3E7OA 4TNBA 4ANLA 3LFNA 4RVTA 4BKYA 4EH8A 4XYFA 4TWOA 4RFYA 1OIUA 5A14A 2EVAA 2JDTA 4ZY6A 4G16A 3OCTA 2C3KA 2BAQA 3QUPA 1U4DA 5A3XA 5IUIA 4KKGA 2UW0A 4E4NA 3UYSA 3ZU7A 4F0GA 4HYSA 3AQVA 1B6CB 2OXXA 5DRDA 2XK6A 5J5SA 1JNKA 3GGFA 4CZUA 3M42A 5BVNA 5I0BA 4K8AA 4F6SA 4N4SA 2IWIA 3VIDA 4FKPA 1ZYDA 5BQ0A 4IEBA 4ZTRA 5CEQA 1U5QA 5B2LA 3R8VA 4XV1A 4DEHA 2PZ5A 5KBRA 3EWHA 5HBEA 5I3RA 1H8FA 2C4GA 2JD5A 3H0ZA 4PPCA 4ZS0A 5DYJA 2YIXA 4ZP5A 1PY5A 4IZAA 3QU0A 1F3MC 3HRBA 4WBBB 5ANJA 3Q9XA 2PK9A 3P78A 4DEBA 3KMWA 2QNJA 4BGQA 4MH7A 2V7OA 3NVKI 4FTJA 2Q83A 4QMXA 2CGUA 2FUMA 1GZOA 4IZ7A 3PWYA 3AD5A 4FIFA 4UXLA 5JKGA 4FVPA 1G8AA 4LL5A 3MH2A 2ZJWA 2E2BA 4MXOA 4DE4A 3KRLA 4M0ZA 2GQGA 4LMUA 4FTNA 3LPBA 4G9RA 3NUXA 2WTVA 2C6OA 4EOOA 3V3VA 2JKOA 3D7TB 2WAJA 3U87A 1JQHA 2GSFA 4CFWA 4E6DA 4Q5EA 3SGCA 5DR6A 4UALA 3LVPA 5GJDA 3VS6A 5AP1A 2WQBA 5L6PA 4K0YA 3SXSA 2O8YA 2VZ6A 3BIZA 4FL1A 4MAOA 1CTPE 3EL8A 4U41A 4C3FA 1M2RA 2FA2A 4R3CA 2EWAA 4W9WA 5HG5A 3MB6A 4M66A 3A7FA 3TXOA 2VN9A 3UNJA 5JGDA 3QZHA 4E20A 5DLSA 2QOCA 3KCKA 2PSQA 3UQFA 4HGLA 2BUJA 4D0WA 4AQCA 2SRCA 2PVNA 3HV5A 4FEUA 2OI4X 4DTBA 3CTHA 4MD7E 4L3LA 4ZSEA 3RINA 2W9FB 3VBYA 2VTIA 2OH4A 1AQ1A 4R6VA 4X0MA 1WVYA 4XS2A 5D7AA 3PG3A 2PPQA 2VTQA 4TKSA 4XP0A 3ZFMA 4BGHA 4WKQA 3QQHA 2ETRA 1QMZA 4YJSA 5FXRA 3MA3A 3IOPA 2CNVA 2GQSA 2ITTA 1PXMA 3FMEA 4I3ZA 5A4TA 4F9WA 4RRVA 4A4OA 3FHIA 5C27A 3DQXA 3PY3A 3RM7A 2R7BA 2OBJA 3IW7A 2FH9A 3PIZA 2C5YA 3PRFA 3R1YA 4FOCA 3E3PA 2WB8A 4MXAA 4XMOA 1A9UA 3W10A 5JMSA 4XG8A 5M53A 1PXJA 4F4PA 3GU4A 4Z9LA 2W1FA 3ZSHA 2XK8A 5E91A 2RG5A 3UDBA 3UG2A 4MYGA 2R7IA 1J7UA 3QTXA 2YJSA 1H24A 1Q8UA 4W4VA 4MNEA 4CKJA 2YM8A 3ORTA 4C2VA 5ANKA 4TWCA 4F9YA 3BBWA 4WSQA 4XBRA 5AM6A 3VRYA 4D2SA 4G17A 4BL1A 2X2MA 4HNFA 2ACXA 3SLSA 4EQMA 3NNVA 4GKIA 4NUSA 4A9TA 3UIBA 1GZ8A 3R7OA 3TNWA 2Z02A 4ZLOA 4AW1A 4UEUA 3Q60A 3FXXA 2P3GX 4B0GA 4CZTA 3MPTA 3PXZA 3FMKA 5D41A 5IH6A 2BCJA 5BX0A 5I5ZA 4OTPA 2WELA 2VWIA 1M7QA 4UWBA 3WILA 3PY1A 2OJJA 5KHWA 1TVOA 3NEWA 3EN7A 3DBDA 4XG2A 4RVMA 1YHSA 2PE0A 3IONA 3R1QA 3BELA 3FZ1A 3MTLA 4DG3E 2Y8OA 2NP8A 4BIBA 1O9UA 4YHFA 4O86A 4FV2A 3SDJA 3ZMMA 4R8QA 3TNHA 4A4XA 3R63A 4OR5A 3RKBA 4FKSA 4ASZA 3AT2A 2IW9A 4YJRA 3ZYAA 3QRJA 3QD2B 2JITA 1YXSA 4QP3A 3HGKA 4R1YA 5ANIA 2Y4IC 2GNIA 3MS9A 3FE3A 3R2BA 5TR6A 3V6RA 2BHEA 2YM5A 3NNWA 5C01A 2QG7A 4BGGA 3NUYA 3GU5A 3ROCA 4F7NA 1M14A 3ZRLA 3KCFA 2HENA 4BDAA 3N4UA 4CTBA 3EOCA 3CQUA 4NEUA 3FDNA 2RFEA 3Q6WA 4BCPA 3R0TA 3HV7A 4QTDA 2PVHA 2IO6A 3EFWA 3QQJA 2R3HA 2CKOA 1H00A 3W8LA 4RPVA 4USDA 4ZLZA 4GIIA 4CVAA 4NM0A 3FC1X 5J1WA 2VWWA 3I5ZA 2H8HA 3KXZA 5AV0A 3IK3A 3PPZA 2JFLA 2XNMA 3EQBA 3F3TA 4KAOA 3C4EA 4YC8A 4QYEA 2A1AB 5KMKA 4IADA 3ATTA 3F2AA 1YOLA 1I44A 4O7RA 3PJ1A 2B1PA 4U3YA 3VBTA 3EQPA 4K6ZA 2BPMA 2PZRA 2XNGA 4NM5A 3RWPA 4QP8A 2JDVA 5JFXA 4CYIA 4YJNA 2XNPA 5JSMA 3DDQA 3QGWA 3MA6A 3FQEA 1WBWA 2GPHA 4C4JA 3GC8A 3ZO4A 2HXLA 4B99A 4HVSA 4JBOA 4L01A 3U51A 5HICA 5L4QA 3GXLA 4GJ2A 3R83A 4L9IA 3DBQA 4QMNA 2BKKA 3MWUA 2ZV2A 4XJ0A 2R3NA 4OUCA 2CKEA 3H9FA 3OG7A 4DT9A 2Y6OA 2GFCA 5HCYA 3S4QA 2V5QA 2H6DA 2AYPA 4FZ6A 4JOAA 5DHJA 4DEAA 3TN8A 4FEXA 2PVRA 4Y85A 4NW5A 1PXPA 3FC2A 4H58A 3UE4A 4F6WA 4I1ZA 2HIWA 1V0OA 4LOPA 2KTYA 4G5JA 1AGWA 5JK3A 2X1NA 3LJ0A 5JQ8A 4FV3A 2X7GA 4B6LA 2UVYA 2WTDA 3RCJA 1J7IA 3G0FA 3QRTA 1WMKA 3OT3A 4HCUA 3HUCA 4FF8A 4IVDA 5DA3A 5HO8A 3SV0A 4EH9A 4EK3A 2OFUA 3DNEA 1IRKA 3ID6C 2BAJA 4FL3A 5EDQA 1Z9XA 2HWPA 4U81A 2B9HA 4YTIA 4Y5HA 5H9BA 3SVVA 3N9XA 4FKQA 3PXQA 4NM3A 3T3VA 4BYJA 5CT7A 2QVSE 4BN1A 2UVZA 2F2UA 3BE9A 5B0XA 4A4LA 2OKRA 2I0YA 4ZSGA 4PDPA 2EU9A 3BRBA 3QC9A 5H8BA 4ACMA 5HZNA 2GNGA 3E64A 4NCTC 1GZNA 5CXZA 2WU7A 3OBGA 4YGAA 2C6EA 5BMSA 1YHVA 4OTDA 2B53A 3COHA 1NW1A 4U40A 3KRJA 3PIYA 4NTTA 3ELJA 4MXCA 4EOJA 3R2YA 1CMKE 3I1AA 4WG3A 4C0TA 2YM3A 2XBAA 2J2IB 1UKIA 1MRYA 4MBLA 3WIGA 4EOPA 2RF9A 5EQYA 3H9OA 3P79A 3LXKA 2IPXA 5BYLA 4RWKA 2WMBA 3QD4A 3MIYA 2YEXA 1MRVA 2BILB 4C4GA 1K3AA 2UZWE 1IEPA 3T9IA 2BRNA 5EW9A 4GU9A 4FTCA 4EWHA 4YHJA 3BLQA 3A4OX 3TUCA 1KOAA 2C6MA 2HXQA 3OWLA 1V1KA 4FEQA 4JQ8A 5CXHA 5D9HA 4QPAA 2OXYA 4ANBA 5KNJA 4MXYA 2PVMA 3CTQA 2E9OA 3QQFA 4QMOA 3CPCA 3D0EA 4YC3A 5CQWA 5HESA 3SD0A 3ZXTA 1W7HA 1OKWA 2VAGA 4LV8A 4ZJIA 5DT4A 5AAFA 3V51A 5BVWA 3S1HA 3HAMA 2V22A 3BHTA 4J99A 4YTHA 4CCUA 3U54A 4GSBA 4ZTQA 5CLPA 1Y6AA 3R7GA 4FZFB 3VBQA 2XS0A 3VF8A 1EH4A 3A7GA 3BLRA 4KUJA 2CGWA 4CLIA 5BNJA 3CQWA 2VO0A 2J4ZA 5KMJA 4LFIA 4U7ZA 3DNDA 5AADA 4O0RA 3DJ6A 3KFAA 3QUDA 5EM7A 3EQCA 3F61A 4KIQA 4QP4A 4XLVA 4LGHA 1G5SA 5FG8A 3F9NA 4DFZE 3VVHA 3TWJA 3NW7A 2WQNA 5I3OA 2WOTA 5CU2A 4MX9A 2VTSA 3G6GA 1PMVA 3F3ZA 1H1PA 3UQGA 3NCGA 4XP2A 3P7AA 4EBVA 3BHHA 3QD3A 2C3IB 3DTCA 3JVRA 3PVBA 4H36A 4Z55A 1IA8A 5EQPA 4JAJA 3DB8A 4BDFA 4QP7A 4UMRA 2IW8A 3DA6A 4TYIA 4KIKB 5DPVA 1LEWA 3Q32A 4AT5A 2OFVA 2XIKA 3FSKA 4UY9A 4MWIA 5HG9A 5AIKA 4KWPA 1PYXA 3WI6A 4Z7HA 3EN5A 3NGAA 5L2SA 2EXCX 2P0CA 2GNLA 3DS6A 4BCIA 3R7YA 5C9CA 4FTIA 4EH3A 5HVKA 3L8SA 4E3CA 4EH6A 4LOQA 4AU8A 4Y72A 3IOKA 4I5CA 3UMXA 2R3GA 2HK5A 5TF9A 5FD2A 5CAPA 4DFUA 3NUSA 4KKEA 5E1EA 2C68A 3NW5A 3DZOA 1H4LA 4RZVA 5AFVA 4EOMA 5FM3A 4XP3A 2XYNA 4FIGA 3IPHA 5CEMA 3Q96A 5IA0A 3GU7A 4D2PA 2ITUA 1ZAOA 3H0YA 4O1PA 2CJMA 1F5QA 2KULA 1YVJA 3A2CA 4BWKA 2BRGA 4MKCA 2A4LA 3SRVB 5CAVA 5CF4A 3COKA 3PE2A 2BRBA 4DF3A 2OJGA 4RLLA 4OTFA 3U9CA 1WBNA 4CT1A 4CV9A 5JQ5A 5AUZA 5EM8A 2Z60A 1E1XA 2QI8A 5EM6A 3F7WA 2WOUA 3DFCB 5DOSA 4E6QA 4WNMA 3ERKA 5HIBA 2WMUA 4CFVA 3IECA 3C0IA 4F09A 3OW4A 5DH3A 2RIOA 2H34A 4XG4A 4IDVA 4YNEA 2XK9A 3CTJA 4M69B 3NWWA 2OIQA 2UUEA 3F69A 4K33A 3CC6A 3FMMA 3D4QA 4FIHA 3HKOA 4FOBA 1UVRA 4NIFB 5K0KA 5IMXA 3II5A 3BX5A 5CT0A 5EH0A 1UWHA 2OJ9A 3D5WA 3PXKA 1MQ4A 4P4CA 1OZ1A 1ZRZA 2X8IA 3SX9A 4DFNA 4ID7A 4PP9A 4H3BA 4V05A 4W4XA 3Q9WA 2CGVA 5HKMA 4ITHA 2E9VA 3NAYA 4HVIA 2VV9A 2WGJA 2I0EA 3Q4UA 1T45A 3GQIA 3LFSA 4O6LA 4FIIA 5IEYA 4Q2AA 5LVOA 1F0QA 3LMIA 4DBXA 2GS2A 3KULA 3Q2MA 1UV5A 1A48A 4O22A 4TT7A 4BIDA 4PNKA 3NCZA 2VWXA 3UBDA 1OVEA 4A9RA 4DAWA 2R0UA 3T9TA 3TKIA 3MJ2A 4EZ3A 4FUYA 2WMWA 3ZZEA 4AGWA 2F7XE 2XRWA 4NTSA 3V5WA 4ANMA 2PMNX 2YHVA 1CKIA 4QP2A 3QTWA 4RMZA 3WE4A 2X0GA 3R02A 4Y95A 5L2QA 4ARKA 4L3JA 4YSJA 5I4NA 4ZJJA 4RQKA 3DK7A 2JIVA 2WKMA 4L42A 3V8SA 2RSVA 1PKDA 3TIZA 4UMQA 4R5SA 3TV7A 4IAZA 5HU3A 3LQ5A 4ZOGA 4JG8A 2UW8A 3O7LB 3LFAA 4HYHA 1M2PA 2ZB0A 1KE9A 3PY0A 5T68A 5EI8A 4C35A 2PVLA 2NRYA 3BBTB 3D15A 2BDWA 3HZTA 3Q4CA 4MWHA 3U9NA 3UP2A 3JY0A 3OWPA 4FEVA 5JRSA 4GYIA 4PUZA 2GMXA 3O17A 5K5NA 2XKDA 2HZIA 3BEGA 2XK7A 3VN9A 3R1SA 4J52A 4JQEA 2C0TA 4M3QA 3R9OA 3A62A 4NWMA 3OBJA 3O50A 3TM0A 3DKGA 3UODA 3I81A 4XH6A 1Q8TA 2BDJA 1WFCA 2X7OA 3V5LA 4C02A 3K2LA 3PTGA 5LMKC 5E1SA 5BYZA 4CFFA 4P90A 1YI6A 3PJ3A 2GTMA 5DI1A 2QOFA 3R7IA 4RX9A 5ICPA 4I21A 3LFCA 3PP1A 5CSPA 3R8PA 4C37A 4A9UA 4RJ6A 4CXAA 2F4JA 1R0PA 5L6OA 3CEKA 1OL2A 4YPSA 5AX9A 3VUKA 3BCEA 5L2TA 2PWLA 2BRMA 3PUPA 4ZS4A 3IW6A 4U3ZA 4A06A 5AV3A 3FKOA 4AOTA 3EQGA 1BKXA 3KB7A 5HTIA 3ANQA 4QQCA 4U42A 4DG0E 4NFNA 2QU5A 2XCHA 5LCJA 5EHOA 3NUPA 4QMMA 2YERA 2JBPA 3WZUA 3ATSA 3CLYA 3LIJA 4DCAA 3UIXA 5DT0A 4JLCA 3OP5A 3HNGA 5FDXA 3ZEWA 5JT2A 3Q9ZA 2YLEA 4I5MA 4EUUA 2ITYA 4PMSA 4KRDA 4FSYA 3EL7A 4DLIA 4QQJA 2VTJA 2QHNA 2YWPA 2R0IA 3RMFA 5E90A 5I9ZA 1FGIA 3MFUA 2OXDA 1ZY5A 3FEGA 3EYHA 3RWQA 2G9XA 5CQUA 5EM5A 5CAQA 3OHTA 4C2WA 4BZDA 2YACA 1T46A 4OBQA 3P23A 3BI6A 1I09A 5HCXA 4M0YA 3RBWA 3R9RA 5FQDC 4I0SA 3R7VA 5IG1A 3HMNA 4I93A 3KXGA 4ZEGA 3FKLA 2F2CB 3G51A 5T6KA 5LXMA 3RM6A 5HCZA 1XJDA 1PF8A 4AA0A 3MVMA 5ETFA 2UZOA 1HCLA 4M68A 3ZBFA 2ZV9A 4AGUA 3L9LA 2QOLA 3OW3A 4FT9A 5I9YA 4MVFA 1IR3A 5KBQA 3BHUA 3UO5A 3DXNA 3G0EA 3F82A 5I9WA 4BCJA 5KMMA 1OL1A 2PVJA 5E8XA 5CZHA 2GTNA 4IAKA 3S2PA 1XHAA 3FLSA 5E8ZA 4RC2A 4F99A 3UNZA 5KKRB 2CPKE 2UV2A 3DKFA 2QOKA 2QLUA 3H4JA 5F1ZA 5E8UA 3QYZA 1PXIA 3V5JA 4YO6A 5TOZA 4BC6A 3UZRA 4FODA 3TUBA 1FINA 1H1SA 5LWMA 4HPUE 2PUNA 2VD5A 3ORNA 3FJQE 4IC8A 3C7QA 4J97A 2UZDA 4FTMA 2G2IA 3E92A 3DKCA 2RG6A 5JZJA 5HBHA 4UMUA 4IVCA 2VTRA 4ZSJA 5F94A 1OBDA 1SYKA 3MPAA 4OTGA 4GU6A 4DH3A 5FUTA 2OJFE 4FKOA 5BMMA 5HQ0A 3OEZA 1Q4LA 5ETIA 4NL0A 2UW3A 3KXHA 2X7FA 5AMNA 1YOJA 3DTWA 5DR2A 3CP9A 2VGPA 3HA6A 5H8EA 3KXNA 4JX7A 4RIYA 2GHGA 3EZRA 4D28A 2CCHA 4K2RA 3VBVA 1DI9A 4YPDA 5EDPA 5GZAA 2G2HA 4CQGA 1UKHA 1PHKA 1YWVA 3O51A 3OCBA 4IFCA 4X21A 2XYUA 1YDRE 3FZTA 1QPDA 4HZRA 4D4VA 5LVMA 5M06A 1W8CA 1X8BA 4J95A 3NR9A 1JKLA 3DFAA 4JS8A 3VHEA 1ERKA 1IASA 3ANRA 4ZAUA 2DQ7X 4FZAB 4QD6A 4I5PA 4U80A 2WTKC 4YP8A 4FK3A 3HV3A 4AN3A 3PDTA 2J0MB 2ITXA 5IQCA 3MY0A 3A60A 4O84A 1XH4A 3F66A 3Q52A 3PP0A 2XIXA 1SNUA 4G3FA 2OZAB 3PLSA 5K5XA 2NNWB 5D1JA 4OAUC 1A06A 5DG5A 5GNKA 4RWIA 4I92A 3TT0A 2XM9A 4KKHA 3DY7A 4BCHA 4FYNA 2VWVA 4QMUA 3EFKA 4GKHA 1JPAA 2IVVA 2B9FA 3R8LA 1NY3A 3KVWA 4OTHA 4TWPA 4ACHA 4BWPA 1ZYSA 2UW7A 5FRIA 4X6QC 5IDPA 3C4WA 4B4LA 4K77A 4YTFA 4FTOA 3R71A 1W84A 3KC3A 3PJCA 5GINE 4OT5A 5GJFA 4AT3A 3DXQA 4P5ZA 2FSTX 1Q8ZA 4IVAA 4EH7A 4OTIA 5IISA 4RJ5A 3U6IA 4WOVA 4O0UA 3F2RA 5FGKA 4RIWA 1H25A 2VWYA 5HIDA 1TQPA 3QKMA 5CVHA 4O0SA 5JFSA 3SW4A 4BDGA 3F5XA 2JKKA 3E62A 3BZ3A 3HRFA 2IZUA 3A61A 4GG7A 4H1MA 3VUHA 4CFMA 5KHXA 4F64A 2C3LA 2CGXA 4RX7A 4QO9A 2I7QA 1WZYA 3LMGA 5FTQA 4Y46A 4RSSA 3LLAA 4YC6A 3R9HA 5IQAA 1Z57A 4FKJA 4BTFA 3F3VA 3PIXA 4I24A 2XA4A 2ZYBA 3MVJA 4IX3A 4C4HA 1E9HA 1DM2A 1PMNA 1BLXA 4AWIA 4TZRA 4WA9A 4BDEA 2GHLA 3S0OA 1U54A 3KF4A 4GYGA 3W16A 5KUPA 4KINA 1UA2A 4Q9SA 4V0GA 4FSTA 5HOAA 5J9ZA 1REKA 4RFZA 5CANA 4AOIA 4PDYA 5C4LA 3ORZA 3QLGA 5CWZA 4RA5A 4YJTA 3LQ8A 4BCQA 5IA2A 1BI8A 3KK9A 2P55A 3A7HA 3UZTA 1TKIA 1PXNA 5H8GA 3LFBA 3LCTA 3UTOA 3VW6A 3EN9A 3NIEA 4QPSA 2ETKA 4E5AX 3FMDA 3WBLA 5CU0A 4P5QA 1KV1A 1P14A 4LGDA 3RAHA 4X7QA 4LYNA 1OBGA 3W2OA 1YDSE 3V5PA 3MN3A 3G33A 2R2PA 2RKUA 2I0HA 2Z7SA 3D2IA 3LCOA 3NNUA 3RPOA 3HMIA 4OW8A 2C1BA 5EW3A 3VJOA 2HCKA 3LKMA 4TYEA 4W8DA 3FQHA 3LW0A 4I4EA 4IW0A 4U43A 5BPYA 1Z5MA 3R8ZA 2YISA 5H2UA 5HI2A 5DN3A 2QR8A 3AT4A 4D0XA 1WVXA 2QOQA 1IAJA 4OTQA 2XP2A 4IXPA 2QQ7A 3Q3BA 4QMWA 3C4XA 3HV4A 2XJ1A 3OZ6A 1VYZA 1ZARA 5EK7A 5CALA 5JZNA 1XO2B 5KZ0A 2VWUA 4FK6A 4Q5HA 3PJ8A 5K3YA 5FEQA 3WF8A 3QKLA 3CY2A 1OL6A 4QYYA 3QGYA 3I79A 4QMLA 2C5OA 2JFMA 4I6HA 4II5A 4X3JA 4FV9A 4J8NA 4L46A 4O96A 3UO6A 3TKHA 2J5EA 2J50A 3HA8A 3OFMA 2VO7A 1K9AA 2OGVA 4YBKA 4BHNA 1XH5A 3LLTA 2J7TA 5CENA 1R0EA 2B55A 2I0VA 3QTRA 3CJGA 3SOAA 1VZOA 3W8QA 3H3CA 4EOLA 3RI1A 4AX8A 4EHGA 4BCGA 4EHVA 2WQMA 3K5VA 3D14A 3ZXZA 1HOWA 3ZFYA 3QZIA 2CLXA 3W2RA 3ZBXA 1LEZA 2UZEA 2XMYA 2ZM3A 4UYNA 3MH1A 2Z8CA 4ERKA 4PY1A 3VS7A 4C36A 4KBCA 3ORPA 2G01A 4IFGA 5AP2A 2CNUA 4MHAA 5AUXA 4AGDA 4ZTMA 3R28A 4FSUA 3TL8A 4Z3VA 3GU8A 4ZTLA 4V01A 2B0QA 2VWBA 4I20A 3ALOA 3BWFA 4Y8DA 4D9TA 3F2NA 1ZY4A 2XF0A 5HG8A 2UW9A 4ITIA 1KE5A 2W96B 3F5GA 4EHEA 3TZMA 5IH4A 1DI8A 2W4JA 1V0PA 3OWJA 3ULZA 1JVPP 4RG0A 4CMUA 5KMNA 3R7EA 2XK4A 3ZSIA 3FL5A 3O2MA 1ZMUA 4FKIA 2VRXA 4FNYA 2BZKB 4C4IA 4FTQA 4O82A 3FMJA 2REIA 3GFEA 3NYVA 4EORA 3QKKA 4UWCA 4WG4A 3QWKA 4ZZNA 1QPEA 5AA9A 1ZYLA 3S3IA 1S9IA 4FR4A 1S9JA 1MRUA 3TNPC 2J6MA 2ZM1A 5GZ9A 3VS5A 4JBPA 2BR1A 4KBKA 4LL0A 3FI4A 5CTPA 4FNWA 3HEGA 2RL5A 3OTVA 2UW6A 4RC3A 2PZIA 1LP4A 4FT3A 4BDJA 5IQDA 4BZOA 1WBPA 1SM2A 2AUHA 3BLHA 4Y5QA 4IAYA 5IEVA 4GUEA 1NA7A 2FSMX 4EOSA 4X3FC 4O83A 4PPBA 3W33A 4IAIA 4HVDA 4RWLA 4JNWA 5EI6A 4ALWA 4HGEA 5FDPA 3FYJX 5L2IA 1UU7A 5HVYA 5E4HA 4XRJA 4AGCA
chains in the Genus database with same CATH superfamily
1W2CA 2XBJA 3E87A 3FLQA 2PZPA 4KIPA 5IDNA 1Y91A 3ITZA 4L45A 5AR2A 3U4WA 4AT5A 3CR0A 3UC3A 4LG4A 2JIUA 4RT7A 2QOBA 1PXLA 3VUIA 3QC4A 3NNXA 3Q9YA 4EQCA 3CD8A 1PYEA 4O1OA 5D12A 5J9LA 1SVGA 4EYMA 3PZEA 3D5VA 1JBPE 4BHZA 1R1WA 3C50A 3SXFA 2OW3A 2C47A 3QF9A 1VR2A 1IA9A 4ENYA 3SW7A 3VRZA 1W83A 4UV0A 1R3CA 1FVVA 5EW8A 5CU4A 5E8VA 3CE3A 3OOMA 4IWPA 4YZNA 4ERWA 4F70A 4MCVA 4HCVA 1HCKA 2HY81 4CTCA 4FKUA 4LM5A 1YXVA 2PVKA 3OCGA 2PYWA 3P7CA 4RBLA 1M17A 3G6HA 1MUOA 2PUUA 3FI2A 3DZQA 3QX2A 3DAKA 4APPA 4L7FA 1Q41A 1SVEA 1XH8A 2XH5A 3UDTA 3RHXA 3VS1A 4YJOA 3GC0A 1PW2A 4RWJA 3TDWA 4RX8A 4MQ2A 4CKRA 4GFOA 1JKKA 4QMPA 4I6BA 2OF4A 2P33A 2R3RA 4TWNA 3P9JA 4IB3A 4QYHA 4D9UA 1CKPA 4F1OA 1IAHA 2HZNA 4APCA 4BDKA 3PWDA 1FPUA 3S95A 2WU6A 2XJ0A 4YJVA 1H27A 2OO8X 4X2GA 2OU7A 5E92A 5DGZA 5FP6A 4W8EA 5CZIA 4HVHA 1KE8A 4AACA 4C59A 2XNBA 3C4ZA 4QEBA 5KE0A 4IACA 4BKZA 4EK6A 4FSQA 4ZSAA 2J0KA 3MVHA 4CKIA 5AX3A 1E1VA 4FSMA 3ZFXA 4RIOA 4X2KA 1OB3A 1Q8YA 4FTRA 1JAMA 5JRQA 2W1CA 4OBPA 3UIUA 5GJGA 3IQ7A 4GFGA 1XR1A 1L8TA 4DH7A 3NDMA 5F4NA 3N4VA 1Q97A 3QXOA 5J8IA 3GEQA 3R30A 5LARA 2WPAA 1XQZA 2BAKA 4R3PA 4XV3A 2VO3A 5LJJA 5B2KA 4BDIA 3SA0A 2O64A 2R4BA 1DS5A 2UZVA 3BWJA 4PTGA 3FPQA 4BI0A 4H39A 3SHEA 4BZNA 2YWVA 4D1XA 4MNEB 3NAXA 1Q99A 2ITWA 4G1WA 4BCNA 4BTMA 3CXWA 3TJDA 5AP0A 2QG5A 4CNHA 2IJMA 3BPRA 1YQJA 5LMBA 4BRXA 2PMIA 4OTWA 4F0FA 4IZ5A 4CFXA 5KKRC 4G34A 3RPSA 5L3AA 4BDBA 1YHWA 3KRWA 3LCSA 2YM7A 3AXWA 4USEA 3C1XA 4X3FA 3WE8A 4JL9A 3QD0A 5FWKK 3OUKA 3Q5ZA 4FV4A 3RK5A 2G2FA 4C62A 2RFDA 3TI1A 4FKGA 3W0NA 5IZFA 4L6QA 4G6NA 2ONLC 4JRVA 4O0YA 4GUBA 2PY3A 3DPKA 5L8JA 1REJA 2AEGA 4O7LA 3ETAA 4ZMEA 4EC8A 5HU9A 4BFMA 2W17A 4TPTA 3WZDA 4H3PA 3TV4A 3DK6A 1Q3WA 1SNXA 2P2IA 2W05A 2XIZA 3F88A 3OY3A 4HZSA 3DK3A 5CI6A 5LVLA 4BCFA 5FTGA 2GCDA 4K18A 4WO5A 5HNBA 4D4RA 1GIJA 5IA5A 3R73A 5EYMA 2VGOA 4EZ5A 3O0GA 1OIQA 2V62A 3POOA 3QCSA 4AT4A 4FJVA 4U97A 3BEAA 3IS5A 2WO6A 3E8NA 3ALNA 4UWYA 4PF4A 2J9MA 4NT4A 5IF1A 4AFEA 3ACJA 2RFSA 5AM7A 4NJ3A 3P0MA 4RFMA 5E8TA 1UWJA 2R3JA 3PXYA 2E9PA 2XIYA 4TXCA 3U4UA 4GVJA 2XM8A 5CSVA 2EXEA 5AUWA 2BZJA 3JVSA 5FEEA 1PRYA 3R01A 2W5BA 2QURA 2RGPA 2UW5A 5EOBA 3TCPA 1JKTA 4C4EA 3LAUA 2QC6A 4D5HA 4EH4A 4CG8A 4OLIA 2OG8A 1H1QA 4FSWA 1JWHA 1STCE 3HMPA 2W1DA 2X39A 4CD0A 4DG2E 4YMJA 1OM1A 4XEYA 1LR4A 2YIQA 4RX5A 4MXXA 4TNDA 1H1RA 4BB4A 4PP7A 1XH6A 4L53A 3PFQA 4ZIMA 1TQIA 2R3IA 4GS6A 1GY3A 2JBOA 5KZIA 5CS6A 4JG6A 2V0DA 5CX9A 4JAIA 4F78A 4I41A 3ZZWA 3OEFX 4FV0A 2A27A 3F3UA 3AC3A 4RA4A 4WUAA 3NYOA 2XARA 4AZTA 3D2KA 3NLBA 2PULA 2R3MA 3DAEA 3GUBA 2HYYA 2X9FA 2WEIA 1UNGA 1XH7A 2XKFA 3A8WA 4GRBA 4CSVA 3ZRMA 4F08A 4XOZA 5FXSA 2P4IA 3JYAA 3PVUA 4YTCA 4BDHA 3CSVA 3MPMA 4EEVA 4E93A 2ZVAA 2VU3A 1H1WA 4AZFA 3T8OA 4EJNA 3AKLA 2QO2A 3HECA 4NCTA 3O8UA 1WBTA 4YZ9A 2O0UA 5A9UA 1FMOE 3UO4A 5AIRA 3ZC5A 1H07A 1FMKA 1MP8A 4CEGA 1GZKA 4EONA 2YIYA 4DEEA 2GNHA 3MSSA 4DH5A 3H9RA 1OGYA 4Y83A 5EYKA 3FUPA 5GIOE 3V01A 3BYMA 3POZA 4IHPA 4YURA 3RTPA 1KV2A 1JLUE 4Z16A 2R5TA 1W82A 5EYCA 4TYJA 4QOXA 3O96A 4ORKA 3TZ8A 1NT2A 3QQUA 2Y6MA 2E9NA 4GVAA 4I94A 2BRHA 3VUGA 4IC7A 4IX4A 5IPJA 1LUFA 2CNQA 4N57A 4QTEA 3A4PA 5JN2A 2XZSA 3LOKA 4PPAA 3VUMA 2Y7JA 3C0GA 4NFMA 4TYGA 5EOLA 3LMHA 3H30A 3QZFA 3RAWA 3HVCA 2R3LA 4O4EA 4DEDA 2BTRA 2Y9QA 2QOIA 4P7EA 5DIAA 1Q3DA 4ZXTA 2C0IA 1V0BA 3CCNA 4GJ3A 4O4CA 2BFYA 2WTIA 2WEVA 4YZDA 2QO7A 2GNFA 3B2TA 3LXLA 3PJ2A 1DAWA 5CEKA 5JH6A 1SMHA 2XJ2A 5IMEA 3QWJA 4PL4A 3FAAA 4DDIA 3PPJA 3QCQA 2VWZA 2ZDTA 3BLAA 3MIAA 2I6LA 3LCKA 3TG1A 3BU3A 3TNIA 3NYXA 3T3UA 4PMPA 2ITQA 4U79A 2W1GA 5KX8A 2ONLA 4FT0A 2J5FA 3KIOC 3RJCA 1ZZ2A 3C5UA 4HGTA 5L8LA 3HDMA 2YZAA 5M4FA 4RJ4A 4DFXE 2VTOA 4GFMA 3MI9A 4PMMA 3I4BA 3AD6A 4IJ9A 4IIRA 4E7WA 3CIKA 3W0RA 2Y4IB 3R1NA 4DGMA 5TT7A 4FKWA 1BL7A 3BKBA 4C3RA 4EC9A 4L68A 3DJ5A 4G9CA 4W4WA 4BYIA 4WNOA 4YJPA 4PTEA 1M52A 2YITA 5A54A 3GQLA 4ZJVA 3I5NA 3Q53A 4XG9A 4F7LA 4IVBA 4U45A 2FSOX 5HTCA 3C13A 4RVKA 2OH0E 1XMLA 2XNOA 4G2FA 4IAAA 2LGCA 3ZO2A 2B7AA 4G3DA 2EUFB 2O65A 2VX1A 5FXQA 2IN6A 4FSNA 2PU8A 2W1EA 3VS3A 4IWQA 3R21A 3C4CA 3NIZA 4I22A 4ANSA 1M7NA 1FOTA 3QQKA 4BBFA 2XKCA 4DFYA 4ZY5A 4TL0A 5IQGA 5AR7A 4ACDA 1PXKA 1ZZLA 3WIKA 4Q9ZA 2DYLA 2WMVA 2OF2A 4CFUA 2UZNA 3EFLA 1XBCA 1QCFA 5M51A 3ZS5A 3ZLXA 1GNGA 5AUYA 4R77A 3VUDA 3DXPA 4X2NA 5M08A 1YWNA 2YM6A 1OPJA 2BZHB 3KGAA 3DKOA 4G3CA 2BROA 3WF7A 2YLFA 1U46A 3TUDA 3BU6A 2PE1A 3ULIA 5IQIA 4BCMA 4DEIA 1W98A 4FTKA 3G9NA 4XLIA 3V6SA 2JAVA 3BU5A 1SZMA 4HYUA 3PVWA 5DVRA 3HRCA 3RK7A 5A4QA 3UOLA 3MH3A 4CV8A 1XBAA 5C03A 4EQUA 3HMOA 4L52A 5HE2A 4FC0A 4JRNA 2ZOQA 3IG7A 4S34A 2ZV8A 5IA3A 3FY2A 2JDRA 5FLFA 1UNLA 3UMWA 2WQOA 3DBCA 3GI3A 1JKSA 2QOOA 5ANEA 4M14A 5FBNC 3W18A 4ZLYA 4CGAA 1Y8YA 4M67A 3RCDA 3ACKA 2ZFYA 3VC4A 4XUFA 4F65A 1J91A 5AEPA 5IH5A 3QHWA 4DEGA 5KMOA 3WYXA 3LHJA 3VF9A 4DHFA 5C8KA 3FQSA 3E8EA 1YXXA 3K5UA 3WF5A 4FKTA 2ESMA 3AC4A 1OPKA 5M09A 4MTAA 1WBOA 5HE3A 3UC4A 3LQ3A 5EYDA 4ONAA 3JUHA 4QDVA 5AAEA 4O0VA 5HLWA 3BYUA 2VTAA 4H1JA 4N6YA 5G6VA 4DFLA 5EHLA 2JEDA 4D4SA 2ZM4A 3SG8A 5IU2A 3QAME 3W0OA 4FG7A 4DH1A 4KD1A 4DBNA 5EI2A 4U5JA 2F7EE 3CKWA 4WT6A 4IWOA 4F0IA 2PHKA 3BV3A 1OL7A 2AC3A 4AN2A 4BVUA 4X2JA 5K0XA 4L7SA 3WF6A 4AN9A 3F6XA 2CCIA 2H96A 4QTAA 4U6RA 3V5TA 5CF8A 4D2VA 3JY9A 3MGYA 1G3NA 4BCOA 2F49A 5HO6A 5IKWA 5AAGA 3HP2A 3ML1A 3QCXA 3TZ9A 4BI1A 4BTKA 3QQGA 4KS8A 2X8DA 3FZPA 3I6UA 4TRLA 3Q4ZA 1O6LA 4F7JA 4J71A 3VBWA 2HW6A 3NW6A 4OT6A 4R5YA 3D7TA 3VUTA 5CEIA 2JAMA 2WIHA 3ZO3A 4F9BA 5M57A 1QPJA 3FPMA 5IQHA 1YXUA 4ZZOA 4FUXA 5KMLA 4AE6A 1BMKA 4PRJA 3UZPA 2ZB1A 4J98A 3VAPA 4AF3A 4AS0A 3P1AA 4QMSA 3BGZA 4FZ7A 3I7CA 3HAVA 3KULB 4PTCA 4QYGA 3ZSGA 3NFFB 5L8KA 4H05A 3LFEA 4E26A 4F1MA 3D5UA 2QCSA 5HTBA 5HIEA 3C5IA 2IZRA 4GCJA 2HW7A 3PG1A 3AC2A 3R22A 1OI9A 2WTWA 3B8QA 3W2CA 2VTPA 4LRKA 4EKLA 4EHZA 1FVRA 3MYGA 4PWNA 1Q61A 4M12A 3KMMA 5CVGA 5T3QA 4AUAA 5LMKA 1JOWB 5GHVA 1GOLA 3QALE 5J95A 1ZOGA 2ZDUA 1SVHA 3LCDA 3BHVA 3E5AA 4FSRA 3FXWA 3RP9A 5CAUA 5IEXA 1AD5A 2Z7QA 3UVPA 4FE2A 5IUHA 1Y6BA 4RQVA 3P5KA 4RJ8A 5D7VA 5DE2A 2WIPA 4FGRA 4EKKA 2CKPA 2YZLA 5A46A 2OSCA 3RZFA 2WMXA 3PZHA 3MH0A 4JI9A 3R00A 5HLNA 3KY2A 4RC4A 3EQHA 3AOXA 2F57A 4TW9A 4CLJA 2BKZA 4FX3A 5DWRA 3H10A 2XNNA 3FLYA 4QT1A 2AQXA 3IKAA 4AXDA 3BYVA 4YZCA 2R3OA 4NYEA 2UW4A 2I1MA 3ODZX 4M13A 5HORA 3UQCA 2GS7A 2JKMA 4RIXA 3EN6A 2GQRA 2WMQA 4U8ZA 5BUIA 4JBQA 4TY1A 2JC6A 2C6IA 5J5TA 1JSVA 3FZOA 3GC9A 5CSWA 3FI3A 4U0IA 5LVPA 4C58A 2WTCA 3B2WA 4MD8E 2PVFA 4O0XA 3WZEA 1H28A 3QLFA 5HHWA 4AZSA 3AGMA 3ZH8A 3NX8A 4NK9A 4YO4A 1W0XC 3F7ZA 3TTIA 1XWSA 4FL2A 2EB3A 3FMNA 3VO3A 4LUDA 2DWBA 3ZOSA 4O7SA 5DR9A 3QYWA 2EB2A 3IW8A 5JFWA 3G5DA 5K4IA 4R3RA 3RGFA 1BUHA 5L2WA 2PVYA 4OTRA 2WQEA 3ZM9A 3VJNA 4ZY4A 4E6CA 3NSZA 3ZUUA 4UX9A 2XKEA 3AD4A 3IW5A 1GIHA 4OAVB 4ZMFA 4USFA 3W2QA 2BIYA 4EYJA 3DAJA 2ITPA 4DGOA 2X4FA 3C51A 4KB8A 4QQ5A 3GCQA 4F1TA 5B7VA 2EXMA 3Q5IA 4L43A 3PA4A 3GOKA 4FKLA 3OMVA 5AUUA 3LFFA 3LM0A 1URCA 1YW2A 2XEYA 4F9AA 4BI2A 3EMGA 4YR8A 3FL4A 3QRUA 4O6EA 5DBXA 3UP7A 4BCKA 4E73A 5DNRA 2CN8A 3FYKX 3UYTA 3O23A 3DLZA 4FV8A 4FNZA 2J0LA 1YI3A 4J8MA 1OL5A 3NUAA 2YIWA 4EWQA 3UPZA 2PE2A 2WNTA 2CKQA 2C6TA 4FT5A 4O7WA 5HE1A 3BGPA 3PSDA 5IQBA 3R9NA 4E8AA 3QHRA 4FKVA 3IO7A 5AR5A 4GW8A 1OUKA 2C5VA 3AC1A 3LE6A 1P2AA 3W1FA 1ZOEA 4TTHB 3MTFA 4N0SA 4HCTA 1PXOA 3U6HA 3MBLA 1Y57A 4IZYA 2C30A 3KL8A 2J51A 4S31A 4M7IA 4OBOA 4YZMA 5LWNA 5KO1A 4AOJA 3LFDA 2FB8A 4YJQA 5AJQA 4DH8A 4CCBA 5A6NA 5ANOA 5CNOA 3UIMA 3VBXA 4NW6A 2BALA 3FKNA 3HLLA 3I0QA 3DDPA 1P4OA 2F9GA 4FGBA 3TZ7A 4BY9E 3DV3A 4B8LA 5BVEA 3AMYA 3M2WA 5EG3A 3UG1A 3AMAA 1B38A 2R3KA 3LJ2A 4YLKA 4EK8A 3EN4A 1RDQE 4IH8A 4UN0C 3GFWA 1BYGA 4C61A 4M97A 4L44A 1YRPA 2O3PA 4AW2A 1ZOHA 4LV7A 5HX6A 4UXQA 4ITJA 2A19B 4HJOA 3L8XA 3HP5A 2BVAA 1RE8A 5CVFA 1WBSA 1CSNA 4CT2A 3NPCA 3EJ1A 4RIYB 3GP0A 4KBAA 2W4KA 4C34A 4D2WA 4R1VA 5BVDA 3UNKA 2IVUA 2B9JA 2YABA 2X6DA 3PSCA 4IX5A 4OGRA 5HD7A 4ALUA 3QTZA 1KSWA 2ZMDA 4C8BA 2AC5A 4FYOA 3NS9A 4QP6A 3CKXA 3CPBA 5I9UA 4J7BA 5JGAA 4IM2A 3VONA 2PTKA 4BBMA 3KVXA 3FY0A 3VNTA 4ASDA 5HGIA 4ANQA 4MBIA 3GCPA 4G3EA 4CRSA 1CM8A 1M2QA 3LFQA 3DT1A 5I9XA 3EHAA 5J7HA 4EOQA 3QTUA 4C57A 5F95A 2O2UA 4MXZA 3V5QA 4PL3A 2YFXA 2W7XA 4GEOA 4KABA 1H0VA 5AP7A 4LRMA 3VULA 1BL6A 3FZRA 5ACBC 4I6QA 5A4EA 3PLAE 3GOPA 5HEZA 3R9DA 2HOGA 4BJJA 4O2PA 4GT5A 3RK9A 3GT8A 2ERKA 4UZHA 2W06A 2BIKB 1ZLTA 2GDOA 4XV2A 4YLLA 3UPXA 5IA4A 4DA5A 4O91A 4O7ZA 3QUEA 5EDRA 3ZRKA 3MY5A 1GIIA 4XOYA 2ITZA 3GNIB 2W9ZB 4AAAA 3MW1A 4RIXB 1KOBA 2PZYA 4EH2A 3QA8A 4B7TA 4DCEA 2Q0BA 3HMMA 4GK4A 4N70A 4MF0A 4YUQA 4ACGA 5L6WL 3KXMA 3FWQA 4IMYA 5CEPA 2YJRA 2WMRA 2JIIA 4RIWB 4S33A 4O21A 5EKOA 4KSPA 3SOCA 2E9UA 3A99A 3FLZA 3R6XA 4PMTA 5FTOA 3QTQA 4G6LA 3LM5A 5FBOA 2YDJA 3TYKA 5CF6A 3LXNA 1KUTA 3FLNC 3K3JA 2A98A 2ZMCA 3ORMA 5LMAA 3ZM4A 1OGUA 4RLKA 1NXKA 4JIAA 3ZUVA 3I7BA 4I23A 3U6JA 3ZC6A 2WMTA 3PE1A 5AUVA 4ZSLA 2YN8A 1ZYCA 3OROA 5F9EA 3AC8A 2PUPA 3CGFA 5CSXA 2IZSA 1PJKA 5IUGA 3TDVA 3PYYA 2XEZA 3KXXA 4XBUA 1FBNA 3UDZA 5I9VA 2Z7LA 4KA3A 2YAAA 4QMTA 4U9AA 1Q24A 3QFVA 4UBAA 4RJ3A 4YZBA 3VHKA 3D5XA 3A8XA 1TQMA 4E5WA 5JFVA 4L67A 5CYIA 1NVSA 1YI4A 3V8WA 3RAKA 3NUNA 4O38A 3TACA 5M44A 3P08A 3DCVA 3HX4A 3P7BA 1U59A 3E8CA 1U54B 2C3JA 5GZ8A 2NO3A 4FBXA 2LAVA 4V0GB 4QP9A 3KRRA 4QMQA 1OKZA 2IVSA 4GMYA 3NZ0A 3S00A 3UVQA 5CU3A 4AA5A 4AP7A 5C4KA 5G1XA 4JJRA 2WFYA 3QL8A 3OXTA 5E8WA 4CG9A 4IX6A 4KS7A 4KIKA 2ERZE 5H3QA 4GK3A 3PXRA 4JQ7A 4WSYA 4YHTA 3E93A 5LOHA 5ACKA 5HNIX 3G15A 3BQCA 4S30A 4NSTA 5GIPE 4C33A 3NVMB 3MESA 3K3IA 4NKAA 2FGIA 4GT3A 2XCKA 3C4FA 3OXZA 2QHMA 2YCQA 3N51A 4K1BA 4UYAA 3G90X 4LV5A 2WMSA 3ENMA 4QRCA 4WNPA 5DFPA 4M15A 2GNJA 5AP4A 4GK2A 5J79A 4Z7GA 1VEBA 4MK0A 2V7AA 5BVKA 5HVJA 3SC1A 5EQEA 2HWOA 4IDTA 3OUNB 3PXFA 4GV1A 1YKRA 3SRVA 3VS2A 1H01A 3DGKA 3L8PA 3EH9A 4FV1A 2R3FA 1URWA 3RALA 1J7LA 3RPVA 4DN5A 3HYHA 3W0PA 3FHRA 5BVFA 4D55A 2YA9A 2WTKB 4B8MA 4ASEA 5IA1A 2J0IA 4A9SA 4IE9A 2UZLA 5HNGA 4IANA 3O8TA 1O6YA 1WBVA 5HE0A 1UNHA 3U8WA 5HX8A 4P2KA 3V8TA 4M69A 2Z2WA 4WNKA 2JDOA 4KIOA 3PPKA 2VTNA 4NIFA 3E3BX 2F7ZE 4QNYA 2C0OA 2G1TA 5AR3A 1U5RA 1YXTA 5M4CA 4QTBA 4IB0A 5AUTA 4R78A 4M8TA 1ND4A 4XNEA 5M55A 3JXWA 3VQHA 4HYIA 3L9PA 3F5PA 3MDYA 4W4YA 4FI1A 4QTCA 2QLQA 3LXPA 3COIA 2CMWA 4I5HA 2ITVA 3MVLA 3OTUA 4DT8A 4ALVA 2YCSA 4FVRA 5AWMA 4K9YA 3QCYA 3VW8A 3BYSA 4PV0A 4AW5A 3VS0A 4MBJA 4EI4A 4D5KA 3KU2A 4ENXA 2G15A 3QQLA 3IGOA 4I6FA 4LMNA 4C7TA 1CKJA 4R7IA 3AG9A 3L1SA 4ZK5A 4IB5A 3ZDUA 5J7BA 3O8PA 2GFSA 3PA3A 4C4FA 3EIDA 3VWAA 4R7HA 2C6LA 3KA0A 4FA2A 4GT4A 3G2FA 4C38A 4IQ6A 5E8SA 5M07A 1XBBA 2X2KA 4FIEA 4UMTA 1P4FA 2A0CX 3UOJA 4WRSA 4AG8A 1NVQA 1GJOA 4JDIA 4ZTHA 2ZV7A 1DAYA 4DINA 5B2MA 3FXZA 3DBFA 3KREA 5ETAA 5EKNA 4O0TA 2OZOA 2VTLA 3IDPA 5EHYA 2QR7A 4EK5A 5CI7A 4J53A 2GS6A 4O7TA 2B9IA 4DC2A 2YIRA 4CMOA 4JG7A 1XKKA 2O63A 5CF5A 3QA0A 3ZDIA 3ZCLA 4HPTE 2XALA 2C6DA 3UOKA 3OXIA 1OUYA 3KF7A 3P4KA 2NRUA 2VTTA 5D10A 3R7UA 4DGLC 3KEXA 4EOIA 4WIHA 2HAKA 1OMWA 1BX6A 2X4ZA 4JDHA 4FG9A 4X2FA 5J87A 4EBWA 5CSHA 4AXAA 4ASXA 5KCVA 4MD9E 5DRBA 5DT3A 4C3PA 2R64A 1WVWA 4XV9A 4D1ZA 1PKGA 2OIDA 5AP3A 2CDZA 3MY1A 3OT8A 3L9MA 2H9VA 4A7CA 4ZTSA 2XUUA 3WARA 4I0RA 2JDSA 5AV2A 4JDJA 1OPLA 3ZUTA 3HV6A 4MQ1A 1NVRA 3E88A 1QL6A 3TTJA 4AZVA 1RJBA 1ZMVA 3UJGA 3A7JA 4FTTA 2HZ0A 3ZTXA 4EL9A 2J90A 2WXVA 4FV7A 2OK1A 2IZTA 3I60A 1KE7A 3R8MA 4DYMA 5BYYA 3PSBA 2W4OA 4ANOA 2UVXA 3Q2JA 1WCCA 1APME 4JIKA 2HY0A 2B52A 2JKQA 2WD1A 3U55A 4XG6A 3AC5A 2WZJA 4E4MA 2OICA 4F6UA 4B9DA 5AV4A 3GC7A 1K2PA 3OCSA 4GG5A 3CQEA 4I4FA 1OKVA 1JSUA 2PMOX 3DBEA 5TKDA 3TNQB 3EZVA 4JT3A 4D1SA 4KRCA 4DHIB 4DTAA 1OIYA 3TEIA 4HOKA 4EJ7A 4KSQA 2XRUA 5HLPA 5CEOA 3IDCA 5JGBA 3MJ1A 4LQMA 3C0HA 1YOMA 5CY3A 4YU2A 4BTJA 1VYWA 4BICA 5CNNA 3RHKA 3E8DA 3P86A 4WRGA 4RVLA 4FEWA 4BR3A 4YSMA 1PMUA 3VQUA 3ZHPC 4DLJA 2OWBA 2R3QA 4AFJA 2X2LA 1MQBA 4S32A 2VTHA 4CYJA 2O5KA 3QRIA 2C5NA 3OC1A 3WZJA 2YM4A 3R8UA 3OWKA 3V04A 3VS4A 3LJ1A 3D9VA 3NRMA 3NUUA 4BBEA 4D4YA 3QZGA 2W1HA 3ORKA 4H3QA 4RZWA 1FQ1B 3CBLA 3M1SA 3FI8A 4IM0A 5DEYA 1XH9A 3REPA 3SAYA 5DMZA 3UDSA 3EFJA 4FV5A 4ANNA 4O7YA 3IW4A 5ANGA 1H08A 2X8EA 4G3GA 3IGGA 4IWDA 4UB7A 2BMCA 4JX3A 3RPYA 2HELA 5AR4A 4D58A 4DGGA 2WMAA 4NZWB 4QNAA 3K54A 3RNYA 4FV6A 5JEBA 2XVDA 3SKCA 4O4BB 2BTSA 5J9YA 3TKUA 4XG7A 5E7RA 4FTAA 1OIRA 4G31A 4LRJA 3EKKA 2VO6A 3ZO1A 2BDFA 3EQIA 3IDBA 4O7VA 1Y8GA 4E4LA 2C69A 4IAFA 4F9CA 2YCRA 2Q0NA 3SQQA 3OY1A 4DHJA 4HW7A 1H26A 4AW0A 5CU6A 3EB0A 3A7IA 3QTIA 1YWRA 2W5AA 4EUTA 3JS2A 3PRIA 3W32A 2CN5A 3ROYA 4ZTNA 2Y0AA 3D83A 3Q04A 3RNIA 4E5BA 1PMEA 4IBMA 4CZYB 3HDNA 1Q5KA 3D94A 4QMYA 2GHMA 4L3PA 1O6KA 2FO0A 2R3PA 5M4IA 4V04A 3OD6X 3CJFA 3R04A 1Q8WA 2Z7RA 3C9WA 4I0TA 4TYHA 3TIYA 1TFFA 4QMZA 5IQFA 2XK3A 4BIEA 2VX0A 3BHYA 4X3FB 4PDSA 4FTUA 1UU3A 3FSFA 2IW6A 3OF0A 2RFNA 3I0OA 2X9EA 4XRLA 4MNFA 2B54A 1J1BA 3D7ZA 3CS9A 3GENA 3QTSA 3FBVA 3GVUA 4CMTA 3W2SA 3O7LD 3W55A 1FVTA 1VJYA 4XX9A 1GAGA 2WHBA 4N6ZA 1ZWSA 3OOGA 4XHKB 3BV2A 4BWXA 2IG7A 3KQ7A 2ETMA 5C8MA 3DU8A 2OZAA 3ORXA 2ITNA 2YDIA 5AR8A 4F7SA 1P5EA 2C6KA 2JLDA 2R9SA 3DQWA 3ORLA 5HO7A 4XCUA 3GCVA 2OJIA 2YCFA 4FKRA 4GL9A 4PDOA 4IJPA 2QODA 3MV5A 3BYOA 4HNIA 3ET7A 1WAKA 3OS3A 4WD5A 5C8NA 3CD3A 3ORIA 5KMIA 5IQEA 1J3HA 5FM2A 2ZAZA 4LOOA 4MF1A 3ZLYA 1CDKA 3MFTA 4Y73A 4LGGA 2J0JA 2P2HA 2QO9A 4DFBA 4JR7A 4YBJA 4DITA 4NJDA 4E4XA 3ZLSA 3DLSA 2CLQA 3KKVA 4IM3A 3W2PA 3RAIA 5CAOA 3M11A 4LI5A 3PA5A 3QX4A 4O2ZA 4CFNA 3G9LX 4MEDA 3KN5A 3NYNA 4RJ7A 2VNYA 4A07A 3E7VA 4EOKA 1VLRA 4FZDB 3DJ7A 2HZ4A 3GBZA 4EH5A 4DDGA 3OVVA 5HBJA 2X6EA 4D2TA 4O27B 3MB7A 4NKSA 1OKYA 1IG1A 4WUNA 3WF9A 3Q6UA 2BZIB 2FYSA 2QKWB 4GIHA 4JBVA 4AZEA 4FVQA 2C5XA 4U44A 2W1IA 3TJCA 3COMA 4RGJA 5K9IA 3RVGA