2GU8A

Discovery of 2-pyrimidyl-5-amidothiophenes as novel and potent inhibitors for akt: synthesis and sar studies
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDEQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-dependent protein kinase, alpha-catalytic subunit
publication title Discovery of 2-pyrimidyl-5-amidothiophenes as potent inhibitors for AKT: synthesis and SAR studies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase/inhibitor
total genus 105
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gu8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gu8A02
3MFSA 3WILA 1PW2A 4F9CA 4BWKA 5KX8A 1W84A 4J98A 4UWCA 1GZNA 1YWNA 2RFDA 3QL8A 4YHTA 5J95A 5A14A 5JN2A 3P4KA 5HE1A 2GHLA 2XIRA 4NT4A 3OCTA 4C4JA 5EQPA 2PMIA 4GJ3A 3FHRA 3ORLA 1ZLTA 1JSVA 4S32A 5H2UA 5CF5A 2IVSA 4O6EA 3Q4CA 4BDHA 2AYPA 1UU9A 2CKEA 2FGIA 3SW7A 2CGVA 3Q6WA 5HLPA 4D2SA 3JY0A 3O7LD 4QQ5A 5E8VA 4R78A 4W4XA 1SVHA 3DKCA 4C02A 4MCVA 3NS9A 2F7ZE 2YEXA 3C4CA 1BLXA 5L2QA 5C8KA 3E93A 3R8VA 1S9IA 4K33A 2F4JA 3OY3A 3Q9XA 1ZZLA 4BHNA 4ALVA 2YIXA 3WBLA 3CY3A 4X2NA 3ZHPC 4A9YA 3SX9A 2XNMA 4BF2A 4G9RA 2Y7JA 4GFGA 3EMGA 3BEGA 4JDHA 3LCTA 2J5FA 4R6VA 3R8LA 4A07A 5E4HA 5GJDA 4Z55A 3CKXA 4FUXA 4IM2A 3SQQA 3MJ2A 2JGZA 2XCKA 4DTBA 1FQ1B 4FEUA 3AC4A 4JDJA 3I5ZA 5CF8A 1H4LA 2V5QA 4G34A 4KINA 2ZB0A 3TUBA 1XH4A 2P2IA 3WI6A 3ZH8A 4TWCA 5AIRA 1URCA 4QMUA 1OBDA 4F1TA 4LOPA 4CTBA 5E1EA 3HMIA 1H26A 4ALUA 3R9HA 5KE0A 2JBOA 3PPZA 4FTRA 4TRLA 1Y57A 1NVRA 2UZTA 1L8TA 2YM4A 4XP2A 2UW0A 5B2LA 3PXYA 4E4LA 4IEBA 3V5LA 4NK9A 4QTBA 4GSBA 3E62A 2XKEA 3DJ5A 3FAAA 1KE7A 4EHZA 3LQ5A 2Z60A 2XK6A 3HECA 4FOBA 3ATSA 4BGHA 2WTKB 4AOJA 3KXMA 3GC7A 4A9RA 5AR4A 1K9AA 2O3PA 2YDKA 2YISA 5BYZA 4L3JA 4AF3A 5M53A 2X8DA 2VTTA 3BRBA 2W1HA 3II5A 3QTRA 2QOBA 4X3FB 3FMNA 5A4QA 2XEYA 5LVMA 4IM0A 5L4QA 2BRHA 2O8YA 3HA8A 1J91A 3QALE 4DEBA 1WMKA 4ACDA 3UQCA 3DFCB 5DPVA 3SLSA 2UZLA 3OWPA 2I0HA 3F5GA 2GPHA 3BV3A 5CU2A 2ZM4A 3R01A 2JKKA 4DH3A 4NWMA 5FXRA 3NUPA 4FSTA 3QA8A 1GIIA 3VULA 2WZJA 3PYYA 1OZ1A 1R39A 2WMRA 3DCVA 3L9MA 4WUNA 4FEXA 2XJ0A 4R3PA 2WEIA 5M4IA 3R7EA 1R0PA 4S33A 1Q3WA 3O8TA 2WOUA 4BIEA 3QFVA 5EW8A 1DS5A 3UG1A 2W96B 3OHTA 3PIZA 4EOKA 5K5XA 3NYOA 4JR3A 5D1JA 2XM9A 3EN5A 2YA9A 1ZYDA 3C0IA 3KF7A 2X1NA 2IJMA 1UA2A 4NM0A 4CYIA 2PZRA 3H10A 2PZIA 3MPTA 4GVJA 3RWQA 4DCEA 2NO3A 4DT9A 2PMNX 2HENA 3FKNA 2CGWA 3KULA 3OXTA 4IB3A 4QT1A 5CSXA 3C51A 2QI8A 3GQIA 4MXYA 4O7SA 3NDMA 1K2PA 1JAMA 5AR2A 4NL0A 4U45A 4E6DA 2IWIA 5C27A 5AP4A 4S2ZA 3ZDIA 5FTGA 4EH2A 1TQIA 3RNYA 3DNDA 4WOVA 2WD1A 3SHEA 3CLYA 5I3RA 3FI3A 4QMLA 4YLLA 3IW5A 5BVDA 1Q99A 4C8BA 3E8EA 1PMUA 1FVTA 3P79A 4L46A 5IA3A 5ACBC 2CGXA 1DM2A 1LEWA 2GHMA 3NLBA 4MK0A 5DR2A 4ANNA 2C3KA 5HO8A 4PY1A 4TWOA 2EVAA 2C69A 3W1FA 4YLJA 3L8XA 4E5AX 5JFWA 1YI4A 3OVVA 1S9JA 3DQWA 2JAVA 4RVMA 5ETIA 4F65A 2ONLA 5CNNA 2PZPA 4HYUA 4XRLA 3MFUA 3FQEA 5CSPA 3DY7A 1H1WA 5CLPA 4HVSA 3AMYA 2P0CA 3RWPA 4EQUA 3DTWA 4FZ6A 5HOAA 3R02A 4NKAA 4O1PA 4IB5A 5HG5A 4QYYA 3VUHA 4O83A 4GKIA 4ASZA 2PVNA 3NNVA 5IEXA 2C30A 3R04A 5LXMA 3UNKA 3V8SA 4WUAA 4J99A 5AV4A 3HZTA 3ZSGA 3FV8A 3OOMA 5L6WL 4B9DA 4Q9SA 3NNXA 1OIQA 4OTDA 4CMUA 1F0QA 2UZOA 3EN6A 3DK6A 4RX9A 5KMLA 3A8WA 1PXLA 4M7IA 4MTAA 2QR7A 3QD3A 4FTQA 4GEOA 3ZC6A 5IQHA 4O6LA 3LJ0A 4I4EA 2XKDA 4DF3A 2V55A 4QP6A 4WKQA 2CN8A 3R9OA 2J50A 4I23A 4FVPA 5JH6A 4FNWA 4BTJA 3GCVA 1ZYJA 3QAME 4O96A 3TZ9A 2GU8A 3OFMA 3UIXA 3P23A 1CKJA 3QU0A 4E20A 2PU8A 1YI6A 4E4MA 5IUHA 5ANEA 1OPLA 4BBFA 2HELA 2OKRA 5E8ZA 1JWHA 4X2KA 2ZMDA 3UVRA 2WEVA 2Z8CA 3CGOA 4AZFA 4D5HA 1YW2A 2JIUA 5E8YA 4DGLC 5AV3A 2UUEA 3QTZA 3LFQA 4KKHA 3BHVA 3W16A 5IQDA 2VGOA 3M1SA 3MH1A 4TW9A 4D9TA 5L2IA 4MF1A 4O0XA 3TJCA 3N4TA 2IO6A 3AXWA 4UEUA 4WSQA 3QUPA 3G9LX 3PY1A 5HCXA 1W0XC 4YTHA 4OAUC 3NUXA 3CD8A 4NW5A 3T9IA 3QGYA 4HZRA 2VZ6A 5GIPE 3OUKA 4E6QA 4CFFA 3BU6A 4IZAA 3PJCA 3F5PA 1IA8A 3Q9YA 3GXLA 3ZRMA 5DFPA 3M2WA 4R7BA 2BZHB 3GC8A 2R7IA 2XMYA 4XV1A 4R3RA 2JDTA 4ZJJA 4N70A 5K3YA 3TNQB 4FTAA 3ULIA 1M2QA 2CCHA 1PY5A 1Q8YA 1GOLA 1IAJA 4JBPA 4TYHA 1BMKA 4YLKA 4Q5EA 5DBXA 2H8HA 4C0TA 4YURA 2WQOA 4LGHA 2C0OA 3NYVA 4NCTC 5KZIA 3SRVA 1RJBA 3WIGA 3LVPA 1Z57A 1VJYA 4IBMA 4CFXA 4CFVA 5L6OA 4NJDA 3HV3A 2KTYA 3DDQA 3H0YA 3WARA 4YZBA 5JQ5A 1ND4A 2IW9A 1JVPP 2GFSA 3VS0A 4XBRA 1WVWA 2W17A 5BYYA 4J96A 2C6DA 4EORA 3O7LB 4UX9A 5C01A 1QPCA 4BDJA 3BE9A 1R0EA 3ITZA 3KMUA 3GOKA 3PSCA 3RM6A 2VWZA 4PPBA 4YMJA 2XKCA 2WOTA 3FUPA 4OW8A 1UU7A 1KE9A 2J4ZA 2WTDA 3GU6A 3ORZA 4FICA 1M14A 4UYNA 2XBAA 2BIKB 3RTPA 4ZMEA 3HP2A 3R9DA 2WFYA 1PXMA 1IR3A 3W2OA 3VO3A 5AR5A 2ITOA 3MTLA 4QTCA 5JGDA 5H8BA 4NEUA 3QF9A 4HPUE 3DBQA 2B0QA 4EWQA 4ASDA 4XV9A 4CSVA 2P55A 1BL6A 1IASA 1VYZA 4JI9A 2VWBA 2SRCA 4FSMA 5DT3A 3ZXZA 3P08A 3PWDA 4L68A 4W9XA 3LW0A 5HE2A 3QHWA 4XOYA 3ZRLA 5CU0A 4FT5A 4FKWA 2UW8A 4A9UA 4N6ZA 3HRCA 3BYOA 3MFTA 4Q9ZA 3MB6A 3MA3A 2E9UA 5J7BA 5J1VA 5AUXA 1MRYA 4QPAA 1GIJA 2WMXA 2W4OA 3CR0A 1G8AA 5M44A 3F66A 5D12A 4ZP5A 4XG3A 3LM5A 1IG1A 3BYVA 2BVAA 2JC6A 2Z7SA 2C3JA 3QZHA 5B2MA 4RPVA 3WF6A 2ITYA 1H0WA 2X8IA 3GU5A 4U79A 1VEBA 3F3TA 2J6MA 3ZUVA 4PP7A 3P0MA 3ANRA 3FLYA 2YJSA 3DLZA 3A60A 4LV5A 4JLCA 1WCCA 4ARKA 4DC2A 4MNEA 3DTCA 1B6CB 2PYWA 4EJ7A 4R7HA 2OI4X 4EH4A 5D7VA 5J9YA 3LJ1A 1GZKA 1BI7A 4FG8A 5CNOA 3U6HA 5E8SA 4O7TA 4FV8A 3LFBA 2BAQA 4EOLA 4EYMA 4QMZA 3QTUA 3FZ1A 4FGBA 4U3YA 1XH7A 4TNBA 4U42A 4EBVA 4I0RA 4RWIA 3ZFXA 3WZKA 2W1DA 1RW8A 5EYMA 3VS2A 4HGSA 5CZHA 4A06A 2P33A 1H00A 3D9VA 2BKZA 3PXZA 1MUOA 4RVKA 5DRBA 2X6DA 4ZEGA 1H08A 3UJGA 5M4UA 3QZIA 3RGFA 5JKGA 3D0EA 3Q60A 3LMHA 2HY81 4ZSLA 3PDTA 5IA4A 4CFWA 2GTNA 5LVLA 5HVKA 1UU3A 1AQ1A 3Q6UA 5BUJA 2PVJA 2A0CX 4M3QA 2OIDA 4YJQA 3UIMA 3ZONA 4GK2A 3IOKA 4OUCA 3EL8A 2X9FA 3EFJA 4XG4A 2VO6A 1ZYSA 4MNFA 4XP0A 2I6LA 3TTIA 4GU6A 5LQFA 4EZ3A 5FGKA 3SXFA 1M7NA 4GG5A 4Y72A 3ZUUA 2BZJA 2CCIA 3KRXA 3LCSA 4FKVA 4IFCA 4D5KA 4YU2A 3D2IA 3RAHA 5K5NA 4AZTA 2AUHA 4O7NA 1NVSA 3MH2A 4ALWA 4B8MA 3FI8A 2GFCA 2YIWA 1GJOA 4BTMA 3L9LA 5LWMA 4FTNA 4JNWA 3EN9A 4HCTA 4LM5A 5TKDA 3U8WA 3BI6A 5LARA 4MXAA 4F7SA 4FUYA 2BHHA 2PUPA 4O84A 3C1XA 3ZM9A 1OL5A 4YNEA 3ZRKA 3VF8A 3C4EA 3MWUA 3NX8A 3PIYA 4JG7A 4NSTA 2C6TA 2WMVA 4GIHA 4LMNA 4OT5A 3GU7A 3IQ7A 3UP2A 4BCQA 4CMOA 3GT8A 3QGWA 5DLSA 4DFNA 3RAIA 4IDVA 2FO0A 3VHEA 3NUAA 3U9NA 4I3ZA 2C5OA 5KBQA 3V04A 4B4LA 2XK4A 4MD8E 1XBCA 4M15A 5EFQA 2VNWA 2GS7A 3MY5A 4XMOA 4BYIA 5CANA 3ACJA 3NIZA 4G3FA 4ZTNA 5LMAA 4EOPA 3ALOA 2YLFA 3F7WA 4L43A 5IEYA 3JVRA 4I93A 4MYGA 4BDAA 2X2KA 2YM5A 3PWYA 4U40A 3Q4ZA 1APME 3ORIA 4FV1A 5TF9A 4KIKA 4KB8A 3OWLA 4EZ7A 5KUPA 3LHJA 3NNUA 4JR7A 5EQYA 3W2RA 1F3MC 2F2CB 5L2SA 5HU3A 4FIGA 5C03A 4WG5A 5ANGA 4A9SA 3R8PA 4AS0A 2ERKA 4FK6A 3MA6A 4BYJA 1DI8A 3COKA 2PE2A 1K3AA 4KBAA 3BHUA 5AA9A 3TUDA 3PG3A 1TVOA 4MAOA 3AMBA 4AOIA 3KL8A 5AP5A 3RZFA 5TT7A 4JQ7A 3LMIA 1KV2A 3R6XA 4G31A 2ZV8A 3RPVA 2PTKA 3R9NA 3ZXTA 4CZTA 3FMLA 3SOAA 4GUBA 1V0OA 1JSUA 4CKJA 3FDNA 4FSZA 3VBVA 3KA0A 3HLLA 2DS1A 3UVPA 5L3AA 2H9VA 1PKDA 4M12A 3LLTA 2VWVA 3FMMA 3GUBA 2FVDA 4LFIA 2YFXA 3VRZA 3N4VA 4M66A 4OTPA 2OH0E 4RFYA 4IAKA 5BQ0A 5FXSA 4AOTA 4O7YA 2BROA 3OT8A 5HVJA 3H9RA 4I21A 5ETCA 1YHSA 1QPEA 1LR4A 4X3FA 2IVTA 4F63A 4O7LA 4NZWB 4GIIA 2XP2A 4V0GB 3LXLA 3WF8A 2YABA 5AUVA 5I0BA 5KKRC 3WZJA 3U9CA 5EYKA 3IO7A 4RIXB 5TR6A 1Q97A 4FKLA 5M56A 2R3KA 4EH7A 1FGIA 1REKA 3OZ6A 3MESA 5CQUA 3V8TA 3SGCA 3UZRA 1ZMVA 4IVAA 2YM3A 1Z5MA 3G33A 4LL0A 5E8XA 4ANBA 3VHKA 1DAWA 4XUFA 3SVVA 5AP0A 4EYJA 2UVXA 4FV0A 4JVGA 4C36A 4JRNA 4C3PA 4X6QC 3EH9A 3D7TB 3S95A 3AC2A 4D9UA 4O91A 1WBVA 2ZDUA 1YDRE 1FMOE 2C6LA 1PJKA 4P7EA 3F88A 3PE1A 4AN2A 4BY9E 2ZV7A 4OTHA 3R63A 1OIYA 5AM7A 4FSRA 4B6LA 5J9LA 4BTFA 4XH6A 1YWVA 3DV3A 4DEAA 3MDYA 5HBHA 5FEDA 5HGIA 4QP4A 5D9HA 4W8DA 1H27A 2J0MB 4IDTA 4EUTA 4EK8A 4BDCA 2JLDA 3PTGA 1M7QA 2EU9A 3QRIA 1XR1A 3HA6A 3TCPA 4JDKA 1Y8GA 2V7AA 3FMHA 3ELJA 2IZSA 4NIFB 3CGFA 1O6KA 3MPMA 4FKTA 5JQ8A 1LPUA 2WTWA 3E7OA 3EFLA 4FIJA 4K1BA 5C4LA 4FIHA 1FVRA 3TT0A 2VTNA 2XYNA 3NW7A 5KCVA 4E5WA 4WRSA 5F94A 2X6EA 4ACMA 4E4XA 3AG9A 1GY3A 2EB3A 3BIZA 3ZYAA 2G15A 3QXOA 3RCDA 3DXNA 3DBCA 2R7BA 5L2TA 2C5XA 4LG4A 4Y5HA 5CZIA 5AM6A 2BRMA 4IX3A 1GNGA 3BYUA 4YJPA 2X8EA 4YUQA 3NEWA 2ZV9A 3UP7A 2XJ1A 5FG8A 3V5WA 3EN7A 1ZYLA 4RIYA 3RHXA 3MW1A 2ZDTA 3JVSA 4NCTA 4DEEA 1ZARA 3A8XA 3MH0A 2QOQA 4IIRA 2PMOX 4JIAA 4XCUA 4EWHA 4O0RA 3GBZA 4EH5A 3BHTA 1BI8A 3TACA 3UDBA 4J53A 4DHFA 4YTCA 3TXOA 3EFWA 2OXXA 4XX9A 3SW4A 1H0VA 3TV6A 3P5KA 2GNGA 4D4RA 3MVLA 2IPXA 5DVRA 2QLQA 3EIDA 4FODA 2XRWA 5KMOA 4DT8A 1Q62A 3I79A 5DHJA 5AWMA 1PYXA 2LGCA 4IX5A 4EKLA 3GP0A 5AA8A 4K11A 2JFLA 5HX6A 2IG7A 4PUZA 4Q5HA 4BDFA 1BKXA 2V7OA 4FT0A 4A4XA 1G8SA 4I6QA 4YR8A 1Q8WA 4XNEA 4BCNA 4KSQA 4LOQA 4AZSA 4DH5A 2DWBA 4QYEA 2X2LA 1U4DA 4RRVA 3NUUA 4AE9A 5IDNA 4B7TA 5CSVA 5IA2A 4O7RA 3D4QA 4XLVA 3UOKA 4OR5A 4PDYA 4QMMA 4U81A 3PXKA 4ZTQA 2XIYA 5F1ZA 3BEAA 3OW4A 3P7BA 5DA3A 4AACA 1FVVA 4TYIA 5CYIA 3TEIA 2QO2A 1IA9A 3VUGA 4O0SA 3PA4A 3D5UA 4ZSAA 4JX7A 3OEZA 4U9AA 3KQ7A 4O7VA 1OKYA 3BELA 3E64A 4GV1A 4BL1A 3OWJA 2R3FA 3QD2B 3SKCA 4IX6A 5EHYA 2QOFA 2UW4A 5HEZA 4BIDA 3S1HA 2CHLA 4ZTLA 4FSWA 4ENXA 2WNTA 4L53A 2CKQA 4ZLYA 2VUWA 3EYGA 3FC1X 5JGAA 5E8UA 4RLKA 5C1QB 4FEWA 2Y0AA 3E7VA 3R7GA 4ZZMA 2UV2A 3EZRA 3GCSA 4DH1A 4BZOA 3VVHA 2C4GA 3C5IA 4I4FA 3R0TA 4L45A 4M69A 2QONA 2W5HA 1YVJA 4FV4A 4JQ8A 2YZLA 2YZAA 3MI9A 4MWHA 3UO4A 5CEPA 4FKPA 2PUUA 1OVEA 4X2FA 3H3CA 4EI4A 5FTQA 1WBSA 2GNHA 4G3GA 1YKRA 3BYSA 3RI1A 3PVUA 3HEGA 3KMWA 4IW0A 4IVDA 3ZBFA 4O81A 2JEDA 4YNOA 4FKQA 4MBLA 5AX3A 5I9UA 5CENA 4HYIA 4D58A 4EEVA 4PMPA 3UOJA 3UNZA 1UWJA 4D4YA 3C5UA 2OJJA 5IKWA 2J0IA 4RJ5A 2W5AA 4RC3A 5CU6A 3VBQA 3ZC5A 2HXLA 1NA7A 3QRTA 1YOLA 4CLJA 3U4UA 5A4TA 5I5ZA 4D55A 4MVFA 3MN3A 3EQGA 4EKKA 4PTCA 3I5NA 1KWPA 4UB7A 5EH0A 3O8UA 1YI3A 3R83A 3TJDA 3BGQA 5ICPA 4LRKA 3TV4A 4A4LA 4DAWA 3OTUA 3KMMA 3RALA 3HV7A 3ORPA 5IQGA 4YTFA 4BGQA 4GT4A 4DFXE 3O51A 2QOLA 3NIEA 3B8QA 5ITAA 3UO6A 3GVUA 1BYGA 2R3IA 1P5EA 3FYKX 3QQUA 4KRDA 4M97A 4WBBB 3EQFA 3BE2A 5HU9A 3PP1A 3AC8A 2WAJA 3QTSA 4PL3A 4L7FA 2JAMA 5HG8A 1BUHA 4PNKA 3VWAA 4NU1A 3R9RA 2DYLA 4G6LA 5IDPA 1OL6A 1ZYCA 3JY9A 3IDBA 3TM0A 1CKIA 3G2FA 3TKIA 3K54A 3GB2A 1YDSE 3OOGA 3PZEA 4HNIA 2OU7A 4W4YA 4ANLA 4EHEA 5M4CA 2F2UA 1HCKA 3KXNA 3KXHA 4F9WA 4F7NA 2CGUA 2W1FA 3DAEA 2BDJA 1EH4A 3EQCA 3V3VA 4EOJA 3FLQA 1H01A 3NWWA 2VTPA 4NW6A 2UZUE 3ZS5A 5CXZA 3LZBA 3CP9A 5M06A 3DQXA 3FBVA 1VZOA 4HCVA 2BR1A 5FTOA 5A9UA 2O2UA 4YJRA 3LCDA 2FYSA 2R3GA 1BL7A 4IB0A 3MGYA 1YRPA 2QOCA 3PIXA 5CT7A 4ZJVA 2O63A 2XJ2A 4BCIA 2VWYA 2WB8A 3DFAA 3RBWA 2BALA 5AFVA 3TI1A 5IQCA 3V6SA 4AFJA 5H9BA 3KXZA 5IH5A 3BGPA 2ETRA 2B55A 4X21A 4DH7A 5DRDA 3LCKA 4D1ZA 2GTMA 2I0EA 2VTJA 3PVGA 4IH8A 2OXDA 5FD2A 4A7CA 5AUTA 2WQEA 2WPAA 3L9PA 3MBLA 4FV7A 4IZ7A 5DWRA 2NP8A 4AP7A 4PX6A 4BI0A 1UNGA 3AOXA 2IW6A 2GS2A 3R2BA 5CEKA 4IAZA 5CXHA 3FXWA 3QD4A 4FV2A 2G2HA 1OIUA 4R7IA 4IWDA 4S34A 5FWKK 4WA9A 1SMHA 3FLSA 3H30A 1REJA 5DR9A 1OKVA 3PZHA 2C68A 1YXTA 4KS7A 3WE8A 1CMKE 1H07A 4DBNA 4XJ0A 4M14A 3O0GA 4JAIA 2X0GA 5KNJA 2UZWE 3MB7A 4YSMA 1W8CA 3BZ3A 4LYNA 3UMWA 2XM8A 3SC1A 4QYGA 1R3CA 4JT3A 2UW5A 5FQDC 2W5BA 4OGRA 5HI2A 4O21A 3EZVA 3PJ3A 3WZEA 2YM8A 4TPTA 5IU2A 3FI2A 1FOTA 3VC4A 3R00A 3K3IA 5E92A 4ACHA 3E63A 4DE4A 3R7YA 3I81A 4I6BA 2I0VA 3ODZX 2UW7A 4XHKB 4BB4A 4G6OA 4IWOA 2WTKC 4O0VA 5FBNC 1Y91A 4MBIA 2ZJWA 4P90A 4QMNA 3FY2A 2W1CA 3DAKA 4X3FC 2R3PA 3HYHA 4OTRA 3W8QA 3COHA 3OS3A 5CVGA 3VS6A 5DN3A 4UZDA 5HE3A 4E6AA 3SV0A 4MWIA 3LAUA 2XYUA 4F0FA 2UZVA 3GC9A 4QMTA 3ZLXA 3S00A 3F82A 4AGUA 3KGAA 3MTFA 3PY0A 2XK7A 4GYIA 2JBPA 1RDQE 3LMGA 4YZDA 4RA5A 3I7BA 4HVHA 3O8PA 4JL9A 2YHVA 1P2AA 2QO7A 3MY1A 5BPYA 5CWZA 4MBJA 4D0XA 4F9YA 4H1JA 5C26A 3MVMA 1J3HA 5HD4A 4AA0A 4L52A 3FMEA 4D1SA 4P5ZA 4BN1A 2Y6MA 2OFUA 4E8AA 5M55A 4ZTRA 4I5PA 1YQJA 2VO3A 3FE3A 3QQHA 4OBPA 2OF2A 3QRJA 2E9OA 2VWXA 2VX1A 4IC7A 3QRUA 4BHZA 2HWOA 4EC8A 3TZ7A 3WOWA 3JR1A 4FK3A 4GMYA 4IJPA 4FSUA 3BU5A 4ZSGA 3Q9ZA 4FTJA 3RAKA 4USEA 3R21A 3NW6A 2RGPA 2CKPA 3D15A 3OBJA 4U43A 4EQMA 3PLSA 2JIIA 4Y85A 2IZTA 3MH3A 4X2JA 4ZSEA 4U7ZA 4EH9A 4OTWA 4E3CA 5GJGA 4FNZA 2BTSA 2XVDA 4FVQA 2NPQA 3R7VA 4R5YA 5HBJA 1PXIA 3RPOA 2EXCX 2J90A 1XWSA 3I0OA 5BX0A 3AMAA 4P4CA 5L8LA 3TUCA 1JPAA 3HKOA 4U3ZA 4YZMA 2WO6A 4AGDA 2DUVA 1YWRA 3N9XA 2R64A 1L3RE 4BDKA 2B9FA 4F08A 2GNIA 4GFOA 1E1VA 3HMMA 5M07A 1MQBA 1QPDA 2A1AB 4PRJA 3RINA 4EOIA 4ZMFA 4FTKA 3WF5A 5EG3A 1MQ4A 3HMPA 3TNWA 4NH1A 2PVFA 5A4LA 1Q8UA 3V5QA 2YM7A 4NFNA 4BCOA 4CTCA 5LJJA 2Y4PA 5AV0A 3F3ZA 1ZOEA 4Z9LA 2I1MA 4BCHA 3ZO2A 4AX8A 3R8MA 2BZKB 3HV5A 3ZSIA 1J7LA 5EM8A 4TKSA 3VF9A 3WF7A 3OY1A 3I6WA 1NY3A 3JPVA 3VRYA 4YHFA 4KSPA 1CM8A 3V5TA 3E87A 2PUIA 1CDKA 4RIXA 3T3UA 3KCKA 2WMSA 2YAKA 4FL2A 3NCZA 1Q4LA 2EUFB 4GUEA 4UV0A 3THBA 4C4IA 4B8LA 3VUDA 3VIDA 5IF1A 1Y8YA 3RJCA 4QTEA 3UNJA 2OG8A 3GNIB 2HY0A 2HK5A 4KKEA 4EOSA 1B38A 2Z2WA 4RT7A 4GW8A 3VS1A 2PWLA 4AGWA 4LQMA 3W2SA 2B9JA 4CCBA 2E9NA 2R3QA 2C3LA 4RFZA 2C5NA 4KD1A 4U41A 3ZU7A 4DGMA 3D5VA 3GU8A 4L00A 4UXLA 3V51A 3NUSA 2YITA 3CD3A 1URWA 3I1AA 1A06A 3GCPA 3VUMA 2QVSE 2OIQA 1WZYA 4HW7A 3O2MA 4I0SA 3WF9A 4XP3A 5LOHA 5FM3A 5HNIX 5IQEA 1TQMA 3OROA 2WMAA 4CNHA 4PPCA 3ZTXA 4BTKA 4IX4A 3DK3A 2R4BA 4F1MA 4IQ6A 4EH6A 3TNPC 3VNTA 2ESMA 2QKRA 2HZ4A 3S2PA 4WSYA 3B2WA 3FZRA 4TT7A 5JEBA 2C1BA 4JOAA 4MQ2A 4AZEA 2R0IA 2WTVA 4O0UA 4ACGA 2X39A 3EQBA 4HPTE 3P1AA 4H1MA 4QP2A 1ZXEA 5FM2A 2R9SA 4DLJA 5ETFA 2CDZA 4YZNA 3NPCA 5EYDA 4IADA 3VS4A 2YIYA 5A6OA 3U6IA 1FMKA 2UZDA 5HIDA 3UIBA 1AD5A 1RQQA 3IPHA 2ITWA 2W9ZB 2BFYA 4KIOA 5HG9A 5EI2A 1MRUA 4ZZOA 4G3EA 4X2GA 4RJ4A 3OD6X 3W10A 2HW6A 4BCJA 4FTMA 3TKHA 2GHGA 4GKHA 3SG9A 1PKGA 1ZWSA 2HCKA 2VWWA 4FC0A 3WYYA 4DEHA 4OAVB 2RIOA 4I94A 4TY1A 4ERWA 4IC8A 1X8BA 4C4HA 5EDPA 3HDNA 4C59A 3CPBA 4QPMA 3ORMA 4K2RA 4C3FA 1JQHA 2VN9A 4D2WA 4I24A 3QRKA 3OEFX 3ATTA 4QOXA 4RZVA 2C3IB 2QG5A 3O17A 4LV8A 3Q4TA 4L8MA 2QHNA 4EJNA 5CASA 3I6UA 3IOPA 3G6HA 4PQNA 4Z7GA 5IA1A 3FLZA 3P7CA 1MRVA 1SZMA 4LI5A 5DEYA 4BCFA 4CRLA 3EKNA 2XB7A 3A7FA 4QMSA 4RZWA 5AP7A 4I6FA 4FKSA 1KE5A 2VD5A 4QMQA 1ZY4A 5HLNA 3OMVA 2YERA 3TZ8A 4BRXA 5A54A 5I9VA 1QCFA 4W8EA 4ZOGA 4F64A 5LMKC 3RNIA 2QG7A 2I7QA 3Q04A 2Y9QA 3T9TA 3V8WA 4QP8A 2R2PA 3QCQA 4TYEA 3AD6A 3MYGA 4CT2A 4D4SA 5HX8A 3GGFA 3GFWA 3PXRA 4L67A 3U54A 1ERKA 4K0YA 4Y8DA 3H9FA 3DZQA 3KK9A 3L1SA 4RBLA 4F9AA 1UV5A 1ZMUA 2OXYA 4B99A 3FWQA 3FZSA 3I7CA 5IMXA 3O96A 5CS6A 5AR3A 4CV9A 4ZY5A 1G5SA 4PDOA 4C38A 4YZCA 2PHKA 3KULB 3LFEA 4M8TA 3NAYA 2WTJA 5EI8A 3T8OA 5ETAA 5ACKA 4BC6A 2WMTA 4IE9A 4QTDA 1JSTA 3Q5IA 3V01A 4JG6A 5IISA 4BVUA 2PZ5A 3G0FA 1OM1A 3IW4A 4GYGA 2PVYA 3OBGA 4AW1A 4AAAA 4RA4A 5JK3A 5IZFA 4XG9A 2PK9A 3F9NA 3AT2A 3LIJA 1Q8TA 3LQ8A 3EL7A 2HYYA 2W05A 4R3CA 4MD7E 4O0YA 1W7HA 4RWLA 5EM5A 3ROCA 4X7QA 4GRBA 5EW9A 2GCDA 3NR9A 4NJ3A 5H3QA 3TIZA 3KFAA 4ASXA 5EW3A 2UZEA 4EHGA 3LJ2A 4FT3A 4DFLA 2ETMA 3P7AA 4UY9A 3FKOA 4GS6A 1LUFA 3KVXA 2O64A 4QNYA 3NUNA 1W83A 4O2ZA 3BQCA 4OTQA 4DFYA 2VTMA 3BKBA 3RCJA 4CQGA 2Y6OA 2QQ7A 2XK9A 3HMOA 5GZ8A 3NW5A 5AMNA 3F5UA 5A4CA 5IQIA 5LVPA 2VNYA 1ZY5A 4CMTA 4O7ZA 1XBBA 5M09A 5E9EA 2PE0A 4FZDB 1NT2A 4RX8A 4XRJA 3UPZA 4W9WA 4O0WA 5IPJA 1O6LA 2XEZA 2YIRA 3E92A 3IGOA 3KEXA 3LFDA 4V04A 4W4VA 3GU4A 3W33A 1J1CA 4L01A 3OUNB 2B54A 5KBRA 4CCUA 3JYAA 3PRIA 4PWNA 4MHAA 3LXNA 4RLLA 2A4LA 4V01A 3TDWA 3IKAA 3U4WA 5H8GA 3QKLA 1NXKA 1YOMA 4QNAA 1KOBA 1UNLA 2BZIB 4PP9A 2YCSA 4XYFA 5AUZA 4IAIA 4N6YA 3C4FA 3CBLA 1H28A 4QYHA 1WBNA 2GQSA 3FQSA 3MPAA 4FG9A 2C6IA 1R1WA 4HCUA 2W0JA 3KC3A 1A9UA 4U5JA 4FL1A 4RC4A 4W4WA 4WT6A 5T6KA 3W8LA 2AC3A 3TV7A 1KSWA 4G3DA 2YDJA 2P3GX 2WELA 4EONA 4KABA 3I60A 5A3XA 1YDTE 3G0EA 4J7BA 4K77A 1KE8A 1NW1A 2OZAB 2FH9A 4O0TA 4HGTA 5CY3A 3AT4A 3FY0A 5ANDA 2X7GA 1ZMWA 3ID6C 3HX4A 3G5DA 1OGUA 2OJIA 2BAJA 3OCGA 1H1SA 3DBEA 3R1SA 4NTTA 2Z7LA 4TYGA 3IW6A 3FHIA 4NUSA 5KHWA 4JQEA 1WVXA 4ZY6A 3A2CA 2ZM3A 4G17A 5B2KA 2OJGA 5IMEA 2VTIA 4YSJA 1A48A 1PHKA 3W2CA 1SNUA 3P9JA 1JKTA 2BHEA 5HLWA 5BNJA 4WIHA 3CXWA 2NRUA 2FSOX 1JLUE 5DR6A 4EK3A 4BZNA 3BLHA 4J52A 3NSZA 4RJ6A 4O1OA 5ANOA 4CV8A 2C5VA 2W7XA 4P5QA 4BDEA 5IA0A 3OT3A 1FPUA 3JS2A 3LFNA 3PY3A 4AQCA 1H25A 3REPA 5J79A 2J7TA 5CU3A 1B39A 5IH4A 4AWIA 3LCOA 5L6PA 4LGGA 4TYHB 3MSSA 2Y4IB 4KBKA 3U55A 4O86A 2F57A 4GG7A 2V22A 3G15A 4AUAA 3UC3A 3QTWA 4FV5A 3PUPA 3SRVB 3Q2JA 3RAWA 2OW3A 3ZDUA 3FZPA 3PXFA 3PE2A 4J8NA 5DIAA 1UNHA 4I20A 3M42A 2B53A 1WAKA 3MVJA 3SA0A 3ORXA 3F7ZA 4JXFA 4ZS4A 2ACXA 4UBAA 4FKOA 5HE0A 5CAOA 3QCXA 2BFXA 2VAGA 4XV3A 2PY3A 2R3LA 3R1QA 4BBMA 4KKGA 5TE0A 3QYZA 2WU6A 1BX6A 1JNKA 4UMRA 3DK7A 2PSQA 4DTKA 5CALA 4H39A 3QQKA 3CPCA 2C1AA 2XNPA 3BCEA 4GT5A 2X81A 4AA5A 1T45A 3C9WA 4E5BA 3IDPA 1IRKA 2JDRA 4L3LA 3E3BX 5JSMA 5HBEA 1H1RA 3COIA 3D14A 5G1XA 3VW6A 2OH4A 4MXOA 4O22A 1U59A 1CKPA 3I0QA 2XIKA 3RP9A 2UW3A 3FL5A 1H1QA 2GNLA 4TN6A 4CZUA 3PFQA 3HV4A 5G6VA 5GINE 4UMUA 3E8DA 4KUJA 2VTOA 4F0IA 3F2RA 4F4PA 3ZFMA 3ZZWA 2PPQA 4XBUA 4OTFA 2PVMA 4BWPA 4GK4A 5DG5A 2BTRA 3O23A 3BBWA 4XV2A 2A27A 4ZXTA 4FTUA 3BGZA 3CS9A 3TNIA 5K0XA 4U44A 3IECA 2OSCA 4J8MA 5CEOA 3W2PA 4USFA 3NMUF 4C7TA 3QUDA 2WQMA 4FI1A 4II5A 1KOAA 5GNKA 4DH8A 3W55A 3QKKA 4FBXA 4QMVA 3VS3A 3B2TA 4X0MA 4YPDA 1JKLA 4CD0A 4DINA 4E73A 5T3QA 2ITVA 4H3PA 4FTIA 3BHHA 3F3WA 5AP3A 4CQEA 2QHMA 4E6CA 3OCSA 3DNEA 4GU9A 2B9IA 4FIFA 4AFEA 4HVIA 3QBNA 4AN3A 4E7WA 4QMXA 3HV6A 2QC6A 4D2RA 1KV1A 4O7WA 5CAPA 3LKMA 5A4EA 4MNEB 5J5SA 4NKSA 2WQBA 1U54B 2P4IA 1WFCA 2W9FB 3AC3A 4FV9A 3ORTA 4D0WA 3QWKA 1YHVA 3P86A 2CKOA 4IXPA 3QWJA 4FSNA 3IS5A 3BWJA 2W1EA 4UMTA 2FSTX 2WGJA 3ETAA 4LUDA 4R5SA 2WKMA 4MKCA 4TNDA 1YXXA 1M17A 2UW9A 5HD7A 2CJMA 3A7IA 2BPMA 3MS9A 4G5JA 4XOZA 4ZIMA 2F9GA 4JBOA 3VAPA 3W32A 5I9WA 4AG8A 4FT7A 1P14A 1XQZA 3QYWA 1Q8ZA 4Y95A 3OTVA 5AAEA 5J7HA 2VWUA 4D2PA 3DXPA 1OUYA 3HL7A 2REIA 3KRJA 4CEGA 4C57A 3BWFA 1DAYA 2FB8A 3ZO1A 2NNWB 4DFBA 4ZTSA 1GIHA 5FXQA 5I3OA 4BKJA 3RHKA 3QCYA 3C4ZA 4CT1A 2XKFA 3C7QA 4TZRA 3UOHA 3DB8A 4K9YA 2WIHA 1I44A 3O50A 1LP4A 4FIIA 3S0OA 3UYSA 3E8NA 1M2PA 1H1PA 4USDA 3L8PA 4KWPA 5B7VA 5CAVA 4RGJA 3R7OA 5HNGA 2JITA 4EOMA 1H8FA 2O0UA 3A99A 4XG7A 4J71A 5IQFA 4UYAA 3R71A 3AT3A 5GIOE 1V0PA 5T68A 4G5PA 5AJQA 2ZMCA 4QO9A 1Q61A 1O6YA 2YAAA 4M0ZA 4C2VA 4H58A 4PPAA 4QP7A 4F6UA 2Z7QA 3HAVA 3EQPA 3QLFA 4CLIA 2PZYA 2RSVA 4M0YA 5EKOA 2IVVA 3CJGA 2JFMA 4PL4A 5FEQA 4ERKA 3WZDA 3ZEWA 3MIYA 5BVKA 3QD0A 5C8MA 3DDPA 4FNXA 4I92A 4DG2E 4Z7HA 5F95A 3BLQA 3GQLA 3L8SA 2EXEA 2YLEA 2BMCA 3AGMA 2VV9A 5KMNA 4CFUA 4X6RA 3LQ3A 2R0UA 1OPJA 4PL5A 1PF8A 3AGLA 3PG1A 1W98A 2O65A 3C50A 1PXNA 2QOIA 1UKHA 2XNNA 3NNWA 1Q3DA 2ETKA 3PJ1A 1Y6BA 4L7SA 4RMZA 2GNJA 3F69A 5DH3A 4HOKA 4D28A 2WMUA 2VTHA 4KIKB 2BILB 3F5XA 3OW3A 3VW8A 3OXIA 4DFZE 4DTAA 3ZBXA 4QRCA 3FXXA 5LMKA 5AIKA 4TTHB 4C34A 5E90A 2YCQA 1OKWA 2ZV2A 3VUIA 1FBNA 3UZPA 3ZLWA 2XNBA 4GL9A 4JRVA 3C0HA 4RVLA 3F61A 5E8TA 2O5KA 4K6ZA 4F09A 4WD5A 2JDVA 3PSDA 3EHAA 3KXGA 5BVEA 2BAKA 4I41A 3MFRA 1PXJA 2Q0NA 2VTRA 4PMTA 4YJOA 4ANOA 3RK5A 3CQUA 3R30A 2ZB1A 3EFKA 2G2IA 4WNMA 2QLUA 2QOOA 4YJNA 3C0GA 5L8JA 3TWJA 5IUIA 4FTCA 3ALNA 5J5TA 5I9ZA 3DT1A 3QX4A 3HP5A 4YP8A 3DB6A 2XIZA 4PTGA 3SXSA 4TXCA 2QU5A 4DN5A 3C13A 2W06A 2W4JA 4L9IA 4C37A 4JAJA 2GMXA 4BR3A 2R3MA 5C4KA 2E9VA 2HOGA 4TWNA 3QZFA 5IQAA 1CTPE 4QQTA 1J1BA 2R3JA 2VX3A 3EWHA 5JT2A 4H3BA 4BI2A 5BVNA 3LXKA 5M57A 3CCNA 4BCPA 5FRIA 3B8RA 4JBVA 2WTIA 5DT0A 5CEIA 2ITNA 3HVCA 3CE3A 4NM3A 3IK3A 1P4FA 4KS8A 3PRFA 3UC4A 5HHWA 3CSVA 4F99A 1PXOA 3RK7A 3VBTA 3ZLSA 2OK1A 2UVYA 2AC5A 4HJOA 4FF8A 4EK5A 4QP3A 3F6XA 3GENA 3FXZA 4DGGA 3C4WA 4N0SA 2X7OA 5D11A 1J7IA 1XH8A 3RPRA 2VTQA 4FEQA 1M2RA 3RK9A 4UMQA 5AUWA 3WZUA 4OBQA 3NGAA 2BKKA 3NUYA 4YBKA 3POOA 3QQGA 4RJ8A 2EWAA 4LUEA 4BBEA 3VBYA 4IWQA 5AV2A 3A4OX 4RG0A 3ZO3A 3D94A 1JKKA 4FKRA 5FUTA 4XG6A 5HG7A 4D2VA 4FVRA 4ZTMA 3KK8A 5HIBA 2ITPA 5BVWA 3U6JA 2W1ZA 3KKVA 3MIAA 4F7LA 2FSLX 4DGOA 5DI1A 3COMA 3FMJA 2C0IA 2UW6A 1SM2A 3ENHA 3Q4UA 5A6NA 4PMSA 2HXQA 5EKNA 1OI9A 3VJOA 3UQFA 2QD9A 5IG1A 4HVGA 2ZOQA 4MQ1A 4X3JA 4IAAA 4RX5A 2XNGA 2ITUA 1SNXA 3BX5A 3K5VA 4PF4A 3IG7A 3FJQE 3V6RA 3LE6A 4FKGA 2BRBA 1AGWA 3DJ7A 5J8IA 4HVDA 2ITTA 5JFVA 3HDMA 3BU3A 5IA5A 1Q24A 1V0BA 2XNOA 3ZCLA 3UOLA 4ZLOA 4YZ9A 5CI6A 1SVGA 1E9HA 3ROYA 2PVHA 2XS0A 5LCKA 5EQEA 3F3UA 4HZSA 5DNRA 3QX2A 3ULZA 2XZSA 2PVKA 4BCKA 5KMKA 4ACCA 2R3OA 2NRYA 3C4XA 3EB0A 1CSNA 4BDDA 4CRSA 1O9UA 1YXVA 3OWKA 5CT0A 2JD5A 1GZ8A 5CVHA 4BDIA 3VUTA 3F2AA 4ITIA 3Q2MA 3FYJX 2ZAZA 4D1XA 4ASEA 2B7AA 3UG2A 4AW0A 4HYHA 4A9TA 4PMMA 2VU3A 2PL0A 4LGDA 5EDRA 1VYWA 1PMNA 4P2KA 5C9CA 2RG5A 5KHXA 5AX9A 3S4QA 4RIYB 4M67A 4XG2A 2ITQA 3GI3A 3K3JA 5GJFA 3TNHA 4AW2A 4IB1A 4ZAUA 1VR2A 4FMQA 1OBGA 4FE2A 4ZSJA 4KIPA 5FBOA 5AADA 3UO5A 3UZTA 4OLIA 2ZM1A 4JDIA 3P78A 5I4NA 4AT5A 3NAXA 2OFVA 5F20A 4AN9A 5EOBA 3U87A 1HOWA 5KMIA 3LXPA 1MP8A 2XK3A 3AD5A 4FKJA 2BDWA 2J0LA 1OIRA 2WHBA 4HNFA 4O27B 4RIOA 3RKBA 3Q96A 4U0IA 4C35A 5HQ0A 4NYEA 4RIWB 4J97A 4G2FA 4DFUA 2GS6A 4PNIA 3EQDA 5F9EA 3FZTA 1XH9A 4H36A 4J95A 3IGGA 2X2MA 5CX9A 1OITA 2CLQA 2QKWB 2W4KA 3GCUA 2Z7RA 3TL8A 3UMXA 4E1ZA 5J9ZA 2QNJA 3UE4A 3UPXA 5M51A 4CGAA 2WXVA 4ANSA 2OZAA 2XRUA 5HCZA 4GJ2A 3BBTB 5GZ9A 5HKMA 3ZEPA 1E1XA 3OXZA 4FV6A 4XEYA 4IZ5A 3ZOSA 4G3CA 5BUIA 3FKLA 4B0GA 1XBAA 3ZLYA 3LFFA 4E26A 4Q2AA 4Z16A 2VTAA 2FSMX 3FC2A 5AP1A 3Q3BA 4TL0A 1GAGA 2JKMA 4GK3A 4KIQA 4EQCA 3QQLA 5DE2A 1ZAOA 3BPRA 4F6WA 3V5JA 4AE6A 2QU6A 2PVLA 4YJUA 2JIVA 1PXKA 1LEZA 5E8WA 4RC2A 2I0YA 4ANQA 4BDGA 1JOWB 2IZRA 4ZY4A 4V0GA 3KN5A 1UKIA 4OBOA 5CF4A 4K18A 3V5PA 4CYJA 4CVAA 1R78A 4IANA 1TQPA 5DGZA 2BUJA 2JDOA 4KNBA 3TIYA 2HAKA 4L44A 4RSSA 1U46A 3QCSA 4YC6A 5D41A 4D2TA 4EL9A 5CSHA 5EOLA 2PUNA 4J1RA 5F4NA 5AUUA 2HW7A 2GDOA 3UTOA 5HCYA 2UZNA 3TG1A 4HYSA 5HORA 4C33A 5DT4A 3R73A 4C2WA 4AZVA 2YN8A 3PP0A 4CG9A 4G6NA 2C6EA 3A7HA 3CQEA 4QPSA 4ONAA 4O38A 5AUYA 3UQGA 3N4UA 4M69B 4F1OA 1PMEA 5J87A 3D7TA 4IVBA 3VQUA 3TN8A 2PVRA 3OG7A 2HIWA 3EN4A 4OT6A 3WE4A 4C62A 5CAUA 2WIPA 4R1VA 2ERZE 5JRSA 4IJ9A 1UU8A 2OICA 1ATPE 4I6HA 5HTBA 2C6KA 1WBTA 4U97A 4F9BA 2A19B 4BCGA 4G9CA 3FPMA 1OL2A 1W82A 2VO7A 3CIKA 4FYOA 4I22A 1F5QA 3PPJA 4C61A 4CG8A 2WQNA 3ODYX 4DG0E 3DLSA 5AAGA 1XHAA 4ZJIA 3QA0A 4LMUA 2HZ0A 4FYNA 1G3NA 1WBWA 4DLIA 3AC5A 4FTOA 2LAVA 3OCBA 4FA2A 3Q5ZA 5CVFA 2J51A 3QTXA 3Q53A 3UVQA 3EYHA 4YGAA 4NIFA 1OL1A 3VJNA 2QOKA 3E8CA 3QLGA 3VS7A 4LL5A 5HO6A 2CNVA 3N51A 3CTQA 2XH5A 4YO4A 5HO7A 3ORKA 4ORKA 5M08A 4HGLA 4ANMA 3R8UA 5ANJA 5EHLA 2YCFA 4D4VA 3FL4A 4EOQA 4DEDA 1U5RA 2RFNA 3CEKA 2VRXA 3NVKI 2R5TA 3D5WA 4FTTA 2YJRA 2CNQA 1QPJA 3OF0A 2YWPA 1ZOHA 5K4IA 5CQWA 4E93A 1DI9A 2ITZA 3DS6A 3G90X 4BKZA 4DGNA 3KY2A 4WRGA 5E1SA 2J9MA 2E2BA 3PSBA 2WMQA 4CZYB 4YHJA 2XIXA 4IACA 3DXQA 1ZRZA 3FQHA 4C4GA 4C4EA 2BRNA 3D5XA 4JBQA 2G2FA 5LMBA 5GHVA 2PMLX 5CEQA 5AV1A 3K5UA 2BDFA 2H34A 5DEWA 4DEIA 3FLNC 3U51A 5CEMA 4FV3A 3VBXA 3HAMA 3HGKA 3SAYA 2QR8A 5TO8A 5L2WA 3BYMA 5CF6A 4BGGA 1U54A 3DOGA 5JZJA 4QQCA 3CQWA 3DBDA 2EB2A 3DKOA 4WBOA 3PA3A 3SDJA 5HTCA 1XJDA 3IW7A 1P4OA 3A4PA 4FSYA 3Q9WA 3IDCA 3RPYA 2FA2A 2XUUA 1NVQA 3ZZEA 4A4OA 3AD4A 4RQVA 4I5HA 4APCA 4EUUA 4QTAA 4Y5QA 4F6SA 2W99B 3RVGA 4KBCA 5KO1A 4H05A 3BLRA 3D7ZA 3BV2A 4O2PA 4FSQA 4BFMA 5CAQA 5K4JA 5IQBA 4DG3E 2B4SB 4FIEA 2IN6A 3W2QA 1QL6A 3MVHA 5E7RA 4EHVA 4FNYA 3E3PA 3K2LA 4MXCA 4PDPA 4RQKA 5IUGA 3DKFA 3R1YA 3PLAE 5DMZA 3HMNA 4RVTA 4WG3A 5EDQA 5K9IA 4YJSA 4WO5A 3E5AA 3QZGA 4AA4A 5EI6A 3DU8A 4ZTHA 2EXMA 4YPSA 3EQIA 2CLXA 1XKKA 4XS2A 5AEPA 5BMSA 2BRGA 5FP6A 5BUEA 4C58A 1YXUA 4WHZA 3KXXA 2YCRA 3VN9A 1Q41A 3R28A 3FPQA 2BIYA 4Y73A 2Q0BA 2W1IA 4GT3A 4BWXA 2ZVAA 4EK6A 2A2AA 3A7JA 3GOPA 5EM6A 4EBWA 5HZNA 2YACA 4ITJA 4UXQA 1WBOA 2OWBA 2XA4A 3RZBA 4AT3A 2V0DA 3QTIA 4IVCA 1I09A 1SYKA 2OBJA 1YOJA 2QO9A 3IONA 5AP6A 5K0KA 4F70A 4C4FA 4N4SA 5LWNA 3HNGA 5JFSA 3LFSA 3QXPA 4FZAB 4I0TA 1RE8A 4FKUA 5AR8A 2J0JA 5JGBA 3SOCA 4EOOA 4RFMA 5FDXA 4ID7A 5CTPA 4M84A 3SG8A 3G6GA 4AZWA 3LFAA 4R77A 3KB7A 1PXPA 4HGEA 5CSWA 4FZFB 5KKRB 3GC0A 5BYLA 3RPSA 4CFNA 3R2YA 2GSFA 3MY0A 4LRJA 4FR4A 1OMWA 4ZK5A 4EH8A 4U8ZA 4Z3VA 4F0GA 2Z02A 4QP1A 2CN5A 3UODA 3NYXA 5GZAA 4OTGA 3KREA 3VUKA 4G1WA 1HCLA 2IW8A 3NYNA 2OIBA 4S31A 3FMDA 1PRYA 2FUMA 4YJVA 3F3VA 4NM5A 5LVNA 5C8NA 1STCE 2C47A 2IZUA 5HICA 3H9OA 4S30A 5DYJA 1OUKA 4CKRA 4I5MA 3UBDA 1KUTA 3KVWA 5ANIA 2H6DA 1YXSA 4QMYA 1PMVA 4BICA 2ZYBA 1IAHA 1OL7A 4RWJA 2GNFA 3VQHA 2RL5A 3ACKA 4IAYA 3SXRA 1XH5A 5FP5A 3A61A 4LRMA 4BIBA 2X4FA 4RJ3A 5HESA 2C6OA 5AR7A 3RMFA 4NM7A 2UVZA 4H3QA 4NFMA 4XG8A 3R1NA 5KMJA 5EK7A 3EKKA 4ENYA 3CTJA 4IHPA 5HIEA 5H8EA 3S3IA 4L6QA 2RFSA 4KAOA 4QMOA 3ZM4A 5HNBA 5HTIA 1Q5KA 2RF9A 3WYXA 4RWKA 4V05A 2CSNA 3AC1A 4BDBA 3A7GA 3DA6A 5B0XA 3DKGA 4EK4A 3ORNA 2XCHA 2W1GA 1J7UA 2JDSA 5BMMA 4ZLZA 4DA5A 2OO8X 3ZSHA 3L9NA 4QD6A 5AAFA 4KA3A 4QQJA 4CFMA 1YHWA 4IMYA 3PJ2A 2VGPA 2ONLC 1KE6A 3PVWA 4IFGA 2G01A 4AW5A 2CPKE 3NZ0A 3NRMA 3PPKA 3R7IA 1OB3A 2DQ7X 4ZS0A 3ZMMA 2E9PA 1WBPA 3KRWA 4LOOA 4YC3A 5D10A 1TKIA 2YIQA 4BCMA 3QQFA 2Q83A 2JKQA 4R1YA 5I9XA 4JS8A 4JIKA 3QKMA 4QYFA 2YWVA 2BCJA 2QOHA 3EOCA 4AT4A 3DGKA 2HZIA 1QMZA 2C0TA 1PYEA 2GQGA 3R22A 4XLIA 4DEGA 3FI4A 2ITXA 2VTLA 3R8ZA 5JFXA 3HUCA 1GZOA 5LCJA 4TWPA 3DPKA 3G9NA 4QMWA 5JRQA 1Y6AA 3M11A 4RJ7A 5EM7A 4YTIA 5KZ0A 2OZOA 3ERKA 4FEVA 4PV0A 2F49A 3EQHA 3PJ8A 4L3PA 4I5CA 3CC6A 3PVBA 4YC8A 4UN0C 4EC9A 3A62A 5EHOA 3LFCA 4MX9A 2JKOA 3H0ZA 2R3RA 5IH6A 3EJ1A 2IVUA 4E4NA 3O71A 3PXQA 4FGRA 2X4ZA 2J0KA 3QC4A 4DITA 4UMPA 2XK8A 4CKIA 3BHYA 3TKUA 4FTLA 5LVOA 3JUHA 4JX3A 5BVOA 4GH2A 2CNUA 2P2HA 3ET7A 5HVYA 4EZ5A 3ANQA 5E91A 4JJRA 3TZMA 2PE1A 3R7UA 1JKSA 4IZYA 2WTCA 4M13A 4YO6A 3DJ6A 3L8VA 3FLWA 4TYJA 5CU4A 4N57A 1ZZ2A 4FKIA 4MXXA 3ENMA 3UYTA 3KN6A 3E88A 3F2NA 5J1WA 2RKUA 4QMPA 3VBWA 3D83A 3HRFA 4CXAA 4GFMA 4FOCA 4U6RA 3KRRA 1M52A 3Q52A 4G16A 3FZOA 3I4BA 3T3VA 2OF4A 2Y8OA 2WMWA 2QCSA 4YBJA 2XBJA 2C5YA 2QODA 2J5EA 2UZBA 5DOSA 3D2KA 3DBFA 3GEQA 3HUBA 4MF0A 3CTHA 3OP5A 5ANKA 4FG7A 3DZOA 1OKZA 1UWHA 3Q32A 1FGKA 2YDIA 2X9EA 2R3HA 5TOZA 5FEEA 4C3RA 4ZZNA 2F7EE 4UALA 3NVMB 4UZHA 4Y46A 4MD9E 3GFEA 3ZUTA 2QURA 2VO0A 3BQRA 3IW8A 3LOKA 3QHRA 4KRCA 2Y4IC 2XNEA 4FL3A 5D7AA 2B1PA 3KCFA 4WNPA 3HRBA 4UWBA 4YJTA 3VS5A 3KU2A 3W18A 5KMMA 2B52A 3JXWA 4OTIA 4IAFA 3CKWA 4IM3A 2B9HA 2OJFE 4FZ7A 5IEVA 3H4JA 2J2IB 3QC9A 4PTEA 4AU8A 4L42A 4Y83A 4BI1A 4MXZA 4O82A 1XO2B 2OGVA 2XF0A 4FT9A 3FSFA 4F7JA 1V1KA 2YM6A 5FLFA 4APPA 4GCJA 4EH3A 4JG8A 2KULA 1OECA 3OC1A 3KRLA 3FMKA 3G51A 2F7XE 3CJFA 4DCAA 2CMWA 4NTSA 1WVYA 2RFEA 3FSKA 1T46A 2OJ9A 5BVFA 4WNKA 4UWYA 1UVRA 3CY2A 5I9YA 3FEGA 1ZOGA 2H96A 4RIWA 5JZNA 3PA5A 2R3NA 3QUEA 3LM0A 3RM7A 5AP2A 2HWPA 3TDVA 2GQRA 1IEPA 3KF4A 2PULA 4GVAA 1U5QA 2VX0A 2V62A 4DBXA 2G9XA 4RX7A 3UGCA 5JMSA 4PDSA 2WU7A 2VTSA 3POZA 4MEDA 4ITHA 1Z9XA 2RG6A 3AQVA 2C6MA 3MJ1A 4FX3A 4MH7A 4R8QA 3WIKA 5EYCA 3SD0A 4BKYA 3EQRA 4IWPA 3MV5A 2HZNA 3GCQA 4QP9A 3DAJA 1H24A 4U80A 4K8AA 2WMBA 4M68A 2X7FA 2OLCA 3LLAA 4I1ZA 4BZDA 1FINA 1OPKA 1XH6A 3LPBA 3NCGA 3QQJA 5L8KA 2G1TA 1SVEA 5CI7A 3ZO4A 1JBPE 4WNOA 3QTQA 3UIUA 5M4FA 4AGCA 3TTJA 5A46A 4AXAA 2I40A 3ZFYA 4WG4A 2VWIA 4DYMA 5FDPA
chains in the Genus database with same CATH superfamily
3MFSA 4AXCA 3WILA 1PW2A 4F9CA 4BWKA 5KX8A 1W84A 4J98A 4UWCA 1GZNA 1YWNA 2RFDA 3QL8A 4YHTA 5J95A 5A14A 5JN2A 4LV7A 3P4KA 4DDGA 5HE1A 2GHLA 2XIRA 4NT4A 3OCTA 4C4JA 1ST4A 5EQPA 2PMIA 4GJ3A 3FHRA 3ORLA 1ZLTA 1JSVA 4S32A 5H2UA 5CF5A 2IVSA 4O6EA 3Q4CA 4BDHA 2AYPA 1UU9A 2CKEA 2FGIA 3SW7A 2CGVA 3Q6WA 5HLPA 4D2SA 3JY0A 3O7LD 4QQ5A 5E8VA 4R78A 4W4XA 1SVHA 3DKCA 4O4EA 4C02A 4MCVA 1VLRA 3NS9A 2F7ZE 2YEXA 3C4CA 1BLXA 5L2QA 5C8KA 3E93A 3R8VA 1S9IA 4K33A 2F4JA 3OY3A 3Q9XA 1ZZLA 4BHNA 4ALVA 2YIXA 3WBLA 3CY3A 4X2NA 3ZHPC 4A9YA 3SX9A 2XNMA 4BF2A 4G9RA 2Y7JA 4GFGA 3EMGA 3BEGA 4JDHA 3LCTA 2J5FA 4R6VA 3R8LA 4A07A 5E4HA 5GJDA 3W0RA 4Z55A 3CKXA 4FUXA 4IM2A 3SQQA 3MJ2A 2JGZA 2XCKA 4DTBA 1FQ1B 4FEUA 3AC4A 4JDJA 3I5ZA 5CF8A 3NFGB 1H4LA 2V5QA 4G34A 4KINA 2ZB0A 3TUBA 1XH4A 2P2IA 3WI6A 3ZH8A 4TWCA 5AIRA 1URCA 4QMUA 1OBDA 4F1TA 4LOPA 4CTBA 5E1EA 3HMIA 1H26A 4ALUA 3R9HA 5KE0A 2JBOA 3PPZA 4FTRA 4TRLA 1Y57A 1NVRA 2UZTA 1L8TA 2YM4A 4XP2A 2UW0A 5B2LA 3PXYA 4E4LA 4IEBA 3V5LA 4NK9A 4QTBA 4GSBA 3E62A 2XKEA 3DJ5A 3FAAA 1KE7A 4EHZA 3LQ5A 2Z60A 2XK6A 3HECA 4FOBA 3ATSA 4BGHA 2WTKB 4AOJA 3KXMA 3GC7A 4A9RA 5AR4A 1K9AA 2O3PA 2YDKA 2YISA 5BYZA 4L3JA 4AF3A 5M53A 2X8DA 2VTTA 3BRBA 2W1HA 3II5A 3QTRA 2QOBA 4X3FB 3FMNA 5A4QA 2XEYA 5LVMA 4IM0A 5L4QA 2BRHA 2O8YA 3HA8A 1J91A 3QALE 4DEBA 1WMKA 4ACDA 3UQCA 3DFCB 5DPVA 3SLSA 2UZLA 3OWPA 2I0HA 3F5GA 2GPHA 3BV3A 5CU2A 2ZM4A 3R01A 2JKKA 4DH3A 4NWMA 5FXRA 3NUPA 4FSTA 3QA8A 1GIIA 3VULA 2WZJA 3PYYA 1OZ1A 1R39A 2WMRA 3DCVA 3L9MA 4WUNA 4FEXA 2XJ0A 4R3PA 2WEIA 5M4IA 3R7EA 1R0PA 4S33A 1Q3WA 3O8TA 2WOUA 4BIEA 3QFVA 5EW8A 1DS5A 3UG1A 2W96B 3OHTA 3PIZA 4EOKA 5K5XA 3NYOA 4JR3A 5D1JA 2XM9A 3EN5A 2YA9A 1ZYDA 3C0IA 3KF7A 2X1NA 2IJMA 1UA2A 4NM0A 4CYIA 2PZRA 3H10A 2PZIA 3MPTA 4GVJA 3RWQA 4DCEA 2NO3A 4DT9A 2PMNX 2HENA 3FKNA 2CGWA 3KULA 3OXTA 4IB3A 4QT1A 5CSXA 3C51A 2QI8A 3GQIA 4MXYA 4O7SA 3NDMA 1K2PA 1JAMA 5AR2A 4NL0A 4U45A 4E6DA 2IWIA 5C27A 5AP4A 4S2ZA 3ZDIA 5FTGA 4EH2A 1TQIA 3RNYA 3DNDA 4WOVA 2WD1A 3SHEA 3CLYA 5I3RA 3FI3A 4QMLA 4YLLA 3IW5A 5BVDA 1Q99A 4C8BA 3E8EA 1PMUA 1FVTA 3P79A 4L46A 5IA3A 5ACBC 2CGXA 1DM2A 1LEWA 2GHMA 3NLBA 4MK0A 5DR2A 1W2DA 2C3KA 4ANNA 5HO8A 4PY1A 4TWOA 2EVAA 2C69A 3W1FA 4YLJA 3L8XA 4E5AX 5JFWA 1YI4A 3OVVA 1S9JA 3DQWA 2JAVA 4RVMA 5ETIA 4F65A 2ONLA 4AAYA 5CNNA 2PZPA 4HYUA 4XRLA 3MFUA 3FQEA 5CSPA 3DY7A 1H1WA 5CLPA 4HVSA 3AMYA 2P0CA 3RWPA 4EQUA 3DTWA 4FZ6A 5HOAA 3R02A 4NKAA 4O1PA 2X0OA 4IB5A 4QYYA 5HG5A 3VUHA 4O83A 4GKIA 4ASZA 2PVNA 3NNVA 5IEXA 2C30A 3R04A 5LXMA 3UNKA 3V8SA 4WUAA 4J99A 5AV4A 3HZTA 3ZSGA 3FV8A 3OOMA 5L6WL 4B9DA 4Q9SA 3NNXA 1OIQA 4OTDA 4CMUA 1F0QA 2UZOA 3EN6A 3DK6A 4RX9A 5KMLA 3A8WA 1PXLA 4M7IA 4MTAA 2QR7A 3QD3A 4FTQA 4GEOA 3ZC6A 5IQHA 4O6LA 3LJ0A 4I4EA 2XKDA 4DF3A 2V55A 4QP6A 4WKQA 2CN8A 3R9OA 2J50A 4I23A 4FVPA 5JH6A 4FNWA 4BTJA 3GCVA 1ZYJA 3QAME 4O96A 3TZ9A 2GU8A 3OFMA 3UIXA 3P23A 1CKJA 3QU0A 4E20A 2PU8A 1YI6A 4E4MA 5IUHA 5ANEA 1OPLA 4BBFA 2HELA 2OKRA 5E8ZA 1JWHA 4X2KA 2ZMDA 3UVRA 2WEVA 2Z8CA 3CGOA 4AZFA 4D5HA 1YW2A 2JIUA 5E8YA 4DGLC 5AV3A 2UUEA 3QTZA 3LFQA 4KKHA 3BHVA 3W16A 5IQDA 2VGOA 3M1SA 3MH1A 4TW9A 4D9TA 5L2IA 4MF1A 4O0XA 3TJCA 3N4TA 4FJVA 2IO6A 3AXWA 4UEUA 4WSQA 3QUPA 3G9LX 3PY1A 3ML1A 5HCXA 1W0XC 4YTHA 4OAUC 3NUXA 3CD8A 4NW5A 3T9IA 3QGYA 4HZRA 2VZ6A 5GIPE 3OUKA 4E6QA 4CFFA 3BU6A 4IZAA 3PJCA 3F5PA 1IA8A 3Q9YA 3GXLA 3ZRMA 5DFPA 3M2WA 4R7BA 2BZHB 3GC8A 2R7IA 2XMYA 4XV1A 4R3RA 2JDTA 4ZJJA 4N70A 5K3YA 3TNQB 4FTAA 3ULIA 1M2QA 2CCHA 1PY5A 1Q8YA 1GOLA 1IAJA 4JBPA 4TYHA 1BMKA 4YLKA 4Q5EA 5DBXA 2H8HA 4C0TA 4YURA 2WQOA 4LGHA 2C0OA 3NYVA 4NCTC 5KZIA 3SRVA 1RJBA 3WIGA 3LVPA 1Z57A 1VJYA 4IBMA 4CFXA 4CFVA 5L6OA 4NJDA 3HV3A 2KTYA 3DDQA 3H0YA 3WARA 4YZBA 5JQ5A 1ND4A 2IW9A 1JVPP 2GFSA 3VS0A 4XBRA 1WVWA 2W17A 5BYYA 4J96A 2C6DA 4EORA 3O7LB 4UX9A 5C01A 1QPCA 4BDJA 3BE9A 1R0EA 3ITZA 3KMUA 3GOKA 3PSCA 3RM6A 2VWZA 4PPBA 4YMJA 2XKCA 2WOTA 3FUPA 4OW8A 1UU7A 1KE9A 2J4ZA 2WTDA 3GU6A 3ORZA 4FICA 1M14A 4UYNA 2XBAA 4QDEA 2BIKB 3RTPA 4ZMEA 3HP2A 3R9DA 2WFYA 1PXMA 1IR3A 3W2OA 3VO3A 5AR5A 2ITOA 3MTLA 4QTCA 5JGDA 5H8BA 4NEUA 3QF9A 3W0PA 4HPUE 3DBQA 2B0QA 4EWQA 4ASDA 4XV9A 2AEGA 4CSVA 2P55A 1BL6A 1IASA 1VYZA 4JI9A 2VWBA 2SRCA 4FSMA 5DT3A 3ZXZA 3P08A 3BL7A 3PWDA 4L68A 4W9XA 3LW0A 5HE2A 3QHWA 4XOYA 3ZRLA 5CU0A 4FT5A 4FKWA 2UW8A 4A9UA 4N6ZA 3HRCA 3W0SA 3BYOA 3MFTA 4Q9ZA 3MB6A 3MA3A 2E9UA 5J7BA 5J1VA 5AUXA 1MRYA 4QPAA 1GIJA 2WMXA 2W4OA 3CR0A 1G8AA 4LDTA 5M44A 3F66A 5D12A 4ZP5A 4XG3A 3LM5A 1IG1A 3BYVA 2BVAA 2JC6A 2Z7SA 2C3JA 3QZHA 5B2MA 4RPVA 3WF6A 2ITYA 1H0WA 2X8IA 3GU5A 4U79A 1VEBA 3F3TA 2J6MA 3ZUVA 4PP7A 3P0MA 3ANRA 3FLYA 2YJSA 3DLZA 3A60A 4LV5A 4JLCA 1WCCA 4ARKA 4DC2A 4MNEA 3DTCA 1B6CB 2PYWA 4EJ7A 4R7HA 2OI4X 4EH4A 5D7VA 5J9YA 3LJ1A 1GZKA 1BI7A 4FG8A 5CNOA 3U6HA 5E8SA 4O7TA 4FV8A 3LFBA 3AKJA 2BAQA 4EOLA 4EYMA 4QMZA 3QTUA 3FZ1A 4FGBA 4U3YA 1XH7A 4TNBA 4U42A 4EBVA 4I0RA 4RWIA 3ZFXA 3WZKA 2W1DA 1RW8A 5EYMA 3VS2A 4HGSA 5CZHA 4A06A 2P33A 1H00A 3D9VA 2BKZA 3PXZA 1MUOA 4RVKA 5DRBA 2X6DA 4ZEGA 1H08A 3UJGA 5M4UA 3QZIA 3RGFA 5JKGA 3D0EA 3Q60A 3LMHA 2HY81 4ZSLA 3PDTA 5IA4A 4CFWA 2GTNA 5LVLA 5HVKA 1UU3A 1AQ1A 3Q6UA 5BUJA 2PVJA 2A0CX 4M3QA 2OIDA 4YJQA 3UIMA 3ZONA 4GK2A 3IOKA 4OUCA 3EL8A 2X9FA 3EFJA 4XG4A 2VO6A 1ZYSA 4MNFA 4XP0A 2I6LA 3TTIA 4GU6A 5LQFA 4EZ3A 5FGKA 3SXFA 1M7NA 4GG5A 4Y72A 3ZUUA 2BZJA 2CCIA 3KRXA 3LCSA 4FKVA 4IFCA 4D5KA 4YU2A 3D2IA 3RAHA 5K5NA 4AZTA 4BJJA 2AUHA 4O7NA 1NVSA 3MH2A 4ALWA 4B8MA 3FI8A 2GFCA 2YIWA 1GJOA 4BTMA 3L9LA 5LWMA 4FTNA 4JNWA 3EN9A 4HCTA 4LM5A 5TKDA 3U8WA 3BI6A 5LARA 4MXAA 4F7SA 4FUYA 2BHHA 2PUPA 4O84A 3C1XA 3ZM9A 1OL5A 4YNEA 3ZRKA 3VF8A 3C4EA 3MWUA 3NX8A 3PIYA 4JG7A 4NSTA 2C6TA 2WMVA 4GIHA 4LMNA 4OT5A 3GU7A 3IQ7A 3UP2A 4BCQA 4CMOA 2XALA 3GT8A 3QGWA 5DLSA 4DFNA 3RAIA 4IDVA 2FO0A 3VHEA 3NUAA 3U9NA 4I3ZA 2C5OA 5KBQA 3V04A 4B4LA 2XK4A 4MD8E 1XBCA 4M15A 5EFQA 2VNWA 2GS7A 3MY5A 4XMOA 4BYIA 5CANA 3ACJA 3NIZA 4G3FA 4ZTNA 5LMAA 4EOPA 3ALOA 2YLFA 3F7WA 4L43A 5IEYA 3JVRA 4I93A 4MYGA 4BDAA 2X2KA 2YM5A 3PWYA 4U40A 3Q4ZA 1APME 3ORIA 4FV1A 5TF9A 4KIKA 4KB8A 3OWLA 4EZ7A 5KUPA 3LHJA 3NNUA 4JR7A 5EQYA 3W2RA 1F3MC 4DHIB 4O4CA 2F2CB 5L2SA 5HU3A 4FIGA 4O4BB 5C03A 4WG5A 5ANGA 4A9SA 3R8PA 4AS0A 2ERKA 4FK6A 3MA6A 4BYJA 1DI8A 3COKA 2PE2A 1K3AA 4KBAA 3BHUA 5AA9A 3TUDA 3PG3A 1TVOA 4MAOA 3AMBA 4AOIA 3KL8A 5AP5A 3RZFA 5TT7A 4JQ7A 3LMIA 1KV2A 3R6XA 4G31A 2ZV8A 3RPVA 2PTKA 3R9NA 3ZXTA 4CZTA 3FMLA 3SOAA 4GUBA 1V0OA 1JSUA 4CKJA 3FDNA 4FSZA 3VBVA 3KA0A 3HLLA 2DS1A 3UVPA 5L3AA 2H9VA 1PKDA 4M12A 3LLTA 2VWVA 3FMMA 3GUBA 2FVDA 4LFIA 2YFXA 3VRZA 3N4VA 4M66A 4OTPA 2OH0E 4RFYA 4IAKA 5BQ0A 5FXSA 4AOTA 4O7YA 2BROA 3OT8A 5HVJA 3H9RA 4I21A 5ETCA 1YHSA 1QPEA 1LR4A 4X3FA 2IVTA 3W0NA 4F63A 4O7LA 4NZWB 4GIIA 2XP2A 4V0GB 3LXLA 3WF8A 2YABA 5AUVA 5I0BA 5KKRC 4O4FA 3U9CA 3WZJA 5EYKA 3IO7A 4RIXB 5TR6A 1Q97A 4FKLA 5M56A 2R3KA 4EH7A 1FGIA 1REKA 3OZ6A 3AKLA 5CQUA 3MESA 3V8TA 3SGCA 3UZRA 1ZMVA 4IVAA 2YM3A 1Z5MA 3G33A 4LL0A 5E8XA 4ANBA 3VHKA 1DAWA 4XUFA 3SVVA 5AP0A 4EYJA 2UVXA 4FV0A 4JVGA 4C36A 4JRNA 4C3PA 4X6QC 3EH9A 3D7TB 3S95A 3BL9A 3AC2A 4D9UA 4O91A 1WBVA 2ZDUA 1YDRE 1FMOE 2C6LA 1PJKA 4P7EA 3F88A 3PE1A 4AN2A 4BY9E 2ZV7A 4OTHA 3R63A 1OIYA 5AM7A 4FSRA 4B6LA 5J9LA 3UDSA 4BTFA 4XH6A 1YWVA 3DV3A 4DEAA 3MDYA 5HBHA 5FEDA 5HGIA 4QP4A 5D9HA 4W8DA 1H27A 2J0MB 4IDTA 4EUTA 4EK8A 4BDCA 2JLDA 3PTGA 1M7QA 2EU9A 3QRIA 1XR1A 3HA6A 3TCPA 4JDKA 1Y8GA 2V7AA 3FMHA 3ELJA 2IZSA 4NIFB 3CGFA 3BLAA 1O6KA 3MPMA 4FKTA 5JQ8A 1LPUA 2WTWA 3E7OA 3EFLA 4FIJA 4K1BA 5C4LA 4FIHA 1FVRA 3TT0A 2VTNA 2XYNA 3NW7A 5KCVA 4E5WA 4WRSA 5F94A 2X6EA 4ACMA 4E4XA 3AG9A 1GY3A 2EB3A 3BIZA 3ZYAA 2G15A 3QXOA 4AXDA 3RCDA 3DXNA 3DBCA 2R7BA 5L2TA 2C5XA 4LG4A 4Y5HA 5CZIA 5AM6A 2BRMA 4IX3A 1GNGA 3BYUA 4YJPA 2X8EA 4YUQA 3NEWA 2ZV9A 3UP7A 2XJ1A 5FG8A 3V5WA 3EN7A 1ZYLA 4RIYA 3RHXA 3MW1A 2ZDTA 3JVSA 4NCTA 4DEEA 1ZARA 3A8XA 3MH0A 2QOQA 4IIRA 2PMOX 4JIAA 4XCUA 4EWHA 4O0RA 3GBZA 4EH5A 3BHTA 1BI8A 3TACA 3UDBA 2X0PA 4J53A 4DHFA 4YTCA 3TXOA 3EFWA 4AXEA 2OXXA 4XX9A 3SW4A 1H0VA 3TV6A 2IEWA 3P5KA 2GNGA 4D4RA 3MVLA 2IPXA 5DVRA 2QLQA 3EIDA 4FODA 2XRWA 5KMOA 4DT8A 1Q62A 3I79A 5DHJA 5AWMA 1PYXA 2LGCA 4IX5A 4EKLA 3GP0A 5AA8A 4K11A 2JFLA 5HX6A 2IG7A 4PUZA 4Q5HA 4BDFA 1BKXA 2V7OA 4FT0A 4A4XA 1G8SA 4I6QA 4YR8A 1Q8WA 4XNEA 4BCNA 4KSQA 4LOQA 4AZSA 4DH5A 2DWBA 4QYEA 2X2LA 1U4DA 4RRVA 3NUUA 4AE9A 5IDNA 4B7TA 5CSVA 5IA2A 4O7RA 3D4QA 4XLVA 3UOKA 4OR5A 4PDYA 4QMMA 4U81A 3PXKA 4ZTQA 2ZFYA 3AKKA 2XIYA 5F1ZA 3BEAA 3OW4A 3P7BA 5DA3A 3VONA 4AACA 1FVVA 4TYIA 5CYIA 3TEIA 2QO2A 1IA9A 3VUGA 4O0SA 3PA4A 3D5UA 4ZSAA 4JX7A 3OEZA 4U9AA 3KQ7A 4O7VA 1OKYA 3BELA 3E64A 4GV1A 4BL1A 3OWJA 2R3FA 3QD2B 3SKCA 4IX6A 5EHYA 2QOFA 2UW4A 5HEZA 4BIDA 3S1HA 2CHLA 4ZTLA 4FSWA 4ENXA 2WNTA 4L53A 2CKQA 4ZLYA 2VUWA 3EYGA 3FC1X 5JGAA 5E8UA 4RLKA 5C1QB 4FEWA 2Y0AA 3E7VA 3R7GA 4ZZMA 2UV2A 3EZRA 3GCSA 4DH1A 4BZOA 3VVHA 2C4GA 3C5IA 4I4FA 3R0TA 4L45A 4M69A 2QONA 2W5HA 1YVJA 4FV4A 4JQ8A 2YZLA 2YZAA 3MI9A 4MWHA 3UO4A 5CEPA 4FKPA 2PUUA 1OVEA 4X2FA 3H3CA 4EI4A 5FTQA 1WBSA 2GNHA 4G3GA 1YKRA 3BYSA 3RI1A 3PVUA 3HEGA 3KMWA 4IW0A 4IVDA 3ZBFA 4AQKA 4O81A 2JEDA 4YNOA 4FKQA 4MBLA 5AX3A 5I9UA 5CENA 4HYIA 4D58A 4EEVA 4PMPA 3UOJA 3UNZA 1UWJA 4D4YA 3C5UA 2OJJA 5IKWA 2J0IA 4RJ5A 2W5AA 4RC3A 5CU6A 3VBQA 3ZC5A 2HXLA 1NA7A 3QRTA 1YOLA 4CLJA 3U4UA 5A4TA 5I5ZA 4D55A 4MVFA 3MN3A 3EQGA 4EKKA 4PTCA 3I5NA 1KWPA 4UB7A 5EH0A 3O8UA 1YI3A 3R83A 3TJDA 3BGQA 5ICPA 4LRKA 3TV4A 4A4LA 4DAWA 3OTUA 3KMMA 3RALA 2XAOA 3HV7A 3ORPA 5IQGA 4YTFA 4BGQA 4GT4A 4DFXE 3O51A 2QOLA 3TMOA 3NIEA 3B8QA 5ITAA 3UO6A 3GVUA 1BYGA 2R3IA 1P5EA 3FYKX 3QQUA 4KRDA 4M97A 4WBBB 3EQFA 3BE2A 5HU9A 3PP1A 3AC8A 2WAJA 3QTSA 4PL3A 4L7FA 2JAMA 5HG8A 1BUHA 4PNKA 3VWAA 4NU1A 3R9RA 2DYLA 4G6LA 5IDPA 1OL6A 1ZYCA 3JY9A 3IDBA 3TM0A 1CKIA 3G2FA 3TKIA 3K54A 3GB2A 1YDSE 3OOGA 3PZEA 4HNIA 2OU7A 4W4YA 4ANLA 4EHEA 5M4CA 2F2UA 1HCKA 3KXNA 3KXHA 4F9WA 4F7NA 2CGUA 2W1FA 3DAEA 2BDJA 1EH4A 3EQCA 3V3VA 4EOJA 3FLQA 1H01A 3NWWA 2VTPA 4NW6A 2UZUE 3ZS5A 5CXZA 3LZBA 3CP9A 5M06A 3DQXA 3FBVA 1VZOA 4HCVA 2BR1A 5FTOA 5A9UA 2O2UA 4YJRA 3LCDA 2FYSA 2R3GA 1BL7A 4IB0A 3MGYA 1YRPA 2QOCA 3PIXA 5CT7A 4ZJVA 2AQXA 2O63A 2XJ2A 4BCIA 2VWYA 2WB8A 3DFAA 3RBWA 2BALA 5AFVA 3TI1A 5IQCA 3V6SA 4AFJA 5H9BA 3KXZA 5IH5A 3BGPA 2ETRA 2B55A 4X21A 4DH7A 5DRDA 3LCKA 4D1ZA 2GTMA 2I0EA 2VTJA 3PVGA 4IH8A 2OXDA 2IF8A 5FD2A 4A7CA 5AUTA 2WQEA 2WPAA 3L9PA 3MBLA 4FV7A 4IZ7A 5DWRA 2NP8A 4AP7A 4PX6A 4BI0A 1UNGA 3AOXA 2IW6A 2GS2A 3R2BA 5CEKA 4IAZA 5CXHA 3FXWA 3QD4A 4FV2A 2G2HA 1OIUA 4R7IA 4IWDA 4S34A 5FWKK 4QEBA 4WA9A 1SMHA 3FLSA 3H30A 1REJA 5DR9A 1OKVA 3PZHA 2C68A 1YXTA 4KS7A 3WE8A 1CMKE 1H07A 4DBNA 4XJ0A 4M14A 3O0GA 4JAIA 2X0GA 5KNJA 2UZWE 3MB7A 4YSMA 1W8CA 3BZ3A 4LYNA 3UMWA 2XM8A 3SC1A 4QYGA 1R3CA 4JT3A 2UW5A 5FQDC 2W5BA 4OGRA 5HI2A 4O21A 3EZVA 3PJ3A 3WZEA 2YM8A 4TPTA 5IU2A 3FI2A 1FOTA 3VC4A 3R00A 3K3IA 5E92A 4ACHA 3E63A 4DE4A 3R7YA 3I81A 4I6BA 2I0VA 3ODZX 2UW7A 4XHKB 4BB4A 4G6OA 4IWOA 2WTKC 4O0VA 5FBNC 1Y91A 4MBIA 4QDVA 2ZJWA 4P90A 4QMNA 3FY2A 2W1CA 3DAKA 4X3FC 2R3PA 3HYHA 4OTRA 3W8QA 3W0OA 3COHA 3OS3A 5CVGA 3VS6A 5DN3A 4UZDA 5HE3A 4E6AA 3SV0A 4MWIA 3LAUA 2XYUA 3PFYA 4F0FA 2UZVA 3GC9A 4QMTA 3ZLXA 3S00A 3F82A 4AGUA 3KGAA 3MTFA 3PY0A 2XK7A 4GYIA 2JBPA 1RDQE 3LMGA 4YZDA 4RA5A 3I7BA 4HVHA 3O8PA 4JL9A 2YHVA 1P2AA 2QO7A 3MY1A 5BPYA 5CWZA 4MBJA 4D0XA 4F9YA 4H1JA 5C26A 3MVMA 1J3HA 5HD4A 4AA0A 4L52A 3FMEA 4D1SA 4P5ZA 4BN1A 2Y6MA 2OFUA 4E8AA 5M55A 4ZTRA 4I5PA 1YQJA 2VO3A 3FE3A 3QQHA 4OBPA 2OF2A 3QRJA 2E9OA 2VWXA 2VX1A 4IC7A 3QRUA 4BHZA 2HWOA 4EC8A 3TZ7A 3WOWA 3JR1A 4FK3A 4GMYA 4IJPA 4FSUA 3BU5A 4ZSGA 3Q9ZA 4FTJA 3RAKA 4USEA 3R21A 3NW6A 2RGPA 2CKPA 3D15A 3OBJA 4U43A 4EQMA 3PLSA 2JIIA 4Y85A 2IZTA 3MH3A 4X2JA 4ZSEA 4U7ZA 4EH9A 4OTWA 4E3CA 5GJGA 4FNZA 2BTSA 2XVDA 4FVQA 2NPQA 3R7VA 4R5YA 5HBJA 1PXIA 3RPOA 2EXCX 2J90A 1XWSA 3I0OA 5BX0A 3AMAA 4P4CA 5L8LA 3TUCA 1JPAA 3HKOA 4U3ZA 4YZMA 2WO6A 4AGDA 2DUVA 1YWRA 3N9XA 2R64A 1L3RE 4BDKA 2B9FA 4F08A 2GNIA 4GFOA 1E1VA 3HMMA 5M07A 1MQBA 1QPDA 2A1AB 4PRJA 3RINA 4EOIA 4ZMFA 4FTKA 3WF5A 5EG3A 1MQ4A 3HMPA 3TNWA 4NH1A 2PVFA 5A4LA 1Q8UA 3V5QA 2YM7A 4NFNA 4BCOA 4CTCA 5LJJA 2Y4PA 5AV0A 3F3ZA 1ZOEA 4Z9LA 2I1MA 4BCHA 3ZO2A 4AX8A 3R8MA 2BZKB 3HV5A 3ZSIA 1J7LA 5EM8A 4TKSA 3VF9A 3WF7A 3OY1A 3I6WA 1NY3A 3JPVA 3VRYA 4YHFA 4KSPA 1CM8A 3V5TA 3E87A 2PUIA 1CDKA 4RIXA 3T3UA 3NFFB 3KCKA 2WMSA 2YAKA 4FL2A 3NCZA 1Q4LA 2EUFB 4GUEA 4UV0A 3THBA 4C4IA 4B8LA 3VUDA 3VIDA 5IF1A 1Y8YA 3RJCA 4QTEA 3UNJA 2OG8A 3GNIB 2HY0A 2HK5A 4KKEA 4EOSA 1B38A 2Z2WA 4RT7A 4GW8A 3VS1A 2PWLA 4AGWA 4LQMA 3W2SA 2B9JA 4CCBA 2E9NA 2R3QA 2C3LA 4RFZA 2C5NA 4KD1A 4U41A 3ZU7A 4DGMA 3D5VA 3GU8A 4L00A 4UXLA 3V51A 3NUSA 2YITA 3CD3A 1URWA 3I1AA 1A06A 3GCPA 3VUMA 2QVSE 2OIQA 1WZYA 4HW7A 3O2MA 4I0SA 3WF9A 4XP3A 5LOHA 5FM3A 5HNIX 5IQEA 1TQMA 3OROA 2WMAA 4CNHA 4PPCA 3ZTXA 4BTKA 4IX4A 3DK3A 2R4BA 4F1MA 4IQ6A 4EH6A 3TNPC 3VNTA 2ESMA 2QKRA 2HZ4A 3S2PA 4WSYA 3B2WA 3FZRA 4TT7A 5JEBA 2C1BA 4JOAA 4MQ2A 4AZEA 2R0IA 2WTVA 4O0UA 4ACGA 2X39A 3EQBA 4HPTE 3P1AA 4H1MA 4QP2A 2A98A 1ZXEA 5FM2A 2R9SA 4DLJA 5ETFA 2CDZA 4YZNA 3NPCA 5EYDA 4IADA 3VS4A 2YIYA 5A6OA 3U6IA 1FMKA 2UZDA 5HIDA 3UIBA 1AD5A 1RQQA 3IPHA 2ITWA 2W9ZB 2BFYA 4KIOA 5HG9A 5EI2A 1MRUA 4ZZOA 4G3EA 4X2GA 4RJ4A 3OD6X 3W10A 2HW6A 4BCJA 4FTMA 3TKHA 2GHGA 4GKHA 3SG9A 1PKGA 1ZWSA 2HCKA 2VWWA 4FC0A 3WYYA 4DEHA 4OAVB 2RIOA 4I94A 4TY1A 4ERWA 4IC8A 1X8BA 4C4HA 5EDPA 3HDNA 4C59A 3CPBA 4QPMA 3ORMA 4K2RA 4C3FA 1JQHA 2VN9A 4D2WA 4I24A 3QRKA 3OEFX 3ATTA 4QOXA 4RZVA 2C3IB 2QG5A 3O17A 4LV8A 3Q4TA 4L8MA 2QHNA 4EJNA 5CASA 3I6UA 3IOPA 3G6HA 4PQNA 4Z7GA 5IA1A 3FLZA 3P7CA 1MRVA 1SZMA 4LI5A 5DEYA 4BCFA 4CRLA 3EKNA 2XB7A 3A7FA