4J97A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic gain-of-function k659e mutation identified in endometrial cancer.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
282
Chain Sequence
LPEDPKWEFPRDKLTLGKPLGEGQVVMAEAVGIDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKETTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Cracking the Molecular Origin of Intrinsic Tyrosine Kinase Activity through Analysis of Pathogenic Gain-of-Function Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 282
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4j97A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4j97A01
4LOPA 1QPJA 4RA4A 3ULIA 5M44A 2B55A 4BWKA 2VTIA 3BCEA 3T3UA 4FR4A 4WIHA 3KVWA 3LFAA 4QD6A 5CU3A 5DA3A 4GIIA 3Q5ZA 1XBAA 3OTVA 3QKKA 4I3ZA 4MX9A 4UV0A 5AP7A 3R9DA 4L68A 3EIDA 4CSVA 4U0IA 4EH9A 4QYFA 4JBOA 1PYXA 1PKGA 4I94A 4E4LA 5DYJA 2ITYA 3DDQA 3LVPA 4L3PA 4FKLA 4AAAA 2P0CA 4FV2A 5BYYA 3C4ZA 3WYXA 3O2MA 2G9XA 4RPVA 2WMUA 4MXOA 2HXQA 4UWYA 3CR0A 4CMUA 4FT5A 3ACKA 3I7BA 3OY1A 4ZSEA 3H30A 2FSLX 3AC1A 4ONAA 3UOHA 2UW3A 4XBRA 5HU3A 4JI9A 4OTFA 3UP7A 2WAJA 3AC3A 3I4BA 3PWDA 5IQHA 3JXWA 4AA4A 2VX1A 4BIEA 5D1JA 2BR1A 2QLQA 2R3OA 3OT8A 3WF8A 2GS6A 2PVFA 3FE3A 3TUCA 3R9NA 3UO6A 4BCGA 2ERKA 5AA8A 4BCKA 4EORA 3CGFA 1O6LA 3FDNA 4QMLA 5L3AA 2PMLX 2BDFA 3COKA 2O2UA 3MFRA 3GCQA 4QYHA 3F61A 4F0GA 4BGHA 4QMTA 4WBOA 5K5NA 3IPHA 3HMNA 3MVJA 3WBLA 2Y7JA 4AGDA 2IN6A 2G2FA 3ENHA 4QP8A 5J9LA 3PA4A 1P14A 4FV1A 3C5UA 3QAME 5HTCA 5E8VA 5KMKA 3MVLA 3RPSA 3CE3A 3KQ7A 4O6EA 5K5XA 4GCJA 4FSTA 4O38A 3OS3A 3PVWA 3PLAE 2RKUA 1PXLA 1H25A 4PF4A 3BKBA 1FOTA 5HI2A 4CFMA 5J5TA 3SHEA 2W1EA 3QX4A 3UO4A 4BZOA 4CT2A 3GU7A 1J3HA 2VWZA 4HNFA 4I4FA 4C35A 5B2LA 3VRZA 4RWJA 1Y91A 4RIXA 5JZNA 3RAHA 4A4XA 2HWPA 5ANJA 5BVEA 4F65A 4DEAA 4TXCA 3QKLA 3ZSIA 4F6SA 2J0KA 3U51A 3BBWA 2HELA 4FTIA 3BPRA 3ANQA 3FLNC 3PSDA 2VUWA 4LOOA 4PL4A 4QP7A 2C5XA 4I0RA 5LMAA 4O82A 3OOGA 1MRVA 5AM7A 3ZO3A 3BHHA 4N6ZA 2W4JA 2ONLA 4ALUA 3DK6A 4IVBA 4M7IA 3CLYA 5L8KA 5F20A 2PE0A 3VUMA 4OAVB 4R7BA 5AAGA 4UWBA 3A7GA 1L8TA 2E9NA 3JY9A 3D15A 3TI1A 1GIJA 3V3VA 3R00A 3R02A 4R7IA 5IMEA 1YXUA 2XVDA 4D2VA 3PVUA 3UMWA 4JDIA 3R7EA 4FUXA 2CGXA 4XG6A 3TNQB 5DVRA 5EM7A 5IUHA 3RK5A 4XMOA 2ITUA 3PIZA 3Q2JA 2I40A 5ITAA 4BB4A 5IH5A 3UIBA 4XNEA 4ZLOA 2V7AA 1FINA 1R78A 2Z60A 4B4LA 3TUBA 4HGTA 4XH6A 2XK3A 4FKTA 5E8SA 4M0YA 1LUFA 5GJGA 1OIUA 4O1PA 4R3RA 4RLLA 4J71A 2OZOA 3PRFA 3VULA 2GNGA 3OG7A 4RBLA 3P4KA 4GFMA 4X7QA 4F7NA 3UZRA 5CI6A 2YCRA 4JQEA 4YGAA 3SGCA 3TDWA 1J91A 2HAKA 4G6NA 3ZHPC 2XBAA 1YWNA 3Q6UA 2ITPA 3QZGA 3R8VA 2O5KA 3Q9WA 4ALWA 2X8EA 4EZ3A 5M55A 1RDQE 2ZOQA 4RX7A 4FNYA 1M2RA 2JKQA 3HMIA 4FIJA 3QUDA 4RVKA 3VF9A 2IO6A 1P5EA 3CQEA 2QODA 3FKOA 3E63A 4PL3A 5M4IA 4FV9A 3LMIA 5JQ5A 3AC4A 1ZOEA 3OEZA 5FXSA 4Y5HA 5E4HA 2VTSA 4K2RA 4L53A 4LMUA 4AOJA 4BCNA 2UW7A 3ZS5A 2QU5A 4CEGA 2BILB 3WZEA 3H9RA 3LFEA 2AC3A 2VTHA 1ZY4A 4E26A 4JAJA 5ETIA 4CXAA 4F63A 4IZ7A 4RJ3A 4ASZA 4H39A 4OBOA 4C4GA 4O2ZA 2VN9A 5CYIA 3BYMA 4MD7E 4CV8A 3IOPA 4KIKA 4IB1A 4O27B 3ALOA 3AGMA 2WQNA 4XRJA 5CT0A 3R9RA 4PQNA 3AXWA 4UYAA 4Y95A 4USFA 2YACA 4J95A 1OBGA 4EHVA 3OZ6A 4L3JA 1CSNA 3C0GA 4K6ZA 1KUTA 1WVWA 4LOQA 5HIBA 3AMYA 2VWIA 4BWPA 4TWPA 4BL1A 5ANDA 1PXOA 1YOMA 2PMNX 3P0MA 2GTNA 2GTMA 2R3KA 4CRSA 3D5XA 4I4EA 2QOBA 3P79A 4HGSA 3HDMA 1YHWA 1TKIA 2OJIA 5EQPA 4EH4A 1V0BA 4GRBA 5HORA 3BHYA 3FLZA 3QLFA 2ETKA 4R3PA 3OCBA 4WBBB 5CNOA 5A6NA 5CZIA 1M7QA 3EJ1A 3QD3A 3RK9A 5L2QA 5C03A 4DEEA 4EOMA 4R1VA 5L8LA 2GSFA 3V8WA 4EBVA 5DI1A 4YSMA 3EZVA 5FDPA 4WSYA 5FXQA 2J0LA 3PUPA 4HNIA 2JDSA 4UXQA 3TNIA 3HYHA 4HCVA 2WMBA 3RI1A 3FZ1A 3ZDIA 3VIDA 3RJCA 5HO6A 2EXEA 2IZSA 4Y46A 3PPZA 4YZCA 4EZ7A 3DXNA 2XNGA 1LP4A 3KEXA 2B9JA 4X3FC 3AMBA 4L00A 1VYZA 3ZLXA 3Q53A 4C62A 2WMAA 5CEPA 4WSQA 4Z9LA 3ETAA 4XP0A 4ZK5A 4D5HA 3ZZEA 1BUHA 3VUKA 4L3LA 3UQFA 3BGQA 4BFMA 1QPCA 1IAJA 4EKLA 4JIAA 4EHGA 4I5MA 5LQFA 3DQXA 5AIKA 5DLSA 3MB6A 2QG7A 3OCSA 5GZ8A 5AA9A 1M14A 2J7TA 3KCFA 4GKIA 4FUYA 5AX9A 3OF0A 4I23A 3UVQA 3RMFA 3PG1A 3A2CA 4U97A 4FODA 3OMVA 4YC6A 5DGZA 4ARKA 3DLSA 3VS5A 2W4OA 3DBCA 2GHGA 4GT3A 4N0SA 1FGKA 3QTQA 4DTKA 4F1TA 4YTCA 4FL3A 1Q41A 3DJ7A 5AV1A 3ACJA 3MPTA 4JBPA 3TKHA 4EH3A 2FGIA 3DKCA 3OP5A 4FSNA 3UZPA 3BGZA 2VD5A 4GJ2A 5CAQA 1YXVA 4M15A 1MP8A 3Q9XA 2UV2A 4IDTA 4LRMA 3R8UA 3GC9A 4S33A 2OXDA 3FC2A 4X2NA 5IEXA 2F9GA 3R22A 3OXZA 3VS3A 4CLIA 4MBIA 4EYMA 1REKA 2BIKB 2R3QA 4EH8A 3LXPA 4M69A 4XP3A 5DT3A 1SVGA 2JDTA 4N57A 3FI3A 4MF1A 4FEVA 3RAIA 2CN5A 1SNUA 4FKOA 3O17A 4FT0A 4C4EA 2I0YA 4YTHA 2YFXA 3V51A 4YMJA 1PW2A 2PVYA 4KA3A 4LMNA 2OZAB 3MPAA 4EYJA 5ANIA 1ZYCA 4ZZOA 3G6HA 4L9IA 4FIFA 5E8ZA 3W33A 1E1VA 4IB3A 4NJ3A 4U80A 3WF7A 3QQHA 4RJ7A 1KOAA 4ZJVA 3G5DA 1H27A 3RGFA 1URCA 2YWPA 3DAKA 1BKXA 2PK9A 2ZDTA 4CZTA 3IKAA 1PYEA 2VTPA 3EQFA 2V0DA 3P7AA 1F3MC 4F1OA 4NTSA 5G6VA 4X2FA 3QC9A 4YHJA 3V5PA 1ZARA 4IAAA 4BCMA 4RGJA 2A27A 4FEQA 4LRJA 4JS8A 4X2JA 4XG7A 2QURA 3RHXA 3ZSHA 5L4QA 1U54A 2H6DA 1WBPA 4DFZE 3DDPA 3HUBA 3WIGA 5JSMA 4PY1A 4FV3A 4Q5EA 2CN8A 4P5ZA 3GQLA 5DWRA 3VBXA 3JYAA 4D58A 1MQBA 3EH9A 5AJQA 4C4JA 3ZEWA 3D5UA 2VWUA 1WBVA 1ZMVA 4CFNA 2GNJA 3R83A 3R9OA 3WF6A 2YDJA 4PTCA 1H0WA 3R73A 2VTLA 3R30A 2YM5A 3IDPA 5IMXA 4FKQA 3U55A 4A9SA 2JFMA 3D7TB 4UBAA 5A4TA 5JKGA 3W55A 2J50A 4EC9A 3BE2A 3PFQA 5HCYA 4B8MA 4KD1A 2CCHA 2CKPA 2YA9A 2GS7A 4U7ZA 4BIDA 1H00A 2OJJA 2PY3A 5FG8A 3H9OA 4JIKA 3PE1A 1DAYA 4P7EA 2GNHA 4PV0A 5E8UA 5IA4A 5D12A 1GZ8A 2W1IA 4FV4A 4MHAA 1IA8A 3UE4A 2IW9A 4IVDA 4UY9A 2OF2A 3LQ5A 1PXJA 3MA6A 1NW1A 4AGUA 1OL2A 5IQDA 4EONA 4RVTA 3A8XA 4XG3A 4WHZA 4K0YA 1GIHA 3AC8A 4CFUA 5CSXA 3DJ5A 2WZJA 2O64A 4FVQA 3JS2A 2ZVAA 5EOLA 4IQ6A 2C1AA 3UNKA 3FY0A 3IW7A 5DH3A 2V22A 5LMBA 1G8SA 2OFUA 4GW8A 5HVJA 1REJA 4GVJA 3PPJA 2B53A 4F7SA 1Y8YA 4MNFA 4ZTNA 1GOLA 3RM6A 3UP2A 3GVUA 5KHWA 2Z8CA 4RG0A 3BEGA 5LVOA 3F3TA 4IW0A 4DCEA 3RZBA 4JG6A 4C4IA 3NPCA 4NKAA 4TKSA 4EH2A 5EM8A 5HE0A 3FEGA 4FV0A 4TY1A 4MNEB 4TYHA 3FMHA 4YUQA 4ZSAA 5CAPA 3FXZA 4EOOA 2JKMA 3K54A 3A60A 5H2UA 2NNWB 5AUZA 3F2AA 4J99A 3Q6WA 3QU0A 4O7NA 5M51A 3AMAA 1H24A 3IDBA 4XG4A 3F3VA 1E1XA 5BVNA 5GIOE 4ANOA 3MVMA 1ZOHA 1XH7A 2PE1A 3PZHA 4UMTA 1UU3A 5FWKK 5HBHA 1XH5A 3ZDUA 4WO5A 2B9IA 2QOKA 3P5KA 4J8NA 3MFUA 4NW6A 2YIRA 2GFSA 4KABA 4E5WA 4FKSA 2W99B 3M1SA 3G15A 3O8PA 4RFZA 3U8WA 5LVNA 2WIPA 3DT1A 5EKNA 2PUUA 3ZONA 3NS9A 5LVMA 3U54A 4NCTA 3DFAA 3HRBA 2F2CB 2V62A 3KN6A 3NCGA 3FUPA 3DGKA 1WBWA 3FL4A 3MN3A 3V5TA 5C8NA 4FKRA 2BDJA 2XIYA 3AD4A 2OIBA 2G2HA 3ZUTA 2PHKA 3D2IA 1WBSA 4CQGA 3MSSA 3NUYA 1FVTA 2V55A 4BHNA 3DZQA 3FQEA 5A6OA 3V6RA 5H3QA 2BZJA 3GFWA 4TNBA 1UNLA 3ORTA 3D83A 3MTFA 4YJSA 5H8EA 2OKRA 3ORNA 4ACCA 4HVIA 1WBTA 5HEZA 2R3GA 3THBA 1CKIA 1XHAA 2OGVA 2XM8A 4OBPA 1QCFA 5AV3A 2C68A 3QZIA 1XBBA 4ENXA 4PDPA 4XS2A 3F2RA 5BYLA 4CZUA 4LQMA 3C4WA 4U81A 1PXMA 5KMLA 2WMQA 3EFLA 1K2PA 1NVSA 1P4OA 3II5A 4WNMA 2R2PA 5CSPA 4W4XA 1LPUA 4W4WA 4QPMA 5CEQA 3RWPA 5CAVA 4EK8A 3MS9A 4CCUA 2FSTX 4DT8A 2P4IA 2YAKA 3GC8A 2UW8A 1MRYA 2YLEA 2Z7LA 3R04A 3SRVA 2X6EA 4C33A 3CP9A 3GU5A 2GNLA 3KY2A 3M42A 4I5CA 4J8MA 5EG3A 4G3FA 5LVLA 2ACXA 1OITA 4WG3A 2CMWA 5KE0A 3EFKA 1KV1A 4BBFA 2BZIB 3KREA 5ANGA 1KE6A 1Q3WA 2I7QA 5DPVA 4AA5A 1J1BA 3LCDA 4NTTA 3ZBXA 3FSFA 4II5A 3VBVA 2JIVA 2XJ2A 2C30A 4QNAA 3MVHA 4RC4A 4C4FA 2PZ5A 2BFXA 3W8LA 2BRMA 2XKFA 4C7TA 4P2KA 2VTTA 4AZEA 3CCNA 3AC5A 3PA5A 5C8KA 2QG5A 3H0ZA 2ZV9A 5CAUA 2AC5A 1OUKA 2ZMDA 3C1XA 4L01A 4RSSA 3Q9ZA 5CI7A 3DXPA 3DQWA 3DNEA 4TZRA 3TZ7A 3S3IA 3GBZA 3GCUA 3G0EA 4EUUA 2HIWA 4DGGA 3BWJA 5IQAA 1VEBA 1NA7A 4RX8A 1DS5A 2YCQA 4RX9A 5JFXA 1TQIA 5A14A 2G2IA 5JN2A 4GU9A 4ANQA 4BCHA 5IA3A 2PUPA 3SVVA 3QQJA 2C3KA 3EN9A 3PXKA 3UQGA 1F5QA 3IDCA 3I6WA 3KRRA 4MBJA 3UOKA 4O96A 2PVLA 4O7WA 2I6LA 4GFOA 4XV3A 4AU8A 4ERKA 4X3FB 4ZSLA 3ZSGA 4I6QA 2VRXA 3FLSA 2BHHA 1Q8YA 4ZTSA 3C50A 2O0UA 4XCUA 3BU5A 3QCSA 4QP1A 2WTJA 4F64A 2IZTA 1YOJA 3VQHA 4H3PA 2VTJA 4MYGA 4YHTA 5CEMA 4AT5A 4MXXA 3UG2A 4HYHA 2BKKA 4YO6A 4F4PA 1JOWB 3TKIA 1S9JA 4XJ0A 4G5PA 3EQCA 3T9TA 2C5NA 4DFUA 4BZNA 3Q5IA 2F4JA 4L43A 2WGJA 4QQTA 4IDVA 5CXHA 5AX3A 4O22A 2IW6A 3P78A 3Q9YA 4GL9A 5BUJA 2VNYA 4IJ9A 2V5QA 5EHYA 3TNWA 4K33A 4L8MA 5AP2A 4EJ7A 4DH7A 5ACBC 1WBNA 2ZM4A 2WOTA 3TWJA 3TKUA 4JLCA 4M14A 3R28A 2X0GA 3QL8A 5LARA 4AN9A 4AN2A 3NUUA 4NWMA 1SYKA 4IC8A 3GENA 4PDOA 3QWJA 2UVXA 4L45A 1OL6A 2YISA 3FAAA 1FVRA 2UZLA 4YNOA 4GG7A 2YM3A 3O0GA 5HVKA 4MXCA 3QWKA 3Q60A 3ZRLA 5BUEA 5M56A 5HD4A 4NW5A 1O6YA 4PPBA 2R0IA 4EJNA 4CNHA 4HCUA 3BV3A 4E93A 4M97A 4FSUA 4ZP5A 4EK5A 4AZTA 2PPQA 5J1WA 2FO0A 4V05A 3EQHA 3G90X 4MVFA 1JKKA 4OAUC 1BI8A 4N70A 1WBOA 5H8GA 1T45A 3NIEA 5EOBA 4IB5A 1XH9A 4LRKA 4I0TA 2W1DA 3TIYA 3EOCA 3DKFA 4BICA 2AUHA 3R7YA 4JX3A 3LFBA 5FP6A 3E7OA 4O0YA 4D1ZA 4YP8A 4WNPA 5D11A 2O63A 2W1ZA 1UU8A 1H07A 2XA4A 3C7QA 4QRCA 1OPLA 3H0YA 3KCKA 4IBMA 2JBPA 2YIWA 2Q0NA 4I1ZA 4JBVA 4OTHA 4PRJA 3SOAA 4PDYA 5FTGA 1SZMA 5FDXA 4F0IA 3AQVA 4D0XA 3W2SA 3TNPC 3P08A 3F88A 4FG9A 1NVRA 3IG7A 4UN0C 3FLQA 5DG5A 1H1PA 4FVPA 2YHVA 1T46A 4QMMA 1HCLA 4A9UA 1ZMUA 1Q62A 5JGBA 2YWVA 3VUGA 3ODYX 2VTNA 4EK3A 4DH5A 4JDHA 4OBQA 3R1NA 4GUEA 4F9AA 3PG3A 2O65A 2RGPA 4ZTHA 1IAHA 4EZ5A 2BKZA 5C4LA 4NUSA 3NW5A 3OXTA 2PZIA 4IWPA 4C37A 2F7EE 3LE6A 5LCKA 4BYJA 1YW2A 3K3JA 2VWVA 4D4VA 5DT4A 3TTIA 5E92A 4YZ9A 1M2PA 2PE2A 3ORXA 3KXMA 5JFWA 4CFFA 2YCFA 2XNPA 3BV2A 4UWCA 2BALA 2FYSA 4BY9E 4GT4A 1X8BA 3PIXA 4BCQA 3I0QA 4FSZA 3W32A 4QTDA 1U59A 3RM7A 3T3VA 2YLFA 3BGPA 4ZEGA 5CASA 4NKSA 3E62A 2QKWB 3FSKA 4ORKA 3CBLA 3KFAA 4FK3A 3R1YA 4HOKA 3HP5A 4UZHA 3N4VA 3OCGA 5E9EA 3EL8A 2XRWA 3LFFA 5E7RA 3FZTA 4AQCA 2BUJA 3FC1X 2UZOA 3QCQA 3CQUA 1JSTA 5HGIA 2EXCX 4O0TA 2PMOX 5AR8A 4FV6A 1UVRA 3RTPA 3PXFA 5M06A 2WTVA 3C5IA 3U9NA 4K11A 2PU8A 4Y8DA 5F95A 3QTZA 4FSRA 1ZXEA 3HEGA 5M08A 5EI6A 4CZYB 4LI5A 3SOCA 2B54A 3COIA 4EK4A 4AZWA 3QTXA 5AP3A 4FZ7A 1PXIA 4EHEA 2BIYA 2YN8A 1APME 2JAVA 4IAZA 4LL5A 5EW8A 4FV7A 4ZTRA 2HZ4A 5KUPA 1IEPA 2EB2A 4EQMA 3HA6A 4M8TA 5KMNA 5AR2A 2ZV7A 2FSMX 3LJ2A 3LZBA 5FTQA 3MJ1A 1U4DA 3CTHA 1ZZLA 4JNWA 5EFQA 5HNBA 3UVPA 5HCXA 3VC4A 3VJNA 4IXPA 5I9XA 1M7NA 2OF4A 2CHLA 4OUCA 1P4FA 4O7RA 3UIUA 3ET7A 5HQ0A 2OU7A 2VWXA 4FTKA 5J95A 4BDGA 1W84A 1FMOE 2RG6A 2I0HA 3UNJA 4FE2A 3NYVA 3R7VA 3NAYA 5E8WA 1HOWA 4G16A 4NIFB 3WF5A 1VR2A 3FY2A 1GAGA 3FMJA 3NSZA 4KB8A 3KF7A 3O7LB 3UBDA 1BL7A 3GCPA 2XK6A 4FNXA 4FT3A 2X4ZA 1RE8A 2OG8A 3M11A 4ZTLA 4IVAA 4XG2A 1OKWA 3NYOA 4CRLA 5LWMA 1IR3A 2B9FA 2CGUA 5HD7A 3C9WA 3R01A 4HZRA 3VO3A 5KMOA 1Q8UA 1Q99A 1SM2A 3UPXA 2WOUA 4S30A 3BI6A 5EKOA 5HO8A 4C3RA 4ANNA 3A7HA 4G3GA 2YDKA 3ZXZA 4BCOA 3LFNA 5BUIA 4EHZA 3R1QA 3KXZA 4TNDA 4AW1A 4DINA 2C47A 2XP2A 4FK6A 4JVGA 3DFCB 4DCAA 3MJ2A 4FSMA 2QOLA 4RWKA 4AZVA 3KMWA 3WILA 5CALA 4IFCA 3HVCA 5J79A 2J2IB 3P1AA 5CF8A 4E1ZA 1YDSE 4C8BA 2GHLA 3NMUF 1OL5A 1XO2B 4BCIA 3QTWA 4QMXA 4O2PA 4DGOA 2R3FA 2IW8A 2G1TA 4FVRA 1WCCA 1W0XC 3A61A 4ZY5A 4BF2A 1R0EA 4AE9A 3HAMA 2BCJA 1FGIA 3K5UA 2VO7A 4KWPA 3FZRA 4KRDA 3V8TA 4F6UA 3IONA 1JSVA 3P23A 1PMUA 3FHIA 4YZNA 4YPSA 2C5YA 3MYGA 3A7IA 5IG1A 3UGCA 2YM7A 2VTQA 4JX7A 5KO1A 5IKWA 3CC6A 3REPA 3U87A 4YJQA 3AC2A 2R4BA 4QMOA 2J0IA 3C4FA 1KWPA 4XOZA 3R7OA 3U6IA 1GNGA 4O1OA 4JOAA 4LG4A 2ZM3A 4FL1A 4D2TA 2YEXA 3TCPA 3MESA 2UZUE 2OK1A 2XMYA 4V0GB 5A3XA 4YO4A 3FQHA 4D9UA 3U6JA 4B99A 4C38A 5AM6A 3PTGA 2ITTA 2OBJA 4M68A 2OICA 5L8JA 4HJOA 1VYWA 3R2YA 4M3QA 2I1MA 4YZDA 3FMEA 5CT7A 5AMNA 5E91A 5HTBA 4F08A 5FTOA 3FPQA 3HV5A 3POOA 4FF8A 3AT3A 4KKGA 4LUDA 4XOYA 1CDKA 3DA6A 2BZKB 2O3PA 4GMYA 4BGGA 4YTFA 2H96A 2E9OA 4G3CA 2WIHA 5KZIA 4IAIA 1ZYLA 4NU1A 3UIXA 4QYGA 1TVOA 3FYJX 3HMOA 4AFJA 4ANSA 4PTGA 1OIYA 2HY81 3ZUVA 2VAGA 3FXXA 4ZTMA 4YBKA 1H08A 3W2QA 2BTSA 3PYYA 4CMTA 1H1RA 3CJFA 3RZFA 1Q5KA 4FEWA 3MB7A 5KZ0A 3DAJA 4OTPA 5T3QA 2WNTA 4JG7A 2JITA 2CLXA 1UWJA 3F3WA 2W1FA 3MH0A 4FV5A 4UYNA 4OLIA 3JY0A 4O7SA 3SDJA 3FL5A 3L8PA 4J1RA 2QVSE 3DBEA 3GU8A 2X2LA 4WG5A 3H3CA 2NP8A 4I24A 5AP4A 4OTGA 2XIRA 4GG5A 4XLVA 5CQUA 2ETMA 3DCVA 4HVDA 4K9YA 4I5PA 4E4XA 2RL5A 2ZAZA 3FZPA 3Q52A 4W4YA 4MXZA 2J4ZA 2HZNA 1UV5A 4OTQA 3FMNA 4MQ2A 4PX6A 2WKMA 3TV4A 4PNKA 3HV3A 2J6MA 1DI8A 5EYKA 4FOBA 3FV8A 5L2IA 5HHWA 3F2NA 4QNYA 2WEVA 2BROA 1J7UA 5HIDA 2XEZA 1Y6BA 3CJGA 3DV3A 3D5WA 3PSCA 4MKCA 4GVAA 2R64A 2ZB0A 4AACA 4G6OA 1NY3A 5HG9A 3NVKI 3NLBA 4TYJA 3VS1A 2GS2A 4DH1A 4AOIA 3DAEA 4ZLZA 4BR3A 3FLYA 3UYSA 2QKRA 3HKOA 4AN3A 3OUKA 4X2KA 2IVSA 5D9HA 2Z7QA 5DR6A 4G1WA 4HPTE 3PXYA 3VW8A 3MFSA 4RMZA 1G8AA 4DFYA 4JDJA 3MY1A 2SRCA 1DAWA 3VS6A 4EEVA 1YKRA 3VS4A 4KAOA 5BVFA 4XHKB 3R0TA 4HPUE 3SW4A 4QMNA 2ITQA 4GJ3A 2EB3A 3CPBA 4BBEA 4RJ4A 2GCDA 3QQGA 4PWNA 5CU0A 3I81A 3FJQE 3HV4A 4S34A 2UZVA 5GHVA 3VS7A 2X1NA 1ND4A 1LR4A 1YXTA 4AZFA 3MIAA 4F1MA 5FLFA 4QMPA 5BQ0A 4JBQA 5DIAA 2FVDA 2WQOA 3VAPA 5A46A 3BBTB 3BLRA 3QCYA 4MNEA 2F7XE 1VJYA 2FA2A 4K77A 2W4KA 3ZO4A 3IW4A 1V1KA 3QD2B 4FICA 4K18A 4BYIA 3RAWA 4AG8A 3OY3A 2G01A 2J90A 4Y73A 3RAKA 4R8QA 4JJRA 4C4HA 3PY1A 2B1PA 5L2SA 2XRUA 4Z7GA 2OH4A 3O96A 1SVEA 4IB0A 4RLKA 5DOSA 2CNUA 5EYMA 3LJ0A 4PMPA 2IPXA 2C69A 2UW4A 3ZLSA 1XKKA 4FIIA 4XBUA 5JQ8A 2J9MA 4BDHA 4BI1A 4TYEA 4O0RA 4ALVA 4WG4A 3ID6C 2JAMA 4C0TA 4C58A 1UA2A 2QONA 3MY0A 3NDMA 4CYJA 4USEA 1CKJA 1KV2A 3WIKA 2IG7A 3OUNB 3UNZA 3NW7A 2HCKA 3DKOA 2X2MA 3HMMA 1A06A 3QD0A 3UTOA 3ZTXA 3CY2A 2R0UA 3LCSA 4ZTQA 1MQ4A 3IS5A 3LFCA 1PJKA 3PJ8A 5D10A 4O7LA 5FEQA 2H8HA 3OWJA 3WZJA 4A7CA 3UQCA 2PUNA 4ANLA 4YC3A 1Y57A 2WTCA 4YJRA 5JGDA 1W8CA 4CCBA 2W5HA 3OWLA 4WOVA 5M4FA 5LMKC 3SX9A 4WNOA 4NFMA 1YWVA 2GQGA 3F6XA 4M66A 4C3PA 3N4TA 1ZYJA 1J1CA 4USDA 2VWBA 2HY0A 2VTRA 4FTAA 4AW0A 2C6LA 5HX8A 4I6FA 3S00A 2OO8X 3NW6A 4BI0A 3TZ9A 4LUEA 1ZRZA 4FIGA 2ZMCA 3GU6A 4NFNA 4NEUA 3TV7A 4D2RA 2VWWA 4ZZNA 1H28A 4EOIA 4DBNA 4NK9A 4CTCA 2ZYBA 4BDEA 4EOKA 2JD5A 1L3RE 3EN4A 3O71A 3QZHA 2UZWE 3V01A 4ASXA 3EKNA 3EKKA 2XKCA 4GK2A 2R3IA 5CX9A 3FBVA 4LYNA 3L9NA 5CEOA 3PXRA 4B9DA 4TTHB 2OXYA 3UODA 3E87A 3HRFA 4W8DA 5HE3A 3TZ8A 3K5VA 2ITOA 3U9CA 4KIQA 2W9ZB 5DEWA 2QC6A 4UXLA 4EH6A 3UMXA 4D5KA 2C6TA 5I5ZA 2YITA 4FTNA 5B2KA 2JDRA 1V0OA 3R63A 4ITIA 3IW5A 4X21A 5FUTA 4FGBA 3E3PA 2YM6A 4TWCA 3QA0A 4MXYA 2VV9A 4KIKB 4O91A 3RVGA 4GUBA 2Y0AA 2YCSA 2PMIA 3COHA 3E64A 5K4IA 5GJDA 3QALE 4F70A 1SNXA 4GV1A 3ULZA 2ERZE 3ANRA 4FZ6A 3U6HA 3DOGA 5DRDA 2VX3A 5HG5A 3ATSA 3L1SA 4FTMA 5DHJA 5I9ZA 5DT0A 3OOMA 4FYNA 4GK4A 2CNQA 3NR9A 5AEPA 2CNVA 3VWAA 5J9ZA 4I22A 4QQJA 2GMXA 2QHNA 4PP9A 4A9TA 4QTBA 4O0SA 4WUNA 3SG8A 4XEYA 2QU6A 5M07A 3W2RA 4GEOA 2XH5A 4HW7A 4P90A 2QQ7A 3R7GA 5LJJA 3QTSA 3MDYA 4FL2A 4R77A 4NYEA 2CJMA 4OTWA 3ITZA 1M17A 2QO7A 3HNGA 2B9HA 5FP5A 4RIOA 5JRSA 3WF9A 4E20A 4E3CA 3GU4A 4DLIA 3G9LX 2LGCA 2X39A 1Q61A 3K3IA 4EOPA 3TL8A 2WMTA 4NT4A 4PTEA 1OB3A 2P2IA 4U40A 5AR7A 3W2PA 4CFWA 5CEKA 1B38A 3IW8A 3Q04A 2PL0A 4L44A 4PUZA 4X6QC 1STCE 2PVJA 3PJ1A 4IZAA 5HICA 4ZIMA 3UC3A 4XYFA 5HBEA 5JH6A 4X3FA 5HVYA 5I4NA 3KU2A 3JVSA 2E9PA 3B2WA 3WI6A 2ESMA 4XV9A 3HX4A 1LEZA 2YERA 4NL0A 1YVJA 3EQPA 4LM5A 4RX5A 3I6UA 3F7WA 4TN6A 3C0HA 4U79A 4XG8A 3DXQA 2RF9A 3ORMA 2OIDA 2A4LA 5IA1A 3RPYA 4JL9A 4QMWA 4D4YA 5JGAA 4H3QA 2YM8A 2Z7SA 2ZB1A 5GZAA 4RJ8A 3UC4A 3EZRA 2BFYA 2I0EA 2E9UA 4ZLYA 3NCZA 4QMYA 3AGLA 4H05A 4KS8A 4YLKA 4O0UA 2XM9A 4YBJA 3S95A 4L7FA 1FQ1B 5AUTA 2FSOX 4TL0A 2QOQA 5J5SA 3AT2A 1U5RA 1WZYA 4EI4A 3EYGA 3S1HA 5FXRA 4QP6A 4IWOA 4KIOA 2ZJWA 3GOKA 3QUPA 2PVRA 4IM0A 3V5WA 3ZC5A 2BAQA 5LXMA 2JIUA 3NUNA 5BMSA 4CLJA 5L6PA 4WT6A 1XH6A 1YWRA 3ZFYA 2VZ6A 3PDTA 3SXRA 4DGLC 1BX6A 4MCVA 3RCJA 1OIQA 2XF0A 1R1WA 4R5SA 2X9EA 4U41A 5M53A 4FNZA 3MW1A 3NGAA 2W96B 4D55A 3CD3A 4RWLA 3OFMA 5LCJA 3ZC6A 4QPSA 3RPOA 3SC1A 1JKSA 1ERKA 2XZSA 4FKUA 4IE9A 3VF8A 3Q2MA 4DG2E 4F09A 2WTKC 3GT8A 4XLIA 3QRKA 1AQ1A 3LM0A 5JMSA 3SA0A 1A48A 4Z55A 4DFBA 4FTLA 2EU9A 3KRJA 3LFQA 1CM8A 4QMSA 4DG0E 5BNJA 3DZOA 4RIYA 1YDRE 3OEFX 3UJGA 3ELJA 4LGDA 1KE8A 3L9PA 4FIEA 2UW5A 2P2HA 4KBAA 4RQVA 4V04A 2HZ0A 1PY5A 2VGPA 4OGRA 2GNFA 3BRBA 3ERKA 5ETAA 3UIMA 4CFVA 3SW7A 1J7LA 2F7ZE 3C0IA 4KSPA 3LLTA 3VBTA 4CG9A 5L6OA 1OPJA 2X7GA 3B8RA 1YRPA 4L67A 4GSBA 2WELA 3G51A 3W18A 3U4UA 5EW3A 2IJMA 5F94A 3ZXTA 1B6CB 4CKIA 4UZDA 3DKGA 3D4QA 5DFPA 4RVMA 4D4RA 2C6DA 1UU9A 2OH0E 2Y4IB 3HV7A 2EUFB 2C6MA 3MGYA 3O50A 3TV6A 3UPZA 3MFTA 1WVYA 1GZNA 3AD6A 4ASDA 4C34A 2X2KA 4BGQA 5L6WL 1WMKA 1FBNA 3NYNA 3S2PA 3P7CA 5IQCA 4DHFA 3BYOA 5E90A 1UKHA 4FTTA 3LQ8A 5EH0A 3UDBA 3ZH8A 4Z16A 4PPAA 4U3ZA 5CS6A 3QBNA 2J0JA 4ANBA 5DMZA 2A0CX 4F6WA 4NM3A 4IHPA 3FI8A 2XYNA 3ZO2A 4RC2A 5ANEA 3SG9A 3BYUA 4AF3A 4PMSA 3PP0A 1RJBA 3QC4A 4APPA 5GINE 2RSVA 3A7FA 3EQRA 4JAIA 1E9HA 3UOJA 4ASEA 2CPKE 5JFSA 3IW6A 2E2BA 4G3EA 4IFGA 4E73A 3QGYA 4XP2A 5I3OA 1A9UA 5DE2A 4CG8A 3BQCA 1Z5MA 5JRQA 2WMVA 2PVMA 4DBXA 3H9FA 4TPTA 5FD2A 3KXXA 5M4UA 3SAYA 3CKWA 4BKYA 2ITZA 5CY3A 4BCPA 4IJPA 2Z7RA 3O7LD 5TO8A 3R8ZA 4EH7A 4CYIA 5K4JA 2OJ9A 4ZMFA 3NEWA 4JQ7A 1BYGA 5J7BA 1K9AA 5I3RA 4CKJA 3WZUA 3V04A 2WTWA 4S32A 1TQPA 3TXOA 1CTPE 4I21A 3V6SA 2VO0A 2BMCA 2Y6OA 4NJDA 3DPKA 3COMA 3RINA 3KN5A 4E8AA 4YU2A 2HXLA 4S31A 3GI3A 4GT5A 4TYHB 5A4QA 5TE0A 5HNIX 4DA5A 2VTAA 4DTBA 2G15A 4BTMA 3PP1A 2PUIA 3BLQA 4AP7A 3KRXA 4NIFA 3CS9A 1XBCA 4YTIA 4FSWA 3E88A 4D2WA 4X6RA 2R7IA 1FVVA 4RZWA 3PJ3A 4HYSA 3E5AA 4AE6A 2C6OA 3EN5A 3GEQA 3ORLA 5IA2A 1W98A 3W16A 1S9IA 4O81A 4BZDA 3CTJA 5FBOA 2BHEA 3KK9A 4C02A 5HO7A 1Q3DA 3FMLA 3FWQA 3NZ0A 2QD9A 4I5HA 3KULB 5HE2A 4FTCA 3NIZA 4MD8E 2XNMA 3DTWA 4RIWB 4C2WA 3TUDA 4MWHA 2WPAA 2WU6A 3BWFA 1GJOA 2HWOA 2WTIA 2ONLC 1Q97A 4IZYA 4PNIA 4JR3A 4PMTA 4QYYA 4BDAA 5KBRA 3UVRA 1H1QA 2HZIA 2QNJA 3D7ZA 4O0WA 3WE4A 4DH3A 2IVVA 5IISA 2CKEA 2FUMA 4EK6A 1PMEA 2X4FA 4FZDB 3W8QA 3D14A 5ANOA 1YDTE 2RIOA 5EI8A 4AT3A 2YJSA 2AYPA 3DK7A 3DK3A 3FMDA 4J98A 2JGZA 2QOFA 2X81A 3GC7A 4YR8A 1Q8ZA 3LXNA 4R6VA 3JPVA 3SD0A 4PP7A 4RFMA 3TN8A 5EHLA 4V01A 4AWIA 2C5VA 4C2VA 2XJ0A 1U5QA 4YJOA 5I9WA 2C6KA 3UZTA 4O6LA 1J7IA 2XKEA 4A4LA 3LOKA 3HGKA 2VGOA 3A7JA 4U8ZA 2CGVA 5DR2A 5HOAA 5AR4A 2BRHA 4K1BA 2Z02A 4ACMA 1XH8A 4BDFA 4FKWA 1Z9XA 4DFXE 2UVYA 3VQUA 2RG5A 5A4CA 4QPAA 1XWSA 2OSCA 4DEIA 3F3ZA 3ZLWA 2JLDA 5FM2A 2X6DA 5IQEA 1W82A 3BIZA 4W9WA 2BAKA 2C3JA 2X8DA 4Q2AA 3C4CA 5T68A 3DU8A 5FEEA 2B4SB 3G9NA 2PVNA 4P5QA 2QO9A 2EXMA 1Q8TA 4ZJIA 4C61A 5TKDA 3KC3A 4IEBA 4WNKA 5GNKA 3U4WA 5I0BA 3WYYA 5IDNA 5ETFA 3EYHA 3LJ1A 3HL7A 4IH8A 4JT3A 4MAOA 1KOBA 2P55A 4MEDA 3VUTA 4DEGA 5EHOA 3FYKX 5IF1A 4CD0A 2R3LA 3KXNA 4FX3A 2C0IA 2J5EA 3KB7A 5H9BA 3MH2A 4CV9A 5IEYA 4G3DA 3NNXA 2YIXA 4HVSA 1YHVA 4A9YA 5BX0A 5KMJA 5EQYA 1Q24A 3D0EA 2QCSA 3F5GA 3N51A 3LXLA 5IEVA 1OIRA 4CMOA 5CXZA 5C1QB 5CVGA 4NZWB 5HBJA 4UEUA 5AP1A 3AT4A 3BHVA 4A07A 2C4GA 5CSHA 4MH7A 4DF3A 4I20A 4G2FA 2PYWA 3F82A 4KINA 2WB8A 1H0VA 3DLZA 3TJCA 2WFYA 1JBPE 2Y6MA 4U45A 1UKIA 3WARA 2PVHA 4EOSA 3NX8A 3C51A 2R5TA 5J8IA 3AG9A 1OUYA 5JK3A 5KKRB 4XX9A 5ICPA 3GCSA 4JG8A 5HU9A 2PTKA 4NM7A 3MV5A 3OVVA 4U9AA 3RPRA 4DYMA 4E6CA 2CKOA 3TIZA 4EOJA 1B39A 1ZAOA 4CKRA 4LGGA 1H1WA 5HIEA 1YXSA 4FG7A 2E9VA 3QQLA 4PPCA 4TRLA 3NUPA 2UW0A 3R2BA 5B0XA 4BBMA 1QL6A 1KE5A 4AA0A 3NYXA 4TT7A 4IWDA 4RJ5A 4GU6A 3BZ3A 4ZAUA 3I5NA 4BDCA 4XUFA 5EYCA 4DGNA 4H1JA 4YJUA 3NAXA 3EMGA 2ITVA 3OXIA 5AIRA 5J9YA 3MH1A 3QRIA 3GOPA 4U43A 2W1HA 2WQMA 5B2MA 1UU7A 2OJGA 4P4CA 4APCA 1GIIA 3KXGA 5LWNA 2WXVA 5CEIA 3DJ6A 2VTMA 4U5JA 3FI2A 4EOQA 3ENMA 4XG9A 2W1GA 4AGCA 4YSJA 5L2TA 3OHTA 2WO6A 3KGAA 1GZOA 3QKMA 1TQMA 4GFGA 5BVKA 3ZMMA 1BL6A 2C0OA 2LAVA 3BELA 4EWQA 5D41A 3HMPA 3PPKA 3WE8A 2HYYA 1PHKA 5CVFA 1OVEA 3L8VA 4FKPA 3IGOA 3R1SA 3OW3A 3ZEPA 1V0PA 5ACKA 5TR6A 5GIPE 2C3LA 4MQ1A 3HV6A 1H1SA 3GXLA 1YXXA 4LGHA 3IECA 3ZLYA 4D2SA 5CSVA 3P86A 1FPUA 5CF4A 2WTKB 5AUXA 3L8XA 2A2AA 4FOCA 5HG7A 3A4OX 5AAFA 4FEUA 4DT9A 5IQFA 4RT7A 2CDZA 5E8XA 4YJVA 1YOLA 3TT0A 4O83A 2ETRA 3RBWA 4IZ5A 3Q4UA 4DFLA 2DYLA 4WRSA 4ITJA 4QOXA 4DC2A 3B8QA 3ORZA 5G1XA 2BAJA 5GJFA 5IUIA 2PVKA 3DTCA 3OW4A 3ORKA 2QOIA 4G9RA 3TDVA 4R7HA 4J97A 3P9JA 2NO3A 2W05A 4G6LA 5AV4A 2Z2WA 4IACA 4IAFA 4L6QA 3TTJA 3VRYA 3WZDA 1LEWA 2OZAA 5IA5A 4RRVA 2FH9A 3R71A 1NVQA 1OMWA 2WMRA 5EM6A 5CF6A 3HA8A 3VJOA 4O86A 3NNVA 3FZSA 3L8SA 5D7AA 3VS2A 5BVOA 3KRWA 4IIRA 4FEXA 2GQRA 4IWQA 5CANA 2BZHB 4FT9A 3ZZWA 4AOTA 4AZSA 3HLLA 5E8YA 5FRIA 4IM3A 2X7FA 4FKVA 4AXAA 4CVAA 1P2AA 1Z57A 1SMHA 3IQ7A 3L9LA 4M0ZA 3ORIA 1F0QA 1RW8A 3OTUA 3RWQA 4FTQA 4FMQA 2A1AB 4OTDA 2CGWA 4A9RA 3G2FA 3GB2A 4UMRA 3CY3A 2O8YA 2C0TA 2XEYA 3HP2A 1ZYSA 4O7TA 4DEBA 1W7HA 2JFLA 2IZUA 5EK7A 1I44A 1IRKA 4LV8A 4DITA 2Y4IC 3ZU7A 3DBDA 1UNHA 4RQKA 5CWZA 2P33A 1IA9A 5EW9A 3F66A 4ZZMA 5CAOA 3KK8A 4ZY6A 4YPDA 2V7OA 3EFWA 1OI9A 3LCOA 3QHWA 3SLSA 5KMMA 4BKJA 4EQCA 3D7TA 5E8TA 4QT1A 2XBJA 3GNIB 4MTAA 1YI4A 3PXZA 5EYDA 3A4PA 1CKPA 2XIZA 2QOOA 4JR7A 3PXQA 5AP5A 3I5ZA 4ITHA 5IQGA 1XR1A 4M12A 5JFVA 5KCVA 5M09A 3I0OA 5HLWA 3CSVA 4D0WA 5IPJA 2RFSA 3BHTA 3EHAA 1O6KA 4E5AX 4J52A 2HK5A 4MXAA 3MY5A 4DH8A 1ZYDA 3W2OA 3BLHA 1R0PA 2UW6A 3SQQA 4ZXTA 3ZRKA 1NT2A 2QR8A 5EQEA 1MUOA 3UOLA 4DEDA 3DNDA 3QHRA 3VS0A 4YZMA 3FKNA 3M2WA 3ODZX 2B52A 5CU4A 4QTAA 1OKZA 1GZKA 3KF4A 4DFNA 5AP6A 4ZSGA 4RA5A 2WMSA 1ZLTA 3F7ZA 4OT6A 1JQHA 4J96A 3T9IA 4D28A 5F4NA 2YJRA 3QRJA 4IX4A 4EKKA 4EBWA 3LQ3A 4TYIA 3VUIA 4AX8A 4LL0A 4M13A 4HGEA 5HLNA 3BYVA 2NRYA 4BKZA 4DEHA 3PZEA 2UW9A 3ZM9A 2IVUA 3DY7A 3KKVA 4BDDA 4RIXB 2X9FA 4Q9ZA 3P7BA 3A8WA 4OW8A 4C57A 3QGWA 4DGMA 2JIIA 3S0OA 3CTQA 2EVAA 5JZJA 2VWYA 3ATTA 2YIYA 3TG1A 3R7UA 3LCTA 5J87A 5B7VA 5A9UA 4GIHA 4JXFA 2JEDA 5K0KA 4IMYA 5AFVA 1KE7A 3GCVA 5DRBA 4KSQA 3QLGA 5CTPA 4R5YA 1W83A 2BRBA 4L42A 3TEIA 4B7TA 2UVZA 4D1SA 4E7WA 4W9XA 2ZDUA 3FHRA 2WHBA 4FSYA 4JDKA 2XUUA 4U3YA 1YQJA 5K9IA 2P3GX 2XNNA 3EWHA 3OWKA 3N4UA 2XYUA 5CZHA 4WD5A 3TNHA 2YZLA 2R3MA 4I6BA 3GFEA 3PWYA 5A54A 3V5JA 3QX2A 4I41A 4GK3A 3RALA 2PWLA 2C6EA 2XK8A 4D9TA 2JDVA 3QRUA 4ERWA 3FZOA 4O7ZA 4W8EA 5FGKA 2KULA 2XCKA 2XIXA 4OR5A 2XIKA 4KNBA 5CU6A 3EL7A 4NCTC 4KKEA 1JVPP 2OLCA 2VTOA 3PY0A 3BE9A 2B7AA 2R3HA 3VNTA 4FZAB 4IM2A 4PMMA 2HW6A 4B6LA 3POZA 4PL5A 5ANKA 4D1XA 4YHFA 3NVMB 4U44A 4B0GA 2C5OA 2W7XA 5AV0A 3RCDA 3RKBA 5CQWA 4J7BA 2Y8OA 5BVWA 3GQIA 5AP0A 3ZO1A 5E1EA 4YJNA 3EB0A 3F5XA 1R3CA 3JVRA 4G5JA 5K3YA 3PVGA 3E3BX 2KTYA 4KKHA 1YI6A 3ROCA 2C1BA 5DNRA 4G9CA 4AW2A 2Q0BA 3R6XA 3G6GA 2PSQA 5FEDA 4C59A 2OFVA 5AUVA 3HRCA 3W2CA 4DAWA 2XK4A 5HX6A 5C8MA 2DS1A 4I0SA 5ETCA 3N9XA 3QFVA 2PZYA 4ID7A 3LMHA 1OBDA 4KRCA 2R3JA 3PIYA 5K0XA 2W5AA 2VU3A 3LMGA 4EH5A 4N4SA 3VBYA 4CQEA 3ORPA 5EI2A 4AUAA 4RZVA 5AWMA 2BVAA 1ATPE 2X7OA 4FC0A 1PKDA 4TYGA 2XCHA 1QPEA 3L9MA 2DQ7X 4QP3A 2NRUA 4Y85A 3FPMA 5AR5A 3F9NA 1M52A 3D94A 3NNUA 2VO3A 3DBQA 4JQ8A 3RPVA 4F99A 5KMIA 4FNWA 4IVCA 2HOGA 1FMKA 4QMUA 3QRTA 3R7IA 3V8SA 4BDIA 3VN9A 4BN1A 4O7VA 5HKMA 4DE4A 5BVDA 1G3NA 1OL7A 3EN7A 4YJTA 2YAAA 4IAKA 5IA0A 3S4QA 3I1AA 2GHMA 3HECA 3R8PA 3LLAA 3OD6X 4ACHA 4H36A 5JEBA 3OWPA 3FMMA 2PULA 4GS6A 4LFIA 5FBNC 4KS7A 2WQEA 5H8BA 3KXHA 1YI3A 1GY3A 4E4NA 1OGUA 5HCZA 4Y72A 1JKTA 4BTFA 5AUYA 3MIYA 1H26A 1UNGA 2W1CA 4FA2A 4HVHA 1ZZ2A 2RFDA 3HUCA 4FT7A 4IX6A 5HESA 3RNIA 4A06A 4GYIA 3QQKA 2UZNA 3LKMA 3QA8A 2R3PA 1HCKA 2OI4X 3QYZA 4FKJA 4E6AA 3VUHA 4DLJA 1JWHA 3LCKA 2REIA 3OT3A 3PVBA 3R9HA 4EQUA 4PDSA 4MBLA 3FKLA 1JLUE 3LFDA 4WRGA 5DR9A 1ZOGA 4O21A 4UMUA 2F49A 4OT5A 4NM0A 3MI9A 1I09A 1QPDA 4CTBA 2YM4A 3MBLA 4HYIA 5BPYA 2B0QA 2WTDA 3D5VA 5L2WA 4C36A 2W17A 3AD5A 3OROA 2CLQA 3F3UA 1BLXA 2OIQA 4H1MA 4UALA 5KKRC 2F2UA 4H3BA 4IC7A 1WVXA 2R9SA 4Z7HA 3Q4ZA 4IANA 2ZM1A 2ITWA 1R39A 3DBFA 3E92A 3ZRMA 3FQSA 2DUVA 4AFEA 2DWBA 2GNIA 4R3CA 3E7VA 3ZCLA 4I92A 4F7JA 5HZNA 4FZFB 4YLLA 1PF8A 3DB8A 3NUXA 4FSQA 3KL8A 4FGRA 4ACDA 3OCTA 3F69A 4U6RA 1OECA 2W9FB 4ZJJA 4WUAA 3JUHA 4AS0A 1K3AA 3LAUA 5HNGA 3CKXA 5DEYA 5J1VA 2IZRA 4DG3E 2WQBA 4M67A 4F7LA 4F9WA 4ACGA 4UMQA 5CSWA 4Z3VA 2JKOA 3MPMA 5F9EA 3C4EA 2QOHA 4WA9A 2VO6A 4OTIA 2CKQA 4MWIA 3LPBA 3E8EA 4EWHA 4H58A 1PXKA 3KMMA 3VBQA 4BDBA 5LVPA 5C9CA 2UUEA 4N6YA 4BIBA 3BYSA 1OKYA 5C27A 1EH4A 1H4LA 1U46A 4XV1A 3G33A 4K8AA 3UG1A 3WOWA 3D9VA 4FG8A 3QCXA 5M4CA 3A62A 5FQDC 2C6IA 3TJDA 3LXKA 3BX5A 3CEKA 3SXFA 2GDOA 4ANMA 2QR7A 3E8DA 4QTCA 4BCJA 3LHJA 4BCFA 1JSUA 2Y9QA 1AD5A 5CF5A 5E1SA 3NWWA 4BI2A 1SVHA 1XJDA 2XJ1A 4RC3A 5EM5A 3EQGA 1JAMA 3G0FA 4M69B 4NSTA 3KULA 4WKQA 5C01A 5TOZA 4BC6A 4GKHA 2BTRA 2BRGA 3FLWA 4CFXA 4R1YA 4RIWA 3B2TA 3ZUUA 4D4SA 5JT2A 4A4OA 1KSWA 3QTIA 2VX0A 1IG1A 3I60A 4JRVA 4ZS4A 4QQCA 1H8FA 4AT4A 5A4LA 3ZM4A 3OBJA 2A19B 3ZOSA 2PZPA 3KVXA 1BMKA 4FV8A 5LMKA 2QLUA 5KHXA 1XH4A 4O0VA 2Q83A 3GUBA 1ZWSA 1URWA 3NNWA 4HYUA 3TACA 3TM0A 3MH3A 3UYTA 4FKGA 3ZBFA 4CGAA 3BEAA 5EDRA 1OPKA 1WFCA 3KA0A 4QP2A 3QXOA 4HCTA 3RK7A 2JC6A 3I7CA 3LM5A 4S2ZA 4CT1A 4ZY4A 5DBXA 4X3JA 2XK9A 4U42A 4NM5A 5KX8A 4EUTA 3C4XA 4AGWA 4F9CA 2H9VA 1Y8GA 3MTLA 1OM1A 3BU3A 4Y83A 2R3RA 1PMNA 4DN5A 1U54B 4TWOA 5IH4A 2QHMA 2CCIA 3Q4CA 4QQ5A 5CLPA 4F0FA 1MRUA 5AADA 2W06A 3CQWA 4BWXA 1UWHA 3KRLA 4FTJA 3CXWA 4LV5A 1CMKE 3O8UA 3H10A 4TW9A 5AV2A 4KBKA 3RP9A 3E8CA 2RFNA 4QMVA 3O51A 4E5BA 3QQFA 4O0XA 5LOHA 4RWIA 4W4VA 4IX3A 4EL9A 1PXNA 4OTRA 5KBQA 3EQBA 2BDWA 4O7YA 4YC8A 3TZMA 3W1FA 2WMWA 4R78A 2OWBA 1YHSA 3HZTA 3E8NA 3O23A 3Q96A 4EOLA 5EDQA 1O9UA 2Y4PA 5AUWA 4E4MA 3R8LA 3SKCA 4RJ6A 3EN6A 3OBGA 3RNYA 3EFJA 2UZTA 3A99A 5M57A 5IUGA 3KMUA 2J0MB 4E6QA 2XNBA 3DS6A 3PRIA 4FIHA 1OZ1A 3OC1A 2XB7A 3IGGA 3NUSA 2J51A 4HGLA 4FI1A 4ZSJA 2J5FA 1H01A 4L7SA 2X8IA 1JNKA 2GQSA 4DTAA 2PZRA 3WZKA 3HDNA 4MD9E 1JPAA 4BRXA 5IZFA 4F9BA 2XNOA 4ENYA 4I93A 3VBWA 3GGFA 3PSBA 3H4JA 2JKKA 5CNNA 5DN3A 3CIKA 2W5BA 3QZFA 4IAYA 2IVTA 4UX9A 4BDJA 1Q4LA 3PJCA 2QI8A 1M2QA 2NPQA 5IQIA 1QMZA 2QO2A 3JR1A 3GC0A 3QTUA 4GYGA 3NUAA 4ZMEA 4GH2A 4YNEA 5HTIA 4FBXA 1G5SA 4RFYA 3QTRA 4RVLA 5BYZA 3VUDA 3UO5A 2JBOA 5AR3A 4IX5A 2ZV8A 4UB7A 3EQIA 2W0JA 5HG8A 3LFSA 4YJPA 1NXKA 3MA3A 4NH1A 4TWNA 3SV0A 5CENA 2VNWA 2WMXA 3ZYAA 4C3FA 5IQBA 4FYOA 3BHUA 3QF9A 4JRNA 5I9UA 2OJFE 4QP4A 5I9VA 2UZBA 2FB8A 3GP0A 3IOKA 2HW7A 2YABA 4YZBA 2ITNA 5C4KA 2XK7A 4XRLA 2BPMA 3AOXA 4Y5QA 3T8OA 4FKIA 2HENA 3NRMA 4G34A 4X0MA 5C26A 3PLSA 1RQQA 2OW3A 3SXSA 2WU7A 5FM3A 3CGOA 4HVGA 3VVHA 1IASA 1XQZA 5I9YA 3D2KA 1PRYA 4MK0A 2WEIA 3FI4A 3IK3A 4E6DA 5IH6A 2XS0A 3BU6A 3V5LA 1OL1A 2RFEA 3MWUA 3QYWA 1ZY5A 4G17A 2ITXA 4ZOGA 5HLPA 3V5QA 1PXPA 4KIPA 3CD8A 4MF0A 3ZFMA 4F9YA 3LW0A 4YURA 4XV2A 5AUUA 3W10A 3BQRA 5TF9A 3VW6A 4L46A 1VZOA 3Q4TA 3R21A 4J53A 1KE9A 2XKDA 4QP9A 5T6KA 4QMQA 2EWAA 3QUEA 3QQUA 2OXXA 5F1ZA 1Q8WA 2F57A 3VHEA 2R3NA 4L52A 4IADA 1AGWA 2ZV2A 2UZEA 5CU2A 3FXWA 3PE2A 1OKVA 2H34A 5D7VA 4BHZA 3PY3A 5IDPA 5A4EA 3Q3BA 3RHKA 3QXPA 2GPHA 2IWIA 3EQDA 2C3IB 3FMKA 4QYEA 2YIQA 4ZS0A 1PMVA 3DB6A 4HZSA 4Q5HA 2YZAA 4D2PA 3O8TA 4FTOA 1JKLA 4BDKA 3QD4A 4M84A 4I6HA 3LIJA 4QO9A 3F5UA 2BRNA 4BVUA 4EC8A 3CPCA 1ZMWA 4RIYB 1Y6AA 2XNEA 4FTUA 3PJ2A 3ZFXA 5EDPA 5HE1A 3ROYA 4FTRA 4QTEA 4O84A 2YDIA 1DI9A 3K2LA 4QMZA 2GFCA 4V0GA 5BMMA 4B8LA 5J7HA 4KUJA 5GZ9A 4YLJA 5KNJA 3VHKA 4AW5A 5AAEA 3I79A 2GU8A 2JDOA 2QOCA 2R7BA 2UZDA 3SRVB 1DM2A 4Q9SA 3HAVA 3C13A 1WAKA 4UMPA 3Q32A 2CSNA 3E93A 3ALNA 3PA3A 2WD1A 4X2GA 3R8MA 4BTJA 4BTKA 5TT7A 4G31A 2I0VA 1BI7A 5IU2A 3F5PA 3IO7A 4KBCA 5CVHA
chains in the Genus database with same CATH superfamily
4LOPA 1QPJA 4RA4A 3ULIA 5M44A 2B55A 4BWKA 2VTIA 3BCEA 3T3UA 4FR4A 4WIHA 3KVWA 3LFAA 4QD6A 5CU3A 5DA3A 4GIIA 3Q5ZA 1XBAA 3OTVA 3QKKA 4I3ZA 4MX9A 4UV0A 5AP7A 3R9DA 4L68A 3EIDA 4CSVA 4U0IA 4EH9A 4QYFA 4JBOA 1PYXA 1PKGA 4I94A 4E4LA 5DYJA 2ITYA 3DDQA 3LVPA 4L3PA 2AQXA 4FKLA 4AAAA 2P0CA 4FV2A 5BYYA 3C4ZA 3WYXA 3O2MA 2G9XA 4RPVA 2WMUA 4MXOA 2HXQA 4UWYA 3CR0A 4CMUA 4FT5A 3ACKA 3I7BA 3OY1A 4ZSEA 3H30A 2FSLX 3AC1A 4ONAA 3UOHA 2UW3A 4XBRA 5HU3A 4JI9A 4OTFA 3UP7A 2WAJA 3AC3A 3I4BA 3PWDA 5IQHA 3JXWA 4AA4A 2VX1A 4BIEA 5D1JA 2BR1A 2QLQA 2R3OA 3OT8A 3WF8A 2GS6A 2PVFA 3FE3A 3TUCA 3R9NA 3UO6A 4BCGA 2ERKA 5AA8A 4BCKA 3PFYA 4EORA 3CGFA 1O6LA 3FDNA 4QMLA 4BJJB 5L3AA 2PMLX 2BDFA 3COKA 2O2UA 3MFRA 3GCQA 4QYHA 1TZDA 3F61A 4F0GA 4BGHA 4QMTA 4WBOA 5K5NA 3IPHA 3HMNA 3MVJA 3WBLA 2Y7JA 4AGDA 2IN6A 2G2FA 3ENHA 4QP8A 5J9LA 3PA4A 1P14A 3W0PA 4FV1A 3C5UA 3QAME 5HTCA 5E8VA 5KMKA 3MVLA 3RPSA 3CE3A 3KQ7A 4O6EA 5K5XA 4GCJA 4FSTA 4O38A 3OS3A 3PVWA 3PLAE 2RKUA 1PXLA 1H25A 4PF4A 3BKBA 3W0RA 1FOTA 5HI2A 4CFMA 5J5TA 3SHEA 2W1EA 3QX4A 3UO4A 4BZOA 4CT2A 3GU7A 1J3HA 2VWZA 4HNFA 4I4FA 4C35A 5B2LA 4ANMA 3VRZA 4LV7A 4RWJA 1Y91A 4RIXA 5JZNA 3RAHA 4A4XA 2HWPA 5ANJA 5BVEA 4F65A 4DEAA 4TXCA 3QKLA 3ZSIA 4F6SA 2J0KA 3U51A 3BBWA 2HELA 4FTIA 3BPRA 3ANQA 3FLNC 3PSDA 2VUWA 4LOOA 4PL4A 4QP7A 2C5XA 4I0RA 5LMAA 4O82A 3OOGA 1MRVA 5AM7A 3ZO3A 3BHHA 4N6ZA 2W4JA 2ONLA 4ALUA 3DK6A 4IVBA 4M7IA 3CLYA 5L8KA 5F20A 2PE0A 3VUMA 4OAVB 4R7BA 5AAGA 4UWBA 3A7GA 1L8TA 2E9NA 3JY9A 3D15A 3TI1A 1GIJA 3V3VA 3R00A 3R02A 4R7IA 5IMEA 1YXUA 2XVDA 4D2VA 3PVUA 3UMWA 4JDIA 3R7EA 4FUXA 2CGXA 4XG6A 3TNQB 5DVRA 5EM7A 5IUHA 3RK5A 4XMOA 2ITUA 3ML1A 3PIZA 3Q2JA 2I40A 5ITAA 4BB4A 5IH5A 3UIBA 4XNEA 4ZLOA 2V7AA 1FINA 1R78A 2Z60A 4B4LA 3TUBA 4HGTA 4XH6A 2XK3A 4FKTA 5E8SA 4M0YA 1LUFA 5GJGA 1OIUA 4O1PA 4R3RA 4RLLA 4J71A 2OZOA 3PRFA 3VULA 2GNGA 3OG7A 4RBLA 3P4KA 4GFMA 4X7QA 4F7NA 3UZRA 5CI6A 2YCRA 2X0PA 4JQEA 4YGAA 3SGCA 3TDWA 1J91A 2HAKA 4G6NA 3ZHPC 2XBAA 1YWNA 3Q6UA 2ITPA 3QZGA 3R8VA 2O5KA 3Q9WA 4ALWA 2X8EA 4EZ3A 5M55A 1RDQE 2ZOQA 4RX7A 4FNYA 1M2RA 2JKQA 3HMIA 4FIJA 3QUDA 4RVKA 3VF9A 2IO6A 1P5EA 3CQEA 2QODA 3FKOA 3E63A 4PL3A 5M4IA 4FV9A 3LMIA 5JQ5A 3AC4A 1ZOEA 3OEZA 5FXSA 4Y5HA 5E4HA 2VTSA 4K2RA 4L53A 4LMUA 4AOJA 4BCNA 2UW7A 3ZS5A 2QU5A 4CEGA 2BILB 2X0QA 3WZEA 3H9RA 3LFEA 2AC3A 2VTHA 1ZY4A 4E26A 4JAJA 5ETIA 4CXAA 4F63A 4IZ7A 4RJ3A 4ASZA 4H39A 4OBOA 4C4GA 4O2ZA 2VN9A 5CYIA 3BYMA 4MD7E 4CV8A 3IOPA 4KIKA 4IB1A 4O27B 4QEBA 3ALOA 3AGMA 2WQNA 4XRJA 5CT0A 3R9RA 4PQNA 3AXWA 4UYAA 4Y95A 4USFA 2YACA 4J95A 1OBGA 4EHVA 3OZ6A 4L3JA 1CSNA 3C0GA 4K6ZA 1KUTA 1WVWA 4LOQA 5HIBA 3AMYA 2VWIA 4BWPA 4TWPA 4BL1A 5ANDA 1PXOA 1YOMA 2PMNX 3P0MA 2GTNA 2GTMA 2R3KA 4CRSA 3D5XA 4I4EA 2QOBA 3P79A 4HGSA 3HDMA 1YHWA 1TKIA 2OJIA 5EQPA 4O4BB 4EH4A 1V0BA 4GRBA 5HORA 3BHYA 3FLZA 3QLFA 2ETKA 4R3PA 3OCBA 4WBBB 5CNOA 5A6NA 5CZIA 1M7QA 3EJ1A 3QD3A 3RK9A 5L2QA 5C03A 4DEEA 4EOMA 4R1VA 5L8LA 2GSFA 3V8WA 4EBVA 5DI1A 4YSMA 3EZVA 5FDPA 4WSYA 5FXQA 2J0LA 3PUPA 4HNIA 2JDSA 4UXQA 3TNIA 3NFGB 3HYHA 4HCVA 2WMBA 3RI1A 3FZ1A 3ZDIA 4LDTA 3VIDA 3RJCA 5HO6A 2EXEA 2IZSA 4Y46A 3PPZA 4YZCA 4EZ7A 4MUQA 3DXNA 2XNGA 1LP4A 3KEXA 2B9JA 4X3FC 3AMBA 4L00A 1VYZA 3ZLXA 3Q53A 4C62A 2WMAA 5CEPA 4WSQA 4Z9LA 3ETAA 4XP0A 4ZK5A 4D5HA 3ZZEA 2IF8A 1BUHA 3VUKA 4L3LA 3UQFA 3BGQA 4BFMA 1QPCA 1IAJA 4EKLA 4JIAA 4EHGA 4I5MA 5LQFA 3DQXA 5AIKA 5DLSA 3MB6A 2QG7A 3OCSA 5GZ8A 5AA9A 1M14A 2J7TA 3KCFA 4GKIA 4FUYA 5AX9A 3OF0A 4I23A 3UVQA 3RMFA 3PG1A 3A2CA 4U97A 4FODA 3OMVA 4YC6A 5DGZA 4ARKA 3DLSA 3VS5A 2W4OA 3DBCA 2GHGA 4GT3A 4N0SA 1FGKA 3QTQA 4DTKA 4F1TA 4YTCA 4AXFA 4FL3A 1Q41A 3DJ7A 5AV1A 1W2FA 3ACJA 3MPTA 4JBPA 3TKHA 4EH3A 2FGIA 3DKCA 3OP5A 4FSNA 3UZPA 3BGZA 2VD5A 4GJ2A 5CAQA 1YXVA 4M15A 1MP8A 3Q9XA 2UV2A 4IDTA 4LRMA 3R8UA 3GC9A 4S33A 2OXDA 3FC2A 4X2NA 5IEXA 2F9GA 3R22A 3OXZA 3VS3A 4CLIA 4MBIA 4EYMA 1REKA 2BIKB 2R3QA 4EH8A 3LXPA 4M69A 4XP3A 5DT3A 1SVGA 2JDTA 4N57A 3FI3A 4MF1A 4FEVA 3RAIA 2CN5A 3W0SA 1SNUA 4FKOA 3O17A 4FT0A 4C4EA 2I0YA 4YTHA 2YFXA 3V51A 4YMJA 1PW2A 2PVYA 4KA3A 4LMNA 2OZAB 3MPAA 4EYJA 5ANIA 1ZYCA 4ZZOA 3G6HA 4L9IA 4FIFA 5E8ZA 3W33A 1E1VA 4IB3A 4NJ3A 4U80A 3WF7A 3QQHA 4RJ7A 1KOAA 4ZJVA 3G5DA 1H27A 3RGFA 1URCA 2YWPA 3DAKA 1BKXA 2PK9A 2ZDTA 4CZTA 3IKAA 2IEWA 1PYEA 2VTPA 3EQFA 2V0DA 3P7AA 1F3MC 4F1OA 4NTSA 5G6VA 4X2FA 3QC9A 4YHJA 3V5PA 1ZARA 4IAAA 4BCMA 4RGJA 2A27A 4FEQA 4LRJA 4JS8A 4X2JA 4XG7A 2QURA 3RHXA 3ZSHA 5L4QA 1U54A 2H6DA 1WBPA 4DFZE 3DDPA 3HUBA 3WIGA 5JSMA 4PY1A 4FV3A 4Q5EA 2CN8A 4P5ZA 3GQLA 5DWRA 3VBXA 3JYAA 4D58A 1MQBA 3EH9A 5AJQA 4C4JA 3ZEWA 3D5UA 2VWUA 1WBVA 1ZMVA 4CFNA 2GNJA 3R83A 3R9OA 3WF6A 2YDJA 4PTCA 1H0WA 3R73A 2VTLA 3R30A 2YM5A 3IDPA 5IMXA 4FKQA 3U55A 4A9SA 2JFMA 3D7TB 4UBAA 5A4TA 5JKGA 3W55A 2J50A 4EC9A 3BE2A 3PFQA 5HCYA 4B8MA 4KD1A 2CCHA 2CKPA 2YA9A 2GS7A 4U7ZA 4BIDA 1H00A 2OJJA 2PY3A 5FG8A 3H9OA 4JIKA 3PE1A 1DAYA 4P7EA 2GNHA 4PV0A 5E8UA 5IA4A 5D12A 3BL7A 1GZ8A 2W1IA 4FV4A 4MHAA 1IA8A 3UE4A 2IW9A 4IVDA 4UY9A 2OF2A 3LQ5A 1PXJA 3MA6A 1NW1A 3TMOA 4AGUA 1OL2A 5IQDA 4EONA 4RVTA 3A8XA 4XG3A 4WHZA 4K0YA 1GIHA 3AC8A 4CFUA 5CSXA 3DJ5A 2WZJA 2O64A 4FVQA 3JS2A 2ZVAA 5EOLA 4IQ6A 2C1AA 3UNKA 3FY0A 3IW7A 5DH3A 2V22A 5LMBA 1G8SA 2OFUA 4GW8A 5HVJA 1REJA 4GVJA 3PPJA 2B53A 4F7SA 1Y8YA 4MNFA 4ZTNA 1GOLA 3RM6A 3UP2A 3GVUA 5KHWA 2Z8CA 4RG0A 1XMLA 3BEGA 5LVOA 3F3TA 4IW0A 4DCEA 3RZBA 4JG6A 4C4IA 3NPCA 4NKAA 4TKSA 4EH2A 5EM8A 5HE0A 3FEGA 4FV0A 4TY1A 4MNEB 4TYHA 3FMHA 4YUQA 4ZSAA 5CAPA 3FXZA 4EOOA 2JKMA 3K54A 3A60A 5H2UA 3UDZA 2NNWB 5AUZA 3PUFC 3F2AA 4J99A 3Q6WA 3QU0A 4FRFA 4O7NA 5M51A 3AMAA 1H24A 3IDBA 4XG4A 3F3VA 1E1XA 5BVNA 2XANA 4ANOA 3MVMA 5GIOE 1ZOHA 1XH7A 2PE1A 3PZHA 4UMTA 1UU3A 5FWKK 5HBHA 4AAYA 1XH5A 3ZDUA 4WO5A 2B9IA 2QOKA 3P5KA 4J8NA 3MFUA 4NW6A 2YIRA 2GFSA 4KABA 4E5WA 4FKSA 2W99B 3M1SA 3G15A 3O8PA 4RFZA 3U8WA 5LVNA 2WIPA 3DT1A 5EKNA 2PUUA 3ZONA 3NS9A 5LVMA 3U54A 4NCTA 3DFAA 3HRBA 2F2CB 2V62A 3KN6A 3NCGA 3FUPA 3DGKA 1WBWA 3FL4A 3MN3A 3V5TA 4DDGA 5C8NA 4FKRA 2BDJA 2XIYA 3AD4A 2OIBA 2G2HA 3ZUTA 2PHKA 3D2IA 4O4FA 1WBSA 4CQGA 3MSSA 3NUYA 1FVTA 2V55A 4BHNA 3DZQA 3FQEA 5A6OA 3V6RA 5H3QA 2BZJA 3GFWA 4TNBA 1UNLA 3ORTA 3D83A 3MTFA 4YJSA 5H8EA 2OKRA 3ORNA 4ACCA 4HVIA 1WBTA 5HEZA 2R3GA 3THBA 1CKIA 1XHAA 2OGVA 2XM8A 4OBPA 1QCFA 5AV3A 2C68A 3QZIA 1XBBA 4ENXA 4PDPA 4XS2A 3F2RA 5BYLA 4CZUA 4LQMA 3C4WA 4U81A 1PXMA 5KMLA 2WMQA 3EFLA 1K2PA 1NVSA 1P4OA 3II5A 4WNMA 2R2PA 5CSPA 4W4XA 1LPUA 4W4WA 4QPMA 5CEQA 3RWPA 5CAVA 4EK8A 3MS9A 4CCUA 2FSTX 4DT8A 2P4IA 2YAKA 3GC8A 2UW8A 1MRYA 2YLEA 2Z7LA 3R04A 3SRVA 2X6EA 4C33A 3CP9A 3GU5A 2GNLA 3KY2A 3M42A 4I5CA 4J8MA 5EG3A 4G3FA 5LVLA 2ACXA 1OITA 4WG3A 2CMWA 5KE0A 3EFKA 1KV1A 4BBFA 2BZIB 3KREA 5ANGA 1KE6A 1Q3WA 2I7QA 5DPVA 4AA5A 1J1BA 3LCDA 4NTTA 3ZBXA 3FSFA 4II5A 3VBVA 2JIVA 2XJ2A 2C30A 4QNAA 3MVHA 4RC4A 4C4FA 2PZ5A 2BFXA 3W8LA 2BRMA 2XKFA 4C7TA 4DDIA 4P2KA 2VTTA 4AZEA 3CCNA 3AC5A 3PA5A 5C8KA 2QG5A 3H0ZA 2ZV9A 5CAUA 2AC5A 1OUKA 2ZMDA 3C1XA 4L01A 4RSSA 3Q9ZA 5CI7A 3DXPA 3DQWA 3DNEA 4TZRA 3TZ7A 3S3IA 3UDSA 3GBZA 3GCUA 3G0EA 4EUUA 2HIWA 4DGGA 3BWJA 5IQAA 1VEBA 1NA7A 4RX8A 1DS5A 2YCQA 4RX9A 5JFXA 1TQIA 5A14A 2G2IA 5JN2A 4GU9A 4ANQA 4BCHA 5IA3A 2PUPA 3SVVA 3QQJA 2C3KA 3EN9A 3PXKA 3UQGA 1F5QA 3IDCA 3I6WA 3KRRA 4MBJA 3UOKA 4O96A 2PVLA 4O7WA 2I6LA 4GFOA 4XV3A 4AU8A 4ERKA 4X3FB 4ZSLA 3ZSGA 4I6QA 2VRXA 3FLSA 2BHHA 1Q8YA 4ZTSA 3C50A 2O0UA 4XCUA 3BU5A 3QCSA 4QP1A 4BJJA 2WTJA 4F64A 2IZTA 1YOJA 3VQHA 4H3PA 2VTJA 4MYGA 4YHTA 5CEMA 4AT5A 4MXXA 5BV3A 3UG2A 4HYHA 2BKKA 4YO6A 4F4PA 1JOWB 3TKIA 1S9JA 4XJ0A 4G5PA 3EQCA 3T9TA 2C5NA 3O5AA 4BZNA 3Q5IA 2F4JA 4DFUA 4L43A 2WGJA 4QQTA 4IDVA 5CXHA 5AX3A 4O22A 2IW6A 3P78A 3Q9YA 4GL9A 5BUJA 2VNYA 4IJ9A 2V5QA 5EHYA 3TNWA 4K33A 4L8MA 5AP2A 4EJ7A 2XAOA 4DH7A 5ACBC 1WBNA 2ZM4A 2WOTA 3TWJA 3TKUA 4JLCA 4M14A 3R28A 2X0GA 3QL8A 5LARA 4AN9A 4AN2A 3W0NA 3NUUA 4NWMA 1SYKA 4IC8A 3GENA 4PDOA 3QWJA 2UVXA 4L45A 1OL6A 2YISA 3FAAA 1FVRA 2UZLA 4YNOA 4GG7A 2YM3A 3O0GA 5HVKA 4MXCA 3QWKA 3Q60A 3ZRLA 5BUEA 5M56A 5HD4A 4NW5A 1O6YA 4PPBA 2R0IA 4EJNA 4CNHA 4HCUA 3BV3A 4E93A 4M97A 4FSUA 4ZP5A 4EK5A 4AZTA 2PPQA 5J1WA 2FO0A 4V05A 3EQHA 3G90X 4MVFA 1JKKA 4OAUC 1BI8A 4N70A 1WBOA 5H8GA 1T45A 3NIEA 5EOBA 4IB5A 1XH9A 4LRKA 4I0TA 2W1DA 3TIYA 3EOCA 3DKFA 4BICA 2AUHA 3R7YA 4JX3A 3LFBA 5FP6A 3E7OA 4O0YA 4D1ZA 4YP8A 4WNPA 5D11A 2O63A 2W1ZA 1UU8A 1H07A 2XA4A 3C7QA 4QRCA 1OPLA 3H0YA 3KCKA 4IBMA 2JBPA 2YIWA 2Q0NA 4I1ZA 4JBVA 4OTHA 4PRJA 3SOAA 4PDYA 5FTGA 1SZMA 5FDXA 4F0IA 3AQVA 4D0XA 3W2SA 3TNPC 3P08A 3F88A 4FG9A 1NVRA 3IG7A 4UN0C 3FLQA 5DG5A 1H1PA 4FVPA 2YHVA 1T46A 4QMMA 1HCLA 4A9UA 1ZMUA 1Q62A 5JGBA 2YWVA 3VUGA 3ODYX 2VTNA 4EK3A 4DH5A 4JDHA 4OBQA 3R1NA 4GUEA 4F9AA 3PG3A 2O65A 2RGPA 4ZTHA 1IAHA 4EZ5A 2BKZA 5C4LA 4NUSA 3NW5A 3OXTA 2PZIA 4IWPA 4C37A 2F7EE 3LE6A 5LCKA 4BYJA 1YW2A 3K3JA 2VWVA 4D4VA 5DT4A 3TTIA 5E92A 4YZ9A 1M2PA 2PE2A 3ORXA 3KXMA 5JFWA 4CFFA 2YCFA 2XNPA 3BV2A 4UWCA 2BALA 2FYSA 4BY9E 4GT4A 1X8BA 3PIXA 4BCQA 3I0QA 4FSZA 3W32A 4QTDA 1U59A 3RM7A 3T3VA 2YLFA 3BGPA 4ZEGA 5CASA 4NKSA 3E62A 2QKWB 3FSKA 4ORKA 3CBLA 3KFAA 4FK3A 3R1YA 4HOKA 3HP5A 4UZHA 3N4VA 3OCGA 5E9EA 3EL8A 2XRWA 3LFFA 5E7RA 3FZTA 4AQCA 2BUJA 3FC1X 2UZOA 3QCQA 3CQUA 1JSTA 5HGIA 2EXCX 4O0TA 2PMOX 5AR8A 4FV6A 1UVRA 3RTPA 1W2DA 3PXFA 5M06A 2WTVA 3C5IA 3U9NA 4K11A 2PU8A 4Y8DA 5F95A 3QTZA 4FSRA 1ZXEA 3HEGA 5M08A 5EI6A 4CZYB 4LI5A 3SOCA 2B54A 3COIA 4EK4A 4AZWA 3QTXA 5AP3A 4FZ7A 1PXIA 4EHEA 2BIYA 2YN8A 1APME 2JAVA 4IAZA 4LL5A 5EW8A 4FV7A 4ZTRA 2HZ4A 5KUPA 1IEPA 2EB2A 4EQMA 3HA6A 4M8TA 5KMNA 5AR2A 2ZV7A 2FSMX 3LJ2A 3LZBA 5FTQA 3MJ1A 1U4DA 3CTHA 1ZZLA 4JNWA 5EFQA 5HNBA 3UVPA 5HCXA 3VC4A 3VJNA 4IXPA 5I9XA 4JMQA 1M7NA 2AEGA 2OF4A 2CHLA 4OUCA 1P4FA 4O7RA 3UIUA 3ET7A 5HQ0A 2OU7A 2VWXA 4FTKA 5J95A 4BDGA 1W84A 1FMOE 2RG6A 2I0HA 3UNJA 4FE2A 3NYVA 3R7VA 3NAYA 5E8WA 1HOWA 4G16A 4NIFB 3WF5A 1VR2A 3FY2A 1GAGA 3FMJA 3NSZA 4KB8A 3KF7A 3O7LB 3UBDA 1BL7A 3GCPA 2XK6A 4FNXA 4FT3A 2X4ZA 1RE8A 2OG8A 3M11A 4ZTLA 4IVAA 4XG2A 1OKWA 3NYOA 4CRLA 5LWMA 1IR3A 2B9FA 2CGUA 5HD7A 3C9WA 3R01A 4HZRA 3VO3A 5KMOA 1Q8UA 1Q99A 1SM2A 3UPXA 2WOUA 4S30A 3BI6A 5EKOA 5HO8A 4C3RA 4ANNA 3A7HA 4G3GA 2YDKA 3ZXZA 4BCOA 3LFNA 5BUIA 4EHZA 3R1QA 3KXZA 4TNDA 4AW1A 4DINA 2C47A 2XP2A 4FK6A 4JVGA 3DFCB 4DCAA 3MJ2A 4FSMA 2QOLA 4RWKA 4AZVA 3KMWA 3WILA 5CALA 4IFCA 3HVCA 5J79A 2J2IB 3P1AA 5CF8A 4E1ZA 1YDSE 4C8BA 2GHLA 3NMUF 1OL5A 1XO2B 4BCIA 3QTWA 4QMXA 4O2PA 4DGOA 2R3FA 2IW8A 3BL9A 2G1TA 4FVRA 1WCCA 1W0XC 3A61A 4ZY5A 2XAMA 4BF2A 1R0EA 4AE9A 3HAMA 2BCJA 1FGIA 3K5UA 2VO7A 4KWPA 3FZRA 4KRDA 3V8TA 4F6UA 3IONA 1JSVA 3P23A 1PMUA 3FHIA 4YZNA 4YPSA 2C5YA 3MYGA 3A7IA 5IG1A 3UGCA 2YM7A 2VTQA 4JX7A 5KO1A 5IKWA 3CC6A 3REPA 3U87A 4YJQA 3AC2A 2R4BA 4QMOA 2J0IA 3C4FA 1KWPA 4XOZA 3R7OA 3U6IA 1GNGA 4O1OA 4JOAA 4LG4A 2ZM3A 4FL1A 4D2TA 2YEXA 3TCPA 3MESA 2UZUE 2OK1A 2XMYA 4V0GB 5A3XA 4YO4A 3FQHA 4D9UA 3U6JA 4B99A 4C38A 5AM6A 3PTGA 2ITTA 2OBJA 4M68A 2OICA 5L8JA 4HJOA 1VYWA 3R2YA 4M3QA 2I1MA 4YZDA 3FMEA 5CT7A 5AMNA 5E91A 5HTBA 4F08A 5FTOA 3FPQA 3HV5A 3POOA 4FF8A 3AT3A 4KKGA 4LUDA 4XOYA 1CDKA 3DA6A 2BZKB 2O3PA 4GMYA 4BGGA 4YTFA 2H96A 2E9OA 4G3CA 2WIHA 5KZIA 4IAIA 1ZYLA 4NU1A 3UIXA 4QYGA 1TVOA 3FYJX 3HMOA 4AFJA 4ANSA 4PTGA 1OIYA 2HY81 3ZUVA 2VAGA 3FXXA 4ZTMA 4YBKA 1H08A 3W2QA 2BTSA 3PYYA 4CMTA 1H1RA 3CJFA 3RZFA 1Q5KA 4FEWA 3MB7A 5KZ0A 3DAJA 4OTPA 5T3QA 2WNTA 4JG7A 2JITA 2CLXA 1UWJA 3F3WA 2W1FA 3MH0A 4FV5A 4UYNA 4OLIA 3JY0A 3P5JC 4O7SA 3SDJA 3FL5A 3L8PA 4J1RA 2QVSE 3DBEA 3GU8A 2X2LA 4WG5A 3H3CA 2NP8A 4I24A 5AP4A 4OTGA 2XIRA 4GG5A 4XLVA 5CQUA 2ETMA 3DCVA 4HVDA 4K9YA 4I5PA 4E4XA 2RL5A 2ZAZA 3FZPA 3Q52A 4W4YA 4MXZA 2J4ZA 2HZNA 1UV5A 4OTQA 3FMNA 4MQ2A 4PX6A 2WKMA 3TV4A 4PNKA 3HV3A 2J6MA 1DI8A 5EYKA 4FOBA 3FV8A 5L2IA 5HHWA 3F2NA 4QNYA 2WEVA 2BROA 1J7UA 5HIDA 2XEZA 1Y6BA 3CJGA 3DV3A 3D5WA 3PSCA 4MKCA 4GVAA 2R64A 2ZB0A 4AACA 4G6OA 1NY3A 5HG9A 3NVKI 3NLBA 4TYJA 3VS1A 2GS2A 4DH1A 4AOIA 3DAEA 4ZLZA 4BR3A 3FLYA 3UYSA 2QKRA 3HKOA 4AN3A 3OUKA 4X2KA 2IVSA 5D9HA 2Z7QA 5DR6A 4G1WA 4HPTE 3PXYA 3VW8A 3MFSA 4RMZA 1G8AA 4DFYA 4JDJA 3MY1A 2SRCA 1DAWA 3VS6A 4EEVA 1YKRA 3VS4A 4KAOA 5BVFA 4XHKB 3R0TA 4HPUE 3SW4A 4QMNA 2ITQA 4GJ3A 2EB3A 3CPBA 4BBEA 4RJ4A 2GCDA 3QQGA 4PWNA 5CU0A 3I81A 3FJQE 3HV4A 4S34A 2UZVA 5GHVA 3VS7A 2X1NA 1ND4A 1LR4A 1YXTA 4AZFA 3MIAA 4F1MA 5FLFA 4QMPA 5BQ0A 4QDVA 4JBQA 5DIAA 2FVDA 2WQOA 3VAPA 5A46A 3BBTB 3BLRA 3QCYA 4MNEA 2F7XE 1VJYA 2FA2A 4K77A 2W4KA 3ZO4A 3IW4A 1V1KA 3QD2B 4FICA 4K18A 4BYIA 3RAWA 4AG8A 3OY3A 2G01A 2J90A 4Y73A 3RAKA 4R8QA 4JJRA 4C4HA 3PY1A 2B1PA 5L2SA 2XRUA 4Z7GA 2OH4A 3O96A 1SVEA 4IB0A 4RLKA 5DOSA 2CNUA 5EYMA 3LJ0A 4PMPA 2IPXA 2C69A 2UW4A 3ZLSA 1XKKA 4FIIA 4XBUA 5JQ8A 2J9MA 4BDHA 4BI1A 4TYEA 4O0RA 4ALVA 4WG4A 3ID6C 2JAMA 4C0TA 4C58A 1UA2A 2QONA 3MY0A 3NDMA 4CYJA 4USEA 1CKJA 1KV2A 3WIKA 2IG7A 3OUNB 3UNZA 4I6LA 3NW7A 2HCKA 4DHJA 3DKOA 2X2MA 3HMMA 1A06A 3QD0A 3UTOA 3ZTXA 3CY2A 2R0UA 3LCSA 4ZTQA 1MQ4A 3IS5A 3LFCA 1PJKA 2A98A 3PJ8A 5D10A 5FEQA 4O7LA 2H8HA 3OWJA 3WZJA 4A7CA 3UQCA 2PUNA 4ANLA 4YC3A 1Y57A 2WTCA 4YJRA 5JGDA 1W8CA 4CCBA 2W5HA 3OWLA 4WOVA 5M4FA 5LMKC 3SX9A 4WNOA 4NFMA 1YWVA 2GQGA 3F6XA 4M66A 4C3PA 3N4TA 1ZYJA 1J1CA 4USDA 2VWBA 2HY0A 2VTRA 4FTAA 4AW0A 2C6LA 5HX8A 4I6FA 3S00A 2OO8X 3NW6A 4BI0A 3TZ9A 4LUEA 1ZRZA 4FIGA 2ZMCA 3GU6A 4NFNA 4NEUA 3TV7A 4D2RA 2VWWA 4ZZNA 1H28A 4EOIA 4DBNA 4NK9A 4CTCA 2ZYBA 4BDEA 4EOKA 2JD5A 1L3RE 3EN4A 3O71A 3QZHA 2UZWE 3V01A 4ASXA 3EKNA 3EKKA 2XKCA 4GK2A 2R3IA 5CX9A 3FBVA 4LYNA 3L9NA 5CEOA 3PXRA 4B9DA 4TTHB 2OXYA 3UODA 3E87A 3HRFA 4W8DA 5HE3A 3TZ8A 3K5VA 2ITOA 3U9CA 4KIQA 2W9ZB 5DEWA 2QC6A 4UXLA 4EH6A 3UMXA 4D5KA 2C6TA 5I5ZA 2YITA 4FTNA 5B2KA 2JDRA 1V0OA 3R63A 4ITIA 3IW5A 4X21A 5FUTA 4FGBA 3E3PA 2YM6A