5AR2A

Rip2 kinase catalytic domain (1 - 310)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
307
structure length
277
Chain Sequence
EAICSALPTIPYHKLADLRYLSGTVSSARHADWRVQVAVKHLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMGGTIIYMPPENYEPSIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 277
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar2A00
4JQEA 3ZONA 4YLKA 3F9NA 4HJOA 3VS6A 4GFMA 1GZ8A 2VWXA 4JQ7A 4YSJA 4CFNA 3LFAA 1QMZA 5E92A 3GC8A 2VTQA 2XS0A 3BV2A 2VZ6A 4FSMA 3R0TA 4BIBA 4YP8A 1K9AA 2B9JA 5CTPA 3W32A 2GNHA 4D1ZA 3MH2A 4NFMA 4KIQA 3TKHA 3AMYA 4YNOA 5HORA 1XO2B 1H25A 3BV3A 5CF4A 1J3HA 5I9ZA 3PIYA 3DGKA 4GK4A 4G3EA 2CPKE 4BI2A 4DHFA 4EUTA 1R3CA 2YIWA 3SW7A 4RIYB 4JX7A 1H26A 4DG0E 5DR6A 2F7ZE 4FVPA 2GCDA 5AMNA 5JFSA 3BLHA 3M11A 3UMWA 4PL3A 4PPBA 4DFZE 1OIQA 3EQPA 2WMBA 4MX9A 4GG7A 4YJUA 4D55A 2R3GA 5D11A 4FTLA 3TNPC 3U6JA 3CPCA 4JDJA 4M14A 3GCVA 4IIRA 1JKSA 4YSMA 4AN2A 3LZBA 4AT5A 4CSVA 5I9VA 3F7WA 2C0TA 2E9NA 3ET7A 4GU6A 3UQGA 1H0WA 1XH6A 3PXRA 5AM6A 4I92A 5LMKC 4BIDA 2WTJA 4AE9A 4Y95A 4KABA 5HIDA 1XBCA 4HCTA 2VTLA 4PWNA 4AGCA 1FVTA 4WSQA 4A9TA 4RJ6A 4NSTA 2PZ5A 4AZSA 4EOLA 2YACA 5JEBA 5FP6A 5HNIX 4X6RA 2Y4IC 4IAKA 5M4IA 1H1WA 4AT4A 4GT4A 4RA5A 2X8EA 5TT7A 1J1BA 3R1NA 4M13A 4MHAA 3G9LX 2EXMA 5GJGA 3VRYA 4RC3A 3SVVA 4IH8A 4P90A 3V8TA 5KBQA 2VO0A 3TV7A 5CALA 4NKAA 3U51A 5AP2A 4I3ZA 3GQIA 3COMA 4FG7A 2VX3A 4Y85A 4HVGA 2P2HA 2QG5A 4FIJA 3AGMA 4RWIA 3F5UA 5AP1A 5TOZA 4CFVA 5HCYA 3FLSA 2YN8A 4HVIA 3MY1A 2JD5A 1QPCA 1ZMUA 2VWIA 4FOCA 2O8YA 4IWPA 2DS1A 4OTIA 3ZSGA 4C58A 4L6QA 1NVQA 5AUTA 4V0GA 3NPCA 2H34A 4U6RA 4RJ3A 3QUDA 3OZ6A 4GJ3A 4H39A 4U9AA 3DNEA 3T9TA 1E1XA 4I6QA 1H1QA 3F5XA 4QYFA 5FD2A 5ICPA 5IU2A 3EL8A 4FYOA 5HE3A 3NAYA 4XBUA 5LVMA 4GFGA 4G5JA 3AXWA 4DBNA 4E73A 5D9HA 1CM8A 4M67A 3WZEA 1ZYCA 4XS2A 3W1FA 3NW6A 4XV1A 2Z7RA 1XH5A 3UODA 4DYMA 5CAOA 4WHZA 1JBPE 2WD1A 4NH1A 5KZ0A 5CU4A 3F2NA 1STCE 4E5WA 4ZJIA 3LFEA 5L8KA 1BL7A 2B52A 2WTKC 3IDBA 4RIYA 4E4LA 4JVGA 4PUZA 2YERA 2QOBA 3QTRA 3UIMA 4WUNA 4BBMA 3R7IA 4O0WA 2V22A 3R71A 3DKOA 4TYEA 5DRDA 3V5LA 3QUEA 2PMOX 2UZWE 4CFMA 1WMKA 2QOOA 3PVUA 4EZ3A 3PP1A 2VO7A 1YRPA 4FTOA 5KMLA 4C3RA 3JYAA 4CXAA 1O6KA 4I22A 2EVAA 3ANQA 3KL8A 5JMSA 3VULA 4MBIA 2WTWA 4HYIA 1VEBA 2R3PA 2OJJA 1U59A 3ORPA 5AV1A 4I6HA 4I5HA 4DITA 5C1QB 3QZFA 4IZ5A 4QOXA 5FG8A 2B55A 1UU8A 3PRIA 5E8WA 3EMGA 3OW3A 4QTBA 3KXZA 4D58A 3ENMA 3NAXA 4I6FA 1ZY5A 4IFGA 2IVUA 4CYJA 1WCCA 4QTCA 5IPJA 4MXYA 5FQDC 3GQLA 1JPAA 1LPUA 2QOFA 5J7BA 5AR7A 3FXZA 3VWAA 3ZO4A 4P2KA 3AD4A 4S32A 3R1QA 3QU0A 5T3QA 4BIEA 4CT2A 3C50A 3CS9A 5EW9A 5AUVA 4D2TA 2G2HA 4V01A 5ANOA 3PSDA 3UOLA 5BVKA 4AW1A 3PA3A 4PP9A 4GL9A 3JVSA 3HMIA 2XRUA 3QQHA 4QQJA 2PE2A 5DG5A 3WF7A 4O22A 3Q9XA 2PMLX 4TT7A 2C5VA 3E7OA 4QMVA 5C9CA 4ZSEA 1WVXA 4EQCA 5KHXA 2OU7A 2HW7A 4GV1A 4U0IA 1OECA 5EM8A 5DN3A 5KE0A 4DGOA 5IMEA 4QP2A 3QKKA 4KKEA 5A6OA 2WMQA 2F7EE 3WIKA 3ODYX 3DQXA 2QR7A 3IGOA 5TO8A 4G3GA 3DKGA 3C0HA 4I6BA 3C0IA 3HUCA 3QZIA 4GJ2A 4EOMA 2VWYA 5BPYA 4PPCA 4KB8A 5CQUA 2YM8A 3TKUA 3OHTA 4F7NA 5HBEA 3BGQA 3QF9A 4DEAA 4QD6A 3Q9YA 2YLEA 4AACA 3BU5A 2ESMA 2XA4A 5HCXA 4A9RA 4JLCA 4IAIA 2YIYA 3U4UA 4F0IA 4KS8A 3BKBA 3EQHA 3NGAA 4XEYA 5DA3A 3LXPA 2I0VA 5CX9A 1MRVA 2Z7LA 3RMFA 3NDMA 3OXTA 4CLIA 4O91A 1P4FA 4L46A 4ONAA 4RSSA 3AMAA 3BE9A 3BWJA 4QPMA 3PE1A 5K0XA 3DKCA 3LMGA 2JBOA 3ORZA 3HV7A 3PJCA 4ZTHA 3HMMA 4MYGA 2VWBA 3KRWA 3F3WA 4FKOA 3MIAA 4RZWA 3KF7A 4AZWA 4YMJA 4IAYA 4MEDA 3QGWA 2XH5A 5GHVA 3ZDUA 4GFOA 3RNIA 3RWPA 4GCJA 4FIIA 4E5AX 1SNUA 2E2BA 3PY1A 4FV3A 4F9CA 3E62A 4FIEA 3WF6A 3PXQA 3FLYA 2QNJA 3EFWA 4DFLA 1PYEA 3UBDA 2BZIB 2RFNA 2CN8A 3PY3A 2ACXA 1GZKA 4UWCA 4TXCA 4XG4A 3TJDA 3DJ5A 2W4JA 3R9OA 3NS9A 3Q32A 4FKPA 2VGPA 4QMUA 5JQ8A 4BBEA 2A0CX 3R30A 1W0XC 4EOSA 5BVOA 3IPHA 2ITZA 3OWLA 3QQJA 4EYMA 5AEPA 1PMNA 3PPKA 3R04A 3UC3A 2QOIA 1PMUA 2ONLA 3A7IA 3BELA 3DKFA 3EFJA 4MH7A 5EH0A 4CKIA 5BVWA 4IADA 3ZUTA 3R73A 3DJ6A 1YI6A 4O27B 5DMZA 5JT2A 3FSKA 5ETAA 4YURA 5HIBA 4E26A 2C6LA 4FSNA 1PYXA 1JVPP 5A4CA 1H08A 5CZHA 2ERZE 2NPQA 4FT5A 2BMCA 4FKGA 2OJFE 4WOVA 1SZMA 2WMRA 3GCSA 3QKMA 4HCUA 4F65A 1I44A 3TZMA 3Q9WA 4L3LA 4EWQA 3V5WA 2V62A 2VTSA 4BDKA 4G6NA 2W1GA 1YKRA 1O6LA 2IW6A 3MVMA 5IH4A 1UKHA 5J79A 1MUOA 1APME 4A9UA 3M42A 5IKWA 2RFSA 1PXIA 3OCBA 4EK4A 3QA8A 1KE7A 4CTCA 2VUWA 1URCA 3TNQB 4FG9A 1QL6A 5C26A 3P5KA 3K3IA 1XBBA 3W55A 1OL5A 3R6XA 3NYXA 4HYHA 4JR7A 3RHXA 3ZXZA 2UVZA 1IG1A 2GSFA 4BGGA 4E6QA 4BTKA 4DEHA 3BX5A 4IX5A 4ACDA 5EI2A 3COKA 5CU3A 3POOA 3ZLWA 4JL9A 2RFDA 2OXXA 3DFAA 5CVFA 5CVGA 5AR3A 2FSTX 2YJRA 4GYIA 4WNMA 4CZUA 4ZSGA 2PZIA 2QOLA 3GI3A 4V05A 4WA9A 4E20A 2OWBA 4YU2A 2IZUA 3KRJA 3MFTA 4GMYA 4Z9LA 4QTEA 3FAAA 1U54B 3IW8A 3RAKA 3EZRA 5CEPA 5L6PA 4RIWA 4BWPA 4Q9ZA 5IUIA 4M69B 4CKRA 1UA2A 2X39A 3G33A 2PVKA 5FP5A 5KUPA 3D15A 4FZ6A 2UW7A 4EH8A 4ZTQA 2YABA 5AR4A 4F7SA 5E8SA 4AA4A 4B4LA 1U46A 3FZSA 1PXOA 3A2CA 4UMTA 3F3VA 4K11A 2RSVA 4FKUA 4RWKA 2QODA 2BDJA 3QCSA 4FT0A 4BB4A 4AOTA 2OJIA 5CT0A 3NNWA 4B99A 4AGDA 2OJGA 3HDNA 1AQ1A 4XNEA 4BDIA 4D4VA 4IACA 1BYGA 3FMMA 3A7HA 3WYXA 4EL9A 4RG0A 1IA8A 2ZMCA 1GAGA 4QP7A 4E6DA 3QLGA 3O2MA 1JSVA 3FMEA 2R9SA 1Z57A 2W05A 4IZ7A 4QPAA 2OW3A 3QQLA 2BUJA 2JDSA 3PXYA 5FEEA 3A62A 4F09A 1TQMA 1RQQA 5DEYA 3UC4A 5KZIA 1XWSA 2UZTA 2WMWA 4O6EA 2OF4A 3DLSA 3ORIA 3SW4A 3H30A 5CEQA 3G90X 3BZ3A 4M84A 3U4WA 4NEUA 5K4JA 4PPAA 1P14A 4BL1A 3H9RA 5CNOA 3CC6A 4FUXA 5I9YA 5GNKA 4OUCA 4FSQA 4MBJA 3FQSA 5AUYA 2P55A 5AV0A 5BQ0A 2I0EA 4I1ZA 5LMAA 1L3RE 1YOMA 3F7ZA 4LOOA 3T3UA 3UMXA 4YJPA 2ITNA 3FMHA 3S3IA 4XRLA 2IZTA 4IAZA 4QP6A 2W96B 2Y0AA 2BHHA 2ZV7A 2A2AA 3QLFA 3SA0A 4B7TA 4BBFA 4NW5A 4L7SA 5ANGA 1FVVA 4IEBA 4FV5A 4QO9A 4AZTA 1P4OA 1JSTA 3VRZA 3W2RA 3EN7A 3PJ8A 5AV2A 4G3CA 2BPMA 4UBAA 2YCSA 5LCJA 1V0PA 2C6TA 4HW7A 4XLIA 2HXQA 5HX8A 3S00A 4FGBA 3GGFA 3K2LA 1F5QA 5LVNA 2QQ7A 3O0GA 4WBBB 3TEIA 1U54A 5HVKA 5CEMA 3W2PA 5DRBA 5DT3A 2PVJA 4U44A 3D5WA 4A4XA 4DEBA 1PF8A 4GEOA 3FZOA 2PE0A 3NIZA 5A54A 5KCVA 3C7QA 3CTJA 3HECA 3HL7A 4FKRA 4NCTA 4E4NA 3ZO1A 1PMEA 4E3CA 5CF8A 4ANQA 3SD0A 3ZM4A 3NLBA 4KSQA 4ZJJA 4RVMA 4C59A 4RJ4A 4GRBA 3I60A 1M7QA 2J50A 2BIYA 3P7AA 2C4GA 5KBRA 3GC9A 2P3GX 4CMOA 3U9NA 5JH6A 1Y8YA 1LUFA 4F9BA 4RFMA 4UEUA 5FEQA 2WKMA 3CE3A 2VWUA 2VNWA 4ANSA 3T9IA 2W5AA 4H36A 3SHEA 1VZOA 3LFDA 4R3PA 4YZBA 4GIIA 4AGUA 5DEWA 5IEVA 1FPUA 3KFAA 5B2LA 5JGAA 3HV6A 2ETRA 4I94A 3C4FA 3VO3A 4YR8A 4GT5A 2ZYBA 3D94A 3IW5A 2HENA 2PHKA 4I5MA 5M55A 2VTHA 4ARKA 4YGAA 4Y5HA 4PNIA 5CF5A 4AUAA 4IDVA 4U97A 5EW8A 2WMVA 4RX8A 4IM3A 3V5PA 4D2RA 5DBXA 5BYZA 4JRVA 5C8KA 4EZ5A 1WBSA 3MDYA 3DDPA 1OL1A 3DK6A 2YAKA 3FJQE 2YAAA 3UDBA 2X7GA 4EQUA 4FNZA 5HG8A 2Q0BA 4K18A 2Z2WA 3RM7A 3VAPA 4UN0C 4ZY5A 4UZHA 4APCA 3F66A 4AZFA 5A4LA 3GC0A 3M1SA 1Y8GA 3GCUA 3OD6X 2XK9A 3QWKA 4FICA 1FINA 5IA5A 3BGPA 2NRUA 2OG8A 4IBMA 2JDRA 4L68A 4N6YA 3I7CA 3BHVA 5JRSA 3I6UA 3QBNA 5TE0A 1H8FA 3A7GA 3D9VA 4FZ7A 3EKNA 1JOWB 3HRBA 4LUEA 4R8QA 4V04A 2C3KA 5EYDA 3QTQA 4FV9A 4FUYA 3B8RA 3BU3A 4MQ2A 4F64A 1Y91A 4YHTA 4FA2A 3BBTB 3FY2A 3R9HA 3QALE 2PMNX 4ID7A 3JVRA 3PWYA 4BDCA 3OF0A 3Q60A 5LARA 4EOJA 3F61A 2WOTA 3FLZA 3FYJX 3LCKA 4RJ5A 5DVRA 4EH5A 4HZRA 2XJ1A 4XJ0A 2VTTA 4C35A 5FLFA 4OBOA 4CMTA 3RGFA 5J7HA 3PXZA 2G15A 4I20A 4ANNA 2J7TA 3TNHA 3TIYA 4FIGA 2YHVA 3AD6A 4GSBA 3DK7A 3EN9A 5EHYA 3RPSA 3VBYA 4FZFB 2PTKA 3UPXA 4J52A 2XK8A 3V01A 2X7OA 3UG2A 3R21A 5ETCA 3UVQA 3VBWA 3OUKA 2QOHA 5D10A 3UQFA 3BI6A 4EYJA 1Q8ZA 2C6MA 4YTHA 3W16A 4FNXA 3QCYA 4GH2A 3LCDA 5IMXA 4TPTA 3QTSA 3CD3A 3PUPA 2ITWA 3ENHA 4G9CA 4HVHA 2B54A 3UQCA 3WF8A 2BALA 5CVHA 5AR8A 4S2ZA 1Q24A 3OY1A 4N4SA 3R7UA 3VS2A 3K5UA 2XNMA 4J1RA 4YJSA 4EC8A 1SVEA 1A06A 1YWVA 2Z7QA 4DH3A 2X8DA 2PE1A 4ALWA 3ZS5A 3R00A 4WIHA 3FMDA 2JDOA 2WQBA 3H3CA 4D2WA 1Y57A 2JIVA 4G3DA 4IZAA 4YLJA 4TYIA 2PVFA 2CCIA 3UO5A 4FSZA 2FYSA 3C4WA 2IO6A 4FV1A 2YLFA 2XM8A 4EK3A 1Q8WA 4KRDA 3MPTA 2WPAA 3BHUA 3FI2A 2CMWA 5GJDA 2ONLC 3A4PA 5H2UA 5K3YA 1DI9A 2F2UA 2WIHA 2WU6A 3H4JA 3TZ8A 3E87A 2HWOA 4RX7A 4X3JA 3ZXTA 2ZDUA 3IDCA 4LUDA 4NFNA 1YQJA 3HA8A 4ZSLA 4OTDA 4WSYA 4RQKA 2OIDA 2BZHB 1H24A 1R1WA 1XQZA 3NCZA 5HD4A 1ZARA 4O0VA 3EH9A 3FC2A 3IS5A 3VVHA 5CSHA 1ZZ2A 2O5KA 3DV3A 2BIKB 5EK7A 4ENYA 3VS5A 5AV4A 1MP8A 5C8MA 3ZTXA 3KRLA 3L9NA 4UZDA 3OXIA 2B4SB 1F0QA 2IVVA 3CEKA 1YDSE 3D7ZA 3GU6A 3KVXA 4Y73A 4QPSA 3UOKA 3DBEA 4FSRA 4JBPA 4QYHA 3I5ZA 3RALA 3RK5A 4H1MA 4LGGA 4ALVA 4CYIA 5K4IA 1SM2A 2XCKA 2WMTA 3ETAA 3F3ZA 3I0OA 3ZZEA 5EYMA 4AA5A 3SDJA 3VHKA 2X2LA 4RLLA 3I7BA 4DEIA 2FSMX 3DK3A 4BGHA 3QD0A 3DA6A 3ZC5A 5J5TA 5L6OA 4JXFA 3FKOA 4B8MA 2VNYA 4DLIA 2OJ9A 1QCFA 4FX3A 3IK3A 4TNBA 4O0YA 4AAAA 3HX4A 4BZNA 4BWKA 5FBOA 4FV0A 4EHZA 4UMRA 3ROYA 5CY3A 2XK4A 2Y6OA 2VX1A 4L42A 2R3JA 4AQCA 5EI6A 1WVYA 3D7TB 1U5QA 1OKZA 3K5VA 4TWNA 5M4CA 3LCTA 4JAJA 4J7BA 1YOJA 3PIZA 4OGRA 4Y8DA 3KULB 1GJOA 3GUBA 5HBHA 1YDRE 1WBOA 2FA2A 4K0YA 2ETKA 3G51A 3PLSA 4U41A 5BUJA 1XH8A 3LQ5A 3V51A 1RW8A 4Q2AA 1PXNA 2C3IB 2Y8OA 3UIBA 3FQEA 3R2YA 4RX9A 3HRCA 3QYZA 1GY3A 4ZJVA 3DOGA 4EHEA 2XIYA 5J87A 3RPRA 3PRFA 3QD3A 5CS6A 3HVCA 2JFMA 4RX5A 2XNOA 3OY3A 3QX4A 4IDTA 4I0TA 2OI4X 3DS6A 3FI3A 3RM6A 3P86A 3SXFA 3F6XA 3FQHA 2HWPA 2JDTA 3NNUA 2GNLA 4EBVA 2EB2A 3REPA 4BDGA 3HZTA 1T45A 2BAJA 2C0OA 2X7FA 3BHHA 4C4EA 3OWJA 1VYWA 3ZBXA 2ITQA 3TKIA 4KBKA 2JAMA 1M17A 4BVUA 2R3LA 4AW5A 4OTWA 2OXDA 2WTVA 4FKJA 2ZDTA 2VO6A 3GU7A 4ZTRA 2W5HA 5FM3A 3ZHPC 3HNGA 4P7EA 5J9YA 2OF2A 2C30A 4M0ZA 1UV5A 3OMVA 4MXOA 4Q5EA 5HG5A 2WGJA 1MRYA 3E93A 3OWPA 3H10A 5DI1A 2CN5A 4FKWA 3KXNA 1Q62A 4IE9A 4TNDA 4G6LA 3OT8A 3PE2A 2KULA 5H9BA 4ZLZA 3OOMA 4LOPA 3HUBA 4CKJA 5HIEA 3F3TA 4OTFA 3UO4A 4IVDA 1YXVA 5KX8A 2X81A 4MNEB 4XG9A 5KHWA 4FT3A 3IECA 3OC1A 4XX9A 3NUPA 3E8DA 3H9OA 3UG1A 4BRXA 4IVBA 2ITYA 4PMTA 4EBWA 1FQ1B 4TKSA 3I0QA 1GZNA 4RWJA 4TYGA 4YJNA 4YJOA 5IEYA 2ZOQA 3D7TA 5IUGA 4MQ1A 4JR3A 3IGGA 3WBLA 4IX4A 3ORXA 3EQGA 4DEGA 2P4IA 3P4KA 3KULA 4JX3A 5F95A 3BU6A 5IA1A 3QD4A 1H1PA 2WTCA 3N51A 4QMPA 2VTJA 3G0EA 4NCTC 1PW2A 3FC1X 2C3JA 3P7CA 2V0DA 2XCHA 4L44A 2XEZA 4OBPA 2XIKA 3MYGA 2OO8X 2AUHA 4HVSA 2WQNA 3AMBA 1XH7A 2RL5A 3G0FA 1Y6AA 2F4JA 4KSPA 3ZLYA 3FHRA 3NUSA 5FM2A 1WBVA 2E9VA 2G2FA 3PFQA 2FSLX 5ETIA 2ITTA 2R3KA 3QQUA 3B8QA 2HOGA 2QO9A 3TG1A 4BTMA 3PVBA 4KWPA 4U81A 2QU5A 2UZDA 4IVCA 2CDZA 2YDIA 5HE1A 4C34A 4ANOA 4R3CA 4M7IA 3VUMA 4D5HA 2I40A 4UY9A 3NEWA 2Z60A 1SYKA 4QP4A 2YIXA 3MFUA 5HQ0A 4XCUA 3C9WA 4RFZA 1M14A 5HZNA 3RTPA 1YXXA 2PMIA 4BCPA 4FSUA 3FPMA 4LRKA 2ZV2A 4Y5QA 3ULIA 1Z9XA 2E9OA 2C69A 3W2OA 2PL0A 2YCRA 3ZFYA 4MWHA 4BZOA 4ZOGA 4EOIA 4G9RA 3GU4A 4RIOA 3ZLXA 4G2FA 4G31A 4YPDA 1YXSA 2R2PA 1M2RA 2F7XE 2XKCA 5HVJA 2BRHA 3A4OX 4FYNA 4FKVA 4OTGA 4O0RA 4S33A 5CASA 1IASA 4DH1A 4B8LA 2C3LA 2G01A 3QRKA 4LYNA 3VUHA 2QKWB 3ZMMA 5FDXA 2B7AA 3PSCA 4O2PA 4P5ZA 4K9YA 3QHRA 2CGXA 4BCNA 5EDPA 3DLZA 4ZZNA 3L8SA 4DFNA 4DLJA 4JI9A 2BAKA 5K5XA 2C6IA 3LXKA 4JQ8A 1ZLTA 1JAMA 3PIXA 2J0MB 2UZVA 2W1FA 4MXZA 4MNEA 5FEDA 4E6CA 4F0FA 5JFVA 3DB6A 3JUHA 3KK8A 5DIAA 1R0PA 2X4FA 1OL6A 5AIRA 4D1SA 4JS8A 4XG7A 4MNFA 2X8IA 1W84A 3OROA 4QMZA 5LVPA 2W0JA 4FIFA 4XBRA 4TYHA 1OKYA 5ETFA 5TF9A 2QHMA 3DTWA 4JBVA 4KS7A 3UVRA 3QD2B 1DM2A 1IRKA 2BFXA 4C4IA 3KRRA 3LCOA 4XP2A 5A3XA 1F3MC 1ZYDA 2FH9A 2J5FA 2VTIA 2XMYA 4FG8A 4L43A 1PXPA 2B9FA 2BVAA 3VBTA 5JK3A 3I79A 4R7HA 3LE6A 3COIA 1EH4A 2PZRA 2XF0A 3CTQA 4PV0A 4C62A 5BVFA 4F70A 3DZOA 4IM0A 5B0XA 4YZCA 2W1HA 4FT7A 4FKIA 4JJRA 4R5SA 4RIWB 1CDKA 2AC3A 2BRBA 1OIYA 5EM5A 4AZVA 3AG9A 2PWLA 3D4QA 1HCKA 3RNYA 4UMUA 3L9MA 3GBZA 4BCFA 1J1CA 1RJBA 1OUKA 3C51A 5AX9A 5E8YA 4A9SA 2XJ0A 3ORTA 4CZYB 4YJQA 2GTMA 2UW8A 5CU6A 5BMMA 4X2NA 3UNZA 3V5TA 2FUMA 2C5OA 4K8AA 3S4QA 1X8BA 2F2CB 2UV2A 4FTQA 3MH0A 4RPVA 2PSQA 4U45A 5LWNA 3G6HA 3FSFA 3CQEA 5LOHA 5IDNA 4C3PA 2JKKA 5I3OA 1FMOE 4BCMA 3BE2A 3E8EA 3P78A 2W4KA 3SXSA 3W10A 2EWAA 2R3MA 4KINA 3QRIA 4UWBA 1XJDA 3IOKA 3TZ7A 3I1AA 3CKWA 4O0UA 5HGIA 4YBJA 3D5XA 3I4BA 4PQNA 5EDQA 1OM1A 3W2CA 3W8LA 4NW6A 4CVAA 1CTPE 2R7BA 3K54A 2Y6MA 3ORKA 4FK6A 3RK9A 4F6WA 3MPMA 2VWZA 3C4CA 3FZTA 3TCPA 2WTDA 3G5DA 4BTJA 1KOAA 1ERKA 1KE8A 3LFCA 2OIQA 4BKJA 3O7LD 5DHJA 4WG5A 3FUPA 1E1VA 1OIUA 4JG6A 3NNVA 3E3PA 1WFCA 3COHA 4ZZOA 3EIDA 3Q5ZA 2O0UA 1YW2A 2QURA 3DBCA 3FMNA 3JXWA 3OTUA 4GW8A 4IMYA 2O2UA 2UW5A 3O7LB 4ZS0A 2WHBA 3MTFA 1NXKA 2VGOA 3C1XA 3OOGA 4JBQA 3PA4A 1FGKA 2HZIA 1B39A 2QLUA 4GS6A 4NIFB 2OZOA 3HV4A 2JBPA 2UUEA 3BQCA 5CLPA 3KY2A 4FV7A 1MQBA 4H1JA 1W98A 3JY0A 3DDQA 3EWHA 4NJ3A 4BCQA 5LVOA 1DI8A 4X2GA 3O23A 5KNJA 1ZMVA 4C02A 4IWQA 4AZEA 3D2KA 3ZH8A 3NRMA 5LWMA 5HI2A 3I81A 4XV3A 1Z5MA 4Z55A 3MW1A 2HAKA 1GIHA 4U7ZA 3ZO2A 1HCLA 1W82A 1B6CB 4NUSA 3VUDA 5AAGA 4W9XA 3E5AA 3Q3BA 1NA7A 2V55A 3OEZA 2HXLA 3RPVA 3RAHA 4Z7HA 4XV9A 3G9NA 5JZJA 1BMKA 5EOLA 3TWJA 3EKKA 4BHZA 3SLSA 4QMLA 4RBLA 4XMOA 5CI7A 5EOBA 5AUWA 2LAVA 4OTQA 5ITAA 5CZIA 1TQPA 4FC0A 4HPTE 4JG8A 3CGFA 3MH1A 5AUXA 1K2PA 4WO5A 3ZLSA 3CXWA 3DAKA 2C5XA 1CKPA 4FSYA 1FGIA 1VJYA 1YHWA 4AN9A 4C36A 5JSMA 1GNGA 4NM3A 3VC4A 4WG4A 5HCZA 4E93A 3OBGA 4PTGA 3WZUA 2UW0A 2GHLA 2ZM3A 1R78A 4A4LA 2ZM4A 5L2QA 2OKRA 4W8DA 2ZB0A 3F2AA 2EU9A 4O0TA 5CXHA 4DEDA 4FF8A 4FNWA 3A7JA 3VIDA 5AR2A 4BDDA 5JN2A 2B9HA 5HO8A 4YC8A 3FMKA 3CIKA 3D5UA 4AF3A 4GU9A 4EUUA 2YM6A 3NYOA 4RVTA 3UZTA 3HKOA 1OZ1A 1SVHA 4HGTA 4YZ9A 4ENXA 2BAQA 5M56A 2BILB 2QOKA 3RZFA 4ZTMA 2B9IA 2R0UA 5IZFA 4DG3E 5AWMA 1UNGA 4JAIA 1BI7A 2JDVA 2YWPA 2IVTA 3KA0A 4OTRA 3MH3A 5EG3A 2ITPA 3BPRA 4YZNA 5DT4A 5I3RA 3P79A 2X9FA 1OPLA 1H1SA 4LV5A 1A9UA 1CMKE 4RVKA 5DGZA 4ZK5A 4CCUA 4D0WA 4QP1A 4X0MA 4TRLA 3R8PA 4LMNA 2G2IA 2GNGA 5AP3A 5F1ZA 4HVDA 4RZVA 2IN6A 2A27A 1Q5KA 1E9HA 4EJNA 4NIFA 5CQWA 2IW9A 4FKLA 5HKMA 3O96A 4WT6A 3PPJA 1Q8UA 2FB8A 4MCVA 4ALUA 1BLXA 4WD5A 2J4ZA 3WI6A 4J95A 4FTKA 2PVYA 1RDQE 1T46A 1K3AA 2WFYA 1U5RA 3A61A 3KXMA 1YWNA 3PXKA 1SNXA 3QRTA 2JAVA 3EQDA 1I09A 3LXNA 4G6OA 4MVFA 4F63A 5HEZA 4DH7A 3VBVA 4DG2E 5CAQA 3V6SA 3BQRA 3R7GA 5J5SA 2XEYA 4PY1A 4CZTA 3FY0A 3AC2A 3V3VA 2QHNA 3BEGA 3I6WA 2JITA 3LPBA 5DLSA 3SV0A 3R2BA 3QTUA 3QUPA 4QTDA 4CMUA 4GUEA 4G3FA 2OIBA 2WMSA 4DGGA 5AP7A 2EB3A 3TV6A 3BHTA 2P0CA 3QTIA 3TIZA 3LJ1A 4KRCA 1OPJA 1PKGA 4FK3A 5E91A 4ZXTA 4E1ZA 2YISA 3EHAA 3FL4A 3ZO3A 3DY7A 2BRGA 4BCIA 3KCKA 3QTXA 2VAGA 3FHIA 4EK5A 3Q53A 4EOQA 4C4HA 3ZEPA 4WNPA 2BZJA 3V04A 4F6UA 2UZLA 4UALA 4IQ6A 3TT0A 4XP0A 1YXUA 4EEVA 5CAVA 3MBLA 4FSWA 3OVVA 2R3HA 3O8TA 5AP5A 3WE4A 5K0KA 5HHWA 3KMUA 3L9LA 4NKSA 2F57A 5KMIA 2R5TA 4FV4A 2W1DA 4MXCA 3OW4A 4EC9A 4MD8E 3LW0A 3PYYA 4M97A 4NT4A 2XYUA 4D4YA 2CLXA 4RJ8A 5M4FA 1YI3A 1S9IA 3CJFA 3R8ZA 3FKNA 2QLQA 2VD5A 2WTIA 2DWBA 3P0MA 3RPOA 1WVWA 4U8ZA 2I1MA 4IJPA 2ZJWA 4FTMA 4PMSA 4RC4A 4IC8A 3ZUVA 4QMQA 4JIAA 3ZC6A 3BYVA 4FL2A 2J0JA 4LGHA 1J91A 4J8NA 4MXXA 4P5QA 4U5JA 5DFPA 3ZEWA 4KIOA 4MXAA 1PXJA 4AP7A 4U40A 4PMPA 3CY2A 2CCHA 4I21A 5CENA 4Z16A 3LAUA 4K6ZA 3RCJA 1VR2A 2O65A 4DTKA 5C8NA 4UXQA 1W83A 3QXOA 4CQEA 1FVRA 3KMMA 4EHVA 1REKA 2XNNA 3IW7A 1H0VA 2QO2A 3KN6A 2SRCA 5HG9A 2BKZA 2R3NA 5HOAA 3VUKA 4BDJA 4E6AA 2J0LA 4D9UA 3LXLA 4ZZMA 3Q6UA 4YJTA 2GFCA 5CEOA 4Z7GA 5HVYA 3ORMA 3VBQA 5CSPA 4BDEA 4B6LA 3WIGA 3DT1A 2JFLA 4EOOA 4IB1A 4XOYA 4ZIMA 3MFRA 3QWJA 1OKVA 5D41A 3UE4A 3ZUUA 4YLLA 5BVNA 4FTUA 4QP3A 4L01A 4R5YA 5FXQA 3F5GA 1WBWA 3DBQA 4DGNA 3MS9A 4ZP5A 3L8PA 1REJA 4UB7A 4O38A 4DN5A 3EQRA 4FR4A 2WAJA 4AU8A 2BDFA 3EQIA 3QX2A 2HYYA 2CLQA 2CGWA 4FL3A 1ZRZA 4GYGA 4TL0A 5A4TA 3ZRKA 4QYGA 4YHFA 5L2SA 2X6EA 4FTRA 4DH8A 5EHLA 3H0YA 4ZEGA 4ITJA 4BCGA 4W8EA 2R7IA 5LXMA 3FKLA 3W2QA 5BX0A 4BZDA 1PY5A 3R7EA 5CEKA 3T3VA 2BROA 1OB3A 4W4WA 4O21A 4LG4A 5HG7A 2XK3A 1GZOA 1H28A 4YNEA 5AJQA 4FKQA 3PJ1A 5D1JA 5AUZA 3F82A 4L7FA 5HTCA 5KMOA 3MJ2A 5J8IA 2J5EA 1PMVA 2BTRA 2R3RA 3PG3A 4RVLA 2FGIA 3C0GA 3DCVA 3KQ7A 4WRGA 5J9ZA 3AQVA 4O96A 1Y6BA 3SOCA 4EKKA 2GTNA 4XLVA 2HW6A 3EJ1A 3HYHA 4W4XA 4ZTSA 3NUYA 4O0SA 4RGJA 3F88A 3VW8A 4UYAA 4M68A 2C5YA 3R1YA 3VW6A 2UW3A 1QPDA 1M2PA 4PTCA 4IX3A 4N70A 5DR9A 3MI9A 3GXLA 3KCFA 5FXSA 5JZNA 4XOZA 3VS7A 4CV8A 4EI4A 4AW0A 3C13A 2HCKA 2HK5A 4I4EA 3NCGA 4B9DA 3RJCA 2W06A 2WOUA 3NIEA 4IB0A 3KK9A 2WEVA 4QQCA 2GHGA 3RBWA 3HV5A 2XBJA 3VUTA 5FRIA 4YTCA 3IOPA 3NUXA 2GNJA 3KXHA 5T68A 5HO6A 4CNHA 4CQGA 3CLYA 4AT3A 1PXKA 4I0RA 4BCOA 5L3AA 2Y9QA 1S9JA 2YITA 2ZM1A 5ANDA 4ANBA 3TZ9A 4L8MA 4BCJA 4FBXA 2J51A 3ZCLA 2A19B 2GNFA 2XYNA 3LOKA 3Q04A 3V6RA 2PK9A 4DINA 2DQ7X 4R3RA 2W9FB 4JT3A 2XNBA 3UYSA 5CXZA 3PTGA 2IWIA 4IAFA 4ANMA 4NJDA 1UU3A 4JDKA 3NYVA 3KF4A 2XUUA 4ASXA 1HOWA 4I93A 1ZYSA 3MN3A 3EQBA 5DR2A 2IW8A 2IZSA 3KVWA 1MQ4A 2CSNA 1WBNA 4E8AA 4BCKA 5AA9A 1ZOGA 1H00A 5I9UA 3SXRA 3EYGA 4CTBA 5A14A 4UWYA 4FEQA 4H58A 4ITHA 5ACKA 1CKJA 3ZYAA 4LL0A 3OT3A 5E8XA 1OMWA 3DBFA 2X2KA 3TNIA 4F1MA 2A4LA 4O1PA 2REIA 5TR6A 4CV9A 1TVOA 4ZY6A 4YTIA 3GP0A 4FV8A 4MF1A 4F7JA 1GIIA 3HP5A 3KC3A 3QGYA 2BRNA 4F99A 4LOQA 1OIRA 3ALNA 1M2QA 4IC7A 4BTFA 5IA0A 3KGAA 3CD8A 3A99A 3GEQA 4L45A 3BLQA 3GCQA 5DOSA 3AT3A 5G6VA 3OCGA 2YCFA 2QOQA 4C61A 4X2JA 2BR1A 4BKZA 5JGBA 2ZV8A 4I5CA 5EM7A 3VF9A 4Y72A 3DNDA 3EFKA 4QP9A 5DE2A 5EKNA 3QL8A 5HLNA 3R8LA 1URWA 2RG6A 3U8WA 4AFEA 3FV8A 2XJ2A 1YI4A 2YDKA 4USFA 3FLNC 3E8NA 4OW8A 4CFFA 2XB7A 5E90A 4QYYA 3UOHA 4XG2A 5CAUA 5G1XA 3GFWA 5JQ5A 5K9IA 3ALOA 5EYKA 4NM7A 3BRBA 2OICA 2YJSA 3FYKX 3FXWA 4IM2A 4TN6A 4U3YA 3TTIA 3U9CA 3ULZA 3RWQA 4D2VA 2FO0A 3AC1A 2GNIA 2J2IB 3ACJA 3Q6WA 4MF0A 4U79A 3OG7A 4MWIA 4TWOA 3VUGA 3TJCA 1SVGA 4PL5A 2QI8A 5BMSA 2QKRA 4MK0A 3UNJA 3LM0A 3RKBA 3OWKA 4IWDA 3C5UA 5EI8A 4QMSA 1ZOEA 3O17A 2X0GA 4KIPA 3RCDA 4HPUE 4TW9A 4CFXA 4L3PA 3KRXA 4A7CA 3R63A 1B38A 2XKDA 1V0BA 4X21A 3R9DA 2XZSA 3P23A 4IW0A 4LV8A 2ITOA 4ACCA 2W9ZB 1TQIA 2Z8CA 5AUUA 3PZEA 4M0YA 3VS4A 1RE8A 4ZAUA 2XKEA 4AS0A 5AAEA 3EN4A 3Q9ZA 5D12A 3E88A 1Q8YA 3FWQA 5FTQA 2E9PA 1ZMWA 3LIJA 2PZYA 1KSWA 3L8VA 3E3BX 4TY1A 4EOKA 3S1HA 5J9LA 4GT3A 2GMXA 2RG5A 2AYPA 3SX9A 4HOKA 2YCQA 2Y7JA 4XUFA 3SAYA 5HE2A 1YHVA 3A8XA 3LM5A 3WF5A 4APPA 4XG3A 3MA6A 3UZPA 2PUUA 3FLQA 3OS3A 2XKFA 4BI1A 5ANEA 2WQOA 1CSNA 5DH3A 4OT6A 3RAWA 5BVDA 2VWWA 3G6GA 3NZ0A 4MAOA 2JGZA 5CU2A 5KKRB 1FOTA 4D5KA 1NVRA 4O1OA 3CPBA 4YUQA 5JFWA 2O3PA 4EH7A 4PDOA 4I5PA 3II5A 4S30A 1ZYLA 3TACA 2WNTA 4QMWA 3EB0A 3C4XA 3MB6A 1Q61A 4L53A 4O6LA 3KXGA 1U4DA 4WRSA 5AP4A 5M4UA 3K3JA 2OSCA 4EH9A 1H01A 1BKXA 3MV5A 2R3QA 3QQFA 4S31A 5EYCA 3SRVB 3ZZWA 3RAIA 4HGEA 2WO6A 5EFQA 2G9XA 5DPVA 3ODZX 4D4SA 4PDPA 1YXTA 3THBA 4TYHB 4DFXE 4AE6A 2R0IA 3G2FA 4AOJA 3O71A 1H1RA 2OK1A 3POZA 1AGWA 2ITXA 2VTOA 3FMJA 3IQ7A 4FKTA 4W9WA 2W7XA 3HP2A 2UZOA 4FZDB 3SOAA 5I9XA 2YZAA 4FTCA 4WNKA 4QMNA 2CJMA 3U6IA 3OTVA 4NU1A 4QMMA 4XP3A 5J1VA 4RA4A 4RIXB 4B0GA 5C27A 5HLWA 1WBTA 5AADA 2YM4A 2C6KA 3Q4UA 3EL7A 3R7YA 3Q4ZA 3LVPA 5J1WA 3M2WA 4D0XA 3FE3A 2I6LA 2UW4A 4PNKA 3HRFA 3R9NA 4ASDA 3WE8A 3R1SA 5EW3A 2DUVA 2OGVA 3WZDA 3AT4A 1Q97A 3WYYA 3WF9A 1H4LA 3PVWA 3TTJA 2DYLA 2H96A 3GU5A 3OXZA 2GS6A 1G3NA 3EQCA 3I5NA 5KMJA 3ZBFA 2VTRA 3GT8A 3E7VA 2R3OA 4TZRA 5CAPA 5HTIA 4GUBA 2ITUA 4YC3A 4YPSA 5E1EA 5I5ZA 3TUDA 3AD5A 2AC5A 3IG7A 3PA5A 4FODA 4N6ZA 2X6DA 3E64A 5L2IA 3BHYA 2C1BA 4FTJA 4ACMA 4AXAA 4BKYA 2YEXA 4J97A 4RC2A 5L2TA 5L4QA 2BRMA 5IUHA 2ZVAA 4GK3A 2J6MA 3W18A 4HGLA 4LRJA 4M15A 5HU3A 3WOWA 3CQUA 1BI8A 3RZBA 4P4CA 4BYIA 2W1IA 4NM0A 5I9WA 5IISA 1Q4LA 3MGYA 4RJ7A 4C8BA 1KV1A 3E92A 3GNIB 3P1AA 4DH5A 2BTSA 3HDMA 4KKGA 1O9UA 3VN9A 4EONA 5LMBA 3T8OA 2LGCA 5GZ9A 4BC6A 3RVGA 1FMKA 4ZLYA 2P33A 2PVMA 3Q2MA 3BBWA 2JKMA 3JPVA 3NW5A 2W99B 4C37A 4DEEA 5A4QA 3F69A 3GCPA 5E8UA 3LFBA 4K1BA 5E8TA 2WQMA 5H8BA 2RKUA 2JKQA 3SRVA 2UZEA 5AP6A 5ANKA 4FOBA 1JWHA 3MSSA 4FKSA 4Q9SA 4W4VA 4U42A 4EOPA 4RFYA 2QCSA 4AN3A 2QD9A 3IONA 4DAWA 3HGKA 4WBOA 3OBJA 4M8TA 4EH2A 2NRYA 2X2MA 2XRWA 4ZTLA 4X3FB 2A1AB 2UZUE 3F5PA 4H3QA 4DC2A 3CR0A 2C6EA 4FTTA 1BL6A 3GOKA 2PVRA 4HNFA 2WB8A 3KU2A 2XBAA 4MTAA 5HNBA 1WBPA 5FWKK 2JIIA 4U80A 1PXMA 2H6DA 2WZJA 3R8MA 3VS3A 3UP2A 3A8WA 4YZMA 2R4BA 1Q99A 5HLPA 2CHLA 4RIXA 3SKCA 4A9YA 5L6WL 4C4JA 5B2KA 4JG7A 1KV2A 1TKIA 3ORNA 4C57A 3UTOA 5IH5A 3QQKA 3O50A 1OKWA 2YM3A 4M66A 4EKLA 3GB2A 5HU9A 2VN9A 2WU7A 4I23A 4AFJA 3AGLA 3FI4A 3UOJA 1SMHA 3CQWA 2C0IA 3DJ7A 4TTHB 4C33A 4Q5HA 4FV2A 4JOAA 2OFUA 3QZGA 3TNWA 1JKTA 3V5JA 5A9UA 2I0HA 3A60A 4FL1A 3U87A 2GHMA 3MIYA 4HZSA 4Y83A 3OUNB 4J53A 4BFMA 1ZZLA 3HEGA 2ITVA 3N9XA 4H3BA 4EWHA 3V5QA 3LFSA 2WMXA 3ZFMA 4DFYA 5IA3A 1BUHA 4IXPA 3PG1A 3CCNA 4BDHA 4ERWA 4EH3A 1JNKA 3DAEA 5CEIA 1DAWA 5JRQA 4GVJA 3ZOSA 4MD7E 5KMMA 4EK6A 4AOIA 3OEFX 4QQ5A 4X2KA 2EXEA 3ZU7A 2WXVA 3QCQA 3KN5A 5LVLA 5K5NA 1PHKA 4FV6A 1YHSA 3VJOA 2IZRA 3NW7A 5L2WA 4M12A 3FZPA 4CFWA 2QOCA 4FZAB 1OVEA 3ERKA 3D0EA 2JIUA 2PVLA 1ZWSA 3UYTA 5GJFA 4JDIA 1BX6A 5J95A 2BDWA 2BFYA 2YFXA 3LHJA 4CT1A 4F08A 2ERKA 3HLLA 5GZAA 2WQEA 4FT9A 3WZKA 1GOLA 1YVJA 2WELA 3D2IA 3GFEA 4AG8A 2QC6A 4DCEA 2O64A 3KKVA 4WKQA 2XM9A 4DGMA 4OT5A 4F4PA 3OCSA 1YWRA 3BYSA 4ASZA 3H9FA 3FBVA 4FVQA 2UW6A 3F3UA 3TV4A 4L67A 2OH0E 3D83A 4KBAA 2QONA 5AP0A 5IDPA 2GFSA 2XIRA 4X3FA 4L52A 4J8MA 3NNXA 2XK6A 5M51A 3FXXA 1R39A 2WEIA 4HGSA 2Y4IB 5CI6A 1M52A 4ZSJA 4TWPA 3PSBA 5LCKA 4PRJA 2J0IA 4F9YA 1UNHA 2P2IA 1R0EA 3P9JA 3AOXA 5JKGA 5CSWA 3RHKA 5EM6A 4K2RA 3BYOA 3Q4TA 3QAME 2VTMA 3QTWA 4XRJA 4E7WA 2HZ0A 3QKLA 3QA0A 3QXPA 3FPQA 3TI1A 3HV3A 4D2PA 2XK7A 1DAYA 2J9MA 2ZV9A 3W2SA 5HNGA 3SQQA 4Y46A 2VWVA 5CT7A 5JGDA 4NTTA 3QC4A 3EYHA 3PZHA 3IW6A 1LR4A 3VQHA 1OI9A 5IH6A 3R8UA 4IANA 5F4NA 4FTAA 4LMUA 1QPEA 2Y4PA 4K77A 4QMOA 1OL7A 3PY0A 4HNIA 4HCVA 4YTFA 1ATPE 4LQMA 4NM5A 3EQFA 3VNTA 3DAJA 2B1PA 2W17A 3DB8A 4R1VA 2EXCX 2H8HA 4S34A 3Q4CA 4LFIA 1Q8TA 3W8QA 4F1TA 3KEXA 2XP2A 2G1TA 3FL5A 5E8ZA 3DU8A 3UIXA 1JKKA 4C3FA 2ETMA 5H8GA 5HESA 4L00A 1V1KA 3R01A 5AA8A 2WTKB 5DWRA 2VTNA 4J98A 4KKHA 5HE0A 4BF2A 1WZYA 3O8UA 4G16A 2XNPA 2PVHA 4YJRA 4UMPA 2C1AA 4JIKA 4C4FA 2HIWA 2HY81 4II5A 5CU0A 4MD9E 2QO7A 5KO1A 1W8CA 3MVHA 4PMMA 1UU7A 1JKLA 5FXRA 5L8LA 1WAKA 3GU8A 1YOLA 3AC4A 3PXFA 5CWZA 5F94A 3QZHA 4AW2A 5IA2A 2X9EA 2W1ZA 3PP0A 4NWMA 2W5BA 5F20A 3QTZA 1XH4A 4QMTA 4E4MA 3KXXA 4BDAA 4KNBA 1ZOHA 3VS0A 3MFSA 4KD1A 4D1XA 1KE6A 4FI1A 4C38A 4EH4A 4KA3A 4O2ZA 3CGOA 3ZRLA 4BCHA 3Q52A 5LMKA 4GVAA 1VYZA 4RMZA 1PXLA 3RPYA 3BYMA 4ZLOA 3TUCA 3BYUA 5C03A 1ZYJA 2W1EA 4OAVB 1IR3A 3ZFXA 1H07A 4X2FA 3LQ8A 4GG5A 4QMYA 1Q3WA 4IZYA 2WIPA 2XIZA 4I4FA 4RT7A 2X4ZA 1W7HA 2HZ4A 4RLKA 2YM7A 4QRCA 3Q96A 2YA9A 3RI1A 3ZRMA 4CRLA 4LM5A 5HD7A 1UKIA 3PJ2A 3R7VA 4EQMA 4CLJA 4UV0A 1MRUA 3MWUA 4PTEA 1IEPA 5H8EA 3KMWA 5IG1A 3FZRA 4G34A 2RF9A 5AR5A 2H9VA 4C2WA 4RRVA 5ANJA 3W33A 3IDPA 2GS2A 4F6SA 5E1SA 4NK9A 5M44A 3O8PA 2C68A 4BYJA 3DTCA 5IEXA 2C6DA 1XHAA 4GK2A 1LEZA 1JLUE 2J0KA 2QVSE 3DPKA 2HELA 5CYIA 2R3IA 2FVDA 3CTHA 4I24A 3V8SA 5BYYA 4OTHA 2OZAB 2KTYA 1H27A 3VQUA 4J99A 3MA3A 5H3QA 3P7BA 2V7AA 3RK7A 5ACBC 2C47A 5DNRA 4M69A 3DQWA 3H0ZA 1ZY4A 4QNAA 3C4EA 4IWOA 2CGVA 3R02A 4YJVA 3PWDA 3LFFA 5DT0A 3NX8A 3PVGA 4G5PA 5KMKA 2PZPA 4D9TA 3ITZA 2VTPA 4NZWB 4F9AA 2GQGA 4IHPA 3E63A 4XHKB 3CY3A 3MY5A 4BWXA 3HMPA 4JDHA 3DFCB 3L1SA 4JBOA 4ACHA 4AGWA 5M53A 2O63A 3R22A 4R6VA 3ZDIA 4D2SA 5BUIA 3MVLA 2UZBA 4BHNA 1NVSA 3WILA 1OUYA 4QP8A 3QC9A 2OH4A 1XKKA 3D14A 3VUIA 4PX6A 3CBLA 5FDPA 2Z7SA 4N0SA 3EN5A 3EZVA 2JC6A 4A07A 3BGZA 4IVAA 5CSVA 3HMNA 4AX8A 4J96A 1OPKA 3DBDA 4EHGA 5E7RA 1ZAOA 2B53A 5CNNA 3QHWA 4BDFA 4KIKB 1NY3A 2OBJA 4MBLA 3WARA 1O6YA 3IO7A 4FNYA 4IX6A 4FMQA 4L3JA 1LP4A 2Q0NA 4USDA 4KBCA 2YIQA 3RP9A 4RWLA 1JSUA 1PKDA 2W1CA 2PVNA 4HYSA 3ANRA 3LFQA 3L8XA 4IJ9A 4KAOA 5CSXA 3LLTA 3AC8A 2E9UA 5IA4A 4FTIA 5KKRC 2HZNA 4IFCA 4WUAA 4G1WA 4X6QC 4YBKA 5L8JA 3ACKA 2PY3A 5EDRA 1Q3DA 4C0TA 4ERKA 5JFXA 4OLIA 3B2WA 4YO6A 2W4OA 4OTPA 5D7AA 1UU9A 4OAUC 4YHJA 2XIXA 3BEAA 3D5VA 5D7VA 3S95A 2NO3A 4E5BA 1UVRA 4OBQA 3GVUA 5T6KA 3ROCA 4UXLA 2BHEA 1V0OA 1OGUA 3UGCA 2QU6A 5AV3A 5LQFA 3QRUA 4MKCA 3DZQA 5HTBA 5HX6A 3VJNA 4H3PA 5CF6A 4FVRA 5IF1A 1YDTE 5I0BA 3CP9A 3IKAA 4NTSA 3UJGA 3GOPA 4CEGA 4F1OA 5HO7A 5I4NA 3S0OA 2OZAA 4PL4A 3TXOA 4CCBA 4BGQA 2VRXA 3FZ1A 3MY0A 3UP7A 3ORLA 4JNWA 4XYFA 1QPJA 3HMOA 3MJ1A 2ZAZA 4EH6A 2GS7A 2UVYA 4LL5A 2VU3A 5A4EA 4IB5A 5E8VA 5A6NA 5BNJA 4U3ZA 3TUBA 2VO3A 5BUEA 3KB7A 2J90A 2HY0A 3O51A 2BZKB 5HICA 3C4ZA 4TYJA 3PJ3A 2CKEA 4YO4A 4J71A 5LJJA 4FIHA 3OCTA 3OP5A 3TN8A 3R8VA 1CKIA 2YM5A 4OR5A 3PPZA 3QCXA 3P08A 2I0YA 2YIRA 4RQVA 4G17A 3UO6A 4C2VA 2VTAA 4TWCA 3BCEA 2ZB1A 2YDJA 5EKOA 4F0GA 4BI0A 3MTLA 4ITIA 3E8CA 2C6OA 2RIOA 2FSOX 4QYEA 3S2PA 4ACGA 4UMQA 4HYUA 4D28A 1XR1A 5B7VA 4I41A 3BWFA 5A46A 2VV9A 5FBNC 4KIKA 1KE9A 4F9WA 3EFLA 4ANLA 1KE5A 4WG3A 4W4YA 5AX3A 4ZY4A 1XH9A 3FDNA 5KMNA 3NR9A 4XV2A 4L9IA 1AD5A 1M7NA 2RFEA 2XNEA 2F49A 4QTAA 5AIKA 2JEDA 1Q41A 4X7QA 5BVEA 2JLDA 3ZSHA 2XNGA 3AT2A 4YC6A 3EN6A 2GPHA 2IVSA 4YZDA 4ASEA 4AWIA 2UW9A 4PDSA 3QFVA 4IAAA 1GIJA 3NUUA 4ZTNA 4U43A 5ANIA 4PP7A 3JS2A 3A7FA 3LFNA 3MPAA 4PF4A 2RGPA 3AC3A 3ELJA 3R28A 4GIHA 3V8WA 4Z3VA 4QQTA 2XVDA 4EK8A 2V7OA 2VX0A 3UPZA 4FSTA 1ZXEA 3L9PA 3VHEA 4F7LA 4UX9A 1G5SA 3JY9A 1UNLA 4C7TA 4DGLC 4BICA 2F9GA 3BIZA 3FLWA 3OFMA 1UWHA 2UZNA 1PJKA 2C5NA 2OXYA 4JRNA 3NUNA 4A06A 3NYNA 4AA0A 1P5EA 3B2TA 4C4GA 3R7OA 2EUFB 2GU8A 5CANA 3SC1A 5F9EA 4CD0A 4FTNA 1XBAA 4LRMA 4XG8A 2JKOA 3HA6A 4QMXA 4X3FC 5GZ8A 1DS5A 4QT1A 4R1YA 1OL2A 3BLRA 3GC7A 5AM7A 3WZJA 3VS1A 4XH6A 3CKXA 2QR8A 4XG6A 3Q5IA 1LEWA 3LCSA 3IW4A 3AC5A 2GDOA 3QYWA 3VBXA 5TKDA 3UVPA 1UWJA 4USEA 1KWPA 2ZMDA 3EOCA 5EHOA 5FTOA 2WMAA 3MVJA 3GENA 2R3FA 2BCJA 3FMLA 3QQGA 4I0SA 4IB3A 3LJ2A 4BDBA 5AAFA 3RINA 4BN1A 4LI5A 3UIUA 4O0XA 4ZSAA 4WNOA 3VF8A 3CJGA 3MB7A 2UVXA 2V5QA 3NSZA 3R83A 4A4OA 5M57A 1KOBA 4E4XA 2OFVA 4EORA 3NWWA 4D4RA 4K33A 5C01A 5HBJA 2NP8A 3ZSIA 5B2MA 4EZ7A 5FGKA 3LJ0A 3U6HA 2WMUA 2X1NA 4LGDA 1JQHA 4QNYA 4UYNA 1OITA 4M3QA 4R7IA 1P2AA 2CGUA 3QRJA 3DXNA 4CRSA 3UNKA 4CFUA 2R64A 4V0GB 2IJMA 3TL8A
chains in the Genus database with same CATH superfamily
4JQEA 3ZONA 4YLKA 3F9NA 4HJOA 3VS6A 4GFMA 1GZ8A 2VWXA 4JQ7A 4YSJA 4CFNA 3LFAA 1QMZA 5E92A 3GC8A 2VTQA 2XS0A 3BV2A 2VZ6A 4FSMA 3R0TA 4BIBA 4YP8A 1K9AA 2B9JA 5CTPA 3W32A 2GNHA 4D1ZA 3MH2A 4NFMA 4KIQA 3TKHA 3AMYA 4YNOA 5HORA 1XO2B 1H25A 3BV3A 5CF4A 1J3HA 5I9ZA 3PIYA 3DGKA 4GK4A 4G3EA 2CPKE 4BI2A 4DHFA 4EUTA 1R3CA 2YIWA 3SW7A 4RIYB 4JX7A 1H26A 4DG0E 5DR6A 2F7ZE 4FVPA 2GCDA 5AMNA 5JFSA 3BLHA 3M11A 3UMWA 4PL3A 4PPBA 4DFZE 1OIQA 3EQPA 2WMBA 4MX9A 4GG7A 4YJUA 4D55A 2R3GA 5D11A 4FTLA 3TNPC 3U6JA 3CPCA 4JDJA 4M14A 3GCVA 4IIRA 1JKSA 4YSMA 4AN2A 3LZBA 4AT5A 4CSVA 5I9VA 3F7WA 2C0TA 2E9NA 3ET7A 4GU6A 3UQGA 1H0WA 1XH6A 3PXRA 5AM6A 4I92A 5LMKC 4BIDA 2WTJA 4AE9A 4Y95A 4KABA 5HIDA 1XBCA 4HCTA 2VTLA 4PWNA 4AGCA 1FVTA 4WSQA 4A9TA 4RJ6A 4NSTA 2PZ5A 4AZSA 4EOLA 2YACA 5JEBA 5FP6A 5HNIX 4X6RA 2Y4IC 4IAKA 5M4IA 1H1WA 4AT4A 4GT4A 4RA5A 2X8EA 5TT7A 1J1BA 3R1NA 4M13A 4MHAA 3G9LX 2EXMA 5GJGA 3VRYA 4RC3A 3SVVA 4IH8A 4P90A 3V8TA 5KBQA 2VO0A 3TV7A 5CALA 4NKAA 3U51A 5AP2A 4I3ZA 3GQIA 3COMA 4FG7A 2VX3A 4Y85A 4HVGA 2P2HA 2QG5A 4FIJA 3AGMA 4RWIA 3F5UA 5AP1A 5TOZA 4CFVA 5HCYA 3FLSA 2YN8A 4HVIA 3MY1A 2JD5A 1QPCA 1ZMUA 2VWIA 4FOCA 2O8YA 4IWPA 2DS1A 4OTIA 3ZSGA 4C58A 4L6QA 1NVQA 5AUTA 4V0GA 3NPCA 2H34A 4U6RA 4RJ3A 3QUDA 3OZ6A 4GJ3A 4H39A 4U9AA 3DNEA 3T9TA 1E1XA 4I6QA 1H1QA 3F5XA 4QYFA 5FD2A 5ICPA 5IU2A 3EL8A 4FYOA 5HE3A 3NAYA 4XBUA 5LVMA 4GFGA 4G5JA 3AXWA 4DBNA 4E73A 5D9HA 1CM8A 4M67A 3WZEA 1ZYCA 4XS2A 3W1FA 3NW6A 4XV1A 2Z7RA 1XH5A 3UODA 4DYMA 5CAOA 4WHZA 1JBPE 2WD1A 4NH1A 5KZ0A 5CU4A 3F2NA 1STCE 4E5WA 4ZJIA 3LFEA 5L8KA 2A98A 1BL7A 2B52A 2WTKC 3IDBA 4RIYA 4E4LA 4JVGA 4PUZA 2YERA 2QOBA 3QTRA 3UIMA 4WUNA 4BBMA 3R7IA 4O0WA 2V22A 3R71A 3DKOA 2X0QA 4TYEA 5DRDA 3V5LA 3QUEA 2PMOX 2UZWE 4CFMA 1WMKA 2QOOA 3PVUA 4EZ3A 3PP1A 2VO7A 4O4CA 1YRPA 4FTOA 5KMLA 4C3RA 3JYAA 4CXAA 1O6KA 4I22A 2EVAA 3ANQA 3KL8A 5JMSA 3VULA 4MBIA 2WTWA 4HYIA 1VEBA 2R3PA 2OJJA 1U59A 3ORPA 5AV1A 4I6HA 4I5HA 4DITA 5C1QB 3QZFA 4IZ5A 4QOXA 5FG8A 2B55A 1UU8A 3PRIA 5E8WA 3EMGA 3OW3A 4QTBA 3KXZA 4D58A 3ENMA 3NAXA 4I6FA 1ZY5A 4IFGA 2IVUA 4CYJA 1WCCA 4QTCA 5IPJA 4MXYA 5FQDC 3GQLA 1JPAA 1LPUA 2QOFA 5J7BA 5AR7A 3FXZA 3VWAA 3ZO4A 4P2KA 3AD4A 4S32A 3R1QA 3QU0A 5T3QA 4BIEA 4CT2A 3C50A 3CS9A 5EW9A 5AUVA 4D2TA 2G2HA 4V01A 5ANOA 3PSDA 3UOLA 5BVKA 4AW1A 3PA3A 4PP9A 4GL9A 3JVSA 3HMIA 2XRUA 3QQHA 4QQJA 2PE2A 5DG5A 3WF7A 4O22A 3Q9XA 2PMLX 4TT7A 2C5VA 3E7OA 4QMVA 5C9CA 4ZSEA 1WVXA 4EQCA 5KHXA 2OU7A 2HW7A 4GV1A 4U0IA 1OECA 5EM8A 5DN3A 5KE0A 4DGOA 5IMEA 4QP2A 3QKKA 4KKEA 5A6OA 2WMQA 2F7EE 3WIKA 3ODYX 3DQXA 2QR7A 3IGOA 5TO8A 4G3GA 3DKGA 3C0HA 4I6BA 3C0IA 3HUCA 3QZIA 4GJ2A 4EOMA 2VWYA 5BPYA 4PPCA 4KB8A 5CQUA 4O4EA 2YM8A 3TKUA 3OHTA 4F7NA 5HBEA 3BGQA 3QF9A 4DEAA 4QD6A 3Q9YA 2YLEA 4AACA 3BU5A 2ESMA 2XA4A 5HCXA 4A9RA 4JLCA 4IAIA 2YIYA 3U4UA 4F0IA 4KS8A 3BKBA 3EQHA 3NGAA 4XEYA 5DA3A 3LXPA 2I0VA 5CX9A 1MRVA 2Z7LA 3RMFA 3NDMA 3OXTA 4CLIA 4O91A 1P4FA 4L46A 4ONAA 4RSSA 3AMAA 3BE9A 3BWJA 4QPMA 3PE1A 5K0XA 3DKCA 3LMGA 2JBOA 3ORZA 3HV7A 3PJCA 4ZTHA 3HMMA 4MYGA 2VWBA 3KRWA 3F3WA 4FKOA 3MIAA 4RZWA 3KF7A 4AZWA 4YMJA 4IAYA 4MEDA 3QGWA 2XH5A 5GHVA 3ZDUA 4GFOA 3RNIA 3RWPA 4GCJA 4FIIA 4E5AX 1SNUA 2E2BA 3PY1A 4FV3A 4F9CA 3E62A 4FIEA 3WF6A 3PXQA 3FLYA 2QNJA 3EFWA 4DFLA 1PYEA 3UBDA 2BZIB 2RFNA 2CN8A 3PY3A 2ACXA 1GZKA 4UWCA 4TXCA 4XG4A 3TJDA 3DJ5A 2W4JA 3R9OA 3NS9A 3Q32A 4FKPA 2VGPA 4QMUA 5JQ8A 4BBEA 2A0CX 3R30A 1W0XC 4EOSA 5BVOA 3IPHA 2ITZA 3OWLA 3QQJA 4EYMA 5AEPA 1PMNA 3PPKA 3R04A 3UC3A 2QOIA 1PMUA 2ONLA 3A7IA 3BELA 3DKFA 3EFJA 4MH7A 5EH0A 4CKIA 5BVWA 4IADA 3ZUTA 3R73A 3DJ6A 1YI6A 4O27B 5DMZA 5JT2A 3FSKA 5ETAA 4YURA 5HIBA 4E26A 2C6LA 4FSNA 1PYXA 1JVPP 5A4CA 1H08A 5CZHA 2ERZE 2NPQA 4FT5A 2BMCA 4FKGA 2OJFE 4WOVA 1SZMA 2WMRA 3GCSA 3QKMA 4HCUA 4F65A 1I44A 3TZMA 3Q9WA 4L3LA 4EWQA 3V5WA 2V62A 2VTSA 4BDKA 4G6NA 2W1GA 1YKRA 1O6LA 2IW6A 3MVMA 5IH4A 1UKHA 5J79A 1MUOA 1APME 4A9UA 3M42A 5IKWA 2RFSA 1PXIA 3OCBA 4EK4A 3QA8A 1KE7A 4CTCA 2VUWA 1URCA 3TNQB 4FG9A 1QL6A 5C26A 3P5KA 3K3IA 1XBBA 3W55A 1OL5A 3R6XA 3NYXA 4HYHA 4JR7A 3RHXA 3ZXZA 2UVZA 1IG1A 2GSFA 4BGGA 4E6QA 4BTKA 4DEHA 3BX5A 4IX5A 4ACDA 5EI2A 3COKA 5CU3A 3POOA 3ZLWA 4JL9A 2RFDA 2OXXA 3DFAA 5CVFA 5CVGA 5AR3A 2FSTX 2YJRA 4GYIA 4WNMA 4CZUA 4ZSGA 2PZIA 2QOLA 3GI3A 4V05A 4WA9A 4E20A 2OWBA 4YU2A 2IZUA 3KRJA 3MFTA 4GMYA 4Z9LA 4QTEA 3FAAA 1U54B 3IW8A 3RAKA 3EZRA 5CEPA 5L6PA 4RIWA 4BWPA 4Q9ZA 5IUIA 4M69B 4CKRA 1UA2A 2X39A 3G33A 2PVKA 5FP5A 5KUPA 3D15A 4FZ6A 2UW7A 4EH8A 4ZTQA 2YABA 5AR4A 4F7SA 5E8SA 4AA4A 4B4LA 1U46A 3FZSA 1PXOA 3A2CA 4UMTA 3F3VA 4K11A 2RSVA 4FKUA 4RWKA 2QODA 2BDJA 3QCSA 4FT0A 4BB4A 4AOTA 2OJIA 5CT0A 3NNWA 4B99A 4AGDA 2OJGA 3HDNA 1AQ1A 4XNEA 4BDIA 4D4VA 4IACA 1BYGA 3FMMA 3A7HA 3WYXA 4EL9A 4RG0A 1IA8A 2ZMCA 1GAGA 4QP7A 4E6DA 3QLGA 3O2MA 1JSVA 3FMEA 2R9SA 1Z57A 2W05A 4IZ7A 4QPAA 2OW3A 3QQLA 2BUJA 2JDSA 3PXYA 5FEEA 3A62A 4F09A 1TQMA 1RQQA 5DEYA 3UC4A 5KZIA 1XWSA 2UZTA 2WMWA 4O6EA 2OF4A 3DLSA 3ORIA 3SW4A 3H30A 5CEQA 3G90X 3BZ3A 4M84A 3U4WA 4NEUA 5K4JA 4PPAA 1P14A 4BL1A 3H9RA 5CNOA 3CC6A 4FUXA 5I9YA 5GNKA 4OUCA 4FSQA 4MBJA 3FQSA 5AUYA 2P55A 2IF8A 5AV0A 5BQ0A 2I0EA 4I1ZA 5LMAA 1L3RE 1YOMA 3F7ZA 4LOOA 3T3UA 3UMXA 4YJPA 2ITNA 3FMHA 3S3IA 4XRLA 2IZTA 4IAZA 4QP6A 2W96B 2Y0AA 2BHHA 2ZV7A 2A2AA 3QLFA 3SA0A 4B7TA 4BBFA 4NW5A 4L7SA 5ANGA 1FVVA 4IEBA 4FV5A 4QO9A 4AZTA 1P4OA 1JSTA 3VRZA 3W2RA 3EN7A 3PJ8A 5AV2A 4G3CA 2BPMA 4UBAA 2YCSA 5LCJA 1V0PA 2C6TA 4HW7A 4XLIA 2HXQA 5HX8A 3S00A 4FGBA 3GGFA 3K2LA 1F5QA 5LVNA 2QQ7A 3O0GA 4WBBB 3TEIA 1U54A 5HVKA 5CEMA 3W2PA 5DRBA 5DT3A 2PVJA 4U44A 3D5WA 4A4XA 4DEBA 1PF8A 4GEOA 3FZOA 2PE0A 3NIZA 5A54A 5KCVA 3C7QA 3CTJA 3HECA 3HL7A 4FKRA 4NCTA 4E4NA 3ZO1A 1PMEA 4E3CA 5CF8A 4ANQA 3SD0A 3ZM4A 3NLBA 4KSQA 4ZJJA 4RVMA 4C59A 4RJ4A 4GRBA 3I60A 1M7QA 2J50A 2BIYA 3P7AA 2C4GA 5KBRA 3GC9A 2P3GX 4CMOA 3U9NA 5JH6A 1Y8YA 1LUFA 1W2CA 4F9BA 4RFMA 4UEUA 5FEQA 2WKMA 3CE3A 2VWUA 2VNWA 4ANSA 3T9IA 2W5AA 4H36A 3SHEA 1VZOA 3LFDA 4R3PA 4YZBA 4GIIA 4AGUA 5DEWA 5IEVA 1FPUA 3KFAA 5B2LA 5JGAA 3HV6A 2ETRA 4I94A 3C4FA 3VO3A 4YR8A 4GT5A 2ZYBA 3D94A 3IW5A 2HENA 2PHKA 4I5MA 5M55A 2VTHA 4ARKA 4YGAA 4Y5HA 4PNIA 5CF5A 4AUAA 4IDVA 4U97A 5EW8A 2WMVA 4RX8A 4IM3A 3V5PA 4D2RA 5DBXA 5BYZA 4JRVA 5C8KA 4EZ5A 1WBSA 3MDYA 3DDPA 1OL1A 3DK6A 2YAKA 3FJQE 2YAAA 3UDBA 2X7GA 4EQUA 4FNZA 5HG8A 2Q0BA 4K18A 2Z2WA 3RM7A 3VAPA 4UN0C 4ZY5A 4UZHA 4APCA 3F66A 4AZFA 5A4LA 3GC0A 3M1SA 1Y8GA 3GCUA 3OD6X 2XK9A 3QWKA 4FICA 1FINA 5IA5A 3BGPA 2NRUA 2OG8A 4IBMA 2JDRA 4L68A 4N6YA 3I7CA 3BHVA 5JRSA 3I6UA 3QBNA 5TE0A 1H8FA 3A7GA 3D9VA 4FZ7A 3EKNA 1JOWB 3HRBA 4LUEA 4R8QA 4V04A 2C3KA 5EYDA 3QTQA 4FV9A 4FUYA 3B8RA 3BU3A 4MQ2A 4F64A 1Y91A 4YHTA 4FA2A 3BBTB 3FY2A 3R9HA 3QALE 2PMNX 4ID7A 3JVRA 3PWYA 4BDCA 3OF0A 3Q60A 5LARA 4EOJA 3F61A 2WOTA 3FLZA 3FYJX 3LCKA 4RJ5A 5DVRA 4EH5A 4HZRA 2XJ1A 4XJ0A 2VTTA 4C35A 5FLFA 4OBOA 4CMTA 3RGFA 5J7HA 3PXZA 2G15A 4I20A 4ANNA 2J7TA 3TNHA 3TIYA 4FIGA 2YHVA 3AD6A 4GSBA 3DK7A 3EN9A 5EHYA 3RPSA 3VBYA 4FZFB 2PTKA 3UPXA 4J52A 2XK8A 3V01A 2X7OA 3UG2A 3R21A 5ETCA 3UVQA 3VBWA 3OUKA 2QOHA 5D10A 3UQFA 3BI6A 4EYJA 1Q8ZA 2C6MA 4YTHA 3W16A 4FNXA 3QCYA 4GH2A 3LCDA 5IMXA 4TPTA 3QTSA 3CD3A 3PUPA 2ITWA 3ENHA 4G9CA 4HVHA 2B54A 3UQCA 3WF8A 2BALA 5CVHA 5AR8A 4S2ZA 1Q24A 3OY1A 4N4SA 3R7UA 3VS2A 3K5UA 2XNMA 4J1RA 4YJSA 4EC8A 1SVEA 1A06A 1YWVA 2Z7QA 4DH3A 2X8DA 2PE1A 4ALWA 3ZS5A 3R00A 4WIHA 3FMDA 2JDOA 2WQBA 3H3CA 4D2WA 1Y57A 2JIVA 4G3DA 4IZAA 4YLJA 4TYIA 2PVFA 2CCIA 3UO5A 4FSZA 2FYSA 3C4WA 2IO6A 4FV1A 2YLFA 2XM8A 4EK3A 1Q8WA 4KRDA 3MPTA 2WPAA 3BHUA 3FI2A 2CMWA 5GJDA 2ONLC 3A4PA 5H2UA 5K3YA 1DI9A 2F2UA 2WIHA 2WU6A 3H4JA 3TZ8A 3E87A 2HWOA 4RX7A 4X3JA 3ZXTA 2ZDUA 3IDCA 4LUDA 4NFNA 1YQJA 3HA8A 4ZSLA 4OTDA 4WSYA 4RQKA 2OIDA 2BZHB 1H24A 1R1WA 1XQZA 3NCZA 5HD4A 1ZARA 4O0VA 3EH9A 3FC2A 3IS5A 3VVHA 5CSHA 1ZZ2A 2O5KA 3DV3A 2BIKB 5EK7A 4ENYA 3VS5A 5AV4A 1MP8A 5C8MA 3ZTXA 3KRLA 3L9NA 4UZDA 3OXIA 2B4SB 1F0QA 2IVVA 3CEKA 1YDSE 3D7ZA 3GU6A 3KVXA 4Y73A 4QPSA 1W2FA 3UOKA 3DBEA 4FSRA 4JBPA 4QYHA 3I5ZA 3RALA 3RK5A 4H1MA 4LGGA 4ALVA 4CYIA 5K4IA 1SM2A 2XCKA 2WMTA 3ETAA 3F3ZA 3I0OA 3ZZEA 5EYMA 4AA5A 3SDJA 3VHKA 2X2LA 4RLLA 3I7BA 4DEIA 2FSMX 3DK3A 4BGHA 3QD0A 3DA6A 3ZC5A 5J5TA 5L6OA 4JXFA 3FKOA 4B8MA 2VNYA 4DLIA 2OJ9A 1QCFA 4FX3A 3IK3A 4TNBA 4O0YA 4AAAA 3HX4A 4BZNA 4BWKA 5FBOA 4FV0A 4EHZA 4UMRA 3ROYA 5CY3A 2XK4A 2Y6OA 2VX1A 4L42A 2R3JA 4AQCA 5EI6A 1WVYA 3D7TB 1U5QA 1OKZA 3K5VA 4TWNA 5M4CA 3LCTA 4JAJA 4J7BA 1YOJA 3PIZA 4OGRA 4Y8DA 3KULB 1GJOA 3GUBA 5HBHA 1YDRE 1WBOA 2FA2A 4K0YA 2ETKA 3G51A 3PLSA 4U41A 5BUJA 1XH8A 3LQ5A 3V51A 1RW8A 4Q2AA 1PXNA 2C3IB 2Y8OA 3UIBA 3FQEA 3R2YA 4RX9A 3HRCA 3QYZA 1GY3A 4ZJVA 3DOGA 4EHEA 2XIYA 5J87A 3RPRA 3PRFA 3QD3A 5CS6A 3HVCA 2JFMA 4RX5A 2XNOA 3OY3A 3QX4A 4IDTA 4I0TA 2OI4X 3DS6A 3FI3A 3RM6A 3P86A 3SXFA 3F6XA 3FQHA 2HWPA 2JDTA 3NNUA 2GNLA 4EBVA 2EB2A 3REPA 4BDGA 3HZTA 1T45A 2BAJA 2C0OA 2X7FA 3BHHA 4C4EA 3OWJA 1VYWA 3ZBXA 2ITQA 3TKIA 4KBKA 2JAMA 1M17A 4BVUA 2R3LA 4AW5A 4OTWA 2OXDA 2WTVA 4FKJA 2ZDTA 2VO6A 3GU7A 4ZTRA 2W5HA 5FM3A 3ZHPC 3HNGA 4P7EA 5J9YA 2OF2A 2C30A 4M0ZA 1UV5A 3OMVA 4MXOA 4Q5EA 5HG5A 2WGJA 1MRYA 3E93A 3OWPA 3H10A 5DI1A 2CN5A 4FKWA 3KXNA 1Q62A 4IE9A 4TNDA 4G6LA 3OT8A 3PE2A 2KULA 5H9BA 4ZLZA 3OOMA 4LOPA 3HUBA 4CKJA 5HIEA 3F3TA 4OTFA 3UO4A 4IVDA 1YXVA 5KX8A 2X81A 4MNEB 4XG9A 5KHWA 4FT3A 3IECA 3OC1A 4XX9A 3NUPA 3E8DA 3H9OA 3UG1A 4BRXA 4IVBA 2ITYA 4PMTA 4EBWA 1FQ1B 4TKSA 3I0QA 1GZNA 4RWJA 4TYGA 4YJNA 4YJOA 5IEYA 2ZOQA 3D7TA 5IUGA 4MQ1A 4JR3A 3IGGA 3WBLA 4IX4A 3ORXA 3EQGA 2AQXA 2P4IA 3P4KA 4DEGA 3KULA 4JX3A 5F95A 3BU6A 5IA1A 3QD4A 1H1PA 2WTCA 3N51A 4QMPA 2VTJA 3G0EA 4NCTC 1PW2A 3FC1X 2C3JA 3P7CA 2V0DA 2XCHA 4L44A 2XEZA 4OBPA 2XIKA 3MYGA 2OO8X 2AUHA 4HVSA 2WQNA 3AMBA 1XH7A 2RL5A 3G0FA 1Y6AA 2F4JA 4KSPA 3ZLYA 3FHRA 3NUSA 5FM2A 1WBVA 2E9VA 2G2FA 3PFQA 2FSLX 5ETIA 2ITTA 2R3KA 3QQUA 3B8QA 2HOGA 2QO9A 3TG1A 4BTMA 3PVBA 4KWPA 4U81A 2QU5A 2UZDA 4IVCA 2CDZA 2YDIA 5HE1A 4C34A 4ANOA 4R3CA 4M7IA 3VUMA 4D5HA 2I40A 4UY9A 3NEWA 2Z60A 1SYKA 4QP4A 2YIXA 3MFUA 5HQ0A 4XCUA 3C9WA 4RFZA 1M14A 5HZNA 3RTPA 1YXXA 2PMIA 4BCPA 4FSUA 3FPMA 4LRKA 2ZV2A 4Y5QA 3ULIA 1Z9XA 2E9OA 2C69A 3W2OA 2PL0A 2YCRA 3ZFYA 4MWHA 4BZOA 4ZOGA 4EOIA 4G9RA 3GU4A 4RIOA 3ZLXA 4G2FA 4G31A 4YPDA 1YXSA 2R2PA 1M2RA 2F7XE 2XKCA 5HVJA 2BRHA 3A4OX 4FYNA 4FKVA 4OTGA 4O0RA 4S33A 5CASA 1IASA 4DH1A 4B8LA 2C3LA 2G01A 3QRKA 4LYNA 3VUHA 2QKWB 3ZMMA 5FDXA 2B7AA 3PSCA 4O2PA 4P5ZA 4K9YA 3QHRA 2CGXA 4BCNA 5EDPA 3DLZA 4ZZNA 3L8SA 4DFNA 4DLJA 4JI9A 2BAKA 5K5XA 2C6IA 3LXKA 4JQ8A 1ZLTA 1JAMA 3PIXA 2J0MB 2UZVA 2W1FA 4MXZA 4MNEA 5FEDA 4E6CA 4F0FA 5JFVA 3DB6A 3JUHA 3KK8A 5DIAA 1R0PA 2X4FA 1OL6A 5AIRA 4D1SA 4JS8A 4XG7A 4MNFA 2X8IA 1W84A 3OROA 4QMZA 5LVPA 2W0JA 4FIFA 4XBRA 4TYHA 1OKYA 5ETFA 5TF9A 2QHMA 3DTWA 4JBVA 4KS7A 3UVRA 3QD2B 1DM2A 1IRKA 2BFXA 4C4IA 3KRRA 3LCOA 4XP2A 5A3XA 1F3MC 1ZYDA 2FH9A 2J5FA 2VTIA 2XMYA 4FG8A 4L43A 1PXPA 2B9FA 2BVAA 3VBTA 5JK3A 3I79A 4R7HA 3LE6A 3COIA 1EH4A 2PZRA 2XF0A 3CTQA 4PV0A 4C62A 5BVFA 4F70A 3DZOA 4IM0A 5B0XA 4YZCA 2W1HA 4FT7A 4FKIA 4JJRA 4R5SA 4RIWB 1CDKA 2AC3A 2BRBA 1OIYA 5EM5A 4AZVA 3AG9A 2PWLA 3D4QA 1HCKA 3RNYA 4UMUA 3L9MA 3GBZA 4BCFA 1J1CA 1RJBA 1OUKA 3C51A 5AX9A 5E8YA 4A9SA 2XJ0A 3ORTA 4CZYB 4YJQA 2GTMA 2UW8A 5CU6A 5BMMA 4X2NA 3UNZA 3V5TA 2FUMA 2C5OA 4K8AA 3S4QA 1X8BA 2F2CB 2UV2A 4FTQA 3MH0A 4RPVA 2PSQA 4U45A 5LWNA 3G6HA 3FSFA 3CQEA 5LOHA 5IDNA 4C3PA 2JKKA 5I3OA 1FMOE 4BCMA 3BE2A 3E8EA 3P78A 2W4KA 3SXSA 3W10A 2EWAA 2R3MA 4KINA 3QRIA 4UWBA 1XJDA 3IOKA 3TZ7A 3I1AA 3CKWA 4O0UA 5HGIA 4YBJA 3D5XA 3I4BA 4PQNA 5EDQA 1OM1A 3W2CA 3W8LA 4NW6A 4CVAA 1CTPE 2R7BA 3K54A 2Y6MA 3ORKA 4FK6A 3RK9A 4F6WA 3MPMA 2VWZA 3C4CA 3FZTA 3TCPA 2WTDA 3G5DA 4BTJA 1KOAA 1ERKA 1KE8A 3LFCA 2OIQA 4BKJA 3O7LD 5DHJA 4WG5A 3FUPA 1E1VA 1OIUA 4JG6A 3NNVA 3E3PA 1WFCA 3COHA 4ZZOA 3EIDA 3Q5ZA 2O0UA 1YW2A 2QURA 3DBCA 3FMNA 3JXWA 3OTUA 4GW8A 4IMYA 2O2UA 2UW5A 3O7LB 4ZS0A 2WHBA 3MTFA 1NXKA 2VGOA 3C1XA 3OOGA 4JBQA 3PA4A 1FGKA 2HZIA 1B39A 2QLUA 4GS6A 4NIFB 2OZOA 3HV4A 2JBPA 2UUEA 3BQCA 5CLPA 3KY2A 4FV7A 1MQBA 4H1JA 1W98A 3JY0A 3DDQA 3EWHA 4NJ3A 4BCQA 5LVOA 1DI8A 4X2GA 3O23A 5KNJA 1ZMVA 4C02A 4IWQA 4AZEA 3D2KA 3ZH8A 3NRMA 5LWMA 5HI2A 3I81A 4XV3A 1Z5MA 4Z55A 3MW1A 2HAKA 1GIHA 4U7ZA 3ZO2A 1HCLA 1W82A 1B6CB 4NUSA 3VUDA 5AAGA 4W9XA 3E5AA 3Q3BA 1NA7A 2V55A 3OEZA 2HXLA 3RPVA 3RAHA 4Z7HA 4XV9A 3G9NA 5JZJA 1BMKA 5EOLA 3TWJA 3EKKA 4BHZA 3SLSA 4QMLA 4RBLA 4XMOA 5CI7A 5EOBA 5AUWA 2LAVA 4OTQA 5ITAA 5CZIA 1TQPA 4FC0A 4HPTE 4JG8A 3CGFA 3MH1A 5AUXA 1K2PA 4WO5A 3ZLSA 3CXWA 3DAKA 2C5XA 1CKPA 4FSYA 1FGIA 1VJYA 1YHWA 4AN9A 4C36A 5JSMA 1GNGA 4NM3A 3VC4A 4WG4A 5HCZA 4E93A 3OBGA 4PTGA 3WZUA 2UW0A 2GHLA 2ZM3A 1R78A 4A4LA 2ZM4A 5L2QA 2OKRA 4W8DA 2ZB0A 3F2AA 2EU9A 4O0TA 5CXHA 4DEDA 4FF8A 4FNWA 3A7JA 3VIDA 5AR2A 4BDDA 5JN2A 2B9HA 5HO8A 4YC8A 2X0PA 3CIKA 3D5UA 3FMKA 4AF3A 4GU9A 4EUUA 2YM6A 3NYOA 4RVTA 3UZTA 3HKOA 1OZ1A 1SVHA 4HGTA 4YZ9A 4ENXA 2BAQA 5M56A 2BILB 2QOKA 3RZFA 4ZTMA 2B9IA 2R0UA 5IZFA 4DG3E 5AWMA 1UNGA 4JAIA 1BI7A 2JDVA 2YWPA 2IVTA 3KA0A 4OTRA 3MH3A 5EG3A 2ITPA 3BPRA 4YZNA 5DT4A 5I3RA 3P79A 2X9FA 1OPLA 1H1SA 4LV5A 1A9UA 1CMKE 4RVKA 5DGZA 4ZK5A 4CCUA 4D0WA 4QP1A 4X0MA 4TRLA 3R8PA 4LMNA 2G2IA 2GNGA 5AP3A 5F1ZA 4HVDA 4RZVA 2IN6A 2A27A 1Q5KA 1E9HA 4EJNA 4NIFA 5CQWA 2IW9A 4FKLA 5HKMA 4O4DA 3O96A 4WT6A 3PPJA 1Q8UA 2FB8A 4MCVA 4ALUA 1BLXA 4WD5A 2J4ZA 3WI6A 4J95A 4FTKA 2PVYA 1RDQE 1T46A 1K3AA 2WFYA 1U5RA 3A61A 3KXMA 1YWNA 3PXKA 1SNXA 3QRTA 2JAVA 3EQDA 1I09A 3LXNA 4G6OA 4MVFA 4F63A 5HEZA 4DH7A 3VBVA 4DG2E 5CAQA 3V6SA 3BQRA 3R7GA 5J5SA 2XEYA 4PY1A 4CZTA 3FY0A 3AC2A 3V3VA 2QHNA 3BEGA 3I6WA 2JITA 3LPBA 5DLSA 3SV0A 3R2BA 3QTUA 3QUPA 4QTDA 4CMUA 4GUEA 4G3FA 2OIBA 2WMSA 4DGGA 5AP7A 2EB3A 3TV6A 3BHTA 2P0CA 3QTIA 3TIZA 3LJ1A 4KRCA 1OPJA 1PKGA 4FK3A 5E91A 4ZXTA 4E1ZA 2YISA 3EHAA 3FL4A 3ZO3A 3DY7A 2BRGA 4BCIA 3KCKA 3QTXA 2VAGA 3FHIA 4EK5A 3Q53A 4EOQA 4C4HA 3ZEPA 4WNPA 2BZJA 3V04A 4F6UA 2UZLA 4UALA 4IQ6A 3TT0A 4XP0A 1YXUA 4EEVA 5CAVA 3MBLA 4FSWA 3OVVA 2R3HA 3O8TA 5AP5A 3WE4A 5K0KA 5HHWA 3KMUA 3L9LA 4NKSA 2F57A 5KMIA 2R5TA 4FV4A 2W1DA 4MXCA 3OW4A 4EC9A 4MD8E 3LW0A 3PYYA 4M97A 4NT4A 2XYUA 4D4YA 2CLXA 4RJ8A 5M4FA 1YI3A 1S9IA 3CJFA 3R8ZA 3FKNA 2QLQA 2VD5A 2WTIA 2DWBA 3P0MA 3RPOA 1WVWA 4U8ZA 2I1MA 4IJPA 2ZJWA 4FTMA 4PMSA 4RC4A 4IC8A 3ZUVA 4QMQA 4JIAA 3ZC6A 3BYVA 4FL2A 2J0JA 4LGHA 1J91A 4J8NA 4MXXA 4P5QA 4U5JA 5DFPA 3ZEWA 4KIOA 4MXAA 1PXJA 4AP7A 4U40A 4PMPA 3CY2A 2CCHA 4I21A 5CENA 4Z16A 3LAUA 4K6ZA 3RCJA 1VR2A 2O65A 4DTKA 5C8NA 4UXQA 1W83A 3QXOA 4CQEA 1FVRA 3KMMA 4EHVA 1REKA 2XNNA 3IW7A 1H0VA 2QO2A 3KN6A 2SRCA 5HG9A 2BKZA 2R3NA 5HOAA 3VUKA 4BDJA 4E6AA 2J0LA 4D9UA 3LXLA 4ZZMA 3Q6UA 4YJTA 2GFCA 5CEOA 4Z7GA 5HVYA 3ORMA 3VBQA 5CSPA