5AR2A

Rip2 kinase catalytic domain (1 - 310)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
307
structure length
277
Chain Sequence
EAICSALPTIPYHKLADLRYLSGTVSSARHADWRVQVAVKHLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMGGTIIYMPPENYEPSIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2
publication title Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 277
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ar2A00
1ZMUA 2YZAA 4JBVA 4YGAA 3GCSA 3PYYA 2I0VA 4ZTRA 4ZK5A 4XYFA 5KNJA 1ZZLA 2BRNA 4UYNA 3PPKA 4IZYA 4ZOGA 3E3BX 5KZIA 2C4GA 2ZB0A 3QGWA 2FH9A 3P7BA 5JQ5A 4EYMA 3F88A 2GU8A 5BUIA 3V5JA 3LVPA 3Q60A 3W16A 3LW0A 4EHVA 3EFJA 5CLPA 5EI8A 4ZSJA 1PKGA 4PF4A 3VVHA 2C5YA 3E5AA 3OHTA 4IVBA 4ZLOA 3UNJA 4PV0A 2XJ2A 4MCVA 4ANLA 5HLWA 2ZMCA 3QX2A 4X2GA 3ENHA 5FDPA 3TIZA 5CASA 4RJ6A 4D2TA 3HMPA 4JRNA 4XJ0A 4JDKA 2BAKA 3IONA 2W96B 2XK7A 2PL0A 4BDEA 1IR3A 4YO6A 4M7IA 4DITA 4ASDA 3VBQA 4BCGA 1H0WA 3G9NA 4CLJA 3MB6A 3TKHA 4E20A 4D2SA 4O91A 3BIZA 4NTSA 3GCPA 3WZUA 3A62A 4FV7A 2WMTA 4TW9A 2ETKA 3C4WA 4EUUA 5KMLA 4MBLA 4F1MA 4M97A 3K2LA 5FP5A 3CPCA 5HD4A 3GOPA 4CVAA 3Q4CA 4W4WA 1GZ8A 3QD4A 2QOKA 3AMAA 4LG4A 2CGWA 2Y7JA 2VWYA 4G3DA 4LOPA 5FP6A 2J90A 3QRUA 4TXCA 3OUNB 3QRKA 5M4UA 4FT3A 1P14A 3DFAA 2XRWA 2W05A 5DT4A 4WUAA 3SRVB 4ZY5A 4WNMA 5F95A 4GEOA 4R3CA 4QO9A 3H9RA 3NNXA 1H25A 3NW6A 3I4BA 4QPSA 1BYGA 5GJGA 4QQCA 3IKAA 4IWDA 1DM2A 3QXOA 5FLFA 4AN3A 2ZMDA 4NM0A 1XH9A 1JSVA 3TCPA 2WTJA 4BCHA 4TWCA 4NM5A 1JSTA 5M53A 4CV9A 3GUBA 4WBOA 4YJRA 4EZ3A 1UWJA 1JPAA 2O3PA 5EW8A 4EEVA 1YKRA 1Q8WA 3IW5A 3RAIA 3VRZA 4MXZA 5LARA 2B52A 3R02A 2ITVA 4G3EA 2X8EA 3SHEA 2A19B 4GYIA 3VS7A 5KZ0A 5J1WA 3E7OA 4L3JA 2OF4A 4QMYA 5KCVA 4TZRA 3ZO4A 1GOLA 3OF0A 5E8ZA 5KBQA 3II5A 3OXTA 5HVKA 2KTYA 3D5WA 2ITOA 2YM8A 3QKKA 3CTJA 3AC8A 3E64A 2C5OA 4L7FA 2H9VA 4QP1A 5DG5A 3B2TA 2PVRA 3ZZEA 4Y72A 2AUHA 3QTSA 3PPZA 5JQ8A 1YXXA 3PJ3A 3PA5A 4HNIA 4O0SA 4ZTMA 2F7EE 3BLQA 3FWQA 4R3RA 3ZCLA 5EYKA 3KVXA 5DOSA 4I6HA 4YC6A 3ZOSA 4F63A 5KUPA 4U80A 4X3JA 1MQ4A 4IEBA 3VC4A 3BE2A 4YTIA 3FXXA 3R7IA 1H0VA 1P5EA 5FXQA 4FZ6A 3OTUA 3EYHA 3Q9WA 3EQCA 3DPKA 4DFXE 3H0ZA 2PHKA 4EONA 1PYXA 2C1BA 2JFLA 3HVCA 1YXTA 4WIHA 4FVPA 2XBAA 3FKLA 1OKWA 4M0YA 5HE2A 3DBCA 1XKKA 4JQ7A 4Z3VA 4A9UA 3BE9A 3F5XA 3MVHA 5J5SA 4JAIA 4ZXTA 4BWPA 4EK3A 3SV0A 4Z7HA 4OR5A 3L8XA 3CC6A 4G6OA 4QYFA 4CSVA 4G9CA 2X9EA 2BDWA 3NW5A 4C4FA 3SXSA 4OBQA 2F7XE 4U97A 5CU0A 1FVRA 1REJA 2QCSA 3WE4A 4FOBA 4FT9A 2OH4A 2BROA 3GBZA 3R22A 3OBGA 3MJ1A 4LOOA 3ORXA 4F0FA 2AC3A 3BU3A 3ORPA 4C7TA 4F1TA 3FLZA 4O0RA 2W06A 3KU2A 4RIXA 4YR8A 1O6LA 3BU5A 4FTQA 3W32A 5AP0A 4FKGA 2BUJA 2W9FB 2QOFA 2Z7LA 3RM6A 3UQGA 4R7HA 3WZJA 2QI8A 3I79A 3PUPA 1FGIA 3DJ6A 4XLVA 4ID7A 2ETMA 2ZVAA 3IQ7A 4C4EA 2B9JA 3UG1A 3DK7A 3QTIA 4EH6A 5HX6A 1XQZA 2PE2A 2QHNA 2VX0A 1H4LA 4I5PA 4I41A 4QP8A 4D2PA 4OAUC 3SC1A 3CQWA 4RRVA 4CNHA 4W9WA 1H01A 3BGZA 4AFEA 4PNIA 4BHZA 3LXNA 4TYIA 3ZEWA 3Q4TA 3ENMA 3VS4A 2VTHA 4J8NA 3TZMA 2YIXA 3GB2A 4KABA 2RG5A 4NUSA 4IAAA 2VNWA 2UV2A 4PL3A 3SW7A 2OJJA 2YCFA 3W8LA 5AIRA 1DAYA 5HOAA 4EHGA 3SKCA 4IE9A 4AGDA 3EQHA 3WE8A 3IG7A 1PHKA 1YOJA 2W99B 4DH3A 5LMBA 2RFSA 2CHLA 2UW5A 2XJ1A 4BL1A 2R4BA 3DKGA 3JVRA 4DFZE 5J9ZA 2WTCA 4WRGA 4RIYA 4U9AA 4CZYB 3ZXZA 5DGZA 4HYHA 2FVDA 4ZJJA 2CSNA 4RC2A 3K54A 4C36A 2A27A 3E8CA 2FO0A 1KOAA 3FBVA 3QTRA 3UIMA 3I6UA 3CD3A 5DN3A 4ASEA 1RJBA 2XNOA 4XP3A 3QLGA 2GNHA 1A06A 4ZSGA 3P78A 4FV9A 5H8BA 2ZJWA 4FSUA 4FKOA 5H3QA 2F49A 5LVLA 2VTOA 3L8VA 3COKA 3QTWA 2I1MA 3WZKA 2C5NA 3PVGA 3MI9A 4AW5A 2UW9A 4QYYA 2W1ZA 1VR2A 2CGUA 3OEZA 4GJ3A 4RC4A 4CYJA 4PMMA 4JBQA 3VQHA 1OUYA 5IH5A 5FDXA 4EC8A 3IK3A 5CNOA 1PXJA 2GHGA 4BGQA 4FR4A 5HHWA 1JKSA 2R3OA 2W1EA 3DGKA 2YCRA 2GDOA 1ZAOA 3D2KA 4GW8A 4I0RA 4I23A 4JG7A 1U59A 2OKRA 4B8LA 3OG7A 1REKA 2J4ZA 2PVHA 4GT4A 4A4OA 5IU2A 1YXVA 2OF2A 3FL5A 3MH3A 3AC5A 4WSYA 4ZLYA 1QCFA 1UV5A 4BHNA 2FGIA 3W2CA 5BNJA 4AG8A 1BI8A 3OC1A 4LFIA 4ACGA 3LXPA 5TKDA 4KKGA 4P4CA 1J3HA 5HG7A 3RPSA 4U3ZA 3R1QA 3E7VA 4BZOA 1Z5MA 4F08A 4YJVA 5CAVA 1Y57A 2OJFE 5DI1A 5CWZA 3D7TA 3FV8A 4NIFA 5TT7A 5AV4A 3MB7A 1RDQE 1P4FA 3HUCA 2LAVA 2HAKA 1UKIA 3D7ZA 3LCOA 3OOGA 4Y46A 4O2PA 5BX0A 4CFXA 4BIDA 5EK7A 2HY81 1ERKA 2VU3A 4OT5A 4F7NA 3HECA 4U44A 5L2IA 3I0QA 3TEIA 3HRCA 4O21A 3F7ZA 2R0UA 2XEZA 4D1XA 2E2BA 2HZIA 3SXRA 5JFWA 4AQCA 3QWKA 3E8NA 4UN0C 5M57A 5KE0A 1WBPA 1BKXA 1Q8ZA 2ESMA 4F9AA 5CT0A 4R7IA 4UEUA 3V5QA 2B1PA 3NDMA 3UP2A 3L8PA 4J95A 3UVRA 4PPCA 4BDIA 4AZVA 3VW8A 1PKDA 5M55A 4BKZA 4M66A 3BGQA 2P0CA 4A9YA 5GZ9A 2WHBA 4CV8A 3QQHA 3RM7A 5K9IA 3SVVA 3PPJA 4E5WA 3I7BA 3VQUA 3ANRA 5BYZA 3VS0A 4ZTNA 1YOLA 1U46A 2Y4PA 2JITA 3OXZA 3TKUA 2UZDA 4K18A 4O0UA 3Q5IA 4PMPA 1RW8A 2Z8CA 3FHIA 4RX9A 3VF9A 1LP4A 3WI6A 4WNPA 3COHA 3R7YA 2J9MA 3KB7A 1AGWA 2OZAA 3NRMA 5CX9A 4BBMA 5AUYA 2XCKA 2E9UA 2ITUA 4E6DA 1CKPA 3BKBA 3FSKA 5FG8A 4DH7A 1WVYA 2VTMA 1FVVA 2CDZA 5EW3A 4ALVA 2Y6MA 3NR9A 3EB0A 2A2AA 3P5KA 4S2ZA 2YCQA 4X2FA 3MH2A 3EN9A 2JFMA 4BKJA 2QG5A 5EI6A 1YWVA 1PF8A 4MYGA 2PMIA 4EOIA 4TN6A 4KINA 4Y5QA 1U5QA 1SYKA 5AR2A 4HW7A 4UBAA 2G15A 3ZFXA 4QTCA 5HG9A 5EM8A 4XG3A 5E8VA 3DQXA 3QRTA 3KGAA 3ZC6A 4EQMA 2QU6A 5HZNA 4ZSLA 3SX9A 4C3RA 2CKEA 4P5ZA 4BYIA 5L2QA 3FI2A 2JBOA 4QMPA 2OICA 5LMKA 3F3UA 5EHOA 3OWLA 4U41A 1BMKA 2XYUA 4O6LA 1IEPA 5FXRA 5LQFA 2R7BA 5J5TA 3CQUA 1UU3A 3CBLA 4K33A 4BBEA 2GSFA 3FLWA 3Q6WA 3ROYA 3CQEA 4YC3A 5JEBA 4BVUA 3GCVA 3L1SA 5CU2A 4FTMA 4B4LA 4DGNA 4ZJVA 4G3GA 4XOYA 3UC4A 3ZRLA 2YM6A 3RZFA 5DR6A 4C2VA 3EQDA 3UDBA 5LXMA 4BN1A 4I3ZA 4QP6A 4U81A 1ZARA 3H0YA 5E8WA 5I9ZA 1VEBA 3ORIA 2IO6A 5HGIA 4XLIA 5C03A 3ZSHA 1CTPE 3GVUA 3QWJA 3JUHA 2YERA 4DCEA 4F0GA 3FDNA 2R5TA 1ZXEA 5D7AA 4BCKA 4JL9A 3FZ1A 2G9XA 3A61A 4MKCA 4IANA 2W4OA 2XCHA 4AXAA 3PXQA 3DTCA 3OBJA 4RIOA 3Q9YA 2UVXA 4GUEA 4R1YA 2XK6A 3PSCA 1J1BA 3FQSA 3PE1A 3QTQA 3ZO2A 3CR0A 3BQCA 3M2WA 1HOWA 3R1NA 3WF6A 3GCUA 3R83A 4BWXA 4ENXA 4IZAA 4AOTA 1YDRE 2JC6A 4XEYA 3GNIB 3HP2A 5CI6A 5AR7A 1OUKA 4YLLA 4AN2A 4BRXA 3HYHA 3D5VA 4ARKA 1ZLTA 4A4LA 2RIOA 4AE9A 2JKMA 4WRSA 2JGZA 2BZHB 3EMGA 3LFAA 3KVWA 3BV2A 3L9PA 5CEKA 4BDBA 4DYMA 3U6IA 4TRLA 3A4OX 3OTVA 5L6PA 3DA6A 2WD1A 2WFYA 3FYKX 4U7ZA 2R3NA 3R8VA 5H9BA 4DEEA 2G2FA 2J50A 4RWKA 3EN7A 4KS7A 2BZKB 4G34A 4BCIA 5HE1A 2OIBA 1UVRA 1W0XC 2HZ4A 4EOPA 4RJ4A 2YDKA 5HE0A 4EJNA 4KKEA 3WIKA 2YIYA 3EJ1A 1XO2B 3RINA 3KXZA 4ITIA 5E92A 4WNOA 3NUNA 4FYNA 4KBCA 4R5SA 3IW4A 2RSVA 5K3YA 2FA2A 4MEDA 1PMUA 3G2FA 5I9XA 4FKQA 4GFMA 3QTUA 4JLCA 3ZLWA 3UG2A 2QNJA 3ZSGA 4DEHA 5J9YA 3DBEA 4FVRA 1WAKA 3NPCA 4NZWB 3ORLA 1WMKA 3AC3A 5AP6A 3C4CA 3EH9A 4K77A 1H8FA 1QPDA 3QQGA 3KRWA 3RHXA 4KB8A 5JH6A 4DEDA 3WYYA 1K9AA 2HYYA 5EDRA 4CFVA 2HXQA 4YO4A 3KKVA 4ZLZA 2CLXA 1Z9XA 4YJNA 2R9SA 4U5JA 4BCPA 3E88A 4GVAA 4IM3A 3PWDA 1OM1A 5L6WL 3FHRA 4RJ8A 4U3YA 3AD5A 1XH4A 2CJMA 5EFQA 2XIKA 5GNKA 3R8PA 3LFEA 3VUKA 5BPYA 3KRRA 4UWBA 3RCJA 2QLQA 2ITPA 3MH1A 4C4HA 5AUZA 2EXCX 4QMZA 2WMQA 4YJUA 4QTEA 5TE0A 3HV3A 1S9JA 3AC2A 3LHJA 4MHAA 3AMBA 3BZ3A 3MSSA 4YZ9A 5KMKA 5M51A 3NSZA 1FMKA 4IWPA 4IWOA 3SRVA 2WMVA 4EBVA 5J9LA 1TQMA 4G9RA 5HIEA 5CTPA 5CQWA 5CAUA 3DFCB 3HA6A 1Z57A 3HX4A 5I9VA 2XJ0A 2JKOA 2XIRA 4KIQA 5A4CA 2IVSA 2PVFA 3O7LB 5BVNA 4J71A 2OIQA 1SNUA 3FMKA 4XRJA 4PY1A 2B55A 3WF9A 4IJPA 4UWCA 3GT8A 3VHEA 3IGOA 2X81A 5C8KA 4APCA 2WTVA 4CFUA 4XMOA 3DLZA 4XCUA 4CZTA 5DBXA 3E93A 2QVSE 4QP7A 5BQ0A 1BL7A 3IDBA 5HBHA 3EQFA 3HDMA 2GHLA 3S2PA 4DLJA 4C35A 1XH8A 3MA3A 4GYGA 3IGGA 2FSLX 4XH6A 4YJTA 5AIKA 4IFCA 3RNYA 3A7IA 3DDQA 4RIWB 3ET7A 4L00A 4AU8A 2Y4IC 2AC5A 2QOBA 4PTGA 3FE3A 2UZTA 4OLIA 5ITAA 3LZBA 3W1FA 3KL8A 4DBNA 4AW2A 4FKIA 4L01A 1S9IA 1KSWA 3EZVA 4IC7A 3PTGA 5JKGA 4IX5A 2YHVA 3B2WA 3PJ2A 4D1ZA 3EN5A 1M17A 1OKZA 3IDPA 3F5PA 3TTIA 2XK9A 2BDFA 2R64A 2EVAA 4NJDA 4Y95A 5LVMA 4UXLA 4F6UA 2WMWA 5BYYA 3IO7A 4TNBA 1PMVA 1Q3DA 1SM2A 1AD5A 4MH7A 4WA9A 2P4IA 4GRBA 3LJ2A 4E4NA 5K5XA 2G01A 5AWMA 5ANKA 2A4LA 2F2CB 3L9MA 3F2NA 4K11A 3EN4A 3N51A 4DG2E 4EOKA 2VWXA 3UP7A 5IMEA 5A4QA 4KSQA 2C6LA 4LUEA 5E91A 4CQGA 3LJ0A 3PSDA 4ZY6A 3R8MA 2VTQA 4Z9LA 2WMBA 2RFNA 5M44A 4EC9A 3PY3A 4QMSA 4W9XA 3ZXTA 5IPJA 3UO5A 2X8IA 4NEUA 4WUNA 4Y85A 4M84A 2HZNA 5HESA 2BTRA 3EKKA 1OL1A 2XK8A 5LWMA 4USEA 4FKLA 2BKZA 4HZSA 3FZSA 2XM9A 4S30A 2FSMX 2PZRA 3K5UA 5FTOA 4AW1A 3FL4A 5CVFA 2V7OA 4TTHB 4GT5A 2YISA 3DJ5A 3QA0A 2QOOA 3A60A 3FXWA 5CVHA 4PRJA 4PDSA 4FG7A 3HGKA 4AP7A 4MWIA 5ACBC 4O0YA 3VUDA 4CRSA 5K4JA 2QLUA 5C8MA 3UPZA 4ZAUA 4Y83A 4YNEA 2BFYA 5BVOA 4Y5HA 5TO8A 1XBBA 2UZVA 2HWPA 2HOGA 1MRVA 2GNGA 3MDYA 2ITXA 3RBWA 3V01A 5JGBA 5JSMA 4B6LA 3PZHA 3ELJA 4C3PA 3O0GA 3IW6A 2C6MA 4FZ7A 5E1SA 1BX6A 2WELA 3KY2A 3UIUA 3ZO1A 4EH7A 2BZJA 3M1SA 3F5UA 5KKRC 3UIXA 4CD0A 4AT3A 3P7CA 2W17A 2J5FA 4QYGA 5J8IA 4I4FA 1Q3WA 3REPA 4OW8A 4XNEA 1T45A 4O0WA 2BAQA 4EK6A 4N0SA 4EHEA 4DGLC 2PVYA 4IM0A 2IVVA 2VTAA 2KULA 4YPSA 5D10A 2O2UA 4I94A 5AP3A 2I40A 3HZTA 2QOHA 3UQFA 3EL7A 3G51A 3R00A 3GU8A 3GC7A 3RPRA 2QKRA 3EQBA 4FZFB 3OMVA 4GMYA 4RFMA 5B2MA 2B4SB 2HZ0A 4G16A 1SVEA 3ROCA 2BAJA 2ITYA 2PY3A 3WF7A 3JVSA 3TV4A 2VX1A 1PXOA 1ZWSA 5KHWA 1KE5A 5LCKA 3V5PA 4BWKA 5AA9A 2BIKB 4GCJA 1OIUA 3PXKA 2C30A 2QR8A 3NAXA 4X3FB 1R0PA 3OW4A 2Q0NA 4FG8A 3GP0A 3D94A 4IBMA 4CKIA 1OIRA 3R71A 3FMMA 3QD2B 1E1VA 2BILB 4N6ZA 4IZ5A 4ALUA 3DBQA 4WHZA 4CYIA 2I0EA 3CLYA 4G1WA 4IX6A 3W18A 2LGCA 1Q24A 4EH3A 5DWRA 2XIYA 4YLKA 3W2RA 2F7ZE 2XKFA 3BHUA 3NCZA 4RPVA 5HVJA 5K0XA 3TUDA 3D15A 3BELA 4E5BA 4YUQA 3AMYA 3KA0A 4K2RA 4PL5A 4E5AX 5HX8A 4AGCA 2QO9A 3NIZA 3GC8A 2BTSA 1YXSA 2OH0E 4C37A 4XRLA 2R7IA 2CN8A 5HVYA 4ACMA 2IN6A 3GC0A 4FIFA 5F20A 5EW9A 4BB4A 5LJJA 3PIZA 2VO6A 4IM2A 4KD1A 5ANEA 5AV0A 4FF8A 4DFLA 2C1AA 3NS9A 4JBOA 1OIQA 3T9IA 5CXZA 2WNTA 4AE6A 1X8BA 2G1TA 3GGFA 3QC4A 2JEDA 4R5YA 4V0GB 3Q5ZA 5J87A 2IVUA 4BF2A 4F6WA 4M14A 3BQRA 4F70A 3UZPA 2HW7A 4L3PA 3MGYA 2BVAA 3Q04A 2UVZA 2J0LA 1DI9A 2GPHA 3W2PA 5A46A 2DYLA 2C5XA 3RTPA 5HCZA 4MWHA 2XKCA 3E92A 4QMTA 4IZ7A 5E8UA 5A4LA 3A7HA 1PMNA 4AS0A 1Q61A 3CXWA 4LGDA 4YNOA 5FD2A 3TNHA 3T3UA 4JX7A 2HWOA 1MRYA 4QNYA 1PY5A 1FPUA 3UOKA 4CT1A 1H28A 5T3QA 4O27B 4DFNA 3GU6A 1CMKE 3OWKA 5EM6A 5CU4A 2ZAZA 3FI3A 3ZHPC 4C57A 1XBCA 5DEYA 3ZTXA 5DMZA 2CMWA 4YZCA 3TI1A 5HG8A 2GTMA 4IAKA 3ZBXA 2NO3A 4QTBA 1APME 1OB3A 3SOAA 2ONLC 3UZTA 4TT7A 3CCNA 1E1XA 4NH1A 3WF5A 3DS6A 2ERKA 3NNVA 3R28A 4RX5A 3FLNC 3OCGA 5E7RA 5HIBA 3OOMA 3LIJA 5EDQA 5B2KA 2UZBA 5ACKA 4AZFA 4YJPA 2ZV9A 2RKUA 3LLTA 4HGLA 2R3KA 4EK8A 2PWLA 3O7LD 2ERZE 2Z7SA 4MVFA 4X7QA 1Q41A 2VWWA 3PY0A 5G1XA 3KFAA 4FTCA 3QUEA 3WZDA 3BLHA 4FYOA 2PVNA 3W55A 3TL8A 3TNPC 2C3IB 4IMYA 2RL5A 3BYVA 3WOWA 5J7BA 3E3PA 2Q0BA 3FLYA 3RMFA 1DS5A 1H27A 1XBAA 4AA4A 4CXAA 5JN2A 4JNWA 2QOIA 5AUTA 5L2WA 1YI4A 4JAJA 3GQLA 3QYZA 3H4JA 1F5QA 1WCCA 2WTKC 5DRBA 2PZYA 1HCLA 5DIAA 4DGOA 3PVBA 4LI5A 3QGYA 1GIHA 3UNKA 5CALA 2WU6A 4Q5HA 5T6KA 3UBDA 4JVGA 1A9UA 2EUFB 3AC1A 3R8ZA 4RQVA 4RMZA 5EYCA 1JKLA 1FGKA 4FNXA 2QHMA 4DFYA 4JT3A 5AA8A 4V05A 1ZOHA 4FT0A 4OTRA 4QRCA 4U79A 4WKQA 4USFA 4C59A 4GSBA 4E73A 3HLLA 3FC1X 2QOCA 4IB1A 4LQMA 4TNDA 3T8OA 5H2UA 5EHYA 2O5KA 4YZNA 4RT7A 4FSQA 4LL5A 1H24A 4TWNA 4ANBA 2VWVA 3C9WA 4FUXA 2B53A 3KXNA 3QUPA 5DLSA 4X2NA 3W8QA 2ZM4A 2NRUA 2X1NA 2HW6A 4F9CA 3TWJA 4PDPA 3TZ8A 2XNMA 3MV5A 4J52A 5AR5A 3NAYA 2C0TA 4ZJIA 3QQJA 4D5HA 3A8WA 3D2IA 2CN5A 2P2HA 3KEXA 3D5XA 3KRLA 3MY5A 4M13A 4TY1A 4CMTA 4Q9ZA 3BYSA 5K4IA 3I1AA 4GIHA 3QKMA 4ZS0A 5AP5A 4IAFA 3TV7A 1RQQA 5HNGA 2QO7A 3ZC5A 3Q53A 2J0MB 4QYEA 4V04A 4ZY4A 3UYTA 2C6OA 5B0XA 3OEFX 3HL7A 1YHWA 4RX8A 4FODA 3QAME 3TNWA 2JLDA 2XKDA 3U9NA 4TYEA 5IEYA 5FGKA 2WQMA 5AV1A 1RE8A 4DTKA 2A0CX 3E8DA 5CNNA 2R3HA 5KMJA 4GU9A 2JDRA 3E87A 1V1KA 3H9OA 4OTPA 4GS6A 4TKSA 3R8UA 4FGBA 3E63A 2WQOA 4IIRA 4IFGA 1XHAA 4ONAA 4I0TA 2JDTA 4N70A 1FOTA 3Q32A 4XV2A 5J7HA 4FV2A 1GZOA 3PXRA 4FK3A 4HZRA 2YDIA 4IAYA 2G2IA 3EQRA 3MVMA 5HQ0A 2REIA 3Q4UA 3QCXA 3QZFA 2UZWE 4IDTA 3ZBFA 3DTWA 5AP2A 3PE2A 4YJQA 5E1EA 4D9UA 4HYUA 4DH5A 4HCVA 5DFPA 5DT0A 3EQIA 2IWIA 4FIHA 3LFFA 5GZAA 4E6AA 3KK8A 5D11A 1ZYJA 3DKOA 3OFMA 3VWAA 2YLEA 4QMMA 2XBJA 3LCSA 2CLQA 3AG9A 4B9DA 4E8AA 3ORTA 3UVPA 4B7TA 3C0HA 4XV9A 2XNGA 4RA4A 3PWYA 4HPTE 3RPOA 1H1PA 3OP5A 2JIIA 4FV4A 4N6YA 2X0GA 3POZA 5A6NA 3Q9XA 4H58A 2XK4A 1JKTA 1KOBA 5LOHA 3QZHA 3VIDA 1WZYA 3GU5A 4FTAA 3VHKA 4D28A 5GJDA 4ASZA 5ETFA 3KMMA 4P2KA 4YHJA 5HLNA 1FMOE 3FC2A 3KXMA 2WXVA 1XH5A 2PMNX 1DAWA 4MBIA 4FKSA 4EH5A 4Q2AA 4FTIA 3OW3A 4RQKA 2PVKA 4DGMA 2C5VA 3AQVA 1CKIA 4F7SA 4RG0A 5HEZA 4OTDA 5FXSA 4BTKA 4C02A 4ZP5A 4BBFA 4C38A 4FMQA 1GZKA 1YRPA 2UZEA 4A9TA 4BI2A 5FBNC 2QO2A 4YURA 3Q2MA 5AJQA 3C13A 2C0IA 2GS2A 2YA9A 4AF3A 2VTNA 5AUXA 3I60A 3NUXA 4F1OA 3O8TA 3QTXA 3DXNA 3PLSA 2YIWA 3G5DA 4LV8A 4PUZA 3PSBA 4FIGA 3HMNA 3I5ZA 3OXIA 4GK3A 4EOOA 3N9XA 3I81A 3TJDA 3FYJX 3UTOA 3W10A 5CAPA 4TYHA 4L9IA 4EKLA 3PJCA 3BPRA 3PA3A 2XF0A 4BICA 1ZRZA 2IVTA 2OXXA 2BPMA 1VZOA 5HCXA 3M11A 4C34A 4QOXA 4PTEA 2C0OA 4BDGA 4FT7A 2WGJA 2XMYA 5DR2A 4II5A 2WTKB 3W33A 5I0BA 3COIA 3PJ8A 3LPBA 3RALA 3NZ0A 3MS9A 4ERWA 4QQTA 4XG4A 4NSTA 2JKQA 1QL6A 2BRMA 3BGPA 4QT1A 3QUDA 3ZLXA 3P1AA 5E8XA 3ULIA 2W4JA 2YABA 4KNBA 4OTHA 4A4XA 2XNEA 2WTIA 3KMWA 3C4XA 3ETAA 3EYGA 4GT3A 4HCTA 1JWHA 4I22A 4FV3A 3BEAA 3GU4A 4ZTHA 4DEBA 5A54A 2R3JA 5L2TA 5J79A 1H07A 3O8PA 3DK3A 3ORNA 4PMTA 5M56A 3B8QA 3COMA 2UW0A 5BMMA 5AM7A 3MPAA 3VULA 4KSPA 2P3GX 3F3WA 4CT2A 4GFGA 1LEWA 4NU1A 3VUIA 3C7QA 1GY3A 2V22A 3QA8A 4G6LA 3G6HA 5CS6A 1WBWA 2VWIA 3Q3BA 4EHZA 4IVCA 4CEGA 3GENA 4YZBA 5G6VA 2XP2A 2UW8A 1F3MC 1W7HA 3DBDA 4J98A 1Q5KA 1OKVA 4D9TA 5TR6A 3UODA 2RFDA 5HNIX 1G3NA 3DB6A 2V7AA 5EI2A 5IEVA 4FNWA 3M42A 4GK2A 2WO6A 1LEZA 3FY0A 3V51A 4Z7GA 2R3QA 3BHHA 2R3MA 1QPJA 3EKNA 4H1MA 1M14A 2VTRA 3IW8A 3F3ZA 2CGXA 3FQHA 4MQ1A 4RBLA 4CFMA 1SNXA 4G2FA 3F5GA 4BDKA 3ODYX 1Y91A 4AA5A 4JI9A 5BVKA 5FEDA 1YWNA 4HOKA 1URWA 3DCVA 2O8YA 2JDVA 1YDSE 4GK4A 5KMOA 5HO7A 4ZZMA 1XWSA 3SD0A 1MRUA 2C6KA 2VZ6A 5DPVA 4IX3A 3RPVA 5HTBA 4Y8DA 3ODZX 3OWJA 1ZOEA 4BDFA 3GOKA 4NKAA 5HE3A 2ZV8A 2PE0A 3G0FA 5AX9A 3NIEA 4KAOA 4JQ8A 3NUPA 1YXUA 4FSNA 3DJ7A 3SQQA 3GI3A 3U51A 5HU9A 4NJ3A 4F7LA 1IRKA 4LUDA 4MF0A 4MXCA 3MTLA 3P7AA 3C5UA 4JJRA 4I24A 4C2WA 2VWZA 5ANOA 4MXXA 4IXPA 3A7FA 4WD5A 1ZY5A 5LWNA 4KRDA 5GHVA 2DWBA 2PTKA 3MFUA 5BMSA 3QF9A 4RWIA 4ZEGA 1R1WA 2HELA 3CKWA 2RF9A 3KRJA 2UUEA 4AZWA 1OMWA 3O96A 3KULB 4JS8A 3BHVA 3D4QA 3P9JA 4YZMA 4D2VA 5I9UA 1V0PA 1Y6AA 4MXOA 4WG4A 5H8GA 3VUMA 1MUOA 4AGWA 5I9YA 1U4DA 5EYMA 3OS3A 2W0JA 3K3JA 4GIIA 1CSNA 2X7GA 1OL7A 5CSXA 2R3PA 3TNIA 4E4MA 4I93A 4AT4A 2PZ5A 4M0ZA 1JAMA 4ZTLA 5CXHA 3TTJA 3W2SA 1WBTA 4KIPA 4NCTC 1OZ1A 2EXMA 1R39A 1H1SA 2W9ZB 4M12A 2EU9A 3FPQA 1MP8A 4DAWA 2JIUA 3OCSA 5KO1A 3CE3A 1KE9A 3WYXA 3QZGA 3RHKA 3KMUA 3TXOA 4EH8A 3P08A 1AQ1A 4L6QA 2UVYA 1CDKA 3QYWA 4K1BA 2GNIA 3ZUUA 5FBOA 4EWHA 4DGGA 4BCQA 3F61A 4CZUA 3DBFA 4FV8A 5LVNA 5BUEA 4J99A 3MY1A 4FBXA 4PL4A 4E93A 3RK7A 1ZZ2A 1O6KA 2XKEA 1YHSA 3ZMMA 2XNBA 4TL0A 5AAEA 2V5QA 2C69A 3F7WA 4JIKA 4YC8A 4DINA 5AEPA 2WB8A 3LJ1A 3IS5A 5ETIA 4FL1A 3VBYA 3RWPA 4HJOA 3O50A 4E7WA 4L3LA 3O51A 2YM7A 3LM5A 4W4YA 3ZDUA 1YOMA 4UMQA 4X3FA 4JG8A 5A14A 3CP9A 1L3RE 4XUFA 4OT6A 4RFYA 4ANQA 3P23A 4C4IA 3PG3A 3EFLA 3PIXA 4FKWA 3DLSA 2X4FA 4MK0A 4S34A 3SW4A 2YJRA 3TJCA 4D0XA 2VO0A 5CT7A 1KV2A 4NIFB 3UYSA 3PG1A 4JXFA 1OKYA 2Z60A 4HGEA 3V5WA 5CF5A 5HIDA 2ZDUA 5ANGA 3GQIA 5KMMA 4BYJA 2P2IA 2XS0A 4FSMA 3QALE 3RAKA 3CGOA 3O8UA 5AUUA 1XH7A 5C8NA 3JS2A 3UOHA 4B8MA 4GV1A 3FKNA 3HMMA 3RP9A 5K0KA 4FKVA 4CTBA 5HBJA 2YLFA 3DNDA 5F94A 5J1VA 2XNPA 2BRHA 4NFNA 4UZHA 5C01A 4HCUA 4EI4A 2J0KA 2GHMA 4C58A 3GEQA 3O23A 4D0WA 4GG5A 2VTIA 3VNTA 5IF1A 3TKIA 3EFKA 2GNFA 2ACXA 4L44A 4QD6A 3ZDIA 3VUHA 4P5QA 4YBKA 3RAHA 3ZFMA 3BYMA 3D5UA 1ZYLA 3LQ5A 1JKKA 3NNUA 4V0GA 4O1PA 3ZRMA 5I9WA 1UNHA 1WVWA 2WIHA 1WBSA 4IADA 3AGMA 4IB5A 2I0HA 4L53A 5HO6A 5IA1A 5CY3A 4U8ZA 3BU6A 4AX8A 1UU9A 3NYNA 4KIOA 3F3TA 2VO3A 4AOIA 5L3AA 2R3IA 3E8EA 1OITA 3FLSA 4F99A 2YFXA 3OY3A 3VUGA 3G9LX 4D4VA 3PRIA 5IDNA 2W5BA 1V0OA 3Q9ZA 1M2QA 2YIQA 5KX8A 5CU6A 4RVLA 4BFMA 4QTAA 3CJFA 1R78A 5EH0A 5CANA 3WARA 1YWRA 3UOLA 3ZO3A 3BHTA 4HVDA 4G17A 3WIGA 4FV1A 4WBBB 4DHFA 1BL6A 3VAPA 2PVLA 1VYZA 5AV2A 3THBA 1M7NA 3AD4A 4NWMA 3UMWA 4L45A 3W2QA 4ACCA 4H36A 2BHHA 2V55A 4CMOA 5HORA 3U8WA 3OUKA 4DEAA 3MFSA 2V0DA 1OL2A 3OY1A 4LM5A 5AUWA 5HI2A 3MW1A 2UZUE 4FV5A 3DB8A 5AP1A 4C4JA 3DAKA 3KXHA 5JFXA 3VBTA 4AACA 1Q4LA 3LFCA 4M8TA 4OTQA 3BHYA 4BIBA 1PW2A 2QU5A 3A4PA 4W4VA 4FTUA 4M67A 2J2IB 3HMOA 5LVPA 1NVSA 4LRJA 3ACKA 2XUUA 3KF7A 4PQNA 3FMHA 3TIYA 2Z2WA 1OL5A 4AUAA 3OT8A 1Q8YA 5CU3A 4I1ZA 3LXLA 4AOJA 4K8AA 5I5ZA 3BWFA 5JMSA 1YVJA 4O0TA 2CCIA 3KXXA 5JFVA 3RJCA 3VBVA 4KA3A 4O22A 3QHWA 3WBLA 2WMRA 3IDCA 4E4XA 4RX7A 1OPJA 2B9FA 2J7TA 3BLRA 4U42A 4EOQA 4PPAA 4JOAA 3DKFA 5AP4A 3PXZA 3VUTA 4GVJA 3UPXA 2VTSA 2QC6A 4FV0A 4CKRA 5AAFA 4G31A 4DEIA 3IOKA 5FQDC 4C0TA 3HV4A 2VX3A 5JGDA 1SVGA 5HNBA 3C50A 4I6BA 4IB3A 3RVGA 4A07A 4U43A 4NKSA 4FICA 3JXWA 1NA7A 3FXZA 1JOWB 3WZEA 3OWPA 3CIKA 4JRVA 3H9FA 2XM8A 3FZRA 4J53A 3S1HA 4A9RA 2VNYA 5D7VA 1XJDA 3ALOA 4ZTQA 3R7OA 1JNKA 3MN3A 3V8TA 3R01A 4QQ5A 5A4EA 2QODA 1JLUE 3U4WA 3DDPA 3R7GA 3FI4A 4D58A 2ZDTA 5EKNA 3DQWA 2ITNA 3OZ6A 1PXIA 5F1ZA 4G5JA 3VBWA 3FMJA 4RWLA 4YTCA 2ITQA 2O0UA 4LRMA 4RJ5A 2YWPA 3G33A 1V0BA 4FL2A 3O71A 4QP4A 2XEYA 5I3OA 3H3CA 4O96A 3ZM4A 3ZSIA 4AWIA 2FB8A 4PNKA 4S32A 4M69B 2ZYBA 5LVOA 4TYGA 3R9DA 2G2HA 2B7AA 4RZVA 3F3VA 5HBEA 3I7CA 4YTHA 2YIRA 3B8RA 4RWJA 4I6FA 4X2KA 5IISA 3HKOA 2JDSA 2WMUA 3LM0A 2JIVA 2VWBA 1BUHA 3PIYA 5BUJA 1U54B 1CKJA 2BALA 2X8DA 1H1RA 3QFVA 3CPBA 5D12A 2HENA 2YJSA 4BDCA 2PMOX 2XNNA 4NW6A 3HRBA 4RVMA 5CQUA 2PE1A 1QPCA 1ZYCA 3D9VA 5CZHA 4MXYA 4IHPA 4O6EA 5BVWA 3ULZA 4BCNA 3P0MA 3GCQA 3C4FA 4FV6A 2WEIA 4D2WA 3S0OA 2R2PA 3CD8A 3EZRA 5ETCA 2C3KA 4FNZA 4BZDA 3PFQA 4C33A 1R0EA 3PXYA 4QP9A 2W1DA 4R3PA 4F6SA 5L4QA 3OD6X 4OBPA 3R9OA 2C3JA 4P90A 1OECA 2VN9A 4YPDA 4YSJA 3Q4ZA 4IAIA 3SA0A 2BZIB 4MNEB 2JAVA 1PXLA 4U6RA 5D41A 2OIDA 3VW6A 3HA8A 4AZSA 3OVVA 4O38A 3AXWA 3QXPA 4Y73A 3L9NA 3PJ1A 2C6IA 2XVDA 2YACA 4WSQA 4DEGA 2Y4IB 5JT2A 1Q8TA 2H34A 1ZYDA 3LCTA 4UX9A 5D9HA 4YMJA 3RK9A 4D55A 4HVGA 1U5RA 4IDVA 5AP7A 4V01A 1WFCA 3P4KA 3PZEA 1VJYA 3KN5A 4FTOA 4OTWA 4EQUA 1IG1A 4FKJA 3VBXA 5BVFA 3QRJA 3RAWA 5HICA 4BDDA 4C3FA 2W5AA 1R3CA 4E4LA 4XOZA 1NY3A 4BCMA 4EH2A 3DZOA 5C27A 1W83A 2WMSA 4FTRA 5AR8A 5EOLA 4ACHA 3QRIA 4D4SA 5IH6A 4L8MA 4XG6A 5IA5A 2DQ7X 4HYSA 5IUIA 3EL8A 4GH2A 3TUCA 2X39A 2AYPA 3MYGA 2C47A 5C9CA 2O64A 5CEMA 2EXEA 2E9VA 5EOBA 4CRLA 2ONLA 3CS9A 2QQ7A 1O6YA 3FAAA 5CF4A 3NX8A 3KQ7A 3OCBA 4HVHA 2OG8A 2OZOA 1KV1A 3AD6A 3C0IA 3GFEA 5IZFA 4F09A 4FIJA 2X2KA 4J8MA 3I6WA 3ZONA 4X0MA 3NGAA 3R30A 3VS1A 4AGUA 5FEQA 4G6NA 4EK4A 2IZTA 3FMNA 4LGHA 4CMUA 2X6EA 3FMEA 4XG9A 2XRUA 4L68A 4MD7E 1ZYSA 3R7VA 4BC6A 4UMPA 4IC8A 2QOQA 5L6OA 2XA4A 5IA3A 3ITZA 2PK9A 4UMUA 1FVTA 4IWQA 4MXAA 5KMNA 3WF8A 3QCSA 3V3VA 4CFNA 3R1SA 1M7QA 5I4NA 3CTHA 3HUBA 2QONA 3VN9A 4X6RA 3UGCA 1B39A 1PXKA 3EQPA 3R6XA 4A7CA 2VD5A 3OROA 4C8BA 3MIAA 2OFVA 5HLPA 5HU3A 4B99A 3MY0A 4BZNA 5AMNA 4ASXA 3V5TA 2FSTX 3Q6UA 2VWUA 3D0EA 5BVDA 3SAYA 4CQEA 4OTGA 3I0OA 2YAKA 3JYAA 4X6QC 2Y6OA 3K5VA 3NYVA 2P55A 2YN8A 2GS6A 2OW3A 3P86A 2OU7A 3R7EA 3RKBA 5F9EA 1B38A 2C6EA 2YCSA 3EQGA 1J1CA 3A7GA 4FG9A 2J5EA 4FTKA 4N4SA 5ANIA 3BV3A 5KKRB 4E6QA 1GIIA 2ZOQA 4DLIA 2YM3A 3DU8A 4H1JA 3FSFA 4C61A 2OFUA 3EWHA 4FSRA 1OPKA 2VO7A 2JBPA 2W5HA 3FUPA 5E8TA 5EG3A 4GG7A 3RCDA 4ZZNA 4UMRA 4BGGA 2QR7A 2Y0AA 1W98A 5AAGA 3JPVA 2GTNA 2GFSA 5KHXA 3C1XA 1PXPA 1OVEA 3KCKA 4EZ7A 4KIKB 4KBAA 5L8JA 3FLQA 4GUBA 2W1GA 2FSOX 2HCKA 2YM4A 4KBKA 4RFZA 3LXKA 4I5MA 4IAZA 3EHAA 3FQEA 4JDHA 3PP0A 3C0GA 4FSYA 3ZEPA 4E3CA 4F9BA 2UW3A 1OI9A 4KRCA 3HV5A 1PJKA 4UALA 2BCJA 4NM3A 1JSUA 1GIJA 2CPKE 2XIZA 3R2YA 3KF4A 4C62A 3U87A 4WNKA 1Q97A 3RPYA 5M4FA 1CM8A 3QX4A 3S3IA 4FX3A 3R2BA 4Z16A 1M52A 2ZM3A 2BDJA 5CEQA 4EOLA 3Q52A 3MVJA 1JVPP 1ZMWA 3NYXA 3UC3A 4YZDA 3RGFA 3UO6A 5AR4A 4FTLA 3MIYA 2YEXA 4BGHA 4BDHA 2I6LA 1YDTE 4ZTSA 3BEGA 2PVMA 2VGOA 3VO3A 4XBRA 3V6SA 1Q8UA 3DV3A 4QMUA 3EIDA 5HG5A 4PX6A 3RWQA 1LPUA 1YQJA 2V62A 2WQNA 3PA4A 4XG2A 4AZEA 2WKMA 2VUWA 4I20A 3QBNA 1M2RA 2ZB1A 5C26A 3G90X 3R8LA 1FINA 1UWHA 5IKWA 5DR9A 3BYOA 4YLJA 5DVRA 4EL9A 4K9YA 3F9NA 4UWYA 3QU0A 2BRGA 4AAAA 3UE4A 3ORKA 4EQCA 5TF9A 4LL0A 4RA5A 3KULA 2EB2A 3KXGA 2ITWA 3NUUA 3TNQB 5M4CA 4BTMA 5IG1A 4CFFA 2RG6A 1SMHA 2XYNA 3DZQA 4WT6A 3NUYA 5H8EA 2WQEA 3TZ9A 2C3LA 3BCEA 3ZFYA 2E9OA 4BI1A 2C68A 3LQ8A 4HGSA 1GZNA 2UW4A 3V5LA 2IW9A 5CVGA 3ACJA 4USDA 2WAJA 4W4XA 4D5KA 3NLBA 3T3VA 4FC0A 4YJOA 3MWUA 2PMLX 4OTIA 4CCUA 3R9NA 3QCQA 4L67A 4XHKB 5CAQA 4L43A 4RGJA 5IA0A 2EB3A 1JQHA 4GL9A 3HV7A 1PYEA 3PVUA 2XB7A 4X2JA 4Z55A 3MBLA 5CF6A 1IASA 2YDJA 3DK6A 3H10A 4ANSA 5A9UA 4RZWA 3R63A 3QKLA 3BX5A 2GNJA 3K3IA 4APPA 4QMQA 3QQKA 4GJ2A 3MFTA 5D1JA 1SZMA 4NT4A 3VS3A 3JY0A 4EK5A 2DUVA 1GNGA 4YSMA 5DNRA 4BDJA 3NNWA 2SRCA 5BVEA 4MAOA 1UU8A 2DS1A 3KRXA 3ZLSA 5AV3A 4MX9A 4J96A 4RJ3A 2W1CA 4A9SA 2HIWA 2WOUA 3AGLA 3U4UA 4BKYA 3OT3A 3VS2A 2XZSA 4NW5A 5ANDA 3QZIA 4MQ2A 4XV1A 3DT1A 4AZTA 2WTDA 2X7OA 4FNYA 3FPMA 4KKHA 4I5HA 4MBJA 4O0XA 5AX3A 2H96A 4EYJA 1F0QA 2VRXA 4YTFA 3MVLA 3P79A 2GFCA 2UZNA 2F2UA 4DC2A 4R1VA 4PMSA 3T9TA 5EKOA 4FEQA 2XH5A 4IQ6A 3JY9A 3QLFA 3TV6A 3FZPA 4D1SA 4EOSA 5JRSA 1W82A 5CF8A 5CEPA 5IDPA 4FI1A 4RC3A 2OXDA 2WU7A 4YBJA 3V8SA 4ZSEA 3E62A 4XG7A 2YITA 4ZSAA 5T68A 2HK5A 2J0JA 3QHRA 4FK6A 4TPTA 5E8YA 3CEKA 5EDPA 2R3RA 4QMVA 5CSHA 5FM3A 4FOCA 1ATPE 4ERKA 3F2AA 2A1AB 3O2MA 4FA2A 4MTAA 5KBRA 2JAMA 2PSQA 4OBOA 3LFNA 2CGVA 4XP2A 1NVRA 3LAUA 3RNIA 1H26A 2WPAA 3DNEA 4EH4A 4M3QA 2VTPA 4PPBA 2HXLA 4B0GA 1QMZA 3MFRA 2WZJA 5CEOA 1YHVA 3UNZA 5J95A 2IZSA 5CENA 4QP3A 5E8SA 4QMXA 3ZH8A 2PZIA 2X4ZA 2JKKA 3S95A 4I21A 2Y8OA 3ZYAA 4EUTA 2X2LA 3SLSA 3C51A 1KWPA 1W8CA 3PRFA 4CCBA 3G0EA 3A99A 3FKOA 1P4OA 4FTTA 4J7BA 4H39A 4WOVA 3VS5A 4RIWA 1UA2A 4IH8A 2OJ9A 4IJ9A 3HV6A 4ITHA 4UYAA 4W8EA 2ZV2A 4XBUA 3S4QA 3R7UA 4FZAB 4IX4A 5EHLA 4RLLA 3PP1A 2H8HA 3BI6A 3ERKA 3HDNA 3ALNA 4OGRA 4M15A 4AFJA 4BDAA 4BCFA 3MA6A 2WOTA 4RSSA 4K6ZA 5GJFA 5LCJA 2IJMA 4F9YA 2W7XA 4I6QA 1ZMVA 2RGPA 3QQUA 4NTTA 4FKRA 1UNLA 3BBWA 4E1ZA 4LV5A 2B9HA 1OIYA 2YM5A 4ANNA 5JRQA 3U9CA 4KS8A 3TN8A 2VTJA 2B9IA 4HGTA 2OJGA 3HRFA 4MF1A 1QPEA 3HEGA 1IA8A 4RIXB 4I92A 5IMXA 3GXLA 4QMNA 3EFWA 3LE6A 4H3BA 4RVTA 2Z7QA 2RFEA 3NCGA 3W2OA 3LFDA 4F7JA 3UVQA 4O1OA 3G6GA 4BIEA 2O65A 2OWBA 4JG6A 2X7FA 3DOGA 3BBTB 4XV3A 5EM5A 5FRIA 1H1QA 4NK9A 3RI1A 3DAEA 3ZUTA 4ZZOA 2GCDA 1BI7A 4G3FA 3V6RA 1YI6A 2VGPA 2CCHA 4TWPA 5HO8A 4IW0A 1G5SA 3PY1A 1K3AA 2WIPA 1FQ1B 1ZOGA 2PUUA 2R3FA 4F64A 2NPQA 1PXNA 2GQGA 3GC9A 1WBVA 4MD8E 5A3XA 4HVIA 4JDJA 1KE7A 1HCKA 3TT0A 1YW2A 2EWAA 4FSTA 3ZU7A 5GZ8A 4NCTA 3NEWA 3AT4A 4LMUA 2F9GA 3LFSA 1KE6A 3EN6A 4DN5A 4EWQA 3UMXA 4FKTA 2OXYA 4EH9A 4JIAA 4CKJA 4RJ7A 5JZNA 5LMKC 1STCE 1Y8GA 3NYOA 4C4GA 4EZ5A 4DG3E 4BTJA 3I5NA 1TVOA 2OI4X 4S33A 4WO5A 4PP9A 4F4PA 4AA0A 4TWOA 1PMEA 2QD9A 3D83A 3HNGA 1Y8YA 2PVJA 3L8SA 3CY2A 3WILA 3VF8A 3FMDA 5F4NA 4YHTA 3CGFA 3QL8A 2W4KA 4RIYB 4JQEA 3S00A 4ENYA 4FVQA 3FJQE 2I0YA 5K5NA 3OCTA 5CYIA 1WBNA 3R73A 4UY9A 2J6MA 3NUSA 3PXFA 3UQCA 3CY3A 3NW7A 4D4YA 4J97A 1PXMA 4CLIA 5FTQA 2R0IA 4YP8A 2J0IA 4LRKA 5L8LA 5DEWA 5AR3A 2X9FA 4M69A 3L9LA 2HY0A 3MH0A 1M2PA 2X2MA 3SXFA 1H1WA 2OO8X 4FIIA 4E26A 4H3QA 1OPLA 3FZTA 4UXQA 5HD7A 4HNFA 4QNAA 1KE8A 4YJSA 5CI7A 3FMLA 4PWNA 2XK3A 5CEIA 2F57A 5L2SA 1U54A 3MPMA 2ZM1A 3C4EA 2ITTA 3POOA 3R1YA 3Q96A 2ZV7A 4IACA 4JBPA 4L46A 3U6HA 4DG0E 3R0TA 4FSZA 4BI0A 3QD3A 4HPUE 4QPAA 5DH3A 2WQBA 1EH4A 1ZY4A 4D4RA 3EOCA 4YU2A 4QMLA 2W1FA 5DE2A 1P2AA 3F69A 3LCKA 3MPTA 2OK1A 5LMAA 1UKHA 4ZIMA 4QYHA 5CAOA 1LUFA 4JX3A 2OJIA 2IW6A 4JR3A 5CSVA 3KK9A 1W84A 2X6DA 2R3LA 3ZUVA 3RK5A 2WTWA 1UNGA 3D7TB 4IVAA 4ANOA 1XR1A 4UMTA 4FTNA 4HYIA 1URCA 3R04A 3MTFA 2GS7A 4FT5A 1H00A 3IOPA 1OL6A 3LFBA 4MNEA 2UZOA 1TKIA 3DKCA 4H3PA 4LMNA 5EM7A 5C1QB 5JFSA 3H30A 2QKWB 5B2LA 4O2ZA 4QMOA 4QTDA 4JR7A 3C4ZA 5HTIA 5L8KA 4A06A 4WG3A 1O9UA 3UIBA 1BLXA 2BHEA 3HP5A 5AADA 4EKKA 3U6JA 3CTQA 3FY2A 4FUYA 4ANMA 2QURA 4P7EA 2H6DA 4FKUA 4ITJA 3QCYA 1GJOA 5FEEA 5IUGA 4UV0A 5ICPA 2E9NA 2P33A 3QC9A 2F4JA 2XIXA 4MD9E 4PDOA 5DA3A 4AN9A 4OUCA 5E90A 2BRBA 4HVSA 2BR1A 3VJNA 2WMAA 1JBPE 2IZRA 1H08A 3ORZA 4UZDA 4TYHB 3LOKA 3CJGA 4X3FC 4CFWA 4U45A 1NVQA 3F82A 3KN6A 5CZIA 2NRYA 3DAJA 2NP8A 2OSCA 4BCJA 5HTCA 3LCDA 2JDOA 4FKPA 4L42A 3IECA 3KC3A 3ANQA 4FZDB 4Q5EA 4QQJA 5AM6A 5ETAA 4JDIA 2O63A 4K0YA 1YI3A 5IA2A 4I0SA 4RLKA 3ORMA 4FL3A 1Q99A 4XS2A 5IH4A 5A6OA 3V04A 2GMXA 5DHJA 3PVWA 4FTJA 5FM2A 2OZAB 3ZRKA 2ETRA 2QOLA 3NWWA 3LMGA 3ZZWA 2FUMA 3AT2A 3A2CA 1J91A 4W8DA 5IUHA 4AW0A 1Q62A 5DT3A 4FIEA 4OTFA 3V8WA 5I3RA 1NXKA 2IZUA 2UW7A 3CKXA 1B6CB 4RVKA 1Y6BA 2Y9QA 3QQLA 4PTCA 4LOQA 4KWPA 2BIYA 3TG1A 3DY7A 2VAGA 4DH8A 4XP0A 4QMWA 4EOJA 5B7VA 5JK3A 4J1RA 4U40A 5AUVA 4M68A 3BRBA 2GNLA 3F66A 4U0IA 3R9HA 2WEVA 1TQPA 2C6DA 3KCFA 3MJ2A 4WG5A 1SVHA 4FSWA 2BFXA 4F9WA 4I5CA 4IB0A 4QP2A 2PZPA 4NFMA 3UO4A 4QPMA 3VS6A 1K2PA 4ALWA 4R8QA 4PP7A 3IPHA 3GFWA 5CSPA 2W1HA 2VTLA 3HMIA 4E6CA 2UZLA 1WVXA 3VJOA 2ITZA 3TZ7A 5JGAA 5IEXA 4OAVB 2B54A 4DH1A 1GAGA 2E9PA 4LGGA 3RZBA 5ANJA 4EOMA 3SOCA 5TOZA 1UU7A 4R6VA 2C6TA 4EORA 3QQFA 2WMXA 4F0IA 3UOJA 4S31A 1E9HA 2VV9A 1MQBA 2UW6A 4I4EA 5JZJA 4O0VA 2Z7RA 3A7JA 5HCYA 4D2RA 5IA4A 4CTCA 2FYSA 1T46A 2IW8A 1TQIA 4IVDA 4ACDA 5A4TA 3ZLYA 3TUBA 4L7SA 2YAAA 5DRDA 2W1IA 1XH6A 5M4IA 1WBOA 1I44A 1OGUA 3BYUA 3R21A 4Q9SA 4KIKA 4G5PA 3TACA 4YHFA 4GFOA 4EBWA 5CSWA 4LYNA 3UJGA 4F65A 4UB7A 3AC4A 3VRYA 3QD0A 4MNFA 3IW7A 1DI8A 2J51A 4BTFA 3ZS5A 4L52A 3AT3A 4XX9A 3LFQA 5FWKK 4XG8A 2OGVA 2BMCA 4G3CA 5HKMA 4NM7A 3GU7A 4GU6A 4BCOA 2JD5A 1VYWA 1I09A 3O17A 4X21A 2R3GA 3AOXA 3D14A 4TYJA 3QTZA 5EYDA 3A8XA 2OBJA 1LR4A 3SDJA 2VTTA 4AT5A 5KMIA 3FZOA 3BWJA 3F6XA
chains in the Genus database with same CATH superfamily
1ZMUA 2YZAA 4JBVA 4YGAA 3GCSA 3PYYA 2I0VA 4ZTRA 4ZK5A 4XYFA 5KNJA 1ZZLA 2BRNA 4UYNA 3PPKA 4IZYA 4ZOGA 3E3BX 5KZIA 2C4GA 2ZB0A 2IEWA 3QGWA 2FH9A 3P7BA 5JQ5A 4EYMA 3F88A 2GU8A 5BUIA 3V5JA 3LVPA 3Q60A 3W16A 3LW0A 4EHVA 3EFJA 5CLPA 5EI8A 4ZSJA 1PKGA 4PF4A 3VVHA 2C5YA 3E5AA 3OHTA 4IVBA 1W2FA 4ZLOA 3UNJA 4PV0A 2XJ2A 4MCVA 4ANLA 5HLWA 2ZMCA 3QX2A 4X2GA 3ENHA 5FDPA 3TIZA 5CASA 4RJ6A 4D2TA 3HMPA 4JRNA 4XJ0A 4JDKA 2BAKA 3IONA 2W96B 2XK7A 2PL0A 4BDEA 1IR3A 4YO6A 4M7IA 4DITA 4ASDA 3VBQA 4BCGA 1H0WA 3G9NA 4CLJA 3MB6A 3TKHA 4E20A 4D2SA 4O91A 3BIZA 4NTSA 3GCPA 3WZUA 3A62A 4FV7A 2WMTA 4TW9A 2ETKA 3C4WA 4EUUA 5KMLA 4MBLA 4F1MA 4M97A 3K2LA 5FP5A 3CPCA 5HD4A 3GOPA 4CVAA 3Q4CA 4W4WA 1GZ8A 3QD4A 2QOKA 3AMAA 4LG4A 2CGWA 2Y7JA 2VWYA 4G3DA 4LOPA 5FP6A 2J90A 3QRUA 4TXCA 3OUNB 3QRKA 5M4UA 4FT3A 1P14A 3DFAA 4O4EA 2XRWA 2W05A 5DT4A 4WUAA 3SRVB 4ZY5A 4WNMA 5F95A 4GEOA 4R3CA 4QO9A 3H9RA 3NNXA 1H25A 3NW6A 3I4BA 4QPSA 1BYGA 5GJGA 4QQCA 3IKAA 4IWDA 1DM2A 3QXOA 5FLFA 4AN3A 2ZMDA 4NM0A 1XH9A 1JSVA 3TCPA 2WTJA 4BCHA 4TWCA 4NM5A 1JSTA 5M53A 4CV9A 3GUBA 4WBOA 4YJRA 4EZ3A 1UWJA 1JPAA 2O3PA 5EW8A 4EEVA 1YKRA 1Q8WA 3IW5A 3RAIA 3VRZA 4MXZA 5LARA 2B52A 3R02A 2ITVA 4G3EA 2X8EA 3SHEA 2A19B 4GYIA 3VS7A 5KZ0A 5J1WA 3E7OA 4L3JA 2OF4A 4QMYA 5KCVA 4TZRA 3ZO4A 1GOLA 3OF0A 5E8ZA 5KBQA 3II5A 3OXTA 5HVKA 2KTYA 3D5WA 2ITOA 2YM8A 3QKKA 3CTJA 3AC8A 3E64A 2C5OA 4L7FA 2H9VA 4QP1A 5DG5A 3B2TA 2PVRA 3ZZEA 4Y72A 2AUHA 3QTSA 3PPZA 5JQ8A 1YXXA 3PJ3A 3PA5A 4HNIA 4O0SA 4ZTMA 2F7EE 3BLQA 3FWQA 4R3RA 3ZCLA 5EYKA 3KVXA 5DOSA 4I6HA 4YC6A 3ZOSA 4F63A 5KUPA 4U80A 4X3JA 1MQ4A 4IEBA 3VC4A 3BE2A 4YTIA 3FXXA 3R7IA 1H0VA 1P5EA 5FXQA 4FZ6A 3OTUA 3EYHA 3Q9WA 3EQCA 3DPKA 4DFXE 3H0ZA 2PHKA 4EONA 1PYXA 2C1BA 2JFLA 3HVCA 1YXTA 4WIHA 4FVPA 2XBAA 3FKLA 1OKWA 4M0YA 5HE2A 3DBCA 1XKKA 4JQ7A 4Z3VA 4A9UA 3BE9A 3F5XA 3MVHA 5J5SA 4JAIA 4ZXTA 4BWPA 4EK3A 3SV0A 4Z7HA 4OR5A 3L8XA 3CC6A 4G6OA 4QYFA 4CSVA 4G9CA 2X9EA 2BDWA 3NW5A 4C4FA 3SXSA 4OBQA 2F7XE 4U97A 5CU0A 1FVRA 1REJA 2QCSA 3WE4A 4FOBA 4FT9A 2OH4A 2BROA 3GBZA 3R22A 3OBGA 3MJ1A 4LOOA 3ORXA 4F0FA 2AC3A 3BU3A 3ORPA 4C7TA 4F1TA 3FLZA 4O0RA 2W06A 3KU2A 4RIXA 4YR8A 1O6LA 3BU5A 4FTQA 3W32A 5AP0A 4FKGA 2BUJA 2W9FB 2QOFA 2Z7LA 3RM6A 3UQGA 4R7HA 3WZJA 2QI8A 3I79A 3PUPA 1FGIA 3DJ6A 4XLVA 4ID7A 2ETMA 2ZVAA 3IQ7A 4C4EA 2B9JA 3UG1A 3DK7A 3QTIA 4EH6A 5HX6A 1XQZA 2PE2A 2QHNA 2VX0A 1H4LA 4I5PA 4I41A 4QP8A 4D2PA 4OAUC 3SC1A 3CQWA 4RRVA 4CNHA 4W9WA 1H01A 3BGZA 4AFEA 4PNIA 4BHZA 3LXNA 4TYIA 3ZEWA 3Q4TA 3ENMA 3VS4A 2VTHA 4J8NA 3TZMA 2YIXA 3GB2A 4KABA 2RG5A 4NUSA 4IAAA 2VNWA 2UV2A 4PL3A 3SW7A 2OJJA 2YCFA 3W8LA 5AIRA 1DAYA 5HOAA 4EHGA 3SKCA 4IE9A 4AGDA 3EQHA 3WE8A 3IG7A 1PHKA 1YOJA 2W99B 4DH3A 5LMBA 2RFSA 2CHLA 2UW5A 2XJ1A 4BL1A 2R4BA 3DKGA 3JVRA 4DFZE 5J9ZA 2WTCA 4WRGA 4RIYA 4U9AA 4CZYB 3ZXZA 5DGZA 4HYHA 2FVDA 4ZJJA 2CSNA 4RC2A 3K54A 4C36A 2A27A 3E8CA 2FO0A 1KOAA 3FBVA 3QTRA 3UIMA 3I6UA 3CD3A 5DN3A 4ASEA 1RJBA 2XNOA 4XP3A 3QLGA 2GNHA 1A06A 4ZSGA 3P78A 4FV9A 5H8BA 2ZJWA 4FSUA 4FKOA 5H3QA 2F49A 5LVLA 2VTOA 3L8VA 3COKA 3QTWA 2I1MA 3WZKA 2C5NA 3PVGA 3MI9A 4AW5A 2UW9A 4QYYA 2W1ZA 1VR2A 2CGUA 3OEZA 4GJ3A 4RC4A 4CYJA 4PMMA 4JBQA 3VQHA 1OUYA 5IH5A 5FDXA 4EC8A 3IK3A 5CNOA 1PXJA 2GHGA 4BGQA 4FR4A 5HHWA 1JKSA 2R3OA 2W1EA 3DGKA 2YCRA 2GDOA 1ZAOA 3D2KA 4GW8A 4I0RA 4I23A 4JG7A 1U59A 2OKRA 4B8LA 3OG7A 1REKA 2J4ZA 2PVHA 4GT4A 4A4OA 5IU2A 1YXVA 2OF2A 3FL5A 3MH3A 3AC5A 4WSYA 4ZLYA 1QCFA 1UV5A 4BHNA 2FGIA 3W2CA 5BNJA 4AG8A 1BI8A 3OC1A 4LFIA 4ACGA 3LXPA 5TKDA 1TZDA 4KKGA 1J3HA 4P4CA 5HG7A 3RPSA 4U3ZA 3R1QA 3E7VA 4BZOA 1Z5MA 4F08A 4YJVA 5CAVA 1Y57A 2OJFE 5DI1A 5CWZA 3D7TA 3FV8A 4NIFA 5TT7A 5AV4A 3MB7A 1RDQE 1P4FA 3HUCA 2LAVA 2HAKA 1UKIA 3D7ZA 3LCOA 3OOGA 4Y46A 4O2PA 5BX0A 4CFXA 4BIDA 5EK7A 2HY81 1ERKA 2VU3A 4OT5A 4F7NA 3HECA 4U44A 5L2IA 3I0QA 3TEIA 3HRCA 4O21A 3F7ZA 2R0UA 2XEZA 4D1XA 2E2BA 2HZIA 3SXRA 5JFWA 4AQCA 3QWKA 3E8NA 4UN0C 5M57A 5KE0A 1WBPA 1BKXA 1Q8ZA 2ESMA 4F9AA 5CT0A 4R7IA 4UEUA 3V5QA 2B1PA 3NDMA 3UP2A 3L8PA 4J95A 3UVRA 4PPCA 4BDIA 4AZVA 3VW8A 1PKDA 5M55A 4BKZA 4M66A 3BGQA 2P0CA 4A9YA 5GZ9A 2WHBA 4CV8A 3QQHA 3RM7A 5K9IA 3SVVA 3PPJA 4E5WA 3I7BA 3VQUA 3ANRA 5BYZA 3VS0A 4ZTNA 1YOLA 1U46A 2Y4PA 2JITA 3OXZA 3TKUA 2UZDA 4K18A 4O0UA 3Q5IA 4PMPA 1RW8A 2Z8CA 3FHIA 4RX9A 3VF9A 1LP4A 3WI6A 4WNPA 3COHA 3R7YA 2J9MA 3KB7A 1AGWA 2OZAA 3NRMA 5CX9A 4BBMA 5AUYA 2XCKA 2E9UA 2ITUA 4E6DA 1CKPA 3BKBA 3FSKA 5FG8A 4DH7A 1WVYA 2VTMA 1FVVA 2CDZA 5EW3A 4ALVA 2Y6MA 3NR9A 3EB0A 2A2AA 3P5KA 4S2ZA 2YCQA 4X2FA 3MH2A 3EN9A 2JFMA 4BKJA 2QG5A 5EI6A 1YWVA 1PF8A 4MYGA 2PMIA 4EOIA 4TN6A 4KINA 4Y5QA 1U5QA 1SYKA 5AR2A 4HW7A 4UBAA 2G15A 3ZFXA 4QTCA 5HG9A 5EM8A 4XG3A 5E8VA 3DQXA 3QRTA 3KGAA 3ZC6A 4EQMA 2QU6A 5HZNA 4ZSLA 3SX9A 4C3RA 2CKEA 4P5ZA 4BYIA 5L2QA 3FI2A 2JBOA 4QMPA 2OICA 5LMKA 3F3UA 5EHOA 3OWLA 4U41A 1BMKA 2XYUA 4O6LA 1IEPA 5FXRA 5LQFA 2R7BA 5J5TA 3CQUA 1UU3A 3CBLA 4K33A 4BBEA 2GSFA 3FLWA 3Q6WA 3ROYA 3CQEA 4YC3A 5JEBA 4BVUA 3GCVA 3L1SA 5CU2A 4FTMA 4B4LA 4DGNA 4ZJVA 4G3GA 4XOYA 3UC4A 3ZRLA 2YM6A 3RZFA 5DR6A 4C2VA 3EQDA 3UDBA 5LXMA 4BN1A 4I3ZA 4QP6A 4U81A 1ZARA 3H0YA 5E8WA 5I9ZA 1VEBA 3ORIA 2IO6A 5HGIA 4XLIA 5C03A 3ZSHA 1CTPE 3GVUA 3QWJA 3JUHA 2YERA 4DCEA 4F0GA 3FDNA 2R5TA 1ZXEA 5D7AA 4BCKA 4JL9A 3FZ1A 2G9XA 3A61A 4MKCA 4IANA 2W4OA 2XCHA 4AXAA 3PXQA 3DTCA 3OBJA 4RIOA 3Q9YA 2UVXA 4GUEA 4R1YA 2XK6A 3PSCA 1J1BA 3FQSA 3PE1A 3QTQA 3ZO2A 3CR0A 3BQCA 3M2WA 1HOWA 3R1NA 3WF6A 3GCUA 3R83A 4BWXA 4ENXA 4IZAA 4AOTA 1YDRE 2JC6A 4XEYA 3GNIB 3HP2A 5CI6A 5AR7A 1OUKA 4YLLA 4AN2A 4BRXA 3HYHA 3D5VA 4ARKA 1ZLTA 4A4LA 2RIOA 4AE9A 2JKMA 4WRSA 2JGZA 2BZHB 3EMGA 3LFAA 3KVWA 3BV2A 3L9PA 5CEKA 4BDBA 4DYMA 3U6IA 4TRLA 3A4OX 3OTVA 5L6PA 3DA6A 2WD1A 2WFYA 3FYKX 4U7ZA 2R3NA 3R8VA 5H9BA 4DEEA 2G2FA 2J50A 4RWKA 3EN7A 4KS7A 2BZKB 4G34A 4BCIA 5HE1A 2OIBA 1UVRA 1W0XC 2HZ4A 4EOPA 4RJ4A 2YDKA 5HE0A 4EJNA 4KKEA 3WIKA 2YIYA 3EJ1A 1XO2B 3RINA 3KXZA 4ITIA 5E92A 4WNOA 3NUNA 4FYNA 4KBCA 4R5SA 3IW4A 2RSVA 5K3YA 2FA2A 4MEDA 1PMUA 3G2FA 5I9XA 4FKQA 4GFMA 3QTUA 4JLCA 3ZLWA 3UG2A 2QNJA 3ZSGA 4DEHA 5J9YA 3DBEA 4FVRA 1WAKA 3NPCA 4NZWB 3ORLA 1WMKA 3AC3A 5AP6A 3C4CA 3EH9A 4K77A 1H8FA 1QPDA 3QQGA 3KRWA 3RHXA 4KB8A 5JH6A 4DEDA 3WYYA 1K9AA 2HYYA 5EDRA 4CFVA 2HXQA 4YO4A 3KKVA 4ZLZA 2CLXA 1Z9XA 4YJNA 2R9SA 4U5JA 4BCPA 3E88A 4GVAA 4IM3A 3PWDA 1OM1A 5L6WL 3FHRA 4RJ8A 4U3YA 3AD5A 1XH4A 2CJMA 5EFQA 2XIKA 5GNKA 3R8PA 3LFEA 3VUKA 5BPYA 3KRRA 4UWBA 3RCJA 2QLQA 2ITPA 3MH1A 4C4HA 5AUZA 2EXCX 4QMZA 2WMQA 4YJUA 4QTEA 5TE0A 3HV3A 1S9JA 3AC2A 3LHJA 4MHAA 3AMBA 3BZ3A 3MSSA 4YZ9A 5KMKA 5M51A 3NSZA 1FMKA 4IWPA 4IWOA 3SRVA 2WMVA 4EBVA 5J9LA 1TQMA 4G9RA 5HIEA 5CTPA 5CQWA 5CAUA 3DFCB 3HA6A 1Z57A 3HX4A 5I9VA 2XJ0A 2JKOA 2XIRA 4KIQA 5A4CA 2IVSA 2PVFA 3O7LB 5BVNA 4J71A 2OIQA 1SNUA 3FMKA 4XRJA 4PY1A 2B55A 3WF9A 4IJPA 4UWCA 3GT8A 3VHEA 3IGOA 2X81A 5C8KA 4APCA 2WTVA 4CFUA 4XMOA 3DLZA 4XCUA 4CZTA 5DBXA 3E93A 2QVSE 4QP7A 5BQ0A 1BL7A 3IDBA 5HBHA 3EQFA 3HDMA 2GHLA 3S2PA 4DLJA 4C35A 1XH8A 3MA3A 4GYGA 3IGGA 2FSLX 4XH6A 4YJTA 5AIKA 4IFCA 3RNYA 3A7IA 3DDQA 4RIWB 3ET7A 4L00A 4AU8A 2Y4IC 2AC5A 2QOBA 4PTGA 3FE3A 2UZTA 4OLIA 5ITAA 3LZBA 3W1FA 3KL8A 4DBNA 4AW2A 4FKIA 4L01A 1S9IA 1KSWA 3EZVA 4IC7A 3PTGA 5JKGA 4IX5A 2YHVA 3B2WA 3PJ2A 4D1ZA 3EN5A 1M17A 1OKZA 3IDPA 3F5PA 3TTIA 2XK9A 2BDFA 2R64A 2EVAA 4NJDA 4Y95A 5LVMA 4UXLA 4F6UA 2WMWA 5BYYA 3IO7A 4TNBA 1PMVA 1Q3DA 1SM2A 1AD5A 4MH7A 4WA9A 2P4IA 4GRBA 3LJ2A 4E4NA 5K5XA 2G01A 5AWMA 5ANKA 2A4LA 2F2CB 3L9MA 3F2NA 4K11A 3EN4A 3N51A 4DG2E 4EOKA 2VWXA 3UP7A 5IMEA 5A4QA 4KSQA 2C6LA 4LUEA 5E91A 4CQGA 3LJ0A 3PSDA 4ZY6A 3R8MA 2VTQA 4Z9LA 2WMBA 2RFNA 5M44A 4EC9A 3PY3A 4QMSA 4W9XA 3ZXTA 5IPJA 3UO5A 2X8IA 4NEUA 4WUNA 4Y85A 4M84A 2HZNA 5HESA 2BTRA 3EKKA 1OL1A 2XK8A 5LWMA 4USEA 4FKLA 2BKZA 4HZSA 3FZSA 2XM9A 4S30A 2FSMX 2PZRA 3K5UA 5FTOA 4AW1A 3FL4A 5CVFA 2V7OA 4TTHB 4GT5A 2YISA 3DJ5A 3QA0A 2QOOA 3A60A 3FXWA 5CVHA 4PRJA 4PDSA 4FG7A 3HGKA 4AP7A 4MWIA 5ACBC 4O0YA 3VUDA 4CRSA 5K4JA 2QLUA 5C8MA 3UPZA 4ZAUA 4Y83A 4YNEA 2BFYA 5BVOA 4Y5HA 5TO8A 1XBBA 2UZVA 2HWPA 2HOGA 1MRVA 2GNGA 3MDYA 2ITXA 3RBWA 3V01A 5JGBA 5JSMA 4B6LA 3PZHA 3ELJA 4C3PA 3O0GA 3IW6A 2C6MA 4FZ7A 5E1SA 1BX6A 2WELA 3KY2A 3UIUA 3ZO1A 4EH7A 2BZJA 3M1SA 3F5UA 5KKRC 3UIXA 4CD0A 4AT3A 3P7CA 2W17A 2J5FA 4QYGA 5J8IA 4I4FA 1Q3WA 3REPA 4OW8A 4XNEA 1T45A 4O0WA 2BAQA 4EK6A 4N0SA 4EHEA 4DGLC 2PVYA 4IM0A 2IVVA 2VTAA 2KULA 4YPSA 5D10A 2O2UA 4I94A 5AP3A 2I40A 3HZTA 2QOHA 3UQFA 3EL7A 3G51A 3R00A 3GU8A 3GC7A 3RPRA 2QKRA 3EQBA 4FZFB 3OMVA 4GMYA 4RFMA 5B2MA 2B4SB 2HZ0A 4G16A 1SVEA 3ROCA 2BAJA 2ITYA 2PY3A 3WF7A 3JVSA 3TV4A 2VX1A 1PXOA 1ZWSA 5KHWA 1KE5A 5LCKA 3V5PA 4BWKA 5AA9A 2BIKB 4GCJA 1OIUA 3PXKA 2C30A 2QR8A 3NAXA 4X3FB 1R0PA 3OW4A 2Q0NA 4FG8A 3GP0A 3D94A 4IBMA 4CKIA 1OIRA 3R71A 3FMMA 3QD2B 1E1VA 2BILB 4N6ZA 4IZ5A 4ALUA 3DBQA 4WHZA 4CYIA 2I0EA 3CLYA 4G1WA 4IX6A 3W18A 2LGCA 1Q24A 4EH3A 2X0PA 5DWRA 2XIYA 4YLKA 3W2RA 2F7ZE 2XKFA 3BHUA 3NCZA 4RPVA 5HVJA 5K0XA 3TUDA 3D15A 3BELA 4E5BA 4YUQA 3AMYA 3KA0A 4K2RA 4PL5A 4E5AX 5HX8A 4AGCA 2QO9A 3NIZA 3GC8A 2BTSA 1YXSA 2OH0E 4C37A 4XRLA 2R7IA 2CN8A 5HVYA 4ACMA 2IN6A 3GC0A 4FIFA 5F20A 5EW9A 4BB4A 5LJJA 3PIZA 2VO6A 4IM2A 4KD1A 5ANEA 5AV0A 4FF8A 4DFLA 2C1AA 3NS9A 4JBOA 1OIQA 3T9IA 5CXZA 2WNTA 4AE6A 1X8BA 2G1TA 3GGFA 3QC4A 2JEDA 4R5YA 4V0GB 3Q5ZA 5J87A 2IVUA 4BF2A 4F6WA 4M14A 3BQRA 4F70A 3UZPA 2HW7A 4L3PA 3MGYA 2BVAA 3Q04A 2UVZA 2J0LA 1DI9A 2GPHA 3W2PA 5A46A 2DYLA 2C5XA 3RTPA 5HCZA 4MWHA 2XKCA 3E92A 4QMTA 4IZ7A 5E8UA 5A4LA 3A7HA 1PMNA 4AS0A 1Q61A 3CXWA 4LGDA 4YNOA 5FD2A 3TNHA 3T3UA 4JX7A 2HWOA 1MRYA 4QNYA 1PY5A 1FPUA 3UOKA 4CT1A 1H28A 5T3QA 4O27B 4DFNA 3GU6A 1CMKE 3OWKA 5EM6A 5CU4A 2ZAZA 3FI3A 3ZHPC 4C57A 1XBCA 5DEYA 3ZTXA 5DMZA 2CMWA 4YZCA 3TI1A 5HG8A 2GTMA 4IAKA 3ZBXA 2NO3A 4QTBA 1APME 1OB3A 3SOAA 2ONLC 3UZTA 4TT7A 3CCNA 1E1XA 4NH1A 3WF5A 3DS6A 2ERKA 3NNVA 3R28A 4RX5A 3FLNC 3OCGA 5E7RA 5HIBA 3OOMA 3LIJA 5EDQA 5B2KA 2UZBA 5ACKA 4AZFA 4YJPA 2ZV9A 2RKUA 3LLTA 4HGLA 2R3KA 4EK8A 2PWLA 3O7LD 2ERZE 2Z7SA 4MVFA 4X7QA 1Q41A 2VWWA 3PY0A 5G1XA 3KFAA 4FTCA 3QUEA 3WZDA 3BLHA 4FYOA 2PVNA 3W55A 3TL8A 3TNPC 2C3IB 4IMYA 2RL5A 3BYVA 3WOWA 5J7BA 3E3PA 2Q0BA 3FLYA 3RMFA 1DS5A 1H27A 1XBAA 4AA4A 4CXAA 5JN2A 4JNWA 2QOIA 5AUTA 5L2WA 1YI4A 4JAJA 3GQLA 3QYZA 3H4JA 1F5QA 1WCCA 2WTKC 5DRBA 2PZYA 1HCLA 5DIAA 4DGOA 3PVBA 4LI5A 3QGYA 1GIHA 3UNKA 5CALA 2WU6A 4Q5HA 5T6KA 3UBDA 4JVGA 1A9UA 2EUFB 3AC1A 3R8ZA 4RQVA 4RMZA 5EYCA 1JKLA 1FGKA 4FNXA 2QHMA 4DFYA 4JT3A 5AA8A 4V05A 1ZOHA 4FT0A 4OTRA 4QRCA 4U79A 4WKQA 4USFA 4C59A 4GSBA 4E73A 3HLLA 3FC1X 2QOCA 4IB1A 4LQMA 4TNDA 3T8OA 5H2UA 5EHYA 2O5KA 4YZNA 4RT7A 4FSQA 4LL5A 1H24A 4TWNA 4ANBA 2VWVA 3C9WA 4FUXA 2B53A 3KXNA 3QUPA 5DLSA 4X2NA 3W8QA 2ZM4A 2NRUA 2X1NA 2HW6A 4F9CA 3TWJA 4PDPA 3TZ8A 2XNMA 3MV5A 4J52A 5AR5A 3NAYA 2C0TA 4ZJIA 3QQJA 4D5HA 3A8WA 3D2IA 2CN5A 2P2HA 3KEXA 3D5XA 3KRLA 3MY5A 4M13A 4TY1A 4CMTA 4Q9ZA 3BYSA 5K4IA 3I1AA 4GIHA 3QKMA 4ZS0A 5AP5A 4IAFA 3TV7A 1RQQA 5HNGA 2QO7A 3ZC5A 3Q53A 2J0MB 4QYEA 4V04A 4ZY4A 3UYTA 2C6OA 5B0XA 3OEFX 3HL7A 1YHWA 4RX8A 4FODA 3QAME 3TNWA 2JLDA 2XKDA 3U9NA 4TYEA 5IEYA 5FGKA 2WQMA 5AV1A 1RE8A 4DTKA 2A0CX 3E8DA 5CNNA 2R3HA 5KMJA 4GU9A 2JDRA 3E87A 1V1KA 3H9OA 4OTPA 4GS6A 4TKSA 3R8UA 4FGBA 3E63A 2WQOA 4IIRA 4IFGA 1XHAA 4ONAA 4I0TA 2JDTA 4N70A 1FOTA 3Q32A 4XV2A 5J7HA 4FV2A 1GZOA 3PXRA 4FK3A 4HZRA 2YDIA 4IAYA 2G2IA 3EQRA 3MVMA 5HQ0A 2REIA 3Q4UA 3QCXA 3QZFA 2UZWE 4IDTA 3ZBFA 3DTWA 5AP2A 3PE2A 4YJQA 5E1EA 4D9UA 4HYUA 4FRFA 4DH5A 4HCVA 5DFPA 5DT0A 3EQIA 2IWIA 4FIHA 3LFFA 5GZAA 4E6AA 3KK8A 5D11A 1ZYJA 3DKOA 3OFMA 3VWAA 2YLEA 4QMMA 2XBJA 3LCSA 2CLQA 3AG9A 4B9DA 4E8AA 3ORTA 3UVPA 4B7TA 3C0HA 4XV9A 2XNGA 4RA4A 3PWYA 4HPTE 3RPOA 1H1PA 3OP5A 2JIIA 4FV4A 4N6YA 2X0GA 3POZA 5A6NA 3Q9XA 4H58A 2XK4A 1JKTA 1KOBA 5LOHA 3QZHA 3VIDA 1WZYA 3GU5A 4FTAA 3VHKA 4D28A 5GJDA 4ASZA 5ETFA 3KMMA 4P2KA 4YHJA 5HLNA 1FMOE 3FC2A 3KXMA 2WXVA 1XH5A 2PMNX 1DAWA 4MBIA 4FKSA 4EH5A 4Q2AA 4FTIA 3OW3A 4RQKA 2PVKA 4DGMA 2C5VA 3AQVA 1CKIA 4F7SA 4RG0A 5HEZA 4OTDA 5FXSA 4BTKA 4C02A 4ZP5A 4BBFA 4C38A 4FMQA 1GZKA 1YRPA 2UZEA 4A9TA 4BI2A 5FBNC 2QO2A 4YURA 3Q2MA 5AJQA 3C13A 2C0IA 2GS2A 2YA9A 4AF3A 2VTNA 5AUXA 3I60A 3NUXA 4F1OA 3O8TA 3QTXA 3DXNA 3PLSA 2YIWA 3G5DA 4LV8A 4PUZA 3PSBA 4FIGA 3HMNA 3I5ZA 3OXIA 4GK3A 4EOOA 3N9XA 3I81A 3TJDA 3FYJX 3UTOA 3W10A 5CAPA 4TYHA 4L9IA 4EKLA 3PJCA 3BPRA 3PA3A 2XF0A 4BICA 1ZRZA 2IVTA 2OXXA 2BPMA 1VZOA 5HCXA 3M11A 4C34A 4QOXA 4PTEA 2C0OA 4BDGA 4FT7A 2WGJA 2XMYA 5DR2A 4II5A 2WTKB 3W33A 5I0BA 3COIA 3PJ8A 3LPBA 3RALA 3NZ0A 3MS9A 4ERWA 4QQTA 4XG4A 4NSTA 2JKQA 1QL6A 2BRMA 3BGPA 4QT1A 3QUDA 3ZLXA 3P1AA 5E8XA 3ULIA 2W4JA 2YABA 4KNBA 4OTHA 4A4XA 2XNEA 2WTIA 3KMWA 3C4XA 3ETAA 3EYGA 4GT3A 4HCTA 1JWHA 4I22A 4FV3A 3BEAA 3GU4A 4ZTHA 4DEBA 5A54A 2R3JA 5L2TA 5J79A 1H07A 3O8PA 3DK3A 3ORNA 4PMTA 5M56A 3B8QA 3COMA 2UW0A 5BMMA 5AM7A 3MPAA 3VULA 4KSPA 2P3GX 3F3WA 4CT2A 4GFGA 1LEWA 4NU1A 3VUIA 3C7QA 1GY3A 2V22A 3QA8A 4G6LA 3G6HA 5CS6A 1WBWA 2VWIA 3Q3BA 4EHZA 4IVCA 4CEGA 3GENA 4YZBA 5G6VA 2AQXA 2XP2A 2UW8A 1F3MC 1W7HA 3DBDA 4J98A 1Q5KA 1OKVA 4D9TA 5TR6A 3UODA 2RFDA 5HNIX 1G3NA 3DB6A 2V7AA 5EI2A 5IEVA 4FNWA 3M42A 4GK2A 2WO6A 1LEZA 3FY0A 3V51A 4Z7GA 2R3QA 3BHHA 2R3MA 1QPJA 3EKNA 4H1MA 1M14A 2VTRA 3IW8A 3F3ZA 2CGXA 3FQHA 4MQ1A 4RBLA 4CFMA 1SNXA 4G2FA 3F5GA 4BDKA 3ODYX 1Y91A 4AA5A 4JI9A 5BVKA 5FEDA 1YWNA 4HOKA 1URWA 3DCVA 2O8YA 2JDVA 1YDSE 4GK4A 5KMOA 5HO7A 4ZZMA 1XWSA 3SD0A 1MRUA 2C6KA 2VZ6A 5DPVA 4IX3A 3RPVA 5HTBA 4Y8DA 3ODZX 3OWJA 1ZOEA 4BDFA 3GOKA 4NKAA 2A98A 5HE3A 2ZV8A 2PE0A 3G0FA 5AX9A 3NIEA 4KAOA 4JQ8A 3NUPA 1YXUA 4FSNA 3DJ7A 3SQQA 3GI3A 3U51A 5HU9A 4NJ3A 4F7LA 1IRKA 4LUDA 4MF0A 4MXCA 3MTLA 3P7AA 3C5UA 4JJRA 4I24A 4C2WA 2VWZA 5ANOA 4MXXA 4IXPA 3A7FA 4WD5A 1ZY5A 5LWNA 4KRDA 5GHVA 2DWBA 2PTKA 3MFUA 5BMSA 3QF9A 4RWIA 4ZEGA 1R1WA 2HELA 3CKWA 2RF9A 3KRJA 2UUEA 4AZWA 1OMWA 3O96A 3KULB 4JS8A 3BHVA 3D4QA 3P9JA 4YZMA 4D2VA 5I9UA 1V0PA 1Y6AA 4MXOA 4WG4A 5H8GA 3VUMA 1MUOA 4AGWA 5I9YA 1U4DA 5EYMA 3OS3A 2W0JA 3K3JA 4GIIA 1CSNA 2X7GA 1OL7A 5CSXA 2R3PA 3TNIA 4E4MA 4I93A 4AT4A 2PZ5A 4M0ZA 1JAMA 4ZTLA 5CXHA 2IF8A 3TTJA 3W2SA 1WBTA 4KIPA 4NCTC 1OZ1A 2EXMA 1R39A 1H1SA 2W9ZB 4M12A 2EU9A 3FPQA 1MP8A 4DAWA 2JIUA 3OCSA 5KO1A 3CE3A 1KE9A 3WYXA 3QZGA 3RHKA 3KMUA 3TXOA 4EH8A 3P08A 1AQ1A 4L6QA 2UVYA 1CDKA 3QYWA 4K1BA 2GNIA 3ZUUA 5FBOA 4EWHA 4DGGA 4BCQA 3F61A 4CZUA 3DBFA 4FV8A 5LVNA 5BUEA 4J99A 3MY1A 4FBXA 4PL4A 4E93A 3RK7A 1ZZ2A 1O6KA 2XKEA 1YHSA 3ZMMA 2XNBA 4TL0A 5AAEA 2V5QA 2C69A 3F7WA 4JIKA 4YC8A 4DINA 5AEPA 2WB8A 3LJ1A 3IS5A 5ETIA 4FL1A 3VBYA 3RWPA 4HJOA 3O50A 4E7WA 4L3LA 3O51A 2YM7A 3LM5A 4W4YA 3ZDUA 1YOMA 4UMQA 4X3FA 4JG8A 5A14A 3CP9A 1L3RE 4XUFA 4OT6A 4RFYA 4ANQA 3P23A 4C4IA 3PG3A 3EFLA 3PIXA 4FKWA