4LOOA

Structural basis of autoactivation of p38 alpha induced by tab1 (monoclinic crystal form)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
349
structure length
349
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Mechanism and consequence of the autoactivation of p38 alpha mitogen-activated protein kinase promoted by TAB1.
pubmed doi rcsb
source organism Mus musculus
total genus 111
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4looA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4looA01
4CYIA 5LCKA 1R0PA 3IG7A 3LQ8A 4YZ9A 4K18A 3I0OA 5T6KA 3IDPA 3LCOA 5IUHA 3S3IA 4FV1A 4C3RA 2UW9A 1R1WA 1XH6A 3BQCA 3NUNA 3OWKA 5EDQA 5B0XA 2XBAA 3QHRA 3E93A 3QZGA 5DH3A 3TZMA 4A07A 3LJ0A 3PIZA 4FF8A 3PLAE 2G1TA 5IQBA 3FYKX 2QKWB 3DAKA 3PRFA 2J50A 4K9YA 4C38A 5HU3A 4L67A 2XUUA 5GJFA 5I3RA 4E5AX 5B7VA 1BMKA 3AMYA 5E8YA 2X8DA 2J0LA 4U42A 3IDCA 5AUYA 4QMLA 2XB7A 2DYLA 4HPUE 4C57A 4BWKA 2QOOA 1Q5KA 1ZYJA 1WFCA 4B99A 4B8LA 2ZV2A 3QWKA 4K1BA 2P2HA 3WI6A 3C7QA 3F5UA 3F3WA 3LQ5A 3OCBA 5AMNA 3KF4A 3BLQA 5IEYA 4TWNA 2OU7A 1OUYA 4ZMFA 3R00A 3JPVA 2YISA 4JT3A 3WOWA 4KNBA 3AC4A 4AA4A 4DH5A 4FKUA 2BKZA 3Q2MA 3NYNA 3ULZA 4EQUA 5JFVA 5M51A 2OH4A 4CGAA 1XWSA 3PJ2A 2IZTA 4IFGA 1FOTA 3W2RA 1VEBA 3ZZWA 2W1EA 3QUPA 2CDZA 3SV0A 1R3CA 5IZFA 2VX0A 5FUTA 1Q41A 4F7SA 3R28A 4TYIA 4YSMA 5C27A 3TZ9A 4I6FA 2BIYA 2W1HA 3E88A 4EOSA 3OS3A 4M66A 4J98A 5IDPA 2W99B 4O1OA 3SD0A 3ORKA 4AG8A 5AV1A 3PZHA 4AZFA 4FVRA 3ZM4A 3UYSA 3NW5A 2VU3A 1YWNA 3HA8A 3QZHA 1AQ1A 2QONA 5EYDA 2X8IA 3MGYA 3DJ7A 2C5VA 4JDIA 4J1RA 2X7OA 5J95A 3E62A 3AD5A 2FB8A 3PE2A 3V5QA 4EQMA 2WD1A 3RHKA 1DAWA 3JR1A 3C0HA 5DEWA 3FI8A 4ACGA 1PYEA 5KMNA 4I0RA 3TJCA 3R1YA 2W05A 3NVKI 5HX8A 3K3JA 3U4UA 2VN9A 4NCTA 4HVSA 5KMLA 3QGWA 1W98A 2XK3A 3MW1A 3DKGA 4R8QA 4BWPA 4BCOA 4IZYA 3IW4A 1PRYA 3MBLA 1KE7A 3CQWA 3Q4TA 5AP4A 5HVYA 2WO6A 1U54B 4ZMEA 3CR0A 3PZEA 4FT5A 1H0VA 2XCHA 5ACBC 3SDJA 1ZYSA 5IA4A 3UZPA 1YKRA 2Z2WA 2FA2A 4XRLA 4BCHA 2YDIA 3M42A 4P90A 3NDMA 4CXAA 1ZZ2A 5AM7A 2WTVA 3A4OX 4ZLOA 4U6RA 5HO6A 4J52A 4G31A 4USEA 5E8ZA 2BFYA 4RGJA 4BTMA 3F2RA 2Z60A 5FXQA 1YXTA 2FH9A 3GC8A 4X21A 4FT3A 3SX9A 3L8XA 4M69A 2ZM1A 2XK8A 2FUMA 4Y83A 4DFYA 2KTYA 3VRZA 1XQZA 4QMOA 3D7TB 5AV4A 5C1QB 3IW7A 3DXPA 4F7LA 4IC7A 5C4KA 4L9IA 3VQHA 2ZB0A 3G0FA 2OJIA 5FM3A 3U6IA 2PVJA 4LRKA 3HLLA 3LM5A 3VBWA 3S00A 5AR2A 4XP3A 1WVYA 3VJNA 5D41A 4O2ZA 3ENHA 3W2OA 4D0XA 1WBWA 3RTPA 2G2FA 3BYOA 1J1CA 4RT7A 5LVOA 3QL8A 5JRQA 3AC5A 5FP6A 4F9AA 2HYYA 3AT2A 3G33A 3UVPA 5E8VA 3S95A 4BB4A 1BI7A 1OITA 2E9PA 2A0CX 3CKXA 2BDFA 3QCSA 4J96A 4E4MA 5EM8A 4B0GA 2VWIA 1PXLA 4OTFA 1MRVA 2PE2A 5HE2A 1E1XA 1UWJA 2HXLA 2X9FA 5GHVA 4ANOA 1OB3A 4II5A 4GIIA 5I9WA 2GU8A 3RWQA 2WQEA 1CKJA 3BGQA 4EC9A 1J3HA 2CGVA 2Y4IC 3VRYA 3F7WA 4FSTA 3G90X 4C3PA 4HGEA 4XG6A 2X4ZA 1FVTA 3Q5IA 4K8AA 2PZYA 4L3PA 4TY1A 5FP5A 2XJ1A 2PSQA 3DK6A 3HMIA 5M44A 3ZLXA 2YN8A 3BV2A 4IVBA 3LFDA 2DQ7X 4LL0A 2UZTA 2VTOA 2VWXA 2IVSA 1NVRA 3VW8A 4FZFB 4U45A 4X3FB 2UW7A 1QCFA 2ZV7A 2OLCA 2HW6A 4APPA 4C02A 3V51A 2RFDA 2C1AA 4PNIA 1YI3A 3Q9ZA 2HZ0A 5D1JA 3QQGA 4JS8A 5LWNA 2BKKA 5IA2A 5DFPA 2PZIA 4YJOA 2QVSE 4QMQA 4UWBA 4PL5A 2FSMX 3LPBA 4KD1A 1L3RE 3UYTA 4JVGA 3WF8A 3RGFA 4DAWA 3DFCB 2F4JA 4HNFA 4FEQA 3SG8A 2RKUA 4LQMA 2PZ5A 3F3TA 3EQIA 3OCTA 2WIPA 4JDKA 4BRXA 1IRKA 2X6DA 1V0PA 3II5A 3QXPA 3R30A 5IMXA 4ZTRA 5HIDA 1Z5MA 5F20A 4RJ5A 3PVUA 5T3QA 3U87A 4CRLA 3P79A 3L9PA 5CZIA 3VW6A 1CDKA 1H28A 1RJBA 4DEBA 4FG7A 4FZ7A 4DEEA 3PG3A 3GCPA 2W1IA 3LFSA 4FX3A 4OT5A 4ZP5A 5AV0A 4KINA 5AM6A 3GB2A 4D55A 2W5BA 2C6DA 1WCCA 3POZA 4J95A 5M55A 5ICPA 4A9UA 4DINA 4KUJA 3DDPA 4X2NA 3WZJA 4C4GA 4KIOA 4Q9SA 4NW5A 4CG8A 3GCVA 3T9TA 4DH3A 1OM1A 4MQ2A 5EYCA 1ZLTA 3BHHA 4IAZA 4FZ6A 1M2RA 3ORZA 3MFRA 4JBQA 3AG9A 4PDPA 1JKKA 5EYKA 4TN6A 5H8BA 2YM5A 1O6LA 2HXQA 3PXYA 3ZSHA 2ZVAA 3QTSA 4TYHB 4I5PA 4DTKA 4EHZA 3QTZA 4RWKA 3G6HA 5HNIX 4L53A 4KSPA 5DGZA 2R0UA 3D7ZA 4RPVA 2A4LA 4ZOGA 2C6LA 4C62A 3DBDA 2C0OA 4Y5HA 4BI2A 4AZEA 3KGAA 3MYGA 2Q0NA 3NX8A 5F1ZA 2C5XA 4JNWA 3NNXA 1EH4A 2GNLA 5FG8A 2WPAA 4GCJA 2P55A 5CT7A 3RZFA 3I4BA 2O64A 3UMXA 4MBLA 2JD5A 5C26A 4EOIA 3DU8A 3OROA 4XOZA 2C6KA 3KMMA 5EM6A 5G6VA 3FC2A 3UBDA 4MKCA 2I0VA 2CMWA 2UZNA 1Q8YA 4FICA 5HBHA 1NW1A 3QD3A 3ZU7A 4FGRA 4O6LA 5TOZA 3EH9A 5KHXA 3DDQA 5C4LA 3HYHA 3V8SA 3LXNA 4G3CA 4H3BA 4D4VA 4E26A 2ZJWA 2VTHA 4MVFA 4CFXA 3TDWA 2WMXA 1P4FA 1B39A 3CXWA 3FMDA 4XJ0A 4PQNA 3E8DA 1G8SA 1K9AA 3MY1A 4G6LA 5KMJA 4EHEA 4QMNA 5AP3A 5AUZA 4D2RA 3C13A 2WXVA 2UVXA 5LARA 4PPAA 3WYXA 4L68A 2R3MA 4WA9A 1M7NA 5BNJA 3SLSA 4YTHA 2ACXA 5L8KA 2J0MB 3E7OA 3MSSA 3R1NA 1OBDA 4R3CA 4FL3A 4GVJA 5GJGA 5AA8A 5F4NA 5HESA 5CX9A 4WNMA 4O7NA 4RMZA 5IQGA 3EZRA 4Q2AA 4ZTLA 4UN0C 3HV5A 2ONLC 4FTRA 1Z57A 5FLFA 5GJDA 3UOLA 1TQPA 2YDKA 4CKIA 3BPRA 4EWQA 3DXQA 2YABA 2PTKA 5E1EA 1TVOA 3V5TA 4YJQA 5IF1A 3P4KA 2FO0A 5CNNA 5AR4A 4GVAA 4CCBA 4DA5A 2C6TA 4I22A 4IAKA 4C3FA 2VZ6A 1Q62A 2HAKA 5CZHA 3HA6A 4ASEA 3OWLA 4P5ZA 2HY81 2W1FA 5LXMA 1OPKA 3T3UA 3ANQA 3HMOA 5EOLA 1PXNA 3GBZA 2HZIA 5CAOA 2W1ZA 2V7OA 3CGFA 2J6MA 4IEBA 1QPJA 3PXKA 4N4SA 3TIYA 2I0EA 4MK0A 3TACA 5JN2A 5CEKA 2PK9A 2B9HA 3QQLA 4OR5A 5HG5A 4QP9A 3ZUUA 3Q53A 1NVSA 4EOLA 4U80A 3UJGA 3QTQA 2W9ZB 3FQEA 4QMMA 4IAFA 2B1PA 3EWHA 3JS2A 4PV0A 5CVFA 4I23A 5EFQA 3KREA 4EBVA 3LMHA 3ROCA 2HY0A 3MY0A 5BVOA 5CAVA 3DZOA 5EYMA 5L3AA 3E63A 3P08A 1PY5A 3AT4A 3G5DA 3R9HA 2XYNA 3V8WA 2PE1A 3O7LB 3UQGA 1PJKA 4A4OA 2I6LA 3OD6X 4EK5A 4IM0A 4YMJA 4FUYA 3HV6A 3TV4A 4CTBA 3IQ7A 4FSZA 4R7HA 4LUEA 3EHAA 2YCQA 4RC4A 4G3EA 4RJ7A 3HRCA 4U7ZA 3BHUA 3W8LA 3HKOA 5FXRA 4ITHA 3W32A 3CQUA 4CMOA 3FKNA 4MXOA 5J5TA 4RFMA 1Q61A 2YM7A 4KKHA 3W2PA 5AP5A 1IASA 4GFOA 4WUNA 2B53A 4WSYA 2AC5A 2YM6A 4BKZA 2XF0A 5L8JA 3LJ1A 3ZFYA 4ANQA 1GOLA 4DFZE 1H1RA 3MJ1A 3RCJA 3W10A 4BHZA 4U3YA 2WMQA 2XBJA 1KE9A 3HVCA 4YO6A 3LIJA 4PDOA 2XJ2A 2JIVA 2PY3A 2W1DA 3EQFA 3H9RA 3LCSA 4YC3A 2IPXA 3E3PA 4XS2A 2Z7SA 3MPMA 3HP5A 4YLLA 5CAUA 2OIQA 4XP2A 3I6UA 4EK3A 1SNXA 5BVEA 4AF3A 4E6QA 2WOUA 3MA6A 3ZC5A 3VUMA 4RX5A 3EJ1A 4X3JA 3QWJA 2GFCA 2OFVA 3RPVA 2GNFA 3R1QA 4WG4A 4AQCA 2XNBA 2R3IA 1H26A 4NH1A 1REJA 4ZJIA 5C8NA 1SM2A 4ZIMA 4WT6A 4EJ7A 3V6SA 3AMAA 3G9LX 4RX7A 3Q9WA 3P23A 4EK8A 4Y73A 4Y85A 4IIRA 2B54A 2BR1A 2WHBA 2WQNA 4GS6A 2V62A 4YJVA 4LGHA 3UGCA 4BIBA 4K33A 1NT2A 3LQ3A 3U6HA 2QOLA 2R3KA 3TNHA 1H08A 4JQEA 4NKAA 4A9SA 2PUIA 2XJ0A 3DPKA 4QP3A 2JKMA 3PP1A 4GMYA 3HRFA 3W2SA 2IN6A 4QQCA 3EKNA 3FMJA 4DGMA 4EOKA 2OBJA 3P7AA 1AGWA 2WQMA 3ORTA 4R1VA 5CLPA 5FTOA 2X2LA 3PTGA 5EDRA 5DG5A 3SHEA 3OG7A 5JSMA 4Q5EA 2PUNA 4QMSA 2Q0BA 3CC6A 2E9UA 4YJRA 2VTAA 4BGHA 1PKGA 5I0BA 4ONAA 3FQHA 2CPKE 4FSWA 2P2IA 5JRSA 3MA3A 1WBPA 2IW8A 2VAGA 2C5YA 4ZY4A 3UE4A 2GNHA 5KKRC 3BYUA 2WTWA 2I7QA 1PW2A 3EKKA 3KXXA 3MH3A 1GIJA 3UIUA 4JAIA 4D58A 3FLQA 3VUIA 3WZDA 2C3JA 4ENXA 5A14A 2CNQA 4DTBA 4AZVA 1WVWA 1ZOHA 1APME 2QO2A 4RBLA 2R3LA 5EI2A 5AWMA 4ZJVA 1YWRA 4ZK5A 4AA0A 1OIYA 1PMEA 4AW0A 2EXEA 5HORA 4HVDA 3OOGA 4FNYA 3A8XA 5I9XA 4OTGA 3F6XA 2JIIA 4GK3A 4BDGA 3ACKA 2PZRA 1UA2A 3GCSA 1K2PA 3ZEWA 4MNEA 4M12A 4MX9A 4IWDA 5DOSA 4DG3E 3RAKA 4RC2A 3A7GA 4ANMA 4FVPA 3FZRA 4YURA 5HKMA 1SVGA 1CMKE 2BRNA 2W4KA 4OUCA 3WARA 4RQVA 2B4SB 3I5NA 4NCTC 3FZPA 4XNEA 4CQEA 2WB8A 3QYWA 4IM2A 1H4LA 4USFA 3ERKA 3I6WA 1HOWA 2OZAB 4M13A 3CLYA 4KIKA 4ACMA 4USDA 3UPXA 2O2UA 4BI1A 4MXYA 4R7BA 4FV3A 5DA3A 2W96B 4G34A 4TNDA 4BY9E 4ERKA 2C6EA 5BUIA 4BIEA 2R64A 2NO3A 3E5AA 3EQBA 4PMPA 3MB6A 3AC2A 3OBJA 4KWPA 4DEDA 5A6OA 1IEPA 3EQCA 3LOKA 4TTHB 4TXCA 5D11A 2XNEA 1NA7A 3SOAA 4PX6A 3LKMA 3DCVA 2CN8A 4X6QC 2NRUA 4AE6A 5I9VA 2WQBA 1OECA 3ZRMA 3L8PA 4BR3A 5DE2A 3QA0A 4OLIA 3SRVA 4CCUA 3QC4A 3DLSA 4LL5A 3OXZA 2HK5A 1G3NA 3QTIA 4GJ2A 3M2WA 4FV0A 5C03A 5CI7A 4FL2A 3GP0A 2EB3A 3P78A 3S4QA 4DTAA 2FSOX 3JUHA 4TPTA 5CTPA 2VNWA 3GQIA 3I81A 1Q8ZA 2GHGA 3QA8A 3ZHPC 3ATSA 3NWWA 3TZ7A 3WZUA 4QQTA 3V01A 5HLNA 3KK9A 2JKOA 4ZEGA 3MH2A 5IKWA 3BE9A 3TNWA 2ITWA 4BTFA 1XBBA 3GCUA 4QT1A 4EK6A 5CXHA 2UVYA 4RWJA 2BMCA 1OPLA 3UNJA 2GS2A 2X39A 4AA5A 5CVGA 2WTCA 2VWBA 2XRWA 2YERA 1MRYA 3DLZA 4W4YA 3H9FA 4ASXA 1RQQA 2OWBA 5D9HA 4ALUA 4RZWA 3NSZA 4FMQA 4EZ7A 4R1YA 4FTLA 2R3JA 4IZ7A 4AT5A 5ANGA 1OKWA 2XA4A 3PXRA 3F2AA 3OT3A 4V0GA 5DYJA 3TUBA 4ORKA 2F7EE 5BMMA 1QL6A 2B7AA 3FLSA 4RIYB 3PVGA 4DH8A 4M15A 5HGIA 3BLRA 3COMA 1SYKA 2HENA 4H58A 2X4FA 4KKGA 3UIMA 4E5WA 2PUUA 1O9UA 4L6QA 3MH0A 1IA9A 3GU5A 5CU3A 2QQ7A 4YPDA 2J5EA 4XLIA 2PULA 1ZRZA 5EM7A 2QODA 2B52A 2R3RA 4IM3A 2PHKA 3TT0A 4X7QA 2Y7JA 2JLDA 4WG5A 4RJ6A 3VUTA 4YU2A 4GIHA 1BL6A 1OL5A 3CCNA 1P14A 4E6CA 3CJGA 4D2TA 3C9WA 4X2FA 4E8AA 3LM0A 4M67A 5AIRA 4MEDA 2R3FA 4XEYA 3N4UA 4L00A 5AUXA 3SC1A 2ZB1A 1SNUA 4ZSAA 4FG9A 2XIKA 2O65A 2YACA 3QFVA 2C6OA 2QO7A 4IC8A 3CD8A 4E7WA 2PYWA 2V5QA 4E93A 2YITA 3OW4A 3KULA 3MTFA 2VWYA 4H39A 3R9NA 3Q2JA 4F4PA 4FI1A 4F64A 4FIJA 3BU5A 4G9CA 5FEDA 3W18A 3OXTA 5JGBA 4CFNA 4XLVA 4BCPA 2HELA 5HVKA 5E8WA 5HBEA 3DAJA 3E7VA 4JRVA 4F63A 5AA9A 3GT8A 4O81A 4GL9A 1ZXEA 3FDNA 3R1SA 4AE9A 3FUPA 4RQKA 2GNJA 4OTHA 3ZSIA 4AX8A 4AS0A 2QURA 5HNGA 4JDJA 3A7IA 3R8MA 3VUKA 3ODZX 5AUTA 3R8UA 5GNKA 3MY5A 3EQGA 3FHRA 1KOBA 3FZTA 5H3QA 2BAKA 3C51A 4G3DA 4PUZA 3ORIA 4G17A 3BELA 2F9GA 4IAAA 3QLFA 3W8QA 2GNGA 3WZKA 5F95A 3UP2A 2BRHA 5I4NA 3WYYA 5IEVA 3UOJA 3D4QA 3R21A 1YDRE 3E3BX 3UIXA 2VUWA 1JWHA 5AV3A 4CQGA 5DVRA 5K5XA 2W06A 3QTUA 5HLWA 3FMKA 2UZBA 2VWWA 2C5NA 3F61A 4XBRA 4ALWA 3CPBA 4FTCA 4O0VA 4O7ZA 1YDSE 4FA2A 1H01A 4LFIA 1ZYCA 3DKFA 4TYGA 5FQDC 4FOCA 1YHSA 2DWBA 4QO9A 1XBAA 4ZLYA 3BRBA 4WHZA 2LGCA 3FBVA 3TNQB 3HL7A 3B8RA 5L4QA 3NNVA 3DKCA 5DNRA 2IW9A 5L8LA 1OIRA 2GPHA 3LXLA 4HVHA 2J4ZA 3DJ5A 2OICA 3EMGA 3KXNA 5M57A 4YTCA 5CQWA 3I0QA 5H2UA 4FKTA 5BYYA 2ITZA 4UMTA 5HQ0A 2BCJA 3F5PA 4FIFA 2WEIA 1J1BA 1XR1A 3P7BA 2ETMA 4PP9A 1H24A 4MXZA 4Y95A 3SXSA 3KF7A 1FINA 4CKRA 1OKZA 2YIQA 3GC9A 1A9UA 3UC3A 2HCKA 3A7HA 3N4VA 2CNVA 5J8IA 4PL4A 4UXLA 4RIXB 1FVRA 3EN4A 4I3ZA 4TWOA 3A62A 4RWIA 4LRMA 2QKRA 3MFUA 1JOWB 1H00A 3DJ6A 3F3UA 3K5VA 3QC9A 1Y57A 1SVHA 3THBA 2BROA 4YZCA 3FLZA 2E2BA 3DKOA 3O17A 1GIIA 3T3VA 2XMYA 4MF1A 4AAAA 5DT4A 3TKUA 1YXUA 2GDOA 3PE1A 5CVHA 5KUPA 3DGKA 4PWNA 4QMZA 3D15A 2G2IA 3BU6A 4FNWA 4FSYA 1P2AA 1LEWA 4BDBA 4NYEA 2EVAA 3TI1A 4PF4A 4O7SA 3NUPA 2GQGA 3OVVA 3GQLA 5L2SA 3QUDA 4EK4A 2YWVA 3Q6WA 3NW6A 4R3PA 4HYIA 4EKKA 3GU6A 2ITYA 2VV9A 5HG8A 3OC1A 4E6DA 2J7TA 3D14A 4XV1A 2A2AA 4I94A 3R8VA 4EHVA 4IB0A 3DB8A 2I0HA 5HOAA 4YHFA 5DBXA 3MIAA 1WVXA 1Q8TA 2PVNA 4B7TA 3IPHA 3CTHA 4AZTA 5JMSA 4BYJA 3ALNA 3NNUA 2O63A 4GU9A 2CGUA 2YIYA 3HAVA 2PE0A 3GNIB 4QP8A 3VBTA 3R73A 3TIZA 4DE4A 3WIKA 3FKLA 3PXZA 2XNOA 5FDPA 5LMKA 4G5PA 4XUFA 4IXPA 3DBEA 1JQHA 3BE2A 2WMTA 4PPBA 3DQWA 5IQAA 2ITNA 4DT8A 5D7AA 3GC0A 2ZMCA 3OWPA 4AFJA 2ZM3A 2JKKA 1PXOA 2R7BA 4L44A 4KIQA 4U0IA 2UUEA 4F6UA 3VF9A 3JVRA 3NS9A 4E6AA 4ARKA 2W17A 4P5QA 2IW6A 3UOKA 2YM4A 3E8EA 4J8NA 3R04A 3W55A 4EBWA 2Y4IB 1IAHA 3OY1A 2GCDA 2IZSA 4QTEA 3A99A 1NVQA 4FT0A 2R7IA 5CT0A 5TF9A 4UX9A 2W5AA 3NYXA 5LCJA 3S0OA 4ZTNA 1KE6A 1T46A 4YC8A 3BHTA 4EUTA 2XNGA 1SVEA 2OGVA 4UZHA 3RPRA 3SQQA 5EI6A 4FTOA 1MQBA 3QQKA 3JYAA 3NCGA 3V5PA 4BCNA 1BYGA 2B9JA 2HOGA 3KQ7A 5EKNA 2IJMA 4MNFA 1FPUA 1UU8A 2W5HA 2RSVA 4FNZA 3RPSA 2CKQA 5JKGA 2R3QA 3WF7A 2OF2A 5BVWA 2I1MA 2XH5A 4FV9A 5KZIA 3TXOA 1LPUA 4N0SA 4O27B 1DI8A 4OTDA 3CSVA 2QLUA 3OUKA 5HO8A 3FWQA 2QOQA 3RBWA 4E73A 4IANA 2IVVA 4C4FA 4L42A 5EQYA 2R5TA 4BCIA 3MTLA 4YPSA 4R5YA 2CN5A 5AP1A 5EI8A 1W84A 2DS1A 3N51A 4U9AA 4BCKA 3KRLA 1OGUA 3QRUA 3MV5A 3A8WA 3QXOA 1JKLA 2NP8A 1K3AA 2C68A 1KV2A 4O0UA 1GJOA 5JZJA 5JEBA 4L7SA 3CD3A 2BZIB 4TYJA 4WNKA 4HYUA 3HMNA 1YOMA 3UZRA 2FYSA 1JLUE 2C0IA 2QU6A 4KS7A 3VQUA 4O84A 2J51A 3U51A 4RA4A 5J87A 4D4YA 5JGAA 3LMGA 3SG9A 5E91A 2PZPA 4QTAA 3NUXA 4G6OA 4DT9A 1P4OA 2PVKA 1H1QA 3PY3A 3A7FA 1JBPE 4BCQA 5HX6A 1XHAA 2YZLA 5L2IA 2OJ9A 3DNDA 4K2RA 4IWQA 3ORXA 3FXXA 4CT1A 4KBKA 3AT3A 4FTNA 5EHYA 2C3LA 5CU4A 4C61A 4C4EA 4IX5A 5J9YA 3E92A 4YJSA 3NMUF 4W9XA 4BTKA 1P5EA 4LGDA 4YJUA 3Q9YA 4KA3A 4UYNA 2WGJA 3FMMA 1OZ1A 4CT2A 4Z55A 5HBJA 3KKVA 3QAME 5HVJA 2IVUA 5CEIA 3OXIA 3A61A 4NIFB 5AR8A 3RVGA 5CS6A 4BKYA 5FD2A 4DEHA 1ND4A 1T45A 4CFWA 5FXSA 2XCKA 4UBAA 4A7CA 3DV3A 3HEGA 3P7CA 2XKEA 3GCQA 4XG3A 5IEXA 4JBPA 5EW9A 4CLJA 5J9ZA 3Q3BA 3CTQA 5I9ZA 1WMKA 2YIWA 2JDRA 2JDVA 1I44A 4BICA 4GFGA 5AP7A 2WU7A 5CYIA 2UW5A 3VJOA 2C3KA 2YAAA 2VTIA 2FSLX 3GC7A 4JQ7A 4O38A 4TNBA 3RP9A 1GZNA 2OZOA 4QPMA 1FBNA 3CE3A 4V01A 5BVFA 2FVDA 4O0RA 2VTRA 4O0TA 4ACCA 5CF4A 3ET7A 5D10A 1UKHA 3FLNC 3BHVA 2YLFA 2QG5A 2OXYA 3ELJA 3I79A 4EZ5A 1M2QA 2J5FA 3BGZA 4ZSJA 1NXKA 3VHEA 3PUPA 2VTPA 3QKMA 4CLIA 2YJRA 4RIWB 3NUUA 4O2PA 1Q3DA 2WAJA 3IGGA 4UV0A 3IGOA 2J2IB 5D7VA 5IU2A 4MH7A 3ORLA 4XH6A 4BZDA 3O23A 4FGBA 4GFMA 4Y5QA 3MVHA 5GZAA 3C5UA 3OWJA 4QMPA 4NM0A 3FI4A 5KX8A 4AT4A 4B9DA 5ETIA 2XYUA 4YZBA 4CV9A 1ZY5A 3O2MA 3R0TA 5BQ0A 3MN3A 5CEQA 5CU0A 4HYHA 4PMTA 3QKKA 3UG1A 4F6SA 5GZ8A 4DEAA 3VVHA 2VNYA 4FKLA 4HGLA 5LMAA 2W1CA 3OT8A 2PU8A 4WO5A 3V5LA 4FODA 4UEUA 4GKIA 2C1BA 3PJ3A 4GG5A 5EHOA 4L01A 5M53A 1H27A 2JEDA 4MAOA 2VGPA 3KCKA 4IACA 4FTUA 1YOLA 4F9YA 2QC6A 2WIHA 4FKQA 3BLHA 3PPJA 3FXZA 3RINA 1Y91A 3VO3A 5E1SA 3OW3A 2ZOQA 5AFVA 4YZNA 4FKWA 3ZRKA 3C5IA 4IX4A 1L8TA 1XH9A 2BAJA 3OHTA 1OL7A 5K3YA 5KZ0A 4DFNA 4ZS4A 2C69A 4RJ8A 3ZSGA 1IA8A 2H8HA 2OH0E 1OVEA 1YOJA 5TKDA 4LYNA 4ALVA 4D9TA 4EOQA 4EH7A 4EJNA 3T8OA 3R22A 1WAKA 1SZMA 3A60A 3LFFA 3QQFA 3R6XA 4DFUA 3FSKA 3NGAA 3RPOA 4DGGA 3TTIA 5K0XA 4FV8A 2QR7A 1O6KA 2VGOA 2Y9QA 3PY1A 2FGIA 4LRJA 3TCPA 4CYJA 3NCZA 3ZM9A 1PMVA 3VUDA 3TN8A 3F2NA 3V5WA 4DCAA 5ANKA 5AAFA 2QO9A 2X2MA 3WE4A 4CFMA 2XIRA 4YLKA 3PJ8A 2VTTA 2ZV8A 4F9BA 3CKWA 4QYYA 5CI6A 4IDTA 2CCIA 4BHNA 1IAJA 2CCHA 4IVAA 4P4CA 2BRMA 1LP4A 2R4BA 2WNTA 2Z7QA 4AOIA 1WBOA 4DBXA 5JGDA 4E1ZA 5IA3A 3DZQA 5BVNA 3O8UA 5CQUA 4HVGA 2AC3A 5K9IA 3QQJA 4AOJA 3WZEA 1PXIA 2C6MA 3OUNB 2UZLA 3KB7A 1M7QA 4CMUA 4Z7HA 4RJ3A 5K5NA 5H8GA 4GRBA 2OIBA 1LEZA 2QOBA 4GUBA 3ZDUA 1OKVA 4DFXE 4U41A 4B4LA 4O0XA 3Q60A 1LR4A 5HLPA 3EL7A 3PA3A 4LOOA 4WIHA 4Y8DA 2C30A 1B6CB 2WQOA 4BDFA 4CZTA 3C50A 3TUCA 3TV7A 2QR8A 2OO8X 4P2KA 3GVUA 3W33A 3NIEA 3R63A 3K2LA 4J8MA 5C8MA 5CAPA 5HTIA 3CEKA 3M1SA 1YI6A 4TWPA 4QMUA 3DB6A 4HJOA 5C9CA 3ZLSA 2XKFA 3QZFA 4MF0A 3UNKA 4I20A 4O0SA 4RVKA 4KAOA 4C8BA 4RRVA 3AMBA 2OKRA 3V5JA 2BVAA 3RM7A 4BGGA 3C4WA 2OI4X 3QTRA 1ERKA 3DT1A 4XG2A 3DA6A 5M4UA 3O96A 3A2CA 4IJPA 4RVTA 3R8LA 3OP5A 2ZDUA 3VBVA 4QYHA 5AP0A 3ZEPA 1YWVA 2ITXA 3KA0A 3P5KA 4KRDA 4KSQA 4U43A 3KCFA 4EZ3A 3BEGA 1H0WA 4FKSA 4RX8A 1W7HA 3GXLA 5L2QA 4LM5A 3R7VA 3D5VA 1GZOA 5E8SA 3VHKA 3BWJA 3QD2B 4R5SA 3LMIA 1OBGA 4L46A 3UQCA 3N9XA 4ID7A 3U9NA 5A54A 1JNKA 5ANDA 5J7HA 3Q4CA 5J1VA 1I09A 4S30A 5E7RA 5AUWA 3VN9A 4IWOA 3MH1A 3TG1A 3U55A 1BL7A 5HG9A 5CEPA 4FTQA 2J0KA 5I5ZA 2R3PA 2V0DA 2PVMA 3ACJA 4AZWA 3MDYA 3UNZA 3PA5A 4YZMA 1YQJA 2YEXA 3OOMA 4FK6A 2JAVA 3HGKA 2JBPA 5M56A 1MP8A 5KKRB 3F66A 5IMEA 3R2YA 3ZDIA 3ZH8A 1OI9A 3WE8A 4GT5A 5AEPA 3G0EA 3PIYA 4Z7GA 4Z9LA 2EB2A 4BCFA 3LCDA 1J7LA 4G9RA 2C3IB 2JDSA 4KB8A 2OFUA 4M97A 3QCYA 4QMWA 4C34A 2CGXA 4FZAB 3F5GA 3QLGA 4CD0A 4E20A 3UO5A 4F1OA 1W0XC 2PVYA 5ACKA 1U54A 5DHJA 3KRJA 3CY3A 5JFSA 3UVRA 2ZM4A 1GZ8A 2PMIA 2HWPA 4W8DA 4YNEA 4NUSA 3R8PA 1Q97A 4HCTA 5AR5A 4ZXTA 2YA9A 4GJ3A 4F08A 3FY0A 5HD4A 1H1SA 3A7JA 3KK8A 1Z9XA 3QCQA 2VWVA 3RAWA 3TKIA 4EH3A 1M14A 5M07A 3SKCA 4XHKB 1YW2A 2QLQA 3SXRA 4G1WA 2GMXA 3HMMA 4M8TA 4BZNA 3C4ZA 4J99A 2Y6OA 4R6VA 5E8TA 3ZTXA 5JT2A 2XM9A 4E5BA 3D7TA 5TR6A 1ZARA 3VNTA 4QP7A 4NFMA 3R7UA 2A27A 3ZO4A 3PXFA 5EHLA 5BYZA 4D28A 1TQIA 4X2KA 3ZLWA 3LLTA 4C33A 4D4RA 3N4TA 2C47A 1V1KA 4BDEA 4QTDA 4QYEA 2E9OA 4EYMA 2ESMA 5DEYA 4ZS0A 4EL9A 3Q9XA 3MWUA 3FMHA 4O0WA 4B8MA 1VJYA 1FMOE 1DAYA 2ERKA 2ERZE 2XVDA 4H3QA 4IBMA 4NKSA 3U6JA 4BYIA 4FK3A 2AYPA 3EQDA 4FNXA 3MFTA 4FV4A 4FZDB 4QMVA 3KU2A 5A9UA 1PXMA 4E4NA 3ORNA 4BBMA 4C58A 3ORMA 4DH1A 2XNNA 5AR7A 5HD7A 3F82A 3PSBA 4M69B 5M4CA 3OF0A 3H3CA 4MCVA 3HV4A 2VO7A 5L2WA 4BKJA 4IADA 3FPQA 3BHYA 4HGTA 1YHWA 4DGNA 4M14A 3UQFA 3ANRA 4KRCA 1JSVA 3Q5ZA 4TT7A 2QOIA 3PVWA 1PMNA 3MI9A 5K0KA 2QCSA 2RGPA 4BI0A 3G15A 1UU7A 2BHEA 4YTFA 2PMNX 3B8QA 2WMVA 3VS6A 4FKOA 3VC4A 4JOAA 2JFMA 1JKSA 5KBRA 2Z7RA 3KXHA 3MVJA 4I0TA 2OJGA 4FSMA 4EH6A 5B2LA 2YLEA 4RWLA 4QNYA 4WD5A 4WG3A 4X3FA 4DEGA 2VX1A 3R7IA 5LMKC 4GU6A 3TL8A 2A1AB 3DK3A 1OPJA 1SMHA 3EYGA 3PPKA 4MD9E 1KSWA 3I1AA 4O0YA 4ZJJA 2ITVA 3K3IA 4GEOA 5CU6A 3QUEA 4D1ZA 5AADA 1KUTA 3UVQA 3BX5A 3NUSA 4V04A 3VBYA 4EH5A 3NAYA 3F3ZA 3IW5A 3IW6A 4CEGA 2XIZA 4XP0A 5KNJA 4KBCA 3R7OA 5KMKA 4JDHA 3GU7A 4EH2A 3HDMA 5HE0A 3KY2A 4EI4A 5BPYA 3KN6A 2PWLA 5IA1A 2YAKA 4BN1A 3HAMA 2VTJA 1Y6BA 2C4GA 5IQIA 2I0YA 4ITIA 1UV5A 3GU8A 3ZO3A 4PMMA 3VBQA 5J79A 2UVZA 2Q83A 3R02A 4FKJA 4FSUA 2EUFB 3V04A 2UZUE 3F7ZA 5BUEA 4X2GA 3R9RA 3F5XA 3K54A 2CNUA 3I7BA 2QOHA 1UNLA 5C01A 2HW7A 3PSCA 5CSPA 3R83A 3HECA 4NTSA 4G16A 3NZ0A 4AW1A 5FGKA 3U9CA 1GIHA 3EFLA 3GU4A 4O22A 5E90A 2QOFA 4DEIA 5A4LA 4ACDA 4JAJA 4U44A 5DN3A 4QP6A 1R0EA 2GQRA 3KXGA 5IH4A 3PYYA 4BIDA 5DI1A 4OTWA 4TYHA 4FTAA 4JL9A 3AXWA 2QD9A 2LAVA 4GUEA 2H6DA 4LI5A 4TWCA 4C4JA 4F0FA 3BI6A 2X0GA 3D9VA 4EORA 3KL8A 3QRIA 5JFWA 3MVMA 4UZDA 1W8CA 3DTWA 2OJFE 1OUKA 3MS9A 3JVSA 1KWPA 2XEZA 1IG1A 4U40A 2V55A 3BU3A 3BYMA 2GHMA 4I5HA 4MBJA 4U3ZA 3QCXA 2HIWA 1U46A 2WMRA 3RWPA 3NYOA 5ANIA 3FYJX 2WMBA 2XK6A 2OXXA 3VBXA 1A48A 3C4FA 2OW3A 1B38A 1QPCA 3PJ1A 4U8ZA 3DOGA 4YSJA 4FIIA 4MD7E 4F1MA 5E4HA 3RAHA 4DN5A 4MXCA 5LWMA 4PMSA 4OTRA 5FDXA 2P3GX 1UNHA 3E8NA 3MB7A 2QU5A 3KEXA 3D5UA 5CSVA 4JI9A 2JDOA 3DS6A 2XS0A 2CKOA 3CQEA 5A4TA 3PRIA 3VS1A 2CJMA 4YTIA 3TDVA 3L8VA 5CASA 4RVMA 4RIOA 1V0OA 4F1TA 2DUVA 4GT3A 4OTQA 1GAGA 5T68A 4FTKA 4ANLA 2O3PA 2YM8A 3HRBA 2JBOA 2WTIA 4TYEA 4AN2A 5AAGA 3W2QA 2Y6MA 3LCTA 3UZTA 1ZAOA 4O1PA 4DH7A 1BI8A 1Q8UA 4NM5A 5M4FA 4HGSA 4IH8A 2OSCA 4CSVA 5KBQA 4BDJA 4F6WA 3DXNA 1DM2A 2WMAA 3LFQA 4MTAA 2XK7A 4FT7A 2JC6A 3I60A 3COHA 3FEGA 4PTGA 4PY1A 2H9VA 4BTJA 3AOXA 4GK2A 2HZ4A 3WF5A 5CXZA 3E64A 4RA5A 4YLJA 4HCVA 4PDYA 3RNIA 4KBAA 4W4WA 3CJFA 3B2WA 2XKDA 2Z7LA 4I24A 4QP2A 4XV2A 5FBOA 1TQMA 4YJPA 3K5UA 4ZTQA 2F2UA 1J7UA 3LFBA 3WILA 4D2VA 3HZTA 3ZUVA 3FI3A 4ZZOA 3EIDA 3BYSA 2J0IA 3EZVA 3QHWA 3ZCLA 3BBWA 5CF5A 4O91A 4FT9A 2R2PA 3QTXA 4MBIA 1MRUA 3Q96A 2WMUA 4FSNA 3NLBA 4C7TA 3D94A 4O82A 4AW5A 2WMWA 4F0IA 3ZONA 4GG7A 4NJ3A 5ETAA 2G15A 1XH4A 4I93A 5DR2A 2ETRA 5TT7A 4ANBA 5HIEA 3EN7A 3TZ8A 4U97A 1KE5A 3LFAA 1JPAA 3LXPA 1BKXA 2ZDTA 3G6GA 3QRTA 4L52A 3AC8A 2VRXA 4DBNA 4IX6A 4KIPA 3LLAA 2ITTA 5K4IA 3BCEA 5AAEA 5D12A 3HV7A 2CLQA 3RK7A 4L3JA 4EKLA 2C6IA 5KMIA 4EUUA 3RM6A 1WBTA 3P9JA 1ZMUA 2UZEA 4BWXA 4C59A 4UMQA 4NWMA 1KOAA 4F99A 4TKSA 5LQFA 4L8MA 4AN3A 3NUYA 4IVCA 1W83A 4YJTA 5CNOA 5HCXA 5J7BA 3UMWA 2BFXA 2VO3A 2ZYBA 4L3LA 5CU2A 3KFAA 3VS0A 3EN9A 4FEWA 1CSNA 3EQHA 4CNHA 4PRJA 4BDKA 5A4EA 1M52A 4IB3A 5L6PA 2QOKA 3EN6A 3DK7A 4DITA 4LGGA 4FKGA 1F3MC 5DIAA 4BDAA 4AFEA 3O50A 5IUGA 5AR3A 1GZKA 4P7EA 4B6LA 5KO1A 3TEIA 2W0JA 3RMFA 1QPEA 3D5XA 4AACA 1FMKA 4UB7A 2YJSA 4H36A 3FSFA 1U59A 5A4QA 5H9BA 4CG9A 4IQ6A 3PDTA 2JITA 3MPAA 2WFYA 3RK9A 4FKPA 5CWZA 4QMXA 4IWPA 4LOPA 1ZOGA 3ALOA 4DG2E 3GEQA 5EQEA 3EL8A 3HDNA 4FIEA 3L9MA 5CSHA 3LE6A 1UWHA 4RX9A 2X6EA 3SW4A 4RC3A 4ANSA 5FTGA 4BDHA 2XKCA 5LOHA 2P33A 5GIPE 4L45A 4EWHA 2Z8CA 3H4JA 3QQHA 1STCE 5FTQA 2GTNA 5EKOA 1R78A 4YO4A 5LVMA 1G5SA 4X0MA 3CS9A 4DLJA 4E3CA 2RFEA 3U4WA 2UZOA 4I41A 3HV3A 5J9LA 3NAXA 4FSQA 3VS2A 2JAMA 3GFEA 3RALA 5M09A 5KMOA 4ERWA 2O8YA 1XKKA 4AP7A 1ZMWA 3FZOA 3RCDA 4EOMA 4C35A 2VO6A 3ZFXA 4EQCA 4X2JA 5HCYA 4RLKA 5IQDA 3FY2A 3FE3A 3UIBA 4GT4A 1OL2A 4QQ5A 5JZNA 2OG8A 4FR4A 5F9EA 4IMYA 3ZS5A 5EQPA 4XG4A 1O6YA 2NPQA 1PKDA 1DI9A 3OBGA 2VWZA 2VX3A 5HG7A 3EQPA 3Q4UA 3QD4A 4D1XA 4N6YA 3PXQA 1ZWSA 4MYGA 2VD5A 4I1ZA 4YHTA 4I5MA 3D2KA 5FEQA 2QG7A 2R3HA 2C0TA 2WELA 4XRJA 1IR3A 2ZV9A 1YVJA 4Z16A 3COKA 4JX3A 3RJCA 3LXKA 4BGQA 1FQ1B 2H34A 1XJDA 2O0UA 2W4OA 4I92A 5E9EA 4D9UA 2P4IA 4YR8A 2YCRA 1H1PA 5AP6A 4I5CA 5KHWA 2JDTA 2WKMA 4F7JA 3PWYA 2ITOA 5DRBA 3TUDA 4KABA 2I40A 4CMTA 4U81A 1AD5A 3RK5A 5HNBA 4HNIA 5ETCA 2GTMA 4BCMA 4H05A 2E9VA 3HP2A 3POOA 2F2CB 4R78A 3VS5A 4DGOA 3NYVA 4GYIA 1G8AA 1F5QA 5CF8A 4I4FA 3PG1A 1PHKA 3VUHA 2XNPA 2GS7A 3O51A 4BBEA 4O7TA 2XZSA 4XV3A 4JG8A 4ZTSA 4AZSA 2PVRA 3FXWA 4FEXA 1OL1A 2R0IA 4FUXA 2OZAA 4WNPA 1LUFA 2WOTA 3QF9A 3DQXA 4OBQA 4V05A 4ZTMA 2WTKB 4Q9ZA 5GINE 4RJ4A 2QNJA 4LV8A 3ZFMA 4UMUA 1JSTA 5H8EA 1Q8WA 4NJDA 4IDVA 3IOPA 2VO0A 3QKLA 2H96A 4E4XA 1TKIA 1WZYA 1V0BA 4C0TA 4BFMA 4MNEB 3EFKA 3S2PA 1A06A 4BDCA 5HE3A 2F57A 4FTMA 2WTDA 3KRXA 1XBCA 2WMSA 2W7XA 1BX6A 3PVBA 4IZAA 5AX9A 4JXFA 3QRJA 4GSBA 3KN5A 4EH4A 2RIOA 4LMNA 4O21A 3E8CA 5HE1A 1HCKA 4A9YA 2ETKA 1ZY4A 3QBNA 3AD4A 3JY9A 3QRKA 4KIKB 3UPZA 2NRYA 4DCEA 2JFLA 2PVHA 4FE2A 5M4IA 1H1WA 2YHVA 5CSWA 3SOCA 1E1VA 1GNGA 4I6QA 3U8WA 5JK3A 1CKPA 3LFCA 4FV2A 4M0YA 4OBOA 4D5HA 5CEMA 4FSRA 1JVPP 1S9IA 2XM8A 2YIXA 4K11A 5CSXA 2P0CA 4KKEA 3HUBA 4ACHA 1JKTA 2XRUA 3ZBFA 4UWYA 5CEOA 3OY3A 3O8TA 3SAYA 2RF9A 4XMOA 3C0GA 4NU1A 5IPJA 5LMBA 3DFAA 4AXAA 3P86A 2ITQA 2WTKC 4IB1A 5I9UA 1U4DA 3ITZA 5ETFA 4S34A 2AUHA 4GH2A 4M0ZA 5M06A 4OAUC 1F0QA 4L43A 4MXXA 5AUUA 2PMLX 3SRVB 3OMVA 5IH6A 3U54A 3ORPA 4PDSA 3QX2A 3I5ZA 3PSDA 3R01A 4K0YA 2CHLA 3PP0A 3C1XA 3KC3A 4L7FA 1UVRA 5CENA 2IWIA 1VYWA 4J7BA 5CANA 2OF4A 1OL6A 3C4CA 3L9LA 3LJ2A 4RSSA 1VYZA 4RIYA 3UO4A 3WIGA 4BCJA 2C5OA 2F7ZE 2A19B 3DBFA 4FIHA 4BF2A 4I4EA 2WEVA 1YI4A 3C4EA 3LW0A 1YDTE 3DBQA 1OIUA 5AX3A 3QALE 1PYXA 4FG8A 4JJRA 2WZJA 4U5JA 1OKYA 3QD0A 2EXCX 2O5KA 4BDIA 4JBVA 3NRMA 4X3FC 3FKOA 2BRBA 3Q4ZA 4QD6A 1UU3A 4AGCA 2GS6A 3DTCA 2UV2A 3RHXA 4EONA 3ZMMA 4O7RA 4AT3A 3IW8A 5B2KA 3VF8A 4XYFA 5AJQA 2UZWE 4HCUA 4WBBB 5DT0A 4C4IA 2IVTA 5IG1A 4QPAA 4V0GB 4O7YA 1PF8A 4G3FA 3ZUTA 4PL3A 4J71A 3H0ZA 2REIA 3ZRLA 1ZZLA 1YRPA 4N70A 3H10A 3JXWA 4EHGA 3LAUA 4YHJA 2YCSA 2BIKB 3LFNA 4G5JA 3NVMB 4JBOA 3GGFA 4GYGA 4D4SA 2QHMA 2PMOX 5FEEA 5DWRA 1XO2B 2RG6A 2X9EA 4QMYA 1J91A 3FLWA 3WF9A 4DC2A 2OK1A 4RFZA 4I6BA 4R7IA 4NM3A 4DLIA 3NPCA 5EOBA 3R7YA 2ITUA 4TL0A 2GFSA 3MESA 4EC8A 4XG8A 4GV1A 3D2IA 2UW3A 3NW7A 3ZLYA 3PY0A 4JR7A 2J0JA 1OIQA 3CY2A 2PUPA 4LUDA 3RZBA 4JX7A 3FMEA 5FWKK 2EU9A 2UZVA 4PPCA 3VS7A 4AUAA 4D2SA 3UG2A 2IO6A 4J97A 1Y8YA 4IAYA 1H8FA 3RPYA 4NL0A 5TE0A 1M2PA 1URCA 4PTCA 5IH5A 4ZZMA 3FMNA 5A3XA 3RAIA 4DHFA 3KULB 4R77A 4UXQA 5LVNA 2ZMDA 3W2CA 5A4CA 3ZOSA 2YZAA 4BDDA 2V7AA 2WU6A 2E9NA 1ATPE 5EW8A 1CM8A 4I6HA 4WOVA 2QOCA 3QZIA 4RG0A 4HVIA 1X8BA 1YHVA 3FL4A 2Y4PA 4GK4A 3H30A 3R71A 4HYSA 4A4XA 5HTBA 3TJDA 5K4JA 2F7XE 4BVUA 3Q52A 4EH8A 2UW4A 4ZZNA 5KCVA 2BHHA 2GSFA 4JIAA 4ENYA 2X8EA 4S2ZA 3G51A 2BTRA 4EOJA 4KS8A 4DFBA 4OT6A 3EQRA 3IOKA 4A9RA 3VULA 4YBKA 1S9JA 2X1NA 4OTIA 3VAPA 4CKJA 5EM5A 4QP1A 2W9FB 4QMTA 3DY7A 3EN5A 4JG6A 4WUAA 4ZSEA 2BTSA 3HX4A 4IZ5A 4FKIA 4FYOA 4XG7A 4IFCA 1UNGA 3FQSA 4NSTA 4RIXA 3NR9A 3R9OA 5B2MA 4QYFA 4IHPA 2GNIA 4XV9A 4IX3A 3P0MA 2YCFA 2BALA 3E87A 4OW8A 4FBXA 4YGAA 3BZ3A 4AGDA 5J5SA 3O0GA 3CTJA 3MVLA 3GI3A 3TM0A 4IAIA 3ODYX 4JG7A 5L2TA 3AGLA 1REKA 3VWAA 3REPA 3L1SA 4Y46A 4E4LA 1PXKA 4Z3VA 4CV8A 1UKIA 4C2WA 4FKRA 4Y72A 4BL1A 5F94A 3AD6A 5JH6A 5DMZA 5AP2A 4G3GA 3AC3A 4HZSA 4LOQA 2CKEA 3PIXA 4O96A 4HZRA 1FVVA 3KXZA 2X81A 3AC1A 4APCA 2BPMA 3G9NA 4QYGA 3Q04A 1YXSA 2CGWA 4UWCA 4UY9A 5CALA 5JQ8A 2FSTX 3LHJA 1PMUA 1R39A 4XCUA 4FV7A 4WNOA 5IQHA 2W1GA 5IDNA 2J90A 4DF3A 3MJ2A 2XK4A 4QPSA 4EEVA 2R9SA 4HW7A 2RFNA 2XNMA 5AV2A 4FL1A 4ASDA 5IQEA 1BUHA 3F3VA 4OAVB 5IA0A 3RNYA 4GKHA 3OEFX 3FZSA 5L6WL 3F69A 4W8EA 3SA0A 5AIKA 2KULA 4H1MA 4ZY6A 5IA5A 2XK9A 3HUCA 3D5WA 5BYLA 1ZYDA 3UO6A 5HEZA 2PVLA 1RW8A 2WTJA 2B9FA 3RKBA 1MQ4A 3WBLA 3BEAA 2IG7A 4D2WA 1XH7A 5ANOA 5HU9A 1XH5A 3AQVA 3NNWA 5J1WA 4C4HA 4MQ1A 4AN9A 1DS5A 1CKIA 3R7EA 5E92A 4WSQA 3TKHA 1WBSA 4W4VA 4JQ8A 4X6RA 3F9NA 3OZ6A 3CBLA 2QI8A 3ZXTA 3KVXA 4GW8A 3EFJA 1KV1A 3PPZA 1UU9A 3ETAA 3TNPC 3ZXZA 2BUJA 4F9CA 4FTIA 2BRGA 2X2KA 2JKQA 5DR9A 2QHNA 4ZLZA 4F9WA 1FGIA 2B55A 3KMUA 5ANEA 4K77A 2W4JA 4WKQA 4UMPA 4O7VA 2XP2A 1U5QA 3R9DA 4QP4A 1ZMVA 2PVFA 3DNEA 3ROYA 5A46A 3LZBA 4TRLA 1FGKA 3V8TA 2JIUA 3BBTB 4BCGA 5FM2A 3V3VA 5IISA 4PTEA 3OFMA 3Q32A 5I3OA 3BGPA 4CFVA 3TTJA 3EOCA 2HZNA 5IQCA 2UW0A 3R8ZA 4H1JA 4WRSA 2XIYA 3ZBXA 5GZ9A 4DGLC 2VTNA 4FIGA 4S32A 5LVLA 3R7GA 3FV8A 2OJJA 3ATTA 2G01A 5HO7A 4EH9A 2IZRA 3DAEA 4Q5HA 3RI1A 3GENA 4CZYB 1JAMA 3D0EA 4DG0E 2X7GA 3FI2A 3V6RA 5KMMA 3LFEA 5EK7A 4PP7A 2PPQA 4QRCA 4NFNA 3S1HA 2X7FA 4HOKA 3SVVA 4C2VA 3COIA 4IVDA 4EOPA 3FJQE 1QMZA 2EWAA 3HMPA 2RL5A 3QYZA 4O83A 1Q4LA 3IKAA 3ZYAA 4ANNA 4AW2A 4H3PA 5HICA 4AGWA 3MPTA 4UMRA 5BUJA 5A6NA 5HCZA 3FZ1A 4ZSGA 5HI2A 3W16A 5EH0A 3UP7A 5GIOE 3H0YA 4O86A 3PWDA 3FPMA 3BKBA 3TWJA 3VIDA 4CFFA 2CKPA 4FYNA 3C4XA 3L8SA 2BZJA 4RFYA 4XBUA 5HTCA 1KE8A 4R3RA 4WBOA 4O7WA 2YWPA 4D2PA 3SGCA 5HIBA 5TO8A 2PL0A 2VWUA 4F09A 4ASZA 3SW7A 3PJCA 3P1AA 3VS3A 4A06A 4A9TA 4MWHA 4ITJA 4NW6A 2UW6A 5M08A 3MFSA 5AUVA 2YIRA 5DLSA 2XEYA 4AOTA 3DBCA 2YFXA 2JGZA 1JSUA 2OIDA 4RVLA 3WF6A 4DYMA 4D0WA 1M17A 3UODA 4MXAA 4ZY5A 3IS5A 4NK9A 2BAQA 4RLLA 4MWIA 4NIFA 3ZZEA 3CGOA 5IQFA 5HHWA 4AU8A 4JLCA 5KE0A 3BWFA 3ZO1A 3O8PA 4F70A 1J7IA 3NUAA 1HCLA 3VUGA 2ZAZA 5HZNA 4PNKA 2CSNA 4CTCA 4IB5A 1Q3WA 4YBJA 4F0GA 4YJNA 3IK3A 4ZSLA 2Y0AA 5DT3A 5JQ5A 5CAQA 3UTOA 4MHAA 2J9MA 4S33A 1W82A 4YP8A 4O6EA 5DR6A 2BDJA 4D1SA 1RE8A 3OTVA 4FOBA 1H25A 3NEWA 1PXJA 4M68A 3CPCA 3GOKA 1PXPA 3AGMA 4AGUA 2BDWA 4G6NA 2ITPA 2B0QA 4LG4A 5IUIA 3KVWA 2G2HA 3A4PA 4RIWA 5EW3A 4AWIA 2YM3A 3H9OA 4N57A 2XIXA 3BYVA 4XG9A 4ZTHA 2SRCA 2Z02A 4MD8E 1CTPE 3R2BA 1VR2A 3QTWA 3PA4A 2EXMA 3I7CA 4FV5A 2GHLA 1URWA 1H07A 3QU0A 4S31A 3TNIA 2UZDA 2YDJA 3B2TA 2OXDA 3JY0A 3QQUA 4JR3A 4QTCA 1BLXA 4FTJA 5DPVA 4DFLA 2RFSA 4FEUA 4IW0A 1RDQE 3EFWA 3NIZA 4J53A 2NNWB 3G2FA 1OMWA 3GOPA 3OCGA 4TZRA 5EDPA 3EB0A 3KMWA 4XX9A 4JIKA 4YNOA 3ID6C 4HPTE 4NTTA 3C0IA 2B9IA 2BILB 4CZUA 5E8XA 3IECA 3M11A 4M84A 5ANJA 3SXFA 4M7IA 4D5KA 3IO7A 2R3OA 2ONLA 4QQJA 3KXMA 2G9XA 2UW8A 4UALA 1E9HA 3BV3A 4UYAA 4CVAA 5I9YA 3ZO2A 4FV6A 4YC6A 3UDBA 2VTQA 4W9WA 3Q6UA 3HNGA 4NM7A 4K6ZA 4FTTA 3W1FA 2F49A 3VS4A 4FEVA 4LMUA 5JFXA 3KRRA 3OTUA 1NY3A 4WRGA 3EYHA 1YXVA 3F88A 4QTBA 2GQSA 1WBVA 3BIZA 2IZUA 5FRIA 3CP9A 4W4XA 3QX4A 4BBFA 3T9IA 1Y6AA 1U5RA 3ULIA 5BVDA 1Q99A 1XH8A 3O71A 3FC1X 4QOXA 5E8UA 3LVPA 5CY3A 4BZOA 4F7NA 4OGRA 3FLYA 2VTLA 4U79A 3PLSA 4I21A 4CRSA 2HWOA 2Y8OA 2R3GA 3IDBA 5DRDA 4C37A 3OEZA 4NT4A 5LVPA 4RZVA 5L6OA 1MUOA 4G2FA 1WBNA 5C8KA 2VTSA 3KRWA 5CF6A 5LJJA 3UC4A 4EOOA 5BMSA 2BZHB 2R3NA 4FKVA 4IE9A 4M3QA 3FHIA 5EG3A 4CFUA 1QPDA 1VZOA 4NEUA 4FC0A 4I0SA 2V22A 3FAAA 3BQRA 3GFWA 4C36A 5BX0A 4XOYA 4TW9A 4EYJA 4IJ9A 3ZC6A 2RG5A 3L9NA 4F65A 1Q24A 3TV6A 3PFQA 3IONA 3UOHA 5G1XA 4YZDA 4YUQA 4BC6A 3LCKA 3OCSA 4JRNA 4LV5A 1Y8GA 3MIYA 3D83A 3FMLA 5BVKA 4QNAA 3GUBA 2BZKB 3ENMA 4FVQA 1ZOEA 4NZWB 3O7LD 3FL5A 4OBPA 2VTMA 4OTPA 5ITAA 3CIKA 4A4LA 1GY3A 5FBNC 4ZAUA 4O7LA 1ZYLA 4N6ZA 1YXXA 2CLXA 3QGYA
chains in the Genus database with same CATH superfamily
4CYIA 5LCKA 1R0PA 3IG7A 3LQ8A 4YZ9A 4K18A 3I0OA 5T6KA 3IDPA 3LCOA 5IUHA 3S3IA 4FV1A 4C3RA 2UW9A 1R1WA 1XH6A 3BQCA 3NUNA 3OWKA 5EDQA 5B0XA 2XBAA 3QHRA 3E93A 3QZGA 5DH3A 3TZMA 4A07A 3LJ0A 3PIZA 4FF8A 3PLAE 2G1TA 5IQBA 3FYKX 2QKWB 3DAKA 3PRFA 2J50A 4K9YA 4C38A 5HU3A 4L67A 2XUUA 5GJFA 5I3RA 4E5AX 5B7VA 1BMKA 3AMYA 5E8YA 2X8DA 2J0LA 4U42A 3IDCA 5AUYA 4QMLA 2XB7A 2DYLA 4HPUE 4C57A 4BWKA 2QOOA 1Q5KA 1ZYJA 1WFCA 4B99A 4B8LA 2ZV2A 3QWKA 4K1BA 2P2HA 3WI6A 3C7QA 3F5UA 3F3WA 3LQ5A 3OCBA 5AMNA 3KF4A 3BLQA 5IEYA 4TWNA 2OU7A 1OUYA 4ZMFA 3R00A 3JPVA 2YISA 4JT3A 3WOWA 4KNBA 3AC4A 4AA4A 4DH5A 4FKUA 2BKZA 3Q2MA 3NYNA 3ULZA 4EQUA 5JFVA 5M51A 2OH4A 4CGAA 1XWSA 3PJ2A 2IZTA 4IFGA 1FOTA 3W2RA 1VEBA 3ZZWA 2W1EA 3QUPA 2CDZA 3SV0A 1R3CA 5IZFA 2VX0A 5FUTA 1Q41A 4F7SA 3R28A 4TYIA 4YSMA 5C27A 3TZ9A 4I6FA 2BIYA 2W1HA 3E88A 4EOSA 3OS3A 4M66A 4J98A 5IDPA 2W99B 4O1OA 3SD0A 3ORKA 4AG8A 5AV1A 3PZHA 4AZFA 4FVRA 3ZM4A 3UYSA 3NW5A 2VU3A 1YWNA 3HA8A 3QZHA 1AQ1A 2QONA 5EYDA 2X8IA 3MGYA 3DJ7A 2C5VA 4JDIA 4J1RA 2X7OA 5J95A 3E62A 3AD5A 2FB8A 3PE2A 3V5QA 4EQMA 2WD1A 3RHKA 1DAWA 3JR1A 3C0HA 5DEWA 3FI8A 4ACGA 1PYEA 5KMNA 4I0RA 3TJCA 3R1YA 2W05A 3NVKI 5HX8A 3K3JA 3U4UA 2VN9A 4NCTA 4HVSA 5KMLA 3QGWA 1W98A 2XK3A 3MW1A 3DKGA 4R8QA 4BWPA 4BCOA 4IZYA 3IW4A 1PRYA 3MBLA 1KE7A 3CQWA 3Q4TA 5AP4A 5HVYA 2WO6A 1U54B 4ZMEA 3CR0A 3PZEA 4FT5A 1H0VA 2XCHA 5ACBC 3SDJA 1ZYSA 5IA4A 3UZPA 1YKRA 2Z2WA 2FA2A 4XRLA 4BCHA 2YDIA 3M42A 4P90A 3NDMA 4CXAA 1ZZ2A 5AM7A 2WTVA 3A4OX 4ZLOA 4U6RA 5HO6A 4J52A 4G31A 4USEA 5E8ZA 2BFYA 4RGJA 4BTMA 3F2RA 2Z60A 5FXQA 1YXTA 2FH9A 3GC8A 4X21A 4FT3A 3SX9A 3L8XA 4M69A 2ZM1A 2XK8A 2FUMA 4Y83A 4DFYA 2KTYA 3VRZA 1XQZA 4QMOA 3D7TB 5AV4A 5C1QB 3IW7A 3DXPA 4F7LA 4IC7A 5C4KA 4L9IA 3VQHA 2ZB0A 3G0FA 2OJIA 5FM3A 3U6IA 1W2DA 2PVJA 4LRKA 3HLLA 3LM5A 3VBWA 3S00A 5AR2A 4XP3A 1WVYA 3VJNA 2XAOA 5D41A 4O2ZA 3ENHA 3W2OA 4D0XA 1WBWA 3RTPA 2G2FA 3BYOA 1J1CA 4RT7A 5LVOA 3QL8A 5JRQA 3AC5A 5FP6A 4F9AA 2HYYA 3AT2A 3G33A 3UVPA 5E8VA 3S95A 4BB4A 1BI7A 1OITA 2E9PA 2A0CX 3CKXA 2BDFA 3QCSA 4J96A 4E4MA 5EM8A 4B0GA 2VWIA 1PXLA 4OTFA 1MRVA 2PE2A 5HE2A 1E1XA 1UWJA 2HXLA 2X9FA 5GHVA 4ANOA 1OB3A 4II5A 4GIIA 5I9WA 2GU8A 3RWQA 2WQEA 1CKJA 3BGQA 4EC9A 1J3HA 2CGVA 2Y4IC 3VRYA 3F7WA 4FSTA 3G90X 4C3PA 4HGEA 4XG6A 2X4ZA 1FVTA 3Q5IA 4K8AA 2PZYA 4L3PA 4TY1A 5FP5A 2XJ1A 2PSQA 3DK6A 3HMIA 5M44A 3ZLXA 2YN8A 3BV2A 4IVBA 3LFDA 2DQ7X 4LL0A 2UZTA 2VTOA 2VWXA 2IVSA 1NVRA 3VW8A 4FZFB 4U45A 4X3FB 2UW7A 1QCFA 2ZV7A 2OLCA 2HW6A 4APPA 4C02A 3V51A 2RFDA 2C1AA 4PNIA 1YI3A 3Q9ZA 2HZ0A 5D1JA 3QQGA 4JS8A 5LWNA 2BKKA 5IA2A 5DFPA 2PZIA 4YJOA 2QVSE 4QMQA 4UWBA 4PL5A 2FSMX 3LPBA 4KD1A 1L3RE 4O4FA 4JVGA 3UYTA 3WF8A 3RGFA 4DAWA 3DFCB 2F4JA 1TFFA 4HNFA 4FEQA 3SG8A 2RKUA 4LQMA 2PZ5A 3F3TA 3EQIA 3OCTA 2WIPA 4JDKA 4BRXA 1IRKA 2X6DA 1V0PA 3II5A 3QXPA 3R30A 5IMXA 4ZTRA 5HIDA 1Z5MA 5F20A 4RJ5A 3PVUA 5T3QA 3U87A 4CRLA 3P79A 3L9PA 5CZIA 3VW6A 1CDKA 1H28A 1RJBA 4DEBA 4FG7A 4FZ7A 4DEEA 3PG3A 3GCPA 2W1IA 3LFSA 4FX3A 4OT5A 4ZP5A 5AV0A 4KINA 5AM6A 3GB2A 4D55A 2W5BA 2C6DA 1WCCA 3POZA 4J95A 5M55A 5ICPA 4A9UA 4DINA 4KUJA 3DDPA 4X2NA 3WZJA 4C4GA 4KIOA 4Q9SA 4NW5A 1TZDA 4CG8A 3GCVA 3T9TA 4DH3A 1OM1A 4MQ2A 5EYCA 1ZLTA 3BHHA 4IAZA 4FZ6A 1M2RA 3ORZA 3MFRA 4JBQA 3AG9A 4PDPA 1JKKA 5EYKA 4TN6A 5H8BA 2YM5A 1O6LA 2HXQA 3PXYA 3ZSHA 2ZVAA 3QTSA 4TYHB 4I5PA 4DTKA 4EHZA 3QTZA 4RWKA 3G6HA 5HNIX 4L53A 4KSPA 5DGZA 2R0UA 3D7ZA 4RPVA 2A4LA 4ZOGA 2C6LA 4C62A 3DBDA 2C0OA 4Y5HA 4BI2A 4AZEA 3KGAA 3MYGA 2Q0NA 3NX8A 5F1ZA 2C5XA 4JNWA 3NNXA 1EH4A 2GNLA 5FG8A 2WPAA 4GCJA 2P55A 5CT7A 3RZFA 3I4BA 2O64A 3UMXA 4MBLA 2JD5A 5C26A 4EOIA 3DU8A 3OROA 4XOZA 2C6KA 3KMMA 5EM6A 5G6VA 3FC2A 3UBDA 4MKCA 2I0VA 2CMWA 2UZNA 1Q8YA 4FICA 5HBHA 1NW1A 3QD3A 3ZU7A 4FGRA 4O6LA 5TOZA 3EH9A 5KHXA 3DDQA 5C4LA 3HYHA 3V8SA 3LXNA 4G3CA 4H3BA 4D4VA 4BJJA 4E26A 2ZJWA 2VTHA 4MVFA 4CFXA 3TDWA 2WMXA 1P4FA 1B39A 3CXWA 3FMDA 4XJ0A 4PQNA 3E8DA 1G8SA 1K9AA 3MY1A 4G6LA 5KMJA 4EHEA 4QMNA 5AP3A 5AUZA 4D2RA 3C13A 2WXVA 2UVXA 5LARA 4PPAA 3WYXA 4L68A 2R3MA 4WA9A 1M7NA 5BNJA 3SLSA 4YTHA 3W0QA 2ACXA 5L8KA 2J0MB 3E7OA 3MSSA 3R1NA 1OBDA 4R3CA 4FL3A 4GVJA 5GJGA 5AA8A 5F4NA 5HESA 2IF8A 5CX9A 4WNMA 4O7NA 4QDEA 4RMZA 5IQGA 3EZRA 4Q2AA 4ZTLA 4UN0C 3HV5A 2ONLC 4FTRA 1Z57A 5FLFA 5GJDA 3UOLA 1TQPA 2YDKA 4CKIA 3BPRA 4EWQA 3DXQA 2YABA 2PTKA 5E1EA 1TVOA 3V5TA 4YJQA 5IF1A 3P4KA 2FO0A 5CNNA 5AR4A 4GVAA 4CCBA 4DA5A 2C6TA 4I22A 4IAKA 4C3FA 2VZ6A 1Q62A 2HAKA 5CZHA 3HA6A 4ASEA 3OWLA 4P5ZA 2HY81 2W1FA 5LXMA 1OPKA 3T3UA 3ANQA 3HMOA 5EOLA 1PXNA 3GBZA 2HZIA 5CAOA 2W1ZA 2V7OA 3CGFA 2J6MA 4IEBA 1QPJA 3PXKA 4N4SA 3TIYA 2I0EA 4MK0A 3TACA 5JN2A 5CEKA 2PK9A 2B9HA 3QQLA 4OR5A 5HG5A 3AKJA 4QP9A 3ZUUA 3Q53A 1NVSA 4EOLA 4U80A 3UJGA 3QTQA 2W9ZB 3FQEA 4QMMA 4IAFA 2B1PA 3EWHA 3JS2A 4PV0A 5CVFA 4I23A 5EFQA 3KREA 4EBVA 3LMHA 3ROCA 2HY0A 3MY0A 5BVOA 5CAVA 3DZOA 5EYMA 5L3AA 3E63A 3P08A 1PY5A 3AT4A 3G5DA 3R9HA 2XYNA 3V8WA 2PE1A 3O7LB 3UQGA 1PJKA 4A4OA 2I6LA 3OD6X 4EK5A 4IM0A 4YMJA 4FUYA 3HV6A 3TV4A 4CTBA 3IQ7A 4FSZA 4R7HA 4LUEA 3EHAA 2YCQA 4RC4A 4G3EA 4RJ7A 3HRCA 4U7ZA 3BHUA 3W8LA 3HKOA 5FXRA 4ITHA 3W32A 3CQUA 4CMOA 3FKNA 4MXOA 5J5TA 4RFMA 1Q61A 2YM7A 4KKHA 3W2PA 5AP5A 1IASA 4GFOA 4WUNA 2B53A 4WSYA 2AC5A 2YM6A 4BKZA 2XF0A 5L8JA 3LJ1A 3ZFYA 4ANQA 1GOLA 4DFZE 1H1RA 3MJ1A 3RCJA 3W10A 4BHZA 4U3YA 2WMQA 2XBJA 1KE9A 3HVCA 4YO6A 3LIJA 4PDOA 2XJ2A 2JIVA 2PY3A 2W1DA 3EQFA 3H9RA 3LCSA 4YC3A 2IPXA 3E3PA 4XS2A 2Z7SA 3MPMA 3HP5A 4YLLA 5CAUA 2OIQA 4XP2A 3I6UA 4EK3A 1SNXA 5BVEA 4AF3A 4E6QA 2WOUA 3MA6A 3ZC5A 3VUMA 4RX5A 3EJ1A 4X3JA 3QWJA 2GFCA 2OFVA 3RPVA 2GNFA 3R1QA 4WG4A 4AQCA 2XNBA 2R3IA 1H26A 4NH1A 1REJA 4ZJIA 5C8NA 1SM2A 4ZIMA 4WT6A 4EJ7A 3V6SA 3AMAA 3G9LX 4RX7A 3Q9WA 3P23A 4EK8A 4Y73A 4Y85A 4IIRA 2B54A 2BR1A 2WHBA 2WQNA 4GS6A 2V62A 4YJVA 4LGHA 3UGCA 4BIBA 4K33A 1NT2A 3LQ3A 3U6HA 2QOLA 2R3KA 3TNHA 1H08A 4JQEA 4NKAA 4A9SA 2PUIA 2XJ0A 3DPKA 4QP3A 2JKMA 3PP1A 4GMYA 3HRFA 3W2SA 2IN6A 4QQCA 3EKNA 3FMJA 4DGMA 2XAMA 4EOKA 2OBJA 3P7AA 1AGWA 2WQMA 3ORTA 4R1VA 5CLPA 5FTOA 2X2LA 3PTGA 5EDRA 5DG5A 3SHEA 3OG7A 5JSMA 4Q5EA 2PUNA 4QMSA 2Q0BA 3CC6A 2E9UA 4YJRA 2VTAA 4BGHA 1PKGA 5I0BA 4ONAA 3FQHA 2CPKE 4FSWA 2P2IA 5JRSA 3MA3A 1WBPA 2IW8A 2VAGA 2C5YA 4ZY4A 3UE4A 2GNHA 5KKRC 3BYUA 2WTWA 2I7QA 1PW2A 3EKKA 3KXXA 3MH3A 1GIJA 3UIUA 4JAIA 4D58A 3FLQA 3VUIA 3WZDA 2C3JA 4ENXA 5A14A 2CNQA 4DTBA 4AZVA 1WVWA 1ZOHA 1APME 2QO2A 4RBLA 2R3LA 5EI2A 5AWMA 4ZJVA 1YWRA 4ZK5A 4AA0A 1OIYA 1PMEA 4AW0A 2EXEA 5HORA 4HVDA 3OOGA 4FNYA 3A8XA 5I9XA 4OTGA 3F6XA 2JIIA 4GK3A 4BDGA 3ACKA 2PZRA 1UA2A 3GCSA 1K2PA 3ZEWA 4MNEA 4M12A 4MX9A 4IWDA 5DOSA 4DG3E 4DHJA 3RAKA 4RC2A 3A7GA 4ANMA 4FVPA 3FZRA 4YURA 5HKMA 1SVGA 1CMKE 2BRNA 2W4KA 4OUCA 3WARA 4RQVA 2B4SB 3I5NA 4NCTC 3FZPA 4XNEA 4CQEA 2WB8A 3QYWA 4IM2A 1H4LA 4USFA 3ERKA 3I6WA 1HOWA 2OZAB 4M13A 3CLYA 4KIKA 4ACMA 4USDA 3UPXA 2O2UA 4BI1A 4MXYA 4R7BA 4FV3A 5DA3A 2W96B 4G34A 4TNDA 4BY9E 4ERKA 2C6EA 5BUIA 4BIEA 2R64A 2NO3A 3E5AA 3EQBA 4PMPA 3MB6A 3AC2A 3OBJA 4KWPA 2X0OA 4DEDA 5A6OA 1IEPA 3EQCA 3LOKA 4TTHB 4TXCA 5D11A 2XNEA 1NA7A 3SOAA 4PX6A 3LKMA 3DCVA 2CN8A 4X6QC 2NRUA 4AE6A 5I9VA 2WQBA 1OECA 3ZRMA 3L8PA 4BR3A 5DE2A 3QA0A 4OLIA 3SRVA 4CCUA 3QC4A 3DLSA 4LL5A 3OXZA 2HK5A 1G3NA 3QTIA 4GJ2A 1G8KA 3M2WA 4FV0A 5C03A 5CI7A 4FL2A 3GP0A 2EB3A 3P78A 3S4QA 4DTAA 2FSOX 3JUHA 4TPTA 5CTPA 2VNWA 3GQIA 3I81A 1Q8ZA 2GHGA 3QA8A 3ZHPC 3ATSA 3NWWA 3TZ7A 3WZUA 4QQTA 3V01A 5HLNA 3KK9A 2JKOA 4ZEGA 3MH2A 5IKWA 3BE9A 3TNWA 2ITWA 4BTFA 1XBBA 3GCUA 4QT1A 3W0PA 4EK6A 5CXHA 2UVYA 4RWJA 2BMCA 1OPLA 3UNJA 2GS2A 2X39A 4AA5A 5CVGA 2WTCA 2VWBA 2XRWA 2YERA 1MRYA 3DLZA 4W4YA 3H9FA 4ASXA 1RQQA 2OWBA 5D9HA 4ALUA 4RZWA 3NSZA 4FMQA 4EZ7A 2AEGA 4R1YA 4FTLA 2R3JA 4IZ7A 4AT5A 5ANGA 1OKWA 2XA4A 3PXRA 3F2AA 3OT3A 4V0GA 5DYJA 3TUBA 4ORKA 2F7EE 5BMMA 1QL6A 2B7AA 3FLSA 4RIYB 3PVGA 4DH8A 4M15A 5HGIA 3BLRA 3COMA 1SYKA 2HENA 4H58A 2X4FA 4KKGA 3UIMA 4E5WA 2PUUA 1O9UA 4L6QA 3MH0A 1IA9A 3GU5A 5CU3A 2QQ7A 4YPDA 2J5EA 4XLIA 2PULA 1ZRZA 5EM7A 2QODA 2B52A 2R3RA 4IM3A 2PHKA 3TT0A 4X7QA 2Y7JA 2JLDA 4WG5A 4RJ6A 3VUTA 4YU2A 4GIHA 1BL6A 1OL5A 3CCNA 1P14A 4E6CA 3CJGA 4D2TA 3PUFC 3C9WA 4X2FA 4E8AA 3LM0A 4M67A 5AIRA 4MEDA 2R3FA 4XEYA 3N4UA 4L00A 5AUXA 3SC1A 2ZB1A 1SNUA 4ZSAA 4FG9A 2XIKA 2O65A 2YACA 3QFVA 2C6OA 2QO7A 4IC8A 3CD8A 4E7WA 2PYWA 2V5QA 4E93A 2YITA 3OW4A 3KULA 3MTFA 2VWYA 4H39A 3R9NA 3Q2JA 4F4PA 4FI1A 4F64A 4FIJA 3BU5A 4G9CA 5FEDA 3W18A 3OXTA 5JGBA 4CFNA 4XLVA 4BCPA 2HELA 5HVKA 5E8WA 5HBEA 3DAJA 3E7VA 4JRVA 4F63A 5AA9A 3GT8A 4O81A 4GL9A 1ZXEA 3FDNA 3R1SA 4AE9A 3FUPA 4RQKA 2GNJA 4OTHA 3ZSIA 4AX8A 4AS0A 2QURA 5HNGA 4JDJA 3A7IA 3R8MA 3VUKA 3ODZX 5AUTA 3R8UA 2NYAA 5GNKA 3MY5A 3EQGA 3FHRA 1KOBA 3FZTA 5H3QA 2BAKA 3C51A 4G3DA 4PUZA 3ORIA 4G17A 3BELA 2F9GA 4IAAA 3QLFA 3W8QA 2GNGA 3WZKA 5F95A 3UP2A 2BRHA 5I4NA 3WYYA 5IEVA 3UOJA 3D4QA 3R21A 1YDRE 3E3BX 3UIXA 2VUWA 1JWHA 5AV3A 4CQGA 5DVRA 5K5XA 3W0RA 2W06A 3QTUA 3BL9A 5HLWA 3FMKA 2UZBA 2VWWA 2C5NA 3F61A 4XBRA 4ALWA 3CPBA 4FTCA 4O0VA 4O7ZA 1YDSE 4FA2A 1H01A 4LFIA 1ZYCA 3DKFA 4TYGA 5FQDC 4FOCA 1YHSA 2DWBA 4QO9A 1XBAA 4ZLYA 3BRBA 4WHZA 2LGCA 3FBVA 3TNQB 3HL7A 3B8RA 5L4QA 3NNVA 3DKCA 5DNRA 2IW9A 5L8LA 1OIRA 2GPHA 3LXLA 4HVHA 2J4ZA 3DJ5A 2OICA 3EMGA 3KXNA 5M57A 4YTCA 5CQWA 3I0QA 5H2UA 4FKTA 5BYYA 2ITZA 4UMTA 5HQ0A 2BCJA 3F5PA 4FIFA 2WEIA 1J1BA 1XR1A 3P7BA 2ETMA 4PP9A 1H24A 4MXZA 4Y95A 3SXSA 3KF7A 1FINA 4CKRA 1OKZA 2YIQA 3GC9A 1A9UA 3UC3A 2HCKA 3A7HA 3N4VA 2CNVA 5J8IA 4PL4A 4UXLA 4RIXB 1FVRA 3EN4A 4I3ZA 4TWOA 3A62A 4RWIA 4LRMA 2QKRA 3MFUA 1JOWB 1H00A 3DJ6A 3F3UA 3K5VA 3QC9A 1Y57A 1SVHA 3THBA 2BROA 4YZCA 3FLZA 2E2BA 3DKOA 3O17A 1GIIA 3T3VA 2XMYA 4MF1A 4AAAA 5DT4A 3TKUA 1YXUA 2GDOA 3PE1A 5CVHA 5KUPA 3DGKA 4PWNA 4QMZA 3D15A 2G2IA 3BU6A 4FNWA 4FSYA 1P2AA 1LEWA 4BDBA 4NYEA 2EVAA 3TI1A 4PF4A 4O7SA 3NUPA 2GQGA 3OVVA 3GQLA 5L2SA 3QUDA 4EK4A 2YWVA 3Q6WA 3NW6A 4R3PA 4HYIA 4EKKA 3GU6A 2ITYA 2VV9A 5HG8A 3OC1A 4E6DA 2J7TA 3D14A 4XV1A 2A2AA 4I94A 3R8VA 4EHVA 4IB0A 3DB8A 2I0HA 5HOAA 4YHFA 5DBXA 3MIAA 1WVXA 1Q8TA 2PVNA 4B7TA 3IPHA 3CTHA 4AZTA 5JMSA 4BYJA 3ALNA 3NNUA 2O63A 4GU9A 2CGUA 2YIYA 3HAVA 2PE0A 3GNIB 4QP8A 3VBTA 3R73A 3TIZA 4DE4A 3WIKA 3FKLA 3PXZA 2XNOA 5FDPA 5LMKA 4G5PA 4XUFA 4IXPA 3DBEA 1JQHA 3BE2A 2WMTA 4PPBA 3DQWA 5IQAA 2ITNA 4DT8A 5D7AA 3GC0A 2ZMCA 1VLRA 3OWPA 4AFJA 2ZM3A 2JKKA 1PXOA 2R7BA 4L44A 4KIQA 4U0IA 3BLAA 2UUEA 4F6UA 3VF9A 3JVRA 4QEBA 3NS9A 4E6AA 4ARKA 2W17A 4P5QA 2IW6A 3UOKA 2YM4A 3E8EA 4J8NA 3R04A 3W55A 4EBWA 2Y4IB 1IAHA 3OY1A 2GCDA 2IZSA 4QTEA 3A99A 1NVQA 4FT0A 2R7IA 5CT0A 5TF9A 4UX9A 2W5AA 3NYXA 5LCJA 3S0OA 4ZTNA 1KE6A 1T46A 4YC8A 4MUQA 3BHTA 4EUTA 2XNGA 1SVEA 2OGVA 4FRFA 4UZHA 3RPRA 3SQQA 5EI6A 4FTOA 1MQBA 3QQKA 3JYAA 3NCGA 3V5PA 4BCNA 1BYGA 2B9JA 2HOGA 3KQ7A 5EKNA 2IJMA 4MNFA 1FPUA 1UU8A 2W5HA 2RSVA 4FNZA 3RPSA 2CKQA 5JKGA 2R3QA 3WF7A 2OF2A 5BVWA 2I1MA 2XH5A 4FV9A 5KZIA 3TXOA 1LPUA 4N0SA 4O27B 1DI8A 4OTDA 3CSVA 2QLUA 3OUKA 5HO8A 3FWQA 2QOQA 3RBWA 4E73A 4IANA 2IVVA 4C4FA 4L42A 5EQYA 2R5TA 4BCIA 3MTLA 4YPSA 4R5YA 2CN5A 5AP1A 5EI8A 1W84A 2DS1A 3N51A 4U9AA 4BCKA 3KRLA 1OGUA 3UDTA 3QRUA 3MV5A 3A8WA 3QXOA 1JKLA 2NP8A 1K3AA 2C68A 1KV2A 4O0UA 1GJOA 5JZJA 5JEBA 4L7SA 3CD3A 2BZIB 4TYJA 4WNKA 4HYUA 3HMNA 1YOMA 3UZRA 2FYSA 1JLUE 2C0IA 2QU6A 4KS7A 3VQUA 4O84A 2J51A 3U51A 4RA4A 5J87A 4D4YA 5JGAA 3LMGA 3SG9A 5E91A 2PZPA 4QTAA 4DHIB 3NUXA 4G6OA 4DT9A 1P4OA 2PVKA 1H1QA 3PY3A 3A7FA 1JBPE 4BCQA 5HX6A 1XHAA 2YZLA 5L2IA 2OJ9A 3DNDA 4K2RA 4IWQA 3ORXA 3FXXA 4CT1A 4KBKA 3AT3A 4FTNA 5EHYA 2C3LA 5CU4A 4C61A 4C4EA 4IX5A 5J9YA 3E92A 4YJSA 3NMUF 4W9XA 4BTKA 1P5EA 2XANA 4LGDA 4YJUA 3Q9YA 4KA3A 4UYNA 2WGJA 3FMMA 1OZ1A 4CT2A 4Z55A 5HBJA 3KKVA 3QAME 5HVJA 2IVUA 5CEIA 3OXIA 3A61A 4NIFB 5AR8A 3RVGA 5CS6A 4BKYA 5FD2A 4DEHA 1ND4A 1T45A 4CFWA 4LV7A 5FXSA 2XCKA 4UBAA 4A7CA 3DV3A 3HEGA 3P7CA 2XKEA 3GCQA 4XG3A 5IEXA 4JBPA 5EW9A 4CLJA 5J9ZA 3Q3BA 3CTQA 5I9ZA 1WMKA 2YIWA 2JDRA 2JDVA 1I44A 4BICA 4GFGA 5AP7A 2WU7A 5CYIA 2UW5A 3VJOA 2C3KA 2YAAA 2VTIA 2FSLX 3GC7A 4JQ7A 4O38A 4TNBA 3RP9A 4F78A 1GZNA 2OZOA 4QPMA 1FBNA 3CE3A 4V01A 5BVFA 2FVDA 4O0RA 2VTRA 2X0PA 4O0TA 4ACCA 3ET7A 5D10A 5CF4A 1UKHA 3FLNC 3BHVA 2YLFA 2QG5A 2OXYA 3ELJA 3I79A 4EZ5A 1M2QA 2J5FA 3BGZA 4ZSJA 1NXKA 3VHEA 3PUPA 2VTPA 3QKMA 4CLIA 2YJRA 4RIWB 3NUUA 4O2PA 1Q3DA 2WAJA 3IGGA 4UV0A 3IGOA 2J2IB 5D7VA 5IU2A 4MH7A 3ORLA 4XH6A 4BZDA 3O23A 4FGBA 4GFMA 4Y5QA 3MVHA 5GZAA 3C5UA 3OWJA 4QMPA 4NM0A 3FI4A 5KX8A 4AT4A 4B9DA 5ETIA 2XYUA 4YZBA 4CV9A 1ZY5A 3O2MA 3R0TA 5BQ0A 3MN3A 5CEQA 5CU0A 4HYHA 4PMTA 3QKKA 3UG1A 4F6SA 5GZ8A 4DEAA 3VVHA 2VNYA 4FKLA 4HGLA 5LMAA 2W1CA 3OT8A 4DDGA 2PU8A 4WO5A 3V5LA 4FODA 4UEUA 4GKIA 2C1BA 3PJ3A 4GG5A 5EHOA 4L01A 5M53A 1H27A 2JEDA 4MAOA 2VGPA 3KCKA 4IACA 4FTUA 1YOLA 4F9YA 2QC6A 2WIHA 4FKQA 3BLHA 3PPJA 3FXZA 3RINA 1Y91A 3VO3A 5E1SA 3OW3A 2ZOQA 5AFVA 4YZNA 4FKWA 3ZRKA 3C5IA 4IX4A 1L8TA 1XH9A 2BAJA 3OHTA 1OL7A 5K3YA 5KZ0A 4DFNA 4ZS4A 2C69A 4RJ8A 3ZSGA 1IA8A 2H8HA 2OH0E 3P5JC 1OVEA 1YOJA 5TKDA 4LYNA 4ALVA 4D9TA 4EOQA 4EH7A 4EJNA 3T8OA 3R22A 1WAKA 1SZMA 3A60A 3LFFA 3QQFA 3R6XA 4DFUA 3FSKA 3NGAA 3RPOA 4DGGA 3TTIA 5K0XA 4FV8A 2QR7A 1O6KA 2VGOA 2Y9QA 3PY1A 2FGIA 4LRJA 3TCPA 4CYJA 3NCZA 3ZM9A 1PMVA 3VUDA 3TN8A 3F2NA 3V5WA 4DCAA 5ANKA 5AAFA 2QO9A 2X2MA 3WE4A 4CFMA 2XIRA 4YLKA 3PJ8A 2VTTA 2ZV8A 4F9BA 3CKWA 4QYYA 5CI6A 4IDTA 2CCIA 4BHNA 1IAJA 2CCHA 4IVAA 4P4CA 2BRMA 1LP4A 2R4BA 2WNTA 2Z7QA 4AOIA 1WBOA 4DBXA 5JGDA 4E1ZA 5IA3A 3DZQA 5BVNA 3O8UA 5CQUA 4HVGA 2AC3A 5K9IA 3QQJA 4AOJA 4AAYA 3WZEA 1PXIA 2C6MA 3OUNB 2UZLA 3KB7A 1M7QA 4CMUA 4Z7HA 4RJ3A 5K5NA 5H8GA 4GRBA 2OIBA 1LEZA 2QOBA 4GUBA 3ZDUA 1OKVA 4DFXE 4U41A 4B4LA 4O0XA 3Q60A 1LR4A 5HLPA 3EL7A 3PA3A