3PUPA

Structure of glycogen synthase kinase 3 beta (gsk3b) in complex with a ruthenium octasporine ligand (os1)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
348
structure length
346
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title Structurally sophisticated octahedral metal complexes as highly selective protein kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 346
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pupA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pupA01
1NW1A 1SM2A 3JY9A 4PDOA 4V0GA 3VHKA 4FNXA 4CYJA 2PE0A 4IB1A 4BWXA 3FZTA 4D4RA 4YJSA 3U9CA 2IW9A 2JKOA 4UY9A 4OBOA 3PSDA 4ZJJA 3UMXA 5CVFA 4FTTA 4N57A 1YI6A 3BWJA 3A62A 4HPUE 5TE0A 1LP4A 3WIGA 2P4IA 4TNBA 2GHMA 4G16A 3DV3A 5FUTA 4JDKA 3ZFMA 4M14A 3FE3A 4H1JA 1PXPA 3ODYX 5LMAA 4NEUA 5FP5A 3ET7A 4C8BA 1YDTE 3N4TA 5LWMA 5C1QB 4KIKA 5DWRA 3CKWA 2ITQA 4PDPA 3A61A 3HMMA 4PUZA 4EH7A 3NNUA 4DBXA 4L01A 3QYZA 3V5QA 4DTAA 4FNYA 5AUWA 4FKSA 5K5XA 5K0KA 1Z5MA 4BR3A 4R3CA 4FTOA 2YDIA 2E9VA 2Z7RA 3R1QA 4D28A 2ETKA 3MB6A 1XH8A 1H07A 2X9EA 4BRXA 4DH1A 5GJFA 3VBQA 3PRIA 3AC5A 5FM3A 1DI9A 3UE4A 1FMKA 1DAWA 2P55A 4UX9A 5CXHA 2QU6A 5ETFA 2YA9A 5AR7A 4HVIA 4U5JA 2ETMA 3EFLA 4QYEA 5CSXA 5I4NA 5LMKA 3LOKA 3WE8A 4MXOA 4FV3A 5HLWA 4ANOA 1WBPA 4DEBA 2UZUE 3BZ3A 3MH2A 4EC9A 3ZXTA 2C6IA 2GFCA 3TV4A 5IUGA 2JKMA 5JRQA 4D2RA 2HELA 3P7BA 3CC6A 4PX6A 4EH9A 3K5UA 2PUUA 2I0YA 4APPA 3GFEA 3AC4A 3LQ3A 3FXXA 2BDFA 1YVJA 5I9ZA 3K2LA 5EM7A 4USFA 1H00A 2QD9A 3WI6A 3T9TA 4ZJVA 4FG7A 1YHSA 2OJIA 3NUXA 4RSSA 4C0TA 2B1PA 3UMWA 4LRMA 1R3CA 4MAOA 4HZSA 4QYGA 3C4XA 2QOCA 4K8AA 1QMZA 2GTMA 4MCVA 4WNMA 5AM7A 5EG3A 2YZAA 3MDYA 4LUDA 4BVUA 3MA6A 3BEAA 3D7TA 1P5EA 3L8VA 3VULA 2SRCA 4BI0A 3KEXA 5GINE 5H8BA 4FBXA 3FPQA 4GFGA 4F6WA 4HCTA 3TTIA 1M2PA 1ND4A 5AM6A 3ZYAA 4IH8A 4JIKA 2WNTA 2RFSA 3W2RA 4TTHB 5HTBA 3IDPA 3OC1A 3HMPA 3UNJA 5L2IA 4ALUA 3E8NA 4TXCA 4E4MA 5DNRA 5J7HA 1H27A 3TZ7A 1WFCA 4I22A 4GK4A 4X3FB 4RGJA 1P2AA 4MQ2A 2ZAZA 5EHLA 4C3FA 3SX9A 3P78A 4YBKA 4HYHA 3CY2A 1O6KA 4BZNA 3UNZA 4NYEA 4PTGA 4AF3A 3K54A 1A48A 4J96A 4ZZNA 3TN8A 3D5WA 2IJMA 3KVXA 3QA8A 4PMTA 4CFVA 2BHEA 2UW0A 3CQWA 3MESA 5HNBA 3VS6A 5HVKA 3VBXA 3DNEA 3A4OX 3PJCA 3LCDA 4FV4A 2BFXA 4EQCA 2XNGA 2BZIB 3Q4ZA 4EBWA 4M84A 4DG3E 3FZ1A 3CPBA 5ACBC 4GYGA 1G3NA 4KS7A 5E8TA 2J90A 4LMUA 1J7UA 2RFEA 4NK9A 2Z60A 3GNIB 5EYMA 2RGPA 3QQHA 1WBWA 3IDBA 4PDSA 5CSHA 4GSBA 2UW4A 1VYWA 3R21A 2O64A 1PMEA 1JVPP 3DBEA 4G6OA 5BQ0A 4N0SA 2CJMA 2GNFA 3C5IA 3O51A 3PYYA 4FZFB 4NM3A 4KABA 4DGLC 3MJ1A 4DH3A 5DLSA 1Y8GA 3LXLA 1H24A 4IM0A 4KKHA 5F1ZA 3R30A 1UU9A 3PZEA 4M13A 1H1PA 1REJA 4YTHA 4PL3A 5AADA 3UG1A 3NNXA 5JMSA 5A14A 2PUNA 2WQMA 1ZY5A 3OWLA 1W0XC 3PSBA 4XG6A 2AC3A 2BFYA 4C62A 5HZNA 4PNKA 4E6AA 2W5AA 4GVAA 3RPRA 3ANQA 2R3HA 4XCUA 4UBAA 2IW8A 3GU4A 4G31A 4RWKA 5HG7A 4P7EA 3PJ3A 2BAQA 4TWCA 5CTPA 3QU0A 4JAIA 4ALVA 2QI8A 3ZSHA 4ACMA 3FXWA 5HNGA 4Z9LA 2JLDA 1MRVA 4YUQA 5IISA 1YXTA 3TG1A 5IDPA 2YCSA 4O0RA 4L7SA 1JQHA 4O1PA 2J4ZA 3BYMA 2G9XA 4XMOA 3V5JA 4WUNA 2X2MA 4IVAA 2PL0A 5L2QA 2YABA 4LM5A 1CM8A 5E8UA 3L9NA 4MK0A 4BL1A 3E93A 1XR1A 3DXNA 4OTIA 5M4FA 4DT8A 2HXQA 4R5SA 4ANMA 3ZH8A 2VTOA 3FQEA 5FDPA 1ZMWA 4FNWA 3WF9A 4QTBA 4OAUC 3NNVA 2EWAA 2XRWA 3OD6X 3SAYA 1BYGA 3G90X 3KN5A 5A4LA 5I5ZA 5CU6A 1IAJA 4LOQA 2XEYA 3HV4A 3R7YA 2QOIA 3O23A 4DT9A 5CSVA 2R2PA 2VRXA 4JIAA 2A4LA 4D58A 4RX8A 3PJ1A 3O96A 4GT3A 1R0PA 3FYJX 3BV2A 4C37A 2RF9A 3MB7A 3UDBA 4UALA 3QZFA 4GG5A 2ZV7A 3G33A 3AGLA 5C27A 4RJ6A 2GS2A 4A4LA 4BCIA 3DBFA 3FZPA 4KAOA 5HIEA 3AG9A 3PVWA 3T9IA 5FEEA 5LWNA 4HJOA 3H30A 3KN6A 4BZOA 3BE9A 1R39A 2QOLA 4OTFA 5I9UA 3UC4A 3LFDA 3MW1A 4EOLA 3R6XA 3RINA 3TNHA 3Q2MA 4K1BA 3ZC6A 5F94A 4QMZA 4XH6A 3PZHA 3UO6A 3R28A 4FSTA 2VO0A 2YCRA 1YOLA 3H4JA 3VW8A 2QOQA 1BL7A 3PY1A 3RJCA 3ENHA 4U79A 1Y6AA 4U97A 5BUIA 5JQ5A 1OVEA 4WOVA 4K2RA 4XLIA 2XH5A 3PJ8A 4PNIA 3HV3A 4ZSJA 2W9ZB 3COIA 3R9OA 2WMWA 4FSUA 3Q5IA 4J95A 1CTPE 1OKWA 4OTPA 3LXKA 5E8VA 4ZSLA 5HI2A 3SD0A 5BVOA 5AV0A 2OZOA 2I0HA 1KWPA 2W1HA 2WQNA 2X39A 2GQRA 3VIDA 2UZVA 3A7HA 2XKFA 1J1BA 4QMXA 4S32A 1URWA 4LRKA 4ZZMA 2V7OA 3LAUA 3AT2A 3BHVA 4G34A 3QTQA 1Y8YA 5AP7A 3RKBA 3EN9A 4FIFA 4CFNA 4PMPA 4AW0A 4WSYA 4ASEA 1RJBA 2F2UA 4TL0A 2CMWA 2W4JA 4KSPA 3P79A 4L68A 3UJGA 5J1WA 2OZAB 4B0GA 2PZIA 3AC1A 4QP8A 3NS9A 5K3YA 4J1RA 1UKIA 5AIRA 4QMLA 4EH8A 4YC3A 2HENA 4IHPA 4EK4A 4IAKA 4X6RA 5B2KA 4BKYA 3D2IA 4RQKA 2JIUA 1Q4LA 2WTKB 1RQQA 4O96A 5D10A 4ZS0A 5DA3A 2WMTA 3QQUA 2OJJA 5DT0A 4ZTLA 3UVQA 2DWBA 4M0YA 4RVMA 5LVMA 3TZMA 1U5QA 5EW8A 4EI4A 2E9NA 4LQMA 2R3PA 1QL6A 5CF6A 4JVGA 4QT1A 2YISA 1YOJA 3PXYA 3UBDA 2ACXA 3UVPA 5BNJA 5JEBA 4TWOA 4RJ4A 4GKIA 2X7OA 4E5AX 5M4IA 4M7IA 4FEQA 4TN6A 3U4WA 5CU3A 2Y7JA 2I40A 3S0OA 5A4QA 4EH4A 5EM6A 2W99B 3V8TA 2H34A 4W4VA 3QAME 2E2BA 3GOPA 4FV7A 4YNEA 3W8LA 2OFUA 4O0VA 2CNQA 3KRWA 4FTMA 4DC2A 2YJSA 3IW6A 5F4NA 4BCKA 3HUCA 3R9DA 3ZSIA 1PXMA 4UEUA 4J71A 3TKHA 3UYSA 4FTNA 4IAFA 5JSMA 1YWNA 3F3TA 3W2CA 1H1RA 3EB0A 2JBPA 5C01A 1UNHA 2QOFA 3FUPA 3FHIA 3Q5ZA 3QCSA 3THBA 3UIXA 4E6DA 5IDNA 3I81A 3E92A 3QRIA 4FV1A 2XRUA 5T68A 2PPQA 1M7NA 1SNXA 3EZRA 3VS0A 4M97A 5A46A 4EZ3A 2X7FA 2PMOX 2X0GA 2YHVA 3IS5A 3KC3A 3QKKA 4U42A 3V01A 5M08A 3FSKA 2XKDA 4L6QA 4EWHA 4PDYA 5KBRA 2OLCA 4P5ZA 1OIRA 1S9IA 4F09A 5GIOE 3DQWA 4L9IA 4B7TA 4E3CA 1A9UA 4HYIA 2WHBA 4IAIA 4JQ7A 3CKXA 2EUFB 1PYXA 2VWYA 4N6YA 4QMMA 2JDRA 2Y8OA 4QOXA 4R1YA 3SQQA 4C4JA 2RFNA 4OTGA 3QQLA 4U9AA 3TIZA 3W1FA 5LJJA 4QP3A 5GIPE 3POZA 3VQUA 2PE2A 3MFSA 2CPKE 5JK3A 5JFXA 3DJ7A 4JBPA 3PWYA 5BUEA 4I41A 3SDJA 5IA3A 4BDKA 3HP5A 1OPLA 2QO9A 5FQDC 5J9LA 4JG6A 3EH9A 4J98A 2WEIA 5ANIA 4EJNA 4A4OA 2PVFA 2QVSE 3KRJA 1F0QA 3F6XA 3C1XA 4FOBA 2VO7A 4EUUA 4CKJA 3RTPA 2XK9A 4WUAA 2Z02A 4N6ZA 4Y5HA 2VGOA 3F61A 3ANRA 2QOKA 4LGDA 4B9DA 4KNBA 4QNAA 5ANEA 4CFWA 3TDVA 3ZSGA 2ZDTA 3NGAA 1BL6A 3FMNA 3FI2A 4C61A 4BDEA 5HU9A 3PXFA 2XZSA 3C4WA 3KXXA 4RZVA 4YO4A 2QO2A 4NCTA 1B6CB 1J91A 3ZLSA 5IQIA 3NWWA 3EQRA 4PTCA 3TXOA 3ZMMA 3V5LA 2NNWB 1GIHA 1QPEA 2C6KA 2P0CA 4GS6A 2HCKA 4YR8A 1U54A 5GZ8A 5HU3A 2C0OA 3DK7A 4X21A 1M52A 4IWQA 4D4VA 5KBQA 2QLQA 4MBJA 3TUCA 2PMLX 4WBBB 4BF2A 2WZJA 3KXZA 5AR2A 3PVUA 1VJYA 4MWIA 1LEZA 4A4XA 3OP5A 5ICPA 3GVUA 4D1XA 4H05A 4IZAA 4JG7A 4AACA 4CGAA 2W4KA 4EHZA 4IW0A 5IQFA 5EYDA 3F7ZA 3HMNA 3KVWA 2QOOA 1Q8YA 3ZS5A 1IAHA 4QO9A 5AIKA 4U40A 3UNKA 3R8MA 1OL6A 4ACHA 3EQPA 3UZTA 2C3JA 2VTRA 3ALOA 2XIKA 4FA2A 4AT5A 4O7LA 3KRRA 5KMLA 5KZIA 3GCVA 4H58A 2YIWA 2Q0BA 1Q8UA 5HCYA 4IXPA 1B38A 1ZYLA 2FYSA 2GSFA 2Y6MA 3P7CA 5M53A 3KRXA 4W4YA 4E5WA 3VHEA 3RP9A 4ANQA 2I0EA 5AR4A 4HCVA 5B0XA 3GCUA 3POOA 4NJ3A 2OK1A 3MH1A 4E73A 4U3YA 1W82A 1HCLA 3Q3BA 4MYGA 2Z2WA 5JGAA 4YHTA 1VR2A 4DG0E 2ITTA 4O0UA 2QU5A 2O3PA 4O0SA 2YDKA 4XOYA 2X8IA 4D1SA 1FVVA 5L6OA 4ZSGA 3ID6C 2J5EA 3W18A 3EFJA 3TKIA 1OKVA 5FGKA 4IIRA 3CR0A 3OXIA 2JDOA 4A9UA 1NVQA 2R3RA 1ZLTA 4M68A 3TI1A 3TUBA 4JX7A 3UO4A 1OM1A 1ZYJA 3FAAA 2BDJA 4W4WA 2QKRA 1LPUA 5JGBA 4CCUA 4IDVA 4D0XA 1FVTA 2QKWB 3OT8A 4GFMA 4IB0A 2QNJA 3PY0A 3UYTA 2WIPA 4JI9A 3ITZA 1U46A 2CLQA 3KXNA 4I4FA 1UVRA 4LRJA 4YJVA 3IOPA 4C4IA 4CG8A 4OLIA 1TQIA 3NAXA 4JBQA 2LGCA 1E1VA 3JXWA 4O21A 3NEWA 5EW9A 5KMOA 3NCGA 5HD7A 3O8UA 1A06A 2XNNA 3QF9A 4FIGA 5HD4A 3LJ1A 4F64A 2X7GA 3D14A 3VS4A 4KKGA 3WF6A 2VTHA 2JKQA 2C69A 3O17A 4ANBA 2O2UA 4FKVA 1IASA 4DLIA 4L3LA 5HE2A 4BCHA 3BHTA 4B4LA 2PVYA 4H39A 3WBLA 2C6MA 3NIEA 4I0SA 3OS3A 3FLSA 3RWQA 2OBJA 4ORKA 4GJ2A 2YZLA 2OICA 2LAVA 2PTKA 4AZEA 2OO8X 5H8GA 3PG1A 4R1VA 4UZDA 2UW9A 2BCJA 1FBNA 3AOXA 4TT7A 4F9AA 3HEGA 2CCHA 4JT3A 4UB7A 5JFVA 2JIVA 3HV7A 5CSWA 4EOOA 5HOAA 4F7LA 3DA6A 4OT6A 2WTWA 4RBLA 5M06A 3Q9XA 4WRGA 5GNKA 2PU8A 4V05A 1CKIA 3TUDA 1UA2A 3I7BA 5HO7A 5LXMA 2FGIA 3ZHPC 2XIZA 4XG2A 2ITYA 1W83A 3GT8A 3CBLA 3O7LD 5FM2A 4AE9A 5JFWA 1UWHA 4C58A 3QYWA 5HX6A 3CY3A 2PVHA 2VX0A 3TM0A 1Q41A 2QODA 4IFCA 4NIFB 1ZYCA 3PXQA 4BWPA 5IF1A 3KCFA 3OG7A 4UYNA 2J7TA 3FKNA 2IZSA 3TNPC 1ATPE 2WD1A 1BMKA 5AR3A 4UXQA 4J99A 2QG7A 1IA9A 3TT0A 4CCBA 2B54A 1Q61A 2EXEA 2UVXA 3QBNA 4KIPA 4EH3A 3GC8A 4HZRA 2F57A 2WEVA 4R3PA 4Q5EA 3QD0A 1GY3A 1VEBA 3DKCA 1JLUE 2C5YA 3TNWA 3U6HA 4J53A 3UC3A 3ALNA 5CT7A 4YHJA 5AUUA 4UMPA 3I4BA 5H3QA 3CQEA 4FKRA 4LYNA 3W2SA 5LVOA 5ANGA 2C5NA 4FZ6A 5M55A 4FICA 4G1WA 4NW5A 4XV2A 2ITXA 2W1ZA 4CMOA 4JXFA 5K4JA 1BI8A 1R0EA 4FZDB 1ZRZA 3CJFA 2RSVA 4YJPA 3P23A 1PKGA 3A7GA 3HRCA 5KZ0A 4E4LA 3R01A 4C33A 3Q6WA 1XH5A 3FLNC 1YXVA 2Z7SA 4J52A 4M0ZA 5E8WA 3QX2A 2IN6A 3O8PA 3QQJA 4JQ8A 4BBMA 5L8LA 4AZFA 2OW3A 4MXZA 3SLSA 1XBAA 3ZEWA 3LPBA 5M4CA 4XG4A 5FRIA 4FT7A 3OWJA 4NH1A 2PMIA 2YIRA 4ALWA 1OKYA 5D11A 3MVJA 2NP8A 3UZPA 2IG7A 5E8SA 5KMKA 1BI7A 5IQDA 2E9UA 3HX4A 2G2FA 1H0WA 4YJTA 3OMVA 4GK3A 2BRNA 4Y73A 3GI3A 5IKWA 2VV9A 3BHYA 4FGRA 4X3FC 3ZO2A 4WT6A 4MNEA 3BLQA 4CYIA 5IA1A 4LV8A 1Z9XA 4YNOA 4G3CA 2WTDA 4A9SA 1FMOE 4EOMA 2ZYBA 4I0TA 4P5QA 5F9EA 2BZJA 4HNFA 3W55A 1WBTA 5KO1A 4CMUA 5DFPA 2CLXA 4OBQA 4D4SA 3C4CA 4KINA 3SGCA 3RZBA 2ZV9A 4FSMA 2BZHB 5EQPA 2WOTA 1ZXEA 2X6EA 5ACKA 4YSMA 4M69B 2GFSA 2WB8A 4ARKA 3U55A 5D7AA 4ZLYA 2OXDA 3BHHA 3MGYA 3OUKA 5L4QA 4TWPA 1O6LA 4YJUA 5AUXA 3T3UA 4GUEA 3DK3A 5JGDA 3ZLYA 4FVPA 5KNJA 1J7IA 4YSJA 5AR5A 1Q8TA 4Q5HA 1YRPA 2FSLX 2XVDA 3QQGA 3R2YA 4GVJA 1DS5A 3RALA 4FTLA 4XBUA 2JAVA 5CQWA 5J87A 3FMMA 3QGWA 3TZ8A 2CN8A 4XX9A 2WTCA 3QCQA 3ZFYA 5CASA 4FKTA 4YPSA 4IX5A 4L3PA 3HVCA 2XP2A 3BU5A 4R7HA 3WZEA 3KRLA 2H6DA 4CV8A 1ZOGA 3CTJA 3GCQA 3DB8A 5DR2A 4YZ9A 2ITPA 3OZ6A 4BC6A 3HYHA 5A4EA 5C8NA 3H9OA 4R6VA 1KV2A 2XNMA 2XIYA 5IUHA 4BGQA 3KREA 4EJ7A 5E1SA 1OL5A 1W84A 4OTRA 4HVDA 3F66A 2ZDUA 2XKCA 4GUBA 3Q9ZA 2YLFA 4ZEGA 2JC6A 3WE4A 3O50A 2XMYA 5D1JA 2GHLA 4YMJA 2JDVA 4NM0A 4ZTHA 4F70A 5CNOA 5AP1A 1MP8A 2JDSA 2XBAA 3G2FA 4GG7A 2PZRA 4IC8A 3PPZA 1YQJA 3RM6A 4UMRA 2R3FA 1PXKA 2WPAA 2YITA 4OT5A 1UNGA 5AUTA 2CHLA 3HNGA 3IW5A 3NYNA 4ZOGA 4YGAA 5DEYA 4D2SA 5FWKK 3COHA 5D41A 1BKXA 4ITHA 1OIUA 3D5XA 2J9MA 4FL3A 5HIBA 2QLUA 3JVSA 4XG3A 4C2VA 3UQFA 2ZM1A 3PIYA 3R8LA 5J9YA 1V0BA 1OL7A 5EOLA 4BHNA 3OBJA 1YHVA 3QX4A 4KBAA 5M09A 2QR7A 3DKOA 5AFVA 2CNVA 2PUPA 4UV0A 1LR4A 3LXNA 4L52A 5KUPA 4TRLA 4MXAA 4LOOA 4QTDA 2UZEA 3EQIA 4BTMA 5KKRB 2R7BA 3QALE 4F6UA 3LVPA 1V0OA 3R7VA 3BIZA 5EKNA 2ESMA 3KF7A 4DEDA 1XKKA 3ZM9A 4FYNA 4U81A 5KE0A 1H4LA 4AW1A 3NYVA 3QGYA 3D4QA 5AAFA 1R78A 2XJ2A 3SOCA 5CVHA 2X8EA 4UMUA 3R0TA 4HGTA 4N70A 2YWVA 5EW3A 4RG0A 1TQPA 3FMDA 2GNGA 1JSUA 4RFYA 4MD8E 2BMCA 4L67A 5CF5A 2R5TA 5FG8A 3NVMB 2W1GA 5H2UA 3NPCA 2XNOA 4BB4A 2CN5A 4E6QA 3PE1A 5L2WA 4FT0A 2R3OA 2ETRA 4O91A 3DGKA 3NSZA 4M3QA 4EH5A 3SW7A 3ENMA 3QKMA 5LCKA 4B6LA 4HGLA 5FTQA 3TNQB 3KULB 3HMIA 5FXQA 3OBGA 4RJ5A 3VUDA 2A1AB 3E63A 1XBBA 4RMZA 4O7SA 4I24A 4RA5A 5CEIA 3HDMA 5CX9A 5E92A 3QLGA 1YWRA 3NDMA 2B9JA 3R1NA 3BEGA 3BYSA 3N4UA 3OROA 4K9YA 2G1TA 2Y4PA 4QMYA 3QTSA 4AX8A 5C8KA 1XH7A 1ZMVA 4YJOA 2UZNA 4JBVA 4NWMA 4DEIA 5CNNA 4HYSA 4AE6A 2J0JA 3GU7A 4CTBA 3R9RA 5M57A 3FI3A 2YM3A 2A19B 2BALA 4WA9A 4YHFA 3EFWA 4O0YA 2V55A 4O6EA 5I3OA 3FXZA 1DM2A 2I0VA 2PVNA 3MBLA 3SG9A 4NM7A 2UVYA 5HKMA 3QTRA 5EKOA 5BVWA 4WNKA 3R63A 4X7QA 1J1CA 1R1WA 3H0YA 4I23A 4C3PA 5DMZA 2WTKC 1Y6BA 2IZTA 2UW6A 3ZZEA 1BUHA 4AZSA 2GNHA 1KE8A 4GU6A 4AT4A 3TTJA 4EBVA 4EOJA 1STCE 4YZNA 4D0WA 4V0GB 4XUFA 2C1AA 2WTJA 4L44A 4MX9A 4BGGA 4BZDA 3F5XA 3RAWA 3EKKA 4DTBA 2PYWA 5AAGA 5HO6A 3JS2A 3RVGA 5K9IA 2VWXA 1Q5KA 2CGUA 3QRUA 4GW8A 4M15A 3GEQA 5ITAA 4QP1A 3ATSA 5CAPA 4RA4A 4NUSA 4TKSA 4BTFA 4FT5A 3FMHA 4XHKB 5IH6A 3OFMA 2JFMA 4F0IA 4PP7A 5L2SA 1M2QA 3W10A 4X2GA 3DZQA 3R8UA 4AP7A 4E8AA 3AMBA 2CCIA 5E1EA 3QC4A 4BIEA 3KB7A 4JDJA 5E91A 4PPAA 1RDQE 2QR8A 4L43A 4PL5A 3A7FA 4UMQA 3VN9A 3ZEPA 2NRUA 5JFSA 2HXLA 3DDQA 4EKLA 2JGZA 4BHZA 2VU3A 3A2CA 5HBEA 2X6DA 2XS0A 3Q04A 2B53A 1OL2A 3O2MA 3CIKA 4CT1A 3BI6A 3W16A 4FV8A 2XYUA 4E93A 3ZCLA 4FEXA 3CJGA 1XHAA 4FKLA 4H1MA 3P9JA 4GFOA 4JBOA 1G8AA 4NW6A 3NYOA 3RK5A 4FEVA 2X2KA 4FR4A 3DFAA 5EDQA 3WIKA 4F1TA 3O8TA 5M56A 1OUKA 3I60A 3LCKA 3HLLA 4OTDA 5FLFA 2PZ5A 2VN9A 4FIEA 3CXWA 3RK7A 3RZFA 1SZMA 1XH9A 3DTCA 2OGVA 1IA8A 3ZUUA 3HRFA 4RFMA 5CEOA 3F5PA 4TYJA 4F7NA 5C03A 5K0XA 3QXOA 3LE6A 3TACA 3ORTA 5EM8A 3F7WA 3OXZA 3AMAA 5J7BA 4BDGA 2VWBA 2BZKB 5HORA 4G3GA 3TWJA 2FVDA 5HVYA 4OBPA 4QQ5A 3DCVA 3TV6A 3ZXZA 4G6LA 4IANA 4K33A 3R8VA 3FL5A 2W1DA 2GDOA 3OWKA 1IEPA 4KA3A 4OR5A 4QD6A 4DGGA 5LVLA 3D7TB 3R2BA 4IM3A 4KRCA 2OXYA 1WVYA 3AT3A 3AC8A 3OXTA 4FGBA 5AV1A 3EQBA 1WZYA 2DYLA 4L46A 5IMXA 3S00A 5DRDA 4FSNA 4WNPA 1PYEA 1NXKA 4UMTA 5AA9A 5CY3A 2J0IA 4EK5A 4RIYA 5DBXA 2XJ1A 4G3DA 2Q0NA 3FMJA 3VS3A 2YAKA 3E64A 4QMNA 5BVNA 3OW4A 4FV5A 1UU3A 5BVFA 5AUZA 3OTUA 4YC8A 2HZ4A 3KXGA 3DKGA 4QRCA 3W8QA 4P4CA 4RLLA 5T6KA 2IW6A 4ZAUA 4PY1A 3II5A 3NX8A 1I09A 4ENXA 4MF1A 2OSCA 3KMMA 3RPVA 5EQEA 2C6TA 5EYCA 1CKPA 2XYNA 4FVRA 2XA4A 5IUIA 4D2TA 3PE2A 3U4UA 2PVMA 2W96B 5J9ZA 5FXRA 1LEWA 2B55A 4FG9A 5J5SA 5BX0A 5IEYA 3BE2A 4U7ZA 4L00A 3VS1A 2BHHA 2R3QA 3CSVA 4E1ZA 2WQOA 4IB5A 2WU6A 1Q3DA 1TQMA 1QPCA 2OI4X 3F2RA 3R7EA 3TCPA 2HY81 2FSTX 4MKCA 4EHEA 1Y57A 1YHWA 4LGGA 5CF8A 3RCJA 3BYOA 1AQ1A 4I92A 4EOPA 2WAJA 3Q6UA 5HE3A 4NT4A 1YW2A 4BKJA 5AV3A 3WYXA 4QTEA 1APME 4RIXA 4W9XA 4PV0A 4U44A 4QQTA 5CI7A 3PLSA 4CG9A 3MPTA 3O0GA 4J8MA 1OKZA 4F99A 3FQHA 2J2IB 5DRBA 2BRBA 3IQ7A 2WFYA 4BDIA 1M7QA 2J6MA 4I6HA 4YJQA 5DN3A 3OOMA 1HOWA 4ANLA 3UOJA 3KU2A 4MQ1A 3KFAA 4RWLA 2XJ0A 4I3ZA 4L3JA 2ITVA 2C5OA 2J50A 1H28A 3C13A 4QMPA 4FTUA 2WU7A 3L9LA 1P4FA 4I20A 4K18A 4RJ3A 2C3KA 4YLJA 3NNWA 4NM5A 2Q83A 3LMHA 3BQCA 5GZ9A 4TW9A 4X0MA 2H9VA 3GU5A 4S2ZA 4H36A 1FGIA 3Q4TA 5L2TA 4BI1A 2R9SA 2F2CB 3ZO3A 4EK8A 3KXHA 3NIZA 4FT9A 2EVAA 2ONLC 4M66A 4WD5A 3LLTA 5IQGA 4DHFA 2WMUA 3FWQA 4RPVA 1OBGA 2GS7A 1UV5A 2XM8A 1MQ4A 2EB3A 2WTIA 4AA0A 4BCOA 4O82A 3CEKA 4IWPA 2VTAA 1XWSA 4USDA 2C47A 4PF4A 1GIIA 3R7IA 2ZMDA 3WOWA 5CAUA 1JWHA 2VTQA 4RRVA 2JITA 5DI1A 5L8JA 2P3GX 3CD8A 3F2AA 4MNFA 4Y5QA 4D5KA 1PXJA 4CLJA 2RG5A 2XKEA 5FBOA 3I6WA 5FD2A 4QMQA 4XS2A 3MVHA 3WILA 4F6SA 4DE4A 2H8HA 3S2PA 1O6YA 3R9HA 5KCVA 3IOKA 3OWPA 3QQKA 4DGOA 4E4NA 4ZTMA 5M51A 5DE2A 3SHEA 2JAMA 2O8YA 4RC4A 3FYKX 4DFZE 1H08A 4RIOA 1TVOA 2B4SB 4ERKA 4Z7GA 4QP4A 4JX3A 4RJ8A 3SV0A 5FTOA 3HA6A 1CMKE 1KE6A 3BLRA 4XG8A 4ACGA 4IEBA 3EYHA 3SA0A 4I5HA 2FUMA 3EN7A 3SXSA 1OZ1A 4XP2A 3L8XA 1XBCA 4QQCA 5HICA 2ONLA 4AN3A 5BMSA 3NVKI 4KB8A 2O65A 4FTQA 4D9TA 3EJ1A 3E7OA 3BBWA 3MH3A 5ETCA 3VBYA 4NU1A 4ZY4A 2YM5A 4ZSAA 5B2LA 1ZZ2A 2EXCX 3ROYA 3ORPA 3Q60A 4AOJA 3EQGA 3JR1A 1UU7A 5CSPA 3KL8A 4FV2A 3OT3A 3VW6A 3BQRA 3HP2A 4MBLA 4O38A 5AX3A 4BWKA 4DEGA 4AGUA 3KQ7A 3HECA 4EH2A 3BLHA 3BYVA 3ACJA 2WTVA 4OW8A 1PW2A 4JJRA 4CFFA 3E3PA 5A3XA 5EOBA 4W4XA 4ASDA 2YM7A 3E8CA 5FDXA 3EN4A 3M1SA 4AUAA 4DN5A 2GNIA 3D9VA 3QD3A 5GHVA 4EYMA 3DT1A 5JZNA 3K3JA 3NYXA 4X6QC 4YP8A 1VYZA 2HYYA 5HO8A 2ZV8A 3VWAA 4BDJA 1JAMA 5B2MA 2BROA 5JRSA 3P7AA 3BWFA 2J51A 4FKJA 4D1ZA 5DH3A 3V6SA 2R4BA 4RC3A 4LG4A 1Q24A 3PUPA 5DG5A 3G0FA 5E8ZA 3R71A 2HZNA 4N4SA 5CI6A 2QC6A 3D5VA 3QWKA 4XOZA 3O71A 5FXSA 4Y85A 2GTNA 4KBCA 3RAIA 3VBWA 1I44A 3FY2A 2C30A 3NR9A 3TV7A 4BDAA 4F63A 3PIXA 4FNZA 2YCQA 3F5UA 3FLQA 4XYFA 3S1HA 4QP2A 4M12A 4DAWA 3LJ2A 2HIWA 5IA5A 4FOCA 3BELA 3RPSA 3SW4A 2OKRA 4G5PA 4I6BA 3UIUA 3VC4A 2QQ7A 3QUDA 4IADA 2W1FA 3IONA 1ZY4A 2QHNA 4HGEA 4CFXA 5GJDA 2C6DA 4RX9A 4BDDA 4DYMA 4CQEA 3ELJA 3RAHA 3VUGA 4FIHA 4DGNA 3I5NA 5C8MA 4YJRA 3CE3A 1YDRE 3GU6A 3VNTA 2E9PA 4U3ZA 4GU9A 3QXPA 2F7XE 2XF0A 5DEWA 4ZJIA 3TNIA 5TOZA 4UWCA 5JZJA 4BCNA 3FKLA 3QTIA 2CKEA 2X4FA 4NTTA 3DXPA 3GC0A 3G6HA 3FLWA 2JIIA 3HMOA 4TYHA 1YXXA 2YIYA 4C34A 1B39A 3V51A 3GCPA 4DA5A 4CFUA 2C6OA 5CEQA 3G15A 3D2KA 2PVLA 4IBMA 5BMMA 5AWMA 4IC7A 3BBTB 3NMUF 5K5NA 4AOTA 3HL7A 1NVSA 2F9GA 5CU4A 3PA4A 3BHUA 3V5WA 2VWVA 1H26A 2QURA 2HWOA 5AP6A 2R3MA 4U80A 3E8EA 2JKKA 1NVRA 4FTIA 4AN9A 1KV1A 4DFLA 3JPVA 4PPCA 4Z16A 1CKJA 3MN3A 4PTEA 4DINA 3A7IA 3C0IA 3Q4CA 3NZ0A 1WMKA 3L9MA 1FOTA 3LFNA 3OCGA 4IZ5A 4FKWA 5DHJA 5IH4A 3MFRA 3ZFXA 4Z7HA 1OBDA 4AGDA 3UP2A 5I9WA 5AX9A 3LZBA 1CSNA 2PMNX 4AXAA 2ITWA 4RIWA 1H01A 4O0TA 2OU7A 4FG8A 4MTAA 3U9NA 1H0VA 4XRJA 1KE5A 3U8WA 5A6NA 4G6NA 2J5FA 2WQBA 4H3PA 4S33A 4U6RA 5IPJA 3LLAA 2Z7LA 3SVVA 3R1SA 3M11A 3RPOA 4E26A 1J7LA 3KMWA 5CEPA 4DFBA 1RW8A 5IH5A 4MVFA 4AA4A 1W8CA 5AP2A 1GAGA 1U54B 2QONA 3E7VA 4FUYA 5HGIA 3PVBA 4PP9A 4TNDA 3GCSA 5TO8A 4V04A 3SXRA 4AFJA 2GQGA 4BBFA 3U54A 2VGPA 5AJQA 2BRGA 2H96A 2W0JA 3OTVA 4O22A 2WGJA 4HVGA 5I9YA 4IVDA 3GU8A 3BV3A 3A60A 1WBSA 3UIMA 5A54A 2RG6A 4BCJA 1F5QA 3RHKA 2ZB0A 4QMVA 4ZTNA 3NW7A 3QRJA 4G5JA 4FYOA 2IZRA 5HBJA 4BCFA 5KKRC 4FV6A 1JPAA 1QCFA 2B9IA 2IVTA 2O63A 2REIA 4LUEA 5ETAA 2ITUA 4C36A 4BCMA 3ULIA 4DF3A 4QPMA 2W4OA 2VTPA 3QKLA 4WG4A 4ZTQA 3FLYA 3DJ6A 3PTGA 5ANJA 4B8LA 5CYIA 3HZTA 2C6LA 2Z7QA 1ERKA 3ULZA 4Z3VA 4RLKA 5AR8A 3CPCA 2OJ9A 3ODZX 4YZBA 5FBNC 2XNEA 5CU2A 3MFUA 4FK6A 3QD2B 2OH4A 3PXZA 4LGHA 2V7AA 3BGQA 3CQUA 4IVCA 3NUYA 4I0RA 5HLNA 1U59A 3PY3A 1WAKA 2OIBA 2B9HA 2ZB1A 4FSWA 3HAVA 2AYPA 2WXVA 3V5TA 5KMMA 5AP4A 3DAKA 2PVRA 3B8RA 4AS0A 1Q8WA 3SKCA 3UOLA 4E6CA 2XIRA 3EMGA 1GZNA 4FIJA 5H9BA 3B2WA 1Q62A 5B7VA 3MVMA 1OIQA 3ZBXA 4O7RA 3W33A 4EYJA 1J3HA 5AP3A 1BLXA 3D5UA 4Q9SA 3GXLA 2X8DA 4P90A 4G9RA 4ASXA 3RCDA 4IZYA 3PJ2A 4FSRA 3V3VA 1ZARA 3P1AA 3VQHA 3HRBA 3KGAA 3E8DA 4X2FA 3F2NA 4EQMA 3ROCA 3N51A 3A8XA 5E90A 3UPZA 4J7BA 2YAAA 3GC9A 3UO5A 3WARA 5HNIX 4JG8A 4ZZOA 4EK3A 1P4OA 2G2IA 2PZPA 1K3AA 3FJQE 5M07A 2WMXA 3MTLA 4FZ7A 3IGGA 4JDIA 2ZV2A 2NRYA 4JS8A 3F3UA 4C4GA 2VNYA 4BIBA 1V1KA 5J95A 4ITIA 4AG8A 1YOMA 4CZYB 5I0BA 4FKOA 1JNKA 3COKA 4A7CA 4YURA 2CGVA 4FTKA 4DFXE 4PMMA 1PMNA 2WQEA 4WO5A 2C3IB 3H9RA 2QCSA 2GU8A 2OIDA 3HAMA 4MD7E 3UQGA 1KOAA 3LM0A 4YLKA 5DOSA 2PHKA 1UKHA 2YEXA 4IWDA 3D83A 4YJNA 3EWHA 2IO6A 3R22A 3F3ZA 2W1EA 2WELA 3VJNA 4G3EA 3H9FA 3VRZA 3GC7A 3NCZA 3C9WA 4UYAA 4ZS4A 5HE0A 4QMWA 5BYLA 5TT7A 3V04A 2HW7A 4G3FA 3V8WA 5AAEA 3GP0A 4QMOA 4WG5A 4YPDA 5HEZA 5TF9A 3HKOA 1ZWSA 3ZLXA 5A6OA 5CZHA 5FEDA 4ZTSA 3DZOA 5IA4A 3LFCA 4E7WA 4EONA 3P5KA 3AD5A 3AGMA 4FL2A 4YC6A 5L8KA 3G0EA 5CENA 4O7YA 4XJ0A 4RT7A 4G9CA 4X3FA 3WF8A 2A27A 1PY5A 2YIQA 5L6WL 4HYUA 5FTGA 3V5PA 4IM2A 3JYAA 4IAZA 4KSQA 2C5VA 4MF0A 3LMIA 3QQFA 3AMYA 5EFQA 1BX6A 3PFQA 2UV2A 5LMKC 3NUSA 2PUIA 1E9HA 4D9UA 4F7JA 3OHTA 4DFUA 4W8EA 1PF8A 2DQ7X 3FMKA 4AOIA 1VZOA 2NPQA 3Q52A 5CALA 1YI4A 4XV1A 4C35A 3MTFA 2VWWA 4ITJA 1W7HA 4QP9A 3DQXA 4Z55A 1PMVA 3NUPA 3D94A 4IFGA 4DLJA 4EORA 4CV9A 4A9TA 4AT3A 3T8OA 4ACCA 5A4CA 2XNPA 3LFEA 3SRVB 4JR7A 4ONAA 3BU3A 4QQJA 4ACDA 2R3KA 4F9BA 5DYJA 2BRHA 3DY7A 5HHWA 3JVRA 5GJGA 3W2OA 3B8QA 4YTFA 5JT2A 1YXSA 2F7EE 3ZZWA 3ZUVA 3P0MA 4XG7A 3JY0A 2XM9A 4OTQA 3LFSA 4NFMA 4RX5A 2C1BA 5A9UA 4FKGA 5DGZA 4K77A 4AGCA 4EUTA 1GNGA 3FDNA 1XH6A 4WRSA 2Y0AA 5I9VA 3FKOA 3H0ZA 2VTIA 2GQSA 2V22A 1OL1A 3RWPA 3UPXA 4O2ZA 4O84A 4WG3A 5IQBA 4S30A 2PVKA 3ERKA 3G9LX 4EEVA 4EOKA 3TDWA 1LUFA 4EK6A 3QA0A 4ZP5A 4RVTA 2UUEA 4OUCA 3PSCA 3HGKA 2WO6A 4MNEB 4ANSA 1OI9A 4QPAA 1FINA 3TEIA 2RFDA 4FTCA 2FH9A 4MH7A 4BN1A 4CTCA 3IO7A 2ZM3A 3VUMA 3AC3A 4KKEA 1NA7A 3VS2A 3MS9A 4O1OA 5KX8A 4V01A 1U4DA 3COMA 4ZK5A 4FV9A 3I5ZA 3PVGA 2ZVAA 4EQUA 5EHYA 2BTRA 4M8TA 4YTIA 5D9HA 3MY0A 3QCYA 4IX6A 3SC1A 3ZUTA 4EL9A 3PLAE 3P4KA 3KXMA 4C4HA 3OY3A 3CGOA 5AMNA 5L3AA 4M67A 1OUYA 2BIYA 2YERA 3VUIA 1GZKA 1ZOHA 3HDNA 3UVRA 2Y4IB 3QRKA 4L7FA 2BVAA 3ZO4A 3EHAA 1CDKA 1F3MC 1O9UA 5HCXA 4LI5A 2GPHA 1WBNA 3R1YA 3OOGA 5IEVA 3NRMA 4CRLA 4MXCA 2J0MB 2BAJA 4QTAA 3N9XA 3UIBA 3GB2A 3NUNA 3W2QA 2C6EA 5CEMA 4GT5A 5CLPA 3LFBA 1ZYSA 4F0GA 1KE7A 4L42A 3VO3A 4U45A 2UW5A 5HBHA 4IJPA 2PVJA 4GEOA 2GNJA 2W7XA 4HGSA 3A4PA 2W5HA 2C68A 2VZ6A 3PRFA 3MSSA 2ZOQA 2W1IA 1ZOEA 4A06A 2ZM4A 4RQVA 3BGZA 3MA3A 2XK7A 1FQ1B 5CEKA 3UZRA 5ANOA 1MUOA 4FSQA 3AXWA 2KULA 4YZCA 3SXFA 3C5UA 1IRKA 3IDCA 3ORLA 2I6LA 3GOKA 4X2KA 3VF8A 3WZKA 2WKMA 4A07A 3VUHA 3T3VA 3LJ0A 4I5CA 1AD5A 1XJDA 5EM5A 2O5KA 4S34A 2DUVA 3FSFA 4O2PA 3VUTA 3ZTXA 4CZUA 1X8BA 4AA5A 2VTLA 3GUBA 3IK3A 2VTJA 4BCQA 3GENA 4GMYA 4KIKB 5EQYA 1T45A 3DNDA 4E4XA 3DU8A 4R3RA 2KTYA 4JOAA 3VRYA 2BDWA 2P33A 3DBCA 2YLEA 4XP3A 3LCTA 2PSQA 3QRTA 4E20A 3OCBA 2B52A 2EXMA 3LFAA 5F20A 3VF9A 3HUBA 3IW8A 2WMAA 3OW3A 3CD3A 4QP7A 4APCA 4YZMA 4BIDA 2BKKA 5FEQA 5AP5A 4AW2A 4I6QA 5F95A 4ZLOA 4IVBA 1PRYA 4W8DA 1YWVA 5CZIA 2R0IA 5TKDA 3LQ5A 3Q53A 5LVNA 2C5XA 3RPYA 1H1WA 2OZAA 3KA0A 4GJ3A 4I1ZA 4ASZA 2IVVA 3V6RA 1IR3A 2C0IA 3AT4A 1MQBA 3I79A 2ITZA 3HV6A 5DR6A 4AZWA 3ZONA 2P2IA 2XNBA 4YZDA 2FA2A 4F1MA 3D15A 3IW7A 4OGRA 3CGFA 3DFCB 5AV2A 3IPHA 3UQCA 3EQHA 3DXQA 4FODA 2UZDA 1REKA 4JQEA 2OWBA 4D55A 5ANKA 3TIYA 3DDPA 4O7WA 3GBZA 4RZWA 1Y91A 3G51A 4R5YA 3F5GA 1H8FA 1U5RA 1WBOA 3E62A 3LKMA 5C4KA 4F4PA 1GZ8A 1KUTA 4MBIA 4GH2A 2YACA 4FZAB 3ZO1A 3DBDA 1K9AA 2OXXA 2WOUA 2XUUA 4FF8A 4TWNA 3VUKA 3ZDUA 4IMYA 3DK6A 1UNLA 2OIQA 4CRSA 2W06A 4FEUA 4DCEA 4RJ7A 5I9XA 5D12A 4D2PA 3R02A 3L1SA 1W98A 2CGXA 3ORIA 4CKIA 4MD9E 5IZFA 3DB6A 3FLZA 3QUEA 4NTSA 4H3BA 4HCUA 5CXZA 1OIYA 4D4YA 4LFIA 4QTCA 3OVVA 2XK6A 4KBKA 4TYIA 5HLPA 3VVHA 2X1NA 3R00A 4FKUA 4WIHA 5HG5A 5EI8A 3QHRA 3RMFA 2JD5A 4C3RA 3Q96A 4YLLA 5LOHA 1WVWA 4MWHA 4MXXA 2VTNA 4AU8A 5HESA 1KE9A 3L8PA 3W32A 3EOCA 1KOBA 3E87A 4MHAA 2BAKA 3DPKA 5BVDA 1M2RA 5KHWA 5LQFA 4GL9A 5EI6A 2JDTA 4B99A 5CANA 3WF5A 3CTHA 4XEYA 1Z57A 1OGUA 4PRJA 5E9EA 5EI2A 3NLBA 4O7ZA 4FTJA 3ETAA 4Y72A 4CT2A 2GHGA 3FZOA 3MY1A 3VJOA 3DLSA 4RX7A 4JDHA 4HVHA 2CKQA 1WVXA 3F3VA 4IWOA 4CNHA 4JRVA 4ZMEA 2VWZA 4HW7A 1YXUA 3Q9WA 3UGCA 4F08A 3DOGA 1PXIA 4F9YA 2B0QA 4F7SA 3K5VA 2GMXA 4DEAA 3RI1A 3A7JA 3R04A 2I7QA 2OG8A 2VWUA 4WKQA 5DT3A 4EHVA 1PMUA 2UVZA 3MYGA 1SMHA 2BUJA 2XK3A 4HPTE 3LCOA 3E88A 1NT2A 5KMIA 2PZYA 4XLVA 2HZ0A 2E9OA 2XK4A 4G17A 3C4FA 1XO2B 2OFVA 4EZ5A 3CP9A 2OJFE 3R7GA 4NSTA 4QYHA 4ZMFA 4ZY5A 3QTZA 3OF0A 5JH6A 4Y46A 4YO6A 4ZXTA 3BCEA 4UZHA 3W2PA 4UXLA 4I6FA 2R64A 4D2WA 4ID7A 3LHJA 3U6IA 2GNLA 4J8NA 3ATTA 4II5A 3QZGA 4RWIA 5KHXA 1PKDA 3I6UA 3KF4A 3LFQA 3REPA 5ANDA 2VTMA 3NUUA 4L8MA 3N4VA 2W5BA 1H1QA 2C4GA 3QL8A 5CAQA 2VX3A 5E7RA 2DS1A 4KS8A 1QPJA 2CNUA 3L9PA 5IQCA 4QMTA 3UTOA 1P14A 3DBQA 4R8QA 4I5MA 3FI4A 4FX3A 3R83A 2BTSA 2JBOA 4JRNA 4GV1A 2HY0A 4QPSA 1YDSE 3KK8A 2ZJWA 4TYEA 4HOKA 3NW5A 3C50A 3MV5A 3MWUA 4FKIA 4OTWA 1Q3WA 1WCCA 4NJDA 2BIKB 4JR3A 4Y95A 2CKOA 2HZIA 3S4QA 2VTSA 3R9NA 1TKIA 4BICA 4O27B 2VWIA 3U51A 4QMUA 4IACA 2VO6A 3IECA 1HCKA 5LARA 4DH8A 4O83A 4BFMA 4MXYA 4FTAA 3JUHA 4XP0A 4O86A 4LL0A 5LVPA 1JSTA 4CEGA 4AZTA 5T3QA 2X4ZA 2Y9QA 4HNIA 3RK9A 4C2WA 5HTIA 4O7NA 3ORZA 4RIYB 3LXPA 3PDTA 3VS5A 4O7TA 2OF4A 5EH0A 3R7OA 4GK2A 4WBOA 4IX3A 3QTXA 4QMSA 3ZM4A 2BRMA 1UWJA 5D7VA 5J8IA 2QOHA 2XIXA 3P86A 3RNIA 2VD5A 3IG7A 4KD1A 4NCTC 1JSVA 5KMJA 2WMSA 3C7QA 3OEZA 2W1CA 2YIXA 4BYJA 4LL5A 4XV9A 2PK9A 5IQEA 2NO3A 4BDHA 1E1XA 2IVSA 2PWLA 4GT4A 3DKFA 4QYFA 2HK5A 4AGWA 2XEZA 2BR1A 3OY1A 3EQFA 2IVUA 2J0LA 3BU6A 2YM6A 3EQCA 4R7BA 3G5DA 3D0EA 5E8YA 3ZRKA 1S9JA 3F82A 3Q2JA 2XBJA 3ORNA 2YFXA 3C0GA 4K6ZA 5HE1A 4RC2A 4KIQA 4W9WA 3BRBA 2PULA 3PP0A 4IZ7A 5DVRA 4Q9ZA 5LCJA 5HIDA 5EK7A 3V8SA 2P2HA 2I1MA 2J0KA 2UW3A 3EFKA 4TPTA 1JBPE 1FPUA 2B7AA 2X9FA 3KCKA 2RIOA 3H3CA 3RHXA 3SG8A 4DGMA 4NZWB 4C57A 3QHWA 4RIXB 3TL8A 4IX4A 4L45A 5AA8A 3F3WA 3IGOA 4EZ7A 1IG1A 4CLIA 4O6LA 5EYKA 3SOAA 3CS9A 3TJCA 3B2TA 4CMTA 3QUPA 1T46A 4PQNA 5IQHA 5CF4A 3QD4A 5E4HA 4DBNA 4OTHA 3QWJA 3FQSA 4R7IA 4IAYA 3F69A 5AP0A 4BI2A 5CWZA 2FO0A 4IE9A 4BCGA 3AD4A 5AUVA 5BYYA 2R3JA 4FI1A 4FV0A 4C4FA 3PIZA 3LW0A 1OB3A 2R3GA 4ENYA 5J79A 4B8MA 1PHKA 3FMLA 4BTJA 2CKPA 3QC9A 4USEA 3R7UA 1URCA 2XB7A 1RE8A 5C26A 1XQZA 1OPKA 3FHRA 4P2KA 2V0DA 5EHOA 5BPYA 2BILB 4FMQA 3ZDIA 2VX1A 3MJ2A 3PXRA 3FV8A 3MIYA 4K11A 4U41A 2Z8CA 1GZOA 3R73A 3P08A 5BYZA 2O0UA 4CZTA 4BYIA 3D7ZA 4YTCA 1JKSA 4IQ6A 4NIFA 4EKKA 1K2PA 3QLFA 3O7LB 1PXNA 1YKRA 4HVSA 4I5PA 5BVKA 4U43A 5IA0A 5HG8A 3M2WA 2VUWA 3FC1X 1GJOA 3ORMA 1MRYA 3HA8A 2X81A 3BYUA 5TR6A 4BDCA 4PPBA 1JOWB 1Q8ZA 4DEEA 2HAKA 5DPVA 1SNUA 3LFFA 5C4LA 1WBVA 3R8ZA 1PXLA 4Y8DA 5C9CA 4WHZA 1FGKA 3MI9A 3EQDA 3OCSA 4GYIA 3ZU7A 4FK3A 4CQGA 3FY0A 4RVKA 4BBEA 5CAOA 2X2LA 5KMNA 1M14A 3MPAA 3WZJA 5J5TA 5HQ0A 3QTUA 5BUJA 4O81A 2AUHA 1PXOA 3AQVA 2WMRA 3C4EA 2VO3A 3VBVA 2OJGA 3VBTA 1Q99A 1SVEA 4JAJA 3EN5A 3LCSA 5J1VA 5DIAA 3WF7A 3DS6A 4XG9A 2G15A 4FVQA 2G01A 3HV5A 2FSOX 3CLYA 4PL4A 4KWPA 4EH6A 1SYKA 2V5QA 2YJRA 4I21A 5CT0A 4GIHA 5HX8A 2QOBA 5M4UA 2ITNA 2XCHA 4UWYA 2JFLA 5DT4A 3Q32A 3KKVA 4EOIA 2VAGA 3U87A 3S3IA 4R77A 3FBVA 4NKAA 3FC2A 3RAKA 2UW7A 2HOGA 3PG3A 5K4IA 1PJKA 4GKHA 4EOSA 2G2HA 3ACKA 3ORKA 3I0OA 4U8ZA 2BPMA 2UW8A 4CSVA 2ERKA 3ZRMA 5CAVA 5HVJA 3BX5A 3QTWA 2EB2A 3GGFA 4F65A 5M44A 3Q9YA 5FP6A 4KUJA 3QFVA 4FC0A 4GRBA 4F0FA 2WMVA 2R3LA 2R3IA 3EIDA 4QYYA 2WMQA 3RNYA 5CS6A 4C7TA 3NW6A 4KRDA 1DAYA 4RFZA 1GOLA 3GQIA 1SVGA 4I93A 5CU0A 2GCDA 3QZIA 2Y6OA 4BDBA 4MEDA 4FSYA 4S31A 2W9FB 3PPKA 2YDJA 3EN6A 5IMEA 4O0XA 2ERZE 5L6PA 4D5HA 5LMBA 4M69A 2VTTA 3WZUA 4EWQA 4EOQA 1ZMUA 2A2AA 4TYGA 3UODA 3LQ8A 4FE2A 3DJ5A 3PPJA 4AN2A 2V62A 4U0IA 4FTRA 3C4ZA 1H25A 1ZYDA 4F9CA 2R0UA 2WMBA 4I94A 2HWPA 4KIOA 5JN2A 4RWJA 3C0HA 1KSWA 3KY2A 4ZTRA 5IA2A 4F9WA 5JKGA 3CCNA 2F49A 4J97A 5HG9A 4E5BA 4DTKA 5IEXA 3PXKA 2GS6A 4DITA 3WYYA 3OUNB 4NKSA 4RVLA 3FPMA 3E5AA 4WNOA 2W17A 2UZWE 4JL9A 5IU2A 3ZC5A 1YI3A 3UOKA 3PA5A 4AZVA 4AW5A 2R3NA 4I4EA 3G6GA 3GQLA 5AEPA 3WZDA 5EDPA 3AD6A 3F88A 3EKNA 1G8SA 3H10A 4FSZA 4NFNA 4Y83A 5CVGA 4AQCA 1UU8A 2YM8A 2FB8A 4X3JA 4DEHA 1XH4A 4FKQA 3BPRA 4AAAA 4O7VA 5CQUA 4A9YA 2WIHA 2QHMA 2ZMCA 3EZVA 1ZZLA 4FKPA 4G2FA 4BKZA 4D2VA 4DFNA 3LMGA 1L8TA 1ZAOA 3KK9A 2PY3A 3GFWA 2UZBA 2BKZA 4WSQA 4QP6A 4CFMA 3FEGA 3FZSA 4XBRA 1V0PA 3QZHA 3PP1A 4FT3A 4IB3A 2RKUA 4H3QA 3UG2A 2CDZA 1GIJA 2UZOA 3TKUA 3NAYA 4ZY6A 3FI8A 2F7ZE 1OITA 4JNWA 4PMSA 3ZBFA 4EHGA 1H1SA 2XK8A 3ZLWA 2ITOA 3DAEA 1OECA 5G6VA 2C3LA 4FL1A 2CGWA 3DTWA 4DG2E 3TJDA 2YWPA 4TYHB 3L8SA 4UWBA 2QG5A 2HW6A 2A0CX 3BGPA 3SRVA 4BGHA 3FL4A 2Y4IC 3CTQA 4O0WA 4C59A 2AC5A 5AUYA 2VNWA 4XV3A 3FZRA 3R8PA 4OAVB 1JKLA 3LM5A 3OCTA 1JKKA 3NUAA 2UZLA 4X2JA 5H8EA 4BTKA 1OPJA 4TY1A 4CD0A 5DR9A 5EDRA 3DAJA 3F9NA 1Q97A 2PE1A 4YU2A 4FIIA 1MRUA 3MY5A 3FMEA 2JEDA 3VS7A 4CKRA 3IW4A 3A8WA 4ZIMA 3KMUA 2F4JA 3E3BX 3EL7A 4IJ9A 3RM7A 3ZRLA 4C38A 2R7IA 4DH7A 3S95A 3EYGA 4C02A 3I0QA 4CXAA 4GIIA 5IQAA 1SVHA 1G5SA 3MVLA 4LMNA 4XRLA 4RIWB 4K0YA 2XCKA 3MH0A 4BY9E 4IDTA 4L53A 3TZ9A 3U6JA 5GZAA 3IKAA 4IAAA 3RBWA 5AV4A 4ZSEA 1OMWA 3A99A 1FVRA 3QCXA 4CVAA 3I1AA 4AFEA 4R78A 4PWNA 2B9FA 2IPXA 3I7CA 4F1OA 3KULA 4ZLZA 4YBJA 3UOHA 2YN8A 3RGFA 3MPMA 4JLCA 3MFTA 4FUXA 2W05A 1L3RE 1QPDA 4QNYA 3K3IA 4FEWA 4C4EA 4Q2AA 2CSNA 4BCPA 5JQ8A 5E8XA 3M42A 5ETIA 2OH0E 2IZUA 5A4TA 1M17A 4X2NA 2YCFA 3ZOSA 4EC8A 3PWDA 5G1XA 1EH4A 3ORXA 4AWIA 4DH5A 2RL5A 4ERWA 2C0TA 2YM4A 4GCJA 2UZTA 3Q4UA 1AGWA 1JKTA 2EU9A 5HCZA 1DI8A 3UP7A 3MIAA 4NL0A 2FSMX 5I3RA 4UN0C 4TZRA 1NY3A 2OF2A 3C51A 2QO7A 3VAPA 5HTCA 5IG1A 3G9NA 4DCAA 3OEFX 4LV5A 4XNEA 3DLZA 3EL8A 4LOPA 4DFYA 3AC2A 3BKBA 5BVEA 4ANNA 3PA3A 2IWIA 4BDFA 3LIJA 4A9RA
chains in the Genus database with same CATH superfamily
1NW1A 1SM2A 3JY9A 4PDOA 4V0GA 3VHKA 4FNXA 4CYJA 2PE0A 4IB1A 4BWXA 3FZTA 4D4RA 4YJSA 3U9CA 2IW9A 2JKOA 4UY9A 4OBOA 3PSDA 4ZJJA 3UMXA 5CVFA 4FTTA 4N57A 1YI6A 3BWJA 3A62A 4HPUE 5TE0A 1LP4A 3WIGA 2P4IA 4TNBA 2GHMA 4G16A 3DV3A 5FUTA 4JDKA 3ZFMA 4M14A 3FE3A 4H1JA 1PXPA 3ODYX 5LMAA 3TMOA 4NEUA 5FP5A 3ET7A 4C8BA 1YDTE 3N4TA 5LWMA 5C1QB 4KIKA 5DWRA 3CKWA 2ITQA 4PDPA 3A61A 3HMMA 4PUZA 4EH7A 3NNUA 4DBXA 4L01A 3QYZA 3V5QA 4DTAA 4FNYA 5AUWA 4FKSA 5K5XA 5K0KA 1Z5MA 4BR3A 4R3CA 4FTOA 2YDIA 2E9VA 2Z7RA 3R1QA 4D28A 2ETKA 3MB6A 1XH8A 1H07A 2X9EA 4BRXA 4DH1A 5GJFA 3VBQA 3PRIA 3AC5A 5FM3A 1DI9A 3UE4A 1FMKA 1DAWA 2P55A 4UX9A 5CXHA 2QU6A 5ETFA 2YA9A 5AR7A 4HVIA 5BV3A 4U5JA 2ETMA 3EFLA 4QYEA 5CSXA 5I4NA 5LMKA 4AXDA 3LOKA 3WE8A 4MXOA 4FV3A 5HLWA 4ANOA 1WBPA 4DEBA 2UZUE 3BZ3A 3MH2A 4EC9A 3ZXTA 2C6IA 2GFCA 3TV4A 5IUGA 2JKMA 5JRQA 4D2RA 2HELA 3P7BA 3CC6A 4PX6A 4EH9A 3K5UA 2PUUA 4AXFA 2I0YA 4APPA 3GFEA 3AC4A 3LQ3A 3FXXA 2BDFA 1YVJA 5I9ZA 3K2LA 5EM7A 4USFA 1H00A 2QD9A 3WI6A 3T9TA 4ZJVA 4FG7A 1YHSA 2OJIA 3NUXA 4RSSA 4C0TA 2B1PA 3UMWA 4LRMA 1R3CA 4MAOA 4HZSA 4QYGA 3C4XA 2QOCA 4K8AA 1QMZA 2GTMA 4MCVA 4WNMA 5AM7A 5EG3A 2YZAA 3MDYA 4LUDA 4BVUA 3MA6A 3BEAA 3D7TA 1P5EA 3L8VA 3VULA 2SRCA 4BI0A 3KEXA 5GINE 5H8BA 4FBXA 3FPQA 4GFGA 4F6WA 4HCTA 3TTIA 1M2PA 1ND4A 5AM6A 3ZYAA 4IH8A 4JIKA 2WNTA 2RFSA 3W2RA 4TTHB 5HTBA 3IDPA 3OC1A 3HMPA 3UNJA 5L2IA 4ALUA 3E8NA 4TXCA 4E4MA 5DNRA 5J7HA 1H27A 3TZ7A 1WFCA 4I22A 4GK4A 4X3FB 4RGJA 1P2AA 4MQ2A 2ZAZA 5EHLA 4C3FA 3SX9A 3P78A 4YBKA 4HYHA 3CY2A 1O6KA 4BZNA 3UNZA 4NYEA 4PTGA 4AF3A 3K54A 1A48A 4J96A 4ZZNA 3TN8A 3D5WA 2IJMA 3KVXA 3QA8A 4PMTA 4CFVA 2BHEA 2UW0A 3CQWA 3MESA 5HNBA 3VS6A 5HVKA 3VBXA 3DNEA 3A4OX 3PJCA 3LCDA 2IF8A 4FV4A 2BFXA 4EQCA 2XNGA 2BZIB 3Q4ZA 4EBWA 4M84A 4DG3E 3FZ1A 3CPBA 5ACBC 4GYGA 1G3NA 4KS7A 5E8TA 3W0SA 2J90A 4LMUA 1J7UA 2RFEA 4NK9A 2Z60A 3GNIB 5EYMA 2RGPA 3QQHA 1WBWA 3IDBA 4PDSA 5CSHA 4GSBA 2UW4A 1VYWA 3R21A 2O64A 1PMEA 1JVPP 3DBEA 4G6OA 5BQ0A 4N0SA 2CJMA 2GNFA 3C5IA 3O51A 3PYYA 4FZFB 4NM3A 4KABA 4DGLC 3MJ1A 4DH3A 5DLSA 1Y8GA 3LXLA 1H24A 4IM0A 4KKHA 5F1ZA 3R30A 1UU9A 3PZEA 4M13A 1H1PA 1REJA 4YTHA 4PL3A 5AADA 3UG1A 3NNXA 5JMSA 5A14A 2PUNA 2WQMA 1ZY5A 3OWLA 1W0XC 3PSBA 4XG6A 2AC3A 2BFYA 4C62A 5HZNA 4PNKA 4E6AA 2W5AA 4GVAA 3RPRA 3ANQA 2R3HA 4XCUA 4UBAA 2IW8A 3GU4A 4G31A 4RWKA 5HG7A 4P7EA 3PJ3A 2BAQA 4TWCA 5CTPA 3QU0A 4JAIA 4ALVA 2QI8A 3ZSHA 4ACMA 2XANA 3FXWA 5HNGA 4Z9LA 2JLDA 4BJJB 1MRVA 4YUQA 5IISA 1YXTA 3TG1A 5IDPA 2YCSA 4O0RA 4L7SA 1JQHA 4O1PA 2J4ZA 3BYMA 2G9XA 4XMOA 3V5JA 4WUNA 2X2MA 4IVAA 2PL0A 5L2QA 2YABA 4LM5A 1CM8A 5E8UA 3L9NA 4MK0A 4BL1A 3E93A 1XR1A 3DXNA 4OTIA 5M4FA 4DT8A 2HXQA 4R5SA 4ANMA 3ZH8A 2VTOA 4LDTA 3FQEA 5FDPA 1ZMWA 4FNWA 3WF9A 4QTBA 4OAUC 3NNVA 2EWAA 2XRWA 3OD6X 3SAYA 1BYGA 3G90X 3KN5A 5A4LA 5I5ZA 5CU6A 1IAJA 4LOQA 2XEYA 3HV4A 3R7YA 2QOIA 3O23A 4DT9A 5CSVA 2R2PA 2VRXA 4JIAA 2A4LA 4D58A 4RX8A 3PJ1A 3O96A 4GT3A 1R0PA 3FYJX 3BV2A 4C37A 2RF9A 3MB7A 4FRFA 3UDBA 4UALA 3QZFA 4GG5A 2ZV7A 3G33A 3AGLA 5C27A 4RJ6A 2GS2A 4A4LA 4BCIA 3DBFA 3FZPA 4KAOA 5HIEA 3AG9A 3PVWA 3VONA 3T9IA 5FEEA 5LWNA 4HJOA 3H30A 3KN6A 4BZOA 3BE9A 1R39A 2QOLA 4OTFA 5I9UA 3UC4A 3LFDA 3MW1A 4EOLA 3R6XA 3BLAA 3RINA 3TNHA 3Q2MA 4K1BA 3ZC6A 5F94A 4QMZA 4XH6A 3PZHA 3UO6A 3R28A 4FSTA 2VO0A 2YCRA 1YOLA 3H4JA 3VW8A 2QOQA 1BL7A 3PY1A 3RJCA 3ENHA 4U79A 1Y6AA 4U97A 5BUIA 5JQ5A 1OVEA 4WOVA 4K2RA 4XLIA 2XH5A 3PJ8A 4PNIA 3HV3A 4ZSJA 2W9ZB 3W0OA 3COIA 3R9OA 2WMWA 4FSUA 3Q5IA 4J95A 1CTPE 1OKWA 4OTPA 3LXKA 5E8VA 4ZSLA 5HI2A 3SD0A 5BVOA 5AV0A 2OZOA 2I0HA 1KWPA 2W1HA 2WQNA 2X39A 2GQRA 3VIDA 2UZVA 3A7HA 2XKFA 1J1BA 4QMXA 4S32A 1URWA 4LRKA 4ZZMA 2V7OA 3LAUA 3AT2A 3BHVA 4G34A 3QTQA 1Y8YA 5AP7A 3RKBA 3EN9A 4FIFA 4CFNA 4PMPA 4AW0A 4WSYA 4JMQA 4ASEA 1RJBA 2F2UA 4TL0A 2CMWA 2W4JA 4KSPA 3P79A 4L68A 3UJGA 5J1WA 2OZAB 3PFYA 4B0GA 2PZIA 3AC1A 4QP8A 3NS9A 5K3YA 4J1RA 1UKIA 5AIRA 4QMLA 4EH8A 4YC3A 2HENA 4IHPA 4EK4A 4IAKA 4X6RA 5B2KA 4BKYA 3D2IA 4RQKA 2JIUA 1Q4LA 2WTKB 1RQQA 4O96A 5D10A 4ZS0A 5DA3A 2XAMA 2WMTA 3QQUA 2OJJA 5DT0A 4ZTLA 3UVQA 2DWBA 4M0YA 4RVMA 5LVMA 3TZMA 1U5QA 5EW8A 4EI4A 2E9NA 4LQMA 2R3PA 1QL6A 5CF6A 4JVGA 4QT1A 2YISA 1YOJA 3PXYA 3UBDA 2ACXA 3UVPA 5BNJA 5JEBA 4TWOA 4RJ4A 4GKIA 2X7OA 4E5AX 5M4IA 4M7IA 4FEQA 4TN6A 3U4WA 5CU3A 2Y7JA 2I40A 3S0OA 5A4QA 4EH4A 5EM6A 2W99B 3V8TA 2H34A 4W4VA 3QAME 2E2BA 3GOPA 4FV7A 4YNEA 3W8LA 2OFUA 4O0VA 2CNQA 3KRWA 4FTMA 4DC2A 2YJSA 3IW6A 5F4NA 4BCKA 3HUCA 3R9DA 3ZSIA 1PXMA 4UEUA 4J71A 3TKHA 3UYSA 4FTNA 4IAFA 5JSMA 1YWNA 3F3TA 3W2CA 1H1RA 3EB0A 2JBPA 5C01A 1UNHA 2QOFA 3FUPA 3FHIA 3Q5ZA 3QCSA 3THBA 3UIXA 4E6DA 5IDNA 3I81A 3E92A 3QRIA 4FV1A 2XRUA 5T68A 2PPQA 3NFGB 1M7NA 1SNXA 3EZRA 3VS0A 4M97A 5A46A 4EZ3A 2X7FA 2PMOX 2X0GA 2YHVA 3IS5A 3KC3A 3QKKA 4U42A 3V01A 5M08A 3FSKA 2XKDA 4L6QA 4EWHA 4PDYA 5KBRA 2OLCA 4P5ZA 1OIRA 1S9IA 4F09A 5GIOE 3DQWA 4L9IA 4B7TA 4E3CA 4DHJA 1A9UA 4HYIA 2WHBA 4IAIA 4JQ7A 3CKXA 2EUFB 1PYXA 2VWYA 4N6YA 4QMMA 2JDRA 2Y8OA 4QOXA 4R1YA 3SQQA 4C4JA 2RFNA 4OTGA 3QQLA 4U9AA 3TIZA 3W1FA 5LJJA 4QP3A 5GIPE 3POZA 3VQUA 2PE2A 3MFSA 2CPKE 5JK3A 5JFXA 3DJ7A 4JBPA 3PWYA 5BUEA 4I41A 3SDJA 5IA3A 4BDKA 3HP5A 3KIOC 1OPLA 2QO9A 5FQDC 5J9LA 4JG6A 3EH9A 4J98A 2WEIA 5ANIA 4EJNA 4A4OA 2PVFA 2QVSE 3KRJA 1F0QA 3F6XA 3C1XA 4FOBA 2VO7A 4EUUA 4CKJA 3RTPA 2XK9A 4WUAA 2Z02A 3W0NA 4N6ZA 4Y5HA 2VGOA 3F61A 3ANRA 2QOKA 4LGDA 4B9DA 4KNBA 4QNAA 5ANEA 4CFWA 3TDVA 3ZSGA 2ZDTA 3NGAA 1BL6A 3FMNA 3FI2A 4C61A 4BDEA 5HU9A 3PXFA 2XZSA 3C4WA 3KXXA 4RZVA 4YO4A 2QO2A 4NCTA 1B6CB 1J91A 3ZLSA 5IQIA 3NWWA 3EQRA 4PTCA 3TXOA 3ZMMA 3V5LA 2NNWB 1GIHA 1QPEA 2C6KA 2P0CA 4GS6A 2HCKA 4YR8A 1U54A 5GZ8A 5HU3A 2C0OA 3DK7A 4X21A 1M52A 4IWQA 4D4VA 5KBQA 3UDZA 2QLQA 4MBJA 3TUCA 2PMLX 4WBBB 4BF2A 2WZJA 3KXZA 5AR2A 3PVUA 1VJYA 4MWIA 1LEZA 4A4XA 3OP5A 5ICPA 3GVUA 4D1XA 4H05A 4IZAA 4JG7A 4AACA 4CGAA 2W4KA 4EHZA 4IW0A 5IQFA 5EYDA 3F7ZA 3HMNA 3KVWA 2QOOA 1Q8YA 3ZS5A 1IAHA 4QO9A 5AIKA 4U40A 3UNKA 3R8MA 1OL6A 4ACHA 3EQPA 3UZTA 2C3JA 2VTRA 3ALOA 2XIKA 4FA2A 4AT5A 4O7LA 3NFFB 3KRRA 5KMLA 5KZIA 3GCVA 4H58A 2YIWA 2Q0BA 1Q8UA 5HCYA 4IXPA 1B38A 1ZYLA 2FYSA 2GSFA 2Y6MA 3P7CA 5M53A 3KRXA 4W4YA 4E5WA 3VHEA 3RP9A 4ANQA 2I0EA 5AR4A 4HCVA 5B0XA 3GCUA 3POOA 4NJ3A 2OK1A 3MH1A 4E73A 4U3YA 1XMLA 1W82A 1HCLA 3Q3BA 4MYGA 2Z2WA 5JGAA 4YHTA 1VR2A 4DG0E 2ITTA 4O0UA 2QU5A 2O3PA 4O0SA 2YDKA 4XOYA 2X8IA 4D1SA 1FVVA 4O4FA 4ZSGA 3ID6C 2J5EA 3W18A 3EFJA 3TKIA 1OKVA 5FGKA 4IIRA 3CR0A 3OXIA 2JDOA 4A9UA 1NVQA 2R3RA 1ZLTA 4M68A 3TI1A 3TUBA 4JX7A 3UO4A 1OM1A 1ZYJA 3FAAA 2BDJA 4W4WA 2QKRA 1LPUA 5JGBA 4CCUA 3W0PA 4IDVA 4D0XA 1FVTA 2QKWB 3OT8A 4GFMA 4IB0A 2QNJA 3PY0A 3UYTA 2WIPA 4JI9A 3ITZA 1U46A 2CLQA 3KXNA 4I4FA 1UVRA 4LRJA 4YJVA 3IOPA 4C4IA 4CG8A 4OLIA 1TQIA 3NAXA 4JBQA 2LGCA 1E1VA 3JXWA 4O21A 3NEWA 5EW9A 5KMOA 4QDEA 3NCGA 5HD7A 3O8UA 1A06A 2XNNA 3QF9A 4FIGA 5HD4A 3LJ1A 4F64A 2X7GA 3D14A 3VS4A 4KKGA 3WF6A 2VTHA 2JKQA 2C69A 3O17A 4ANBA 2O2UA 4FKVA 1IASA 4DLIA 4L3LA 5HE2A 4BCHA 3BHTA 4B4LA 2PVYA 4H39A 3WBLA 2C6MA 3NIEA 4I0SA 3OS3A 3FLSA 3RWQA 2OBJA 4ORKA 4GJ2A 2YZLA 2OICA 2LAVA 2PTKA 4AZEA 2OO8X 5H8GA 3PG1A 4R1VA 4UZDA 2UW9A 2BCJA 1FBNA 3AOXA 4TT7A 4F9AA 3HEGA 2CCHA 4JT3A 4UB7A 5JFVA 2JIVA 3HV7A 5CSWA 4EOOA 5HOAA 4F7LA 3DA6A 4OT6A 2WTWA 4RBLA 5M06A 2XARA 3Q9XA 4WRGA 5GNKA 2PU8A 4V05A 1CKIA 3TUDA 1UA2A 3I7BA 5HO7A 5LXMA 2FGIA 3ZHPC 2XIZA 4XG2A 2ITYA 1W83A 3W0MA 3GT8A 3CBLA 3O7LD 5FM2A 4AE9A 5JFWA 1UWHA 4C58A 3QYWA 5HX6A 3CY3A 2PVHA 2VX0A 3TM0A 1Q41A 2QODA 4IFCA 4NIFB 1ZYCA 3PXQA 4BWPA 5IF1A 3KCFA 3OG7A 4UYNA 2J7TA 3FKNA 2IZSA 3TNPC 1ATPE 2WD1A 1BMKA 5AR3A 4UXQA 4J99A 2QG7A 1IA9A 3TT0A 4CCBA 2B54A 1Q61A 2EXEA 2UVXA 3QBNA 4KIPA 4EH3A 3GC8A 4HZRA 2F57A 2WEVA 4R3PA 4Q5EA 3QD0A 1GY3A 1VEBA 3DKCA 1JLUE 2C5YA 3TNWA 3U6HA 4J53A 3UC3A 3ALNA 5CT7A 4YHJA 5AUUA 4UMPA 3I4BA 5H3QA 3CQEA 4FKRA 4LYNA 3W2SA 5LVOA 5ANGA 2C5NA 4FZ6A 5M55A 4FICA 4G1WA 4NW5A 4XV2A 2ITXA 2W1ZA 4CMOA 4JXFA 5K4JA 1BI8A 1R0EA 4FZDB 1ZRZA 3CJFA 2RSVA 4YJPA 3P23A 1PKGA 3A7GA 3HRCA 5KZ0A 4E4LA 1ST0A 3R01A 4C33A 3Q6WA 1XH5A 3FLNC 1YXVA 2Z7SA 4J52A 4M0ZA 5E8WA 3QX2A 2IN6A 3O8PA 3QQJA 4JQ8A 4BBMA 5L8LA 4AZFA 2OW3A 4MXZA 3SLSA 1XBAA 3ZEWA 3LPBA 5M4CA 4XG4A 5FRIA 4FT7A 3OWJA 4NH1A 2PMIA 2YIRA 4ALWA 1OKYA 5D11A 3MVJA 3W0RA 2NP8A 1W2DA 3UZPA 2IG7A 5E8SA 5KMKA 1BI7A 4LV7A 2E9UA 5IQDA 3HX4A 2G2FA 1H0WA 4YJTA 3OMVA 4GK3A 2BRNA 4Y73A 3GI3A 5IKWA 2VV9A 3BHYA 4FGRA 4X3FC 3ZO2A 4WT6A 4MNEA 3BLQA 4CYIA 5IA1A 4LV8A 1Z9XA 4YNOA 4G3CA 2WTDA 4A9SA 1FMOE 4EOMA 2ZYBA 4I0TA 4P5QA 5F9EA 2BZJA 4HNFA 3W55A 1WBTA 5KO1A 4CMUA 5DFPA 2CLXA 4OBQA 4D4SA 3C4CA 4KINA 3SGCA 3RZBA 2ZV9A 4FSMA 2BZHB 5EQPA 2WOTA 1ZXEA 2X6EA 5ACKA 4YSMA 4M69B 2GFSA 2WB8A 4ARKA 3U55A 5D7AA 4ZLYA 2OXDA 3BHHA 3MGYA 3OUKA 5L4QA 4TWPA 1O6LA 4YJUA 5AUXA 2NYAA 3T3UA 4GUEA 3DK3A 5JGDA 3ZLYA 4FVPA 5KNJA 1J7IA 4YSJA 5AR5A 1Q8TA 4Q5HA 1YRPA 2FSLX 2XVDA 3QQGA 3R2YA 4GVJA 1DS5A 3RALA 4FTLA 4XBUA 2JAVA 5CQWA 5J87A 3FMMA 3QGWA 3TZ8A 2CN8A 4XX9A 2WTCA 3QCQA 3ZFYA 5CASA 4FKTA 4DHIB 4YPSA 4IX5A 4L3PA 3HVCA 2XP2A 3BU5A 4R7HA 3WZEA 3KRLA 2H6DA 4CV8A 1ZOGA 3CTJA 3GCQA 3DB8A 5DR2A 4YZ9A 2ITPA 3OZ6A 4BC6A 3HYHA 5A4EA 5C8NA 3H9OA 4R6VA 1KV2A 2XNMA 2XIYA 4O4BB 4BGQA 5IUHA 3KREA 4EJ7A 5E1SA 1OL5A 1W84A 4OTRA 4HVDA 3F66A 2ZDUA 2XKCA 4GUBA 3Q9ZA 2YLFA 4ZEGA 2JC6A 3WE4A 3O50A 2XMYA 3BL7A 5D1JA 2GHLA 4YMJA 2JDVA 4NM0A 4ZTHA 4F70A 5CNOA 5AP1A 1MP8A 2JDSA 2XBAA 3G2FA 4GG7A 2PZRA 4IC8A 3PPZA 1YQJA 3RM6A 4UMRA 2R3FA 1PXKA 2WPAA 2YITA 4OT5A 1UNGA 5AUTA 2CHLA 3HNGA 3IW5A 3NYNA 4ZOGA 4YGAA 5DEYA 4D2SA 5FWKK 3COHA 5D41A 1BKXA 4ITHA 1OIUA 3D5XA 2J9MA 4FL3A 5HIBA 2QLUA 3JVSA 4XG3A 4C2VA 3UQFA 2ZM1A 3PIYA 3R8LA 5J9YA 1V0BA 1OL7A 5EOLA 4BHNA 3OBJA 1YHVA 3QX4A 4KBAA 5M09A 2QR7A 3DKOA 5AFVA 2CNVA 2PUPA 4UV0A 1LR4A 3LXNA 4L52A 5KUPA 4TRLA 4MXAA 4LOOA 4QTDA 2UZEA 3EQIA 4BTMA 5KKRB 2R7BA 3QALE 4F6UA 3LVPA 1V0OA 3R7VA 3BIZA 5EKNA 2ESMA 3KF7A 4DEDA 1XKKA 3ZM9A 4FYNA 4U81A 5KE0A 1H4LA 4AW1A 3NYVA 3QGYA 3D4QA 5AAFA 1R78A 2XJ2A 3SOCA 5CVHA 2X8EA 4UMUA 3R0TA 4HGTA 4N70A 2YWVA 5EW3A 4RG0A 1TQPA 3FMDA 2GNGA 1JSUA 4RFYA 4MD8E 2BMCA 4L67A 5CF5A 2R5TA 5FG8A 3NVMB 2W1GA 5H2UA 3NPCA 2XNOA 4BB4A 2CN5A 4E6QA 3PE1A 5L2WA 4FT0A 2R3OA 2ETRA 4O91A 3DGKA 3NSZA 4M3QA 4EH5A 3SW7A 3ENMA 3QKMA 5LCKA 4B6LA 4HGLA 5FTQA 3TNQB 3KULB 3HMIA 5FXQA 3OBGA 4RJ5A 3VUDA 2A1AB 3E63A 1XMMA 1XBBA 4RMZA 4O7SA 4I24A 4RA5A 5CEIA 3HDMA 5CX9A 5E92A 3QLGA 1YWRA 3NDMA 2B9JA 3R1NA 3BEGA 3BYSA 3N4UA 3OROA 4K9YA 2G1TA 2Y4PA 4QMYA 3QTSA 4AX8A 5C8KA 1XH7A 1ZMVA 4YJOA 2UZNA 4JBVA 4NWMA 4DEIA 5CNNA 4HYSA 4AE6A 2J0JA 3GU7A 4CTBA 3R9RA 5M57A 3FI3A 2YM3A 2A19B 2BALA 4WA9A 4YHFA 3EFWA 4O0YA 2V55A 4O6EA 5I3OA 3FXZA 1DM2A 2I0VA 2PVNA 3MBLA 3SG9A 4NM7A 2UVYA 5HKMA 3QTRA 5EKOA 5BVWA 4WNKA 3R63A 4X7QA 1J1CA 1R1WA 3H0YA 4I23A 4C3PA 5DMZA 2WTKC 1Y6BA 2IZTA 2UW6A 3ZZEA 1BUHA 4AZSA 2GNHA 1KE8A 4GU6A 4AT4A 3TTJA 4EBVA 4EOJA 4QEBA 1STCE 4YZNA 4D0WA 4V0GB 4XUFA 2C1AA 2WTJA 4L44A 4MX9A 4BGGA 4BZDA 3F5XA 3RAWA 3EKKA 4DTBA 2PYWA 5AAGA 5HO6A 3JS2A 3RVGA 5K9IA 2VWXA 1Q5KA 2CGUA 3QRUA 4GW8A 4M15A 3GEQA 5ITAA 4QP1A 3ATSA 5CAPA 4RA4A 4NUSA 4TKSA 4BTFA 4FT5A 3FMHA 4XHKB 5IH6A 3OFMA 2JFMA 4F0IA 4PP7A 5L2SA 1M2QA 3W10A 4X2GA 3DZQA 3R8UA 4AP7A 4E8AA 3AMBA 2CCIA 5E1EA 3QC4A 4BIEA 3KB7A 4JDJA 5E91A 4PPAA 1RDQE 2QR8A 4L43A 4PL5A 3A7FA 4UMQA 3VN9A 3ZEPA 2NRUA 5JFSA 2HXLA 3DDQA 4EKLA 2JGZA 4BHZA 2VU3A 3A2CA 5HBEA 2X6DA 2XS0A 3Q04A 2B53A 1OL2A 3O2MA 3CIKA 4CT1A 3BI6A 3W16A 4FV8A 2XYUA 4E93A 3ZCLA 4FEXA 3CJGA 1XHAA 4FKLA 4H1MA 3P9JA 4GFOA 4JBOA 1G8AA 4NW6A 3NYOA 3RK5A 4FEVA 2X2KA 4FR4A 3DFAA 5EDQA 3WIKA 4F1TA 3O8TA 5M56A 1OUKA 3I60A 3LCKA 3HLLA 4OTDA 5FLFA 2PZ5A 2VN9A 4FIEA 3CXWA 3RK7A 3RZFA 3AKKA 1SZMA 1XH9A 3DTCA 2OGVA 1IA8A 3ZUUA 3HRFA 4RFMA 5CEOA 3F5PA 4TYJA 4F7NA 5C03A 5K0XA 3QXOA 3LE6A 3TACA 3ORTA 5EM8A 3F7WA 3OXZA 3AMAA 5J7BA 4BDGA 2VWBA 2BZKB 5HORA 4G3GA 3TWJA 2FVDA 5HVYA 4OBPA 4QQ5A 3DCVA 3TV6A 3ZXZA 4G6LA 4IANA 4K33A 3R8VA 3FL5A 2W1DA 2GDOA 3OWKA 1IEPA 4KA3A 4OR5A 4QD6A 4DGGA 5LVLA 3D7TB 3R2BA 4IM3A 4KRCA 2OXYA 1WVYA 3AT3A 3AC8A 3OXTA 4FGBA 5AV1A 3EQBA 1WZYA 2DYLA 4L46A 5IMXA 3S00A 5DRDA 4FSNA 4WNPA 1PYEA 1NXKA 4UMTA 5AA9A 5CY3A 2J0IA 4EK5A 4RIYA 5DBXA 2XJ1A 4G3DA 2Q0NA 3FMJA 3VS3A 2YAKA 3E64A 4QMNA 5BVNA 3OW4A 4FV5A 1UU3A 5BVFA 5AUZA 3OTUA 4YC8A 2HZ4A 3KXGA 3DKGA 4QRCA 3W8QA 4P4CA 4RLLA 5T6KA 4AXEA 2IW6A 4ZAUA 4PY1A 3II5A 1VLRA 4DDGA 3NX8A 1I09A 4ENXA 4MF1A 2OSCA 3KMMA 3RPVA 5EQEA 2C6TA 5EYCA 1CKPA 2XYNA 4FVRA 2XA4A 5IUIA 4D2TA 3PE2A 3U4UA 2PVMA 2W96B 5J9ZA 5FXRA 1LEWA 2B55A 4FG9A 5J5SA 5BX0A 5IEYA 3BE2A 4U7ZA 4L00A 3VS1A 2BHHA 2R3QA 3CSVA 4E1ZA 2WQOA 4IB5A 2WU6A 1Q3DA 1TQMA 1QPCA 2OI4X 3F2RA 3R7EA 3TCPA 2HY81 2FSTX 4MKCA 4EHEA 1Y57A 1YHWA 4LGGA 5CF8A 3RCJA 3BYOA 1AQ1A 4I92A 4EOPA 2WAJA 3Q6UA 5HE3A 4NT4A 1YW2A 4BKJA 5AV3A 3WYXA 4QTEA 1APME 4RIXA 4W9XA 4PV0A 4U44A 4QQTA 5CI7A 3PLSA 4CG9A 3MPTA 3O0GA 4J8MA 1OKZA 4F99A 3FQHA 2J2IB 5DRBA 2BRBA 3IQ7A 2WFYA 4BDIA 1M7QA 2J6MA 4I6HA 4YJQA 5DN3A 3OOMA 1HOWA 4ANLA 3UOJA 3KU2A 4MQ1A 3KFAA 4RWLA 2XJ0A 4I3ZA 4L3JA 2ITVA 2C5OA 2J50A 1H28A 3C13A 4QMPA 4FTUA 2WU7A 3L9LA 1P4FA 4I20A 4K18A 4RJ3A 2C3KA 4YLJA 3NNWA 4NM5A 2Q83A 4DHZA 3LMHA 3BQCA 5GZ9A 4TW9A 4X0MA 2H9VA 3GU5A 4S2ZA 4H36A 1FGIA 3Q4TA 5L2TA 4BI1A 2R9SA 2F2CB 3ZO3A 4EK8A 3KXHA 3NIZA 4FT9A 2EVAA 2ONLC 4M66A 4WD5A 3LLTA 5IQGA 4DHFA 2WMUA 3FWQA 4RPVA 1OBGA 2GS7A 1UV5A 2XM8A 1MQ4A 2EB3A 2WTIA 4AA0A 4BCOA 4O82A 3CEKA 4IWPA 2VTAA 1XWSA 4USDA 2C47A 4PF4A 1GIIA 3R7IA 2ZMDA 3WOWA 5CAUA 1JWHA 2VTQA 4RRVA 2JITA 5DI1A 5L8JA 2P3GX 3CD8A 3F2AA 4MNFA 4Y5QA 4D5KA 1PXJA 4CLJA 2RG5A 2XKEA 5FBOA 3I6WA 5FD2A 4QMQA 4XS2A