4XNEA

Crystal structure of erk2 in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
346
structure length
344
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Combining `dry' co-crystallization and in situ diffraction to facilitate ligand screening by X-ray crystallography.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 107
structure length 344
sequence length 346
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xneA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xneA01
2GNJA 2EUFB 4X3FC 1CTPE 3UOHA 4F0FA 4PPCA 1PHKA 3VQUA 1NVRA 3NIZA 1YXTA 2QHNA 2YACA 2X9EA 4BRXA 5ANOA 4L45A 1F0QA 3FXWA 4FV0A 4JRNA 4N6ZA 3KFAA 2BTSA 3LCSA 2PZ5A 4X21A 2UW0A 4O7ZA 1DAWA 2UW9A 1Q8TA 2R3JA 3DZOA 3EQIA 3PPZA 3QZIA 4YJPA 3W8LA 4ANOA 1G5SA 4Z9LA 4JT3A 3RM7A 3VRZA 4B8LA 3MYGA 3DB8A 3MB7A 1ZXEA 3RPRA 3B2WA 4AW5A 3WF6A 3HMPA 3VF9A 5HVJA 3WE8A 1H1WA 1WAKA 3HECA 1Y57A 3Q53A 5M44A 1PW2A 4I0RA 5EQYA 1H0WA 3QCYA 2FYSA 4JX7A 3FZSA 1ZMWA 1MP8A 4R3RA 4H58A 3UP2A 4ZS4A 2PHKA 2HZ4A 3FAAA 2VUWA 3QHRA 3A4OX 4IWDA 4BVUA 1BL7A 4RJ4A 2Y4PA 4BDHA 2XJ2A 4AW2A 3NYNA 3FMMA 2WMUA 4J96A 4KAOA 4XG8A 2NPQA 4YTHA 4AZVA 3LIJA 3COHA 1WBPA 2YN8A 2OH0E 2W17A 3Q5IA 4I23A 3FY2A 5K4IA 1W7HA 2PVFA 3GOKA 1JKKA 4F1TA 4FTNA 2V62A 1WBTA 4BDFA 2EVAA 3AGMA 4XUFA 3DA6A 3S2PA 4IM3A 5KKRB 4C02A 4NSTA 5M51A 3S4QA 5A6OA 4IX4A 5DNRA 4FTUA 4KSQA 5K3YA 5LVNA 4BCFA 4ZJVA 3FLNC 4IDVA 2XK4A 4WNKA 1ZY4A 2A1AB 4F1MA 5AV4A 5CEQA 4ASXA 2DUVA 5DT4A 4BI2A 4XYFA 2LGCA 3RNYA 4D2VA 5L8KA 4XCUA 4C3RA 2E2BA 3LFCA 2RGPA 4FK6A 3CPBA 3CQWA 4HYHA 2HZ0A 4LMUA 4UZHA 4I4FA 4R7HA 5CT0A 2ITTA 4DFNA 4KKHA 3W33A 4XEYA 2VRXA 5HEZA 1ZYSA 3O51A 4MBIA 1OKVA 3P08A 3RWPA 3SKCA 4DHFA 3ID6C 4PRJA 5KNJA 5M07A 1YRPA 4BWPA 4AW0A 5ANGA 4F9CA 4O21A 4QMXA 4YLKA 4RX5A 2YCSA 3WZJA 4X3FB 3UVRA 3COKA 2W4KA 2YM7A 4CXAA 3OBGA 1H1RA 3BHHA 4JBOA 4LG4A 4TL0A 1U46A 3OT8A 2JIUA 5HU9A 4HPTE 4AG8A 3UNJA 1DAYA 3V5LA 5ANDA 1Q3DA 2ZVAA 4GFGA 4ZY4A 3CPCA 4QYFA 5LXMA 4ZLYA 2IZTA 2Z7SA 4F1OA 5D7AA 1ZOGA 2VN9A 2YAKA 4YJQA 2CLQA 4C3PA 4RSSA 4GKIA 3QYWA 2CN5A 3IW4A 2HENA 1E9HA 1APME 3D2IA 4TRLA 2XEYA 2UW5A 1ZLTA 3EYHA 3DAJA 3PFQA 5TKDA 3F5PA 1R3CA 3FXZA 4L01A 1U54A 4QMOA 4ZK5A 4U3ZA 3WF7A 5C4KA 1YI4A 2C3JA 3HV3A 1Y8GA 4RMZA 2WTJA 2JBOA 2WOTA 3EN5A 4EQCA 3HP5A 4FG7A 5HTBA 5IMXA 4YU2A 2F2UA 3BBTB 4L53A 5FGKA 2IVSA 3AT2A 2WTCA 3PZHA 5C8NA 4A9SA 1DI8A 3CY2A 2A27A 3E8EA 2B9FA 2BZKB 1H07A 2IPXA 4ANSA 2OSCA 3VC4A 2CGWA 3FUPA 4X2JA 4YBKA 4LV5A 4ZTHA 5AAFA 4QMPA 4WBOA 4EK5A 1A48A 1B39A 2GNHA 3D5XA 5AMNA 1H4LA 3BWJA 4DT8A 2Q0BA 1Q24A 4BWXA 3DXPA 4MKCA 2X9FA 4QTEA 4BKJA 3ZBXA 2WMWA 4FTAA 2XMYA 2XKCA 1H27A 4E26A 3R2YA 2QO9A 4ARKA 4K9YA 2BILB 3C1XA 3OCGA 3ORNA 4C4GA 1Q8YA 5HD7A 4K8AA 5HGIA 1KE7A 3LFFA 3RHKA 4KIKB 3ZEWA 3NUSA 3LFEA 2XKEA 3R01A 4IADA 4DG2E 4F9YA 2J6MA 4FKIA 4IZAA 4YHJA 3RMFA 2I6LA 3HX4A 2HCKA 2HOGA 4YJNA 4C4JA 2XIXA 2UW7A 4OT5A 3NAXA 4Y72A 3MVHA 2JKOA 4G6NA 4ZS0A 4JIAA 3F2AA 2X4ZA 2GDOA 2R3HA 3RM6A 1QPDA 3U4UA 1G8AA 3P1AA 3LM5A 4QTAA 5BQ0A 5CU0A 3Q9WA 5IH5A 1Q4LA 4PL5A 3BYSA 3H30A 3NX8A 4ACGA 4E6QA 2VV9A 2C5VA 3FYKX 4F9AA 2F9GA 5HKMA 4FTRA 5BVWA 5KO1A 3UG2A 5BYZA 3MFUA 3QTRA 4A9UA 1G8SA 2ONLC 4EWQA 4JR7A 2XZSA 5C8MA 3DKFA 3W16A 4CG9A 4EJ7A 1Q61A 4MTAA 5FD2A 1JSVA 2W06A 4LGDA 3QLFA 3RNIA 2Q83A 5FQDC 3OXZA 4BIDA 1IAHA 3VUIA 5HICA 4ZAUA 4BCOA 1J1BA 5A9UA 1PYXA 4CRLA 5L6WL 4ZJJA 3IONA 3D5VA 3NRMA 4XG7A 4HCTA 3LCOA 4YJUA 2VTNA 2R3MA 3DTWA 4CRSA 3TIZA 3R9OA 3SG8A 4L3JA 4U43A 2QCSA 4BTJA 5JQ8A 3HUCA 3V51A 5JQ5A 5EYDA 4PQNA 2VNWA 4FV7A 4M3QA 2CNQA 4U7ZA 3R7GA 2UW4A 4NW6A 4QQCA 5D1JA 5G6VA 2XK7A 3R7IA 3Q9ZA 3TUDA 5FTGA 3PLAE 4MQ1A 3Q3BA 3FY0A 3LKMA 3OS3A 4EH8A 3GCPA 1Q5KA 1YXUA 1B38A 1CKPA 3BU5A 4H05A 4AN3A 3DV3A 4Y5QA 2W1DA 5K0XA 4M14A 4BDAA 3S00A 4JI9A 2GHGA 3HRBA 3ORZA 3UODA 4ZTRA 3OCBA 3IS5A 3MPTA 3QQHA 2F2CB 4G6LA 4I5CA 4RJ5A 1Z5MA 3VJOA 3EFJA 4R77A 5E9EA 4U44A 4XP0A 3UP7A 4FG9A 2JDRA 3UO5A 2QOIA 5JMSA 4JIKA 1JKTA 3C5UA 2J0MB 3IW8A 5CZHA 5JGBA 5M4IA 4NYEA 4AOTA 4CYJA 1BI8A 5AR2A 5AR5A 4RRVA 1CKIA 2XNNA 4DC2A 2Y8OA 2C6OA 5DR9A 4BI0A 1UNHA 3EQBA 2BZHB 3BHVA 3GXLA 4O0XA 3HZTA 1Q3WA 3OUKA 3TJCA 5CXZA 3QRUA 5LCKA 3RZBA 4F6WA 5IEYA 1XQZA 3TACA 3CP9A 3FQSA 3TZMA 1NXKA 3F66A 3LQ3A 5IQAA 2QONA 3MW1A 3QTWA 2YITA 3CQEA 3GVUA 1VYZA 4FKSA 3BYUA 1XBAA 2WMVA 3ZLYA 3HMNA 3AC8A 2REIA 4CT1A 3MVJA 4KNBA 5FP5A 5AUYA 3C4CA 3TWJA 4NKAA 2G2FA 2XK6A 2VWIA 4FI1A 3RHXA 4UBAA 2X39A 4GVJA 4L7SA 4RX7A 4AFEA 5IKWA 4BDKA 4HVSA 3DXNA 3LXPA 3IGGA 3TUCA 1UNLA 3TKHA 3WZEA 2WEIA 4MD8E 4CKRA 2V7OA 5FTOA 5HZNA 1IASA 4TWOA 2ITWA 3DBFA 3WOWA 3H9OA 3A7HA 1OKZA 2WU7A 4D58A 4IAYA 3FKLA 3RWQA 2WTKB 4EOJA 3ZDIA 2XKDA 1CDKA 3KA0A 3QU0A 4FKPA 4FSMA 2O8YA 4G9RA 5KMNA 5IQDA 2I0YA 5CEMA 1EH4A 3CGFA 1RDQE 2XH5A 3S3IA 4GJ3A 3SV0A 4I41A 5H3QA 4HVGA 5FUTA 5FTQA 3V5TA 1W98A 3RTPA 1OGUA 1NVSA 1L3RE 4BDBA 1IA8A 5CZIA 4Y85A 4DTAA 3PIZA 5DRBA 1O6YA 4LUDA 4W4WA 4RVTA 3DBCA 1PRYA 3NUNA 2X6DA 4YZBA 5CVHA 3JY0A 3VBWA 4ITIA 2QOCA 3EFKA 5HIDA 5AUTA 3KVXA 3SOCA 3BE2A 1T45A 4X2KA 4XV2A 5L2SA 2P3GX 4KIQA 2PVNA 4X7QA 3OUNB 5EHOA 3LQ8A 4FT3A 1XWSA 3NZ0A 5TT7A 4GV1A 4MNEA 3M2WA 1QPEA 2W1FA 4BR3A 4IVCA 5EM6A 3RP9A 4YTCA 4EOQA 2VWUA 4YMJA 2BZIB 1GJOA 2R0IA 1KOAA 4FTOA 4GK2A 2O63A 2XJ1A 2Z60A 1OKYA 4ALWA 4P5ZA 2W1GA 3QTUA 3S95A 1M2RA 2NRUA 3ZDUA 2JDOA 4DN5A 3E8DA 4CGAA 2W4OA 4BDEA 4GYGA 3KC3A 4K1BA 5FBOA 4EUUA 5IQHA 2QO2A 4USDA 2IO6A 5LVMA 3BV3A 4XP3A 2H34A 2JIVA 4NM0A 3CC6A 4RC2A 5CT7A 3LFNA 3A4PA 2GTMA 3PIXA 4XV9A 5AUZA 4BICA 5J8IA 2HY0A 2J90A 5AP1A 1FMOE 4D55A 4DEBA 5EQPA 4OAUC 2NRYA 2OIDA 4I5HA 3V5PA 2FB8A 3KMMA 3BI6A 4XBUA 4HCVA 2XCKA 2BAKA 3FMKA 1U4DA 2OKRA 3HEGA 2JDSA 3R8UA 5HBHA 3ZZWA 5JFXA 5M4UA 2X7FA 3KK9A 4GSBA 4EOPA 4CT2A 4S34A 3QKLA 1KE5A 5A4EA 2IJMA 3D14A 3C0IA 1IEPA 4D0XA 2BIKB 5HI2A 3GGFA 2RG6A 1U5RA 2WQEA 3CIKA 4FA2A 1OIYA 5AUVA 3TG1A 1JLUE 1TQIA 2UW8A 3H9FA 3MIYA 2ZOQA 4WOVA 3T8OA 1XJDA 3I7BA 4TWNA 2Y7JA 2VTJA 3DK7A 4WIHA 3EL8A 3HNGA 4FTQA 3LFQA 1GIIA 3F69A 1S9JA 2R5TA 4TN6A 5ETAA 1SM2A 4UV0A 3FHIA 4FTJA 3F9NA 4MXZA 4W9XA 3VS3A 4C2WA 4YJOA 5DEWA 3LMHA 4RJ6A 2C3LA 3AC3A 3PLSA 4RX8A 5GIPE 1YHSA 3ULIA 5EKNA 2BRBA 4UALA 2C69A 2UVZA 4LV8A 5ANEA 3VUDA 1BI7A 3OY1A 5ACKA 4UMQA 4YZNA 3E5AA 4Z55A 3QF9A 4YUQA 4FL1A 4RG0A 3MN3A 1JSTA 3LMIA 1Y6BA 3LQ5A 4MD7E 3N4VA 4O82A 5CI7A 3SXFA 3KULB 3EQFA 3DLZA 2HELA 3KY2A 2QHMA 5LARA 5JFWA 4I5PA 4PUZA 2QOOA 3VS1A 4WT6A 2W0JA 3FLSA 5CU2A 1ZZ2A 3VBXA 4AGCA 4K6ZA 4QQJA 2HXLA 1OIUA 2B52A 2QOQA 1KE6A 4AA0A 3FC2A 4MD9E 1YHVA 3PXRA 4H1MA 4YZMA 2LAVA 3N51A 4A07A 4BYJA 4GKHA 4X0MA 3QQGA 1Q99A 4OT6A 3ULZA 2OJJA 3WARA 4E4MA 3FLYA 4EWHA 4F6SA 1TQMA 2JLDA 2XCHA 3ODZX 3BWFA 4ANBA 5CEOA 2IZSA 4E4NA 2FH9A 4CMUA 4DEGA 3ORXA 2XNOA 4IE9A 2A0CX 1KOBA 2VNYA 3MA3A 4EUTA 3AGLA 3BEGA 3DJ6A 4RBLA 4UMTA 2YZAA 2YDKA 3LLTA 3Q9YA 3DGKA 4BHNA 1GZNA 4FZ6A 2CGVA 2WQMA 4TYHA 4BGGA 3AMAA 3Q9XA 4FOBA 1GNGA 3R21A 4F7JA 4QT1A 5H8BA 4RPVA 3TN8A 4AW1A 2X8IA 2YEXA 2X2KA 2KULA 3H3CA 3P7BA 3R73A 3HKOA 3DY7A 4FUYA 1F5QA 3O7LB 3IOPA 1PXKA 3EWHA 4GFMA 2EXEA 3WI6A 5FRIA 3OROA 4TW9A 4AZWA 3ORMA 5FXSA 1URCA 4R3CA 4NWMA 2R9SA 2Z7QA 2R3PA 3MFSA 4GH2A 4EQUA 3SX9A 5KMLA 5CASA 4DA5A 1FVRA 1PYEA 5HESA 5DIAA 4N6YA 2PVYA 3COIA 2XBJA 3QQUA 4ZY5A 3PA3A 1PJKA 2J5EA 1XH5A 2UZVA 3PE2A 4IW0A 2PL0A 4PP9A 5E8UA 5FEEA 3PXYA 5J1VA 4XS2A 4D2PA 2W1HA 4MWIA 3W8QA 3F3WA 3I81A 4AZEA 3R04A 4J95A 3SXSA 2PK9A 3BQRA 4UZDA 2E9UA 2PMNX 3Q4ZA 4JR3A 2I0EA 5AEPA 4MNFA 4XP2A 4DEHA 3OZ6A 3DQWA 5AA8A 1L8TA 3GENA 4QMTA 2GFCA 2I40A 2H6DA 2QODA 5TF9A 2C6IA 3L8VA 4XG3A 1UU7A 3CLYA 3I4BA 4GVAA 3HMIA 2QU6A 3QCXA 4MQ2A 4UYNA 4HGSA 4YJTA 4ZJIA 4D2TA 5B2MA 5HD4A 4BIBA 3MFRA 3KQ7A 3R8PA 4F9WA 5F95A 3EN6A 1KWPA 4O0TA 5M53A 2P2IA 3LW0A 3PJ8A 3JXWA 3MGYA 1LEWA 3WYXA 1CM8A 4O81A 4AF3A 4BCHA 1SNUA 5EI2A 5H2UA 1XH7A 3I7CA 3TNQB 4OTFA 3UG1A 5L4QA 5E8TA 5BUJA 4O7YA 5EI6A 5KBRA 2OIBA 4FC0A 3PVGA 2Y4IB 4J1RA 3VRYA 2PMLX 5IISA 4BB4A 3GOPA 4ID7A 3HGKA 2OZAA 2JEDA 4DFXE 3A61A 1OITA 4O0RA 4QMUA 3O7LD 4AWIA 3K54A 5EM8A 2VWZA 4CV8A 1LP4A 4BBEA 3QQJA 3DTCA 5L8LA 4BZOA 2XNGA 3HRCA 3E3BX 4IDTA 3A7GA 4KINA 4L52A 2DYLA 2G9XA 2HK5A 3AD6A 3F5GA 3EJ1A 4FV2A 2YJSA 3ROCA 2X1NA 3BLHA 3CR0A 4C8BA 4AS0A 1B6CB 3TM0A 2RFNA 3ODYX 4U40A 4RIWB 5A14A 2WHBA 3VVHA 3FLZA 4P2KA 2R4BA 2UZOA 3FI3A 3IG7A 2IVVA 3FC1X 3VWAA 4MEDA 5M4FA 4YBJA 3MA6A 4YZCA 5BX0A 2R2PA 4W9WA 4BDGA 3EH9A 3SC1A 4QNYA 4KS8A 4N0SA 4GRBA 4NIFB 5BVOA 3G90X 2ITQA 4JBQA 4AXAA 3U9CA 3Q04A 5EYKA 4A4XA 4BDDA 2CNVA 4DFLA 4FZFB 2CSNA 3HV4A 2QOHA 5EW9A 3NW7A 2X8EA 1AGWA 2FSTX 5J9YA 5HX6A 3KCKA 4FT0A 3KVWA 4MK0A 2O3PA 3TV7A 1W83A 2XF0A 2GU8A 3VS7A 4KSPA 4E7WA 3C4WA 4JAIA 1M7QA 3NLBA 4NW5A 4DH1A 3FL4A 4PNIA 4XHKB 5IQBA 2DWBA 4RIYB 1HCKA 2AC3A 4IB5A 4F6UA 4GMYA 3MS9A 3V01A 4KABA 4R5YA 1FVTA 2YABA 5KMIA 3ZH8A 3AOXA 4UMRA 4O7VA 2BR1A 4C57A 1W84A 4ZZOA 3NYVA 5AM7A 2W99B 2YIWA 3ORLA 4O0VA 2ZM4A 3GFEA 5AV1A 4FE2A 3ROYA 3ZM9A 4NJDA 4UX9A 3Q5ZA 5CU3A 4ACMA 4RA5A 3HMMA 2CJMA 2VTIA 4IB3A 2BFYA 3SRVA 4O96A 5IA1A 3BGQA 3BRBA 4HZRA 5L2IA 5C03A 4FSTA 3GCUA 2BROA 2JKQA 4JBPA 1RW8A 2ERKA 5BMSA 2BCJA 5EM7A 3THBA 3V6SA 3M11A 3DNEA 5HVYA 4ALVA 4ZSEA 4HGEA 2X81A 2UW3A 1P2AA 2WNTA 3PXKA 2YCRA 2ZDUA 4I1ZA 4PDSA 4C4HA 4WD5A 4PPAA 3VHKA 4LL0A 3VAPA 2OH4A 4TXCA 4F64A 5HTCA 4LUEA 1H1QA 3NW6A 4D2SA 4RVLA 2XM9A 3SVVA 4IM2A 4M84A 3CQUA 2YAAA 2BFXA 5LMKA 4O86A 4PDOA 3LFBA 5HCXA 2CKEA 5I4NA 1TQPA 2R3RA 4O7SA 4O84A 5J87A 3U6JA 4UWCA 4QP4A 4GIIA 3UMXA 5EI8A 3T9IA 2OXDA 2WMBA 3ORTA 4JOAA 4WRSA 3UOLA 3HUBA 3U6IA 1OB3A 4C36A 3PSDA 2PTKA 5C27A 2RFDA 3BELA 3GUBA 3GBZA 3HDNA 2H9VA 4YC6A 4YTIA 5CF5A 4MXOA 3G51A 3Q4UA 4RVKA 3TIYA 3NVKI 2PSQA 4IZ7A 3TV6A 4I4EA 5E92A 3SQQA 4ANQA 1MRUA 3DB6A 3C4ZA 3OG7A 3F88A 3ORKA 4R8QA 4RFYA 3BCEA 4RIXB 4W8EA 1M2PA 1BLXA 2ZYBA 4PDYA 4KBCA 4O6EA 4M69B 3AG9A 4BHZA 4F0GA 2CKQA 4M7IA 2QOLA 2XJ0A 4G5JA 3TT0A 2UVXA 3A7FA 4WUNA 4RWLA 5LVOA 1K3AA 3D94A 3N4UA 3Q6WA 4ZXTA 1QMZA 3IDPA 1ZYDA 4IBMA 4QMVA 3IECA 3LFDA 5AP5A 3HMOA 4RX9A 3VW6A 2P0CA 4FKLA 2E9VA 4O0YA 2V0DA 3A62A 5CSPA 4HCUA 2XIRA 2F49A 5IA2A 2W9FB 1IG1A 2X2LA 3QFVA 5AP2A 5HE1A 5EH0A 3T3UA 2YLEA 2F7EE 4O0WA 5DLSA 2UZNA 4G3CA 5DN3A 5ANKA 2CKPA 4ANMA 2ERZE 4EOSA 2O0UA 4FZDB 4JX3A 1ZMVA 4UYAA 1NW1A 3IW5A 2JGZA 2OF4A 3KN5A 3QD4A 3TZ8A 3KCFA 4PMSA 3ZU7A 3ZSHA 3IW6A 3ZXTA 4PNKA 4W4XA 2XS0A 5AAEA 1E1VA 3EHAA 5M06A 1H24A 1WBNA 1YDTE 3KRJA 3O96A 3NAYA 4RJ8A 1F3MC 5E8SA 5GZ9A 1OIQA 2G2HA 3GC8A 5CQUA 5EW3A 4C58A 4XV3A 3D15A 4UXQA 4H3BA 4X3JA 4UMUA 5A6NA 3A7IA 4F9BA 2A2AA 3ENMA 4BKYA 4ZTNA 3BGPA 3OEFX 3KN6A 5AV0A 3EN4A 3D7TA 4JDHA 4DLIA 2VWVA 3MJ1A 4QMNA 4H39A 4JDJA 4Z3VA 4AGDA 4HW7A 1H00A 5L3AA 4O7WA 2Z02A 1M14A 4EH7A 2C5XA 3KB7A 4Z7HA 2W1EA 3LJ1A 1ERKA 4ZSLA 4EK6A 1PXJA 3QUDA 1YXSA 1KUTA 4KKGA 4OTDA 3O17A 4U41A 5IA5A 5HNGA 2B0QA 5EHLA 4AN9A 3DFCB 2J0IA 4CCBA 5DI1A 4AAAA 2B54A 2BALA 3OXTA 4V0GB 3WIGA 1H8FA 3P23A 3OCTA 3UYSA 1NVQA 2WMTA 2YJRA 3KEXA 3UVPA 4S33A 5M57A 4BBMA 4TYIA 1DS5A 1Y8YA 1R0EA 3LM0A 3ZYAA 4DEAA 4JVGA 3NNVA 4DGGA 3MJ2A 3HAMA 5CAOA 3ZO3A 4TWCA 4D9UA 3MY0A 1M7NA 1MRVA 1GOLA 3MPMA 5CAQA 3I0OA 4RLKA 4LYNA 4M0YA 4FICA 3PP1A 2W4JA 4O38A 5HORA 5HG8A 2IVTA 2OK1A 4CZTA 2ETRA 4S2ZA 1BL6A 4FK3A 2C47A 3OFMA 4E93A 5DPVA 4E3CA 3LJ0A 4YP8A 4YC8A 4GT5A 5CSHA 4WKQA 3CEKA 4EORA 1GZOA 4XG9A 2DS1A 4BTKA 3WZKA 5JFSA 2X7OA 2RFSA 3ITZA 2VTQA 1XBCA 4CKIA 4RA4A 3VBQA 3I0QA 3QQLA 3OOMA 4FGRA 4DF3A 4XG4A 4BDJA 5E91A 1T46A 3N4TA 3UO6A 3RK7A 5CEKA 1XHAA 5C26A 1WBOA 3CD3A 3WF8A 1YXVA 3QA8A 3ETAA 2BRHA 5HBEA 3FJQE 3R7UA 2ESMA 2XIYA 3FSKA 4C33A 1YKRA 3W2OA 3FI2A 2WQBA 4OBPA 5JN2A 1ZY5A 3DDQA 4Q9SA 2GMXA 2QLQA 4D2WA 3QRIA 3QRKA 2YWVA 3F5UA 3ZSGA 5AIRA 4YPSA 1Q8ZA 4JXFA 3KRWA 4C2VA 4XRJA 5GHVA 1ZYCA 3MY5A 5K5XA 5BUIA 1J91A 4ZZNA 4D4RA 5A4QA 1H25A 4LOQA 1V1KA 3NPCA 3C13A 3DJ7A 4FSWA 1IAJA 3C4FA 3F3TA 2J50A 2UZEA 5ITAA 4CZYB 4FL3A 4W4YA 3IW7A 3CE3A 5HE0A 4O83A 2GTNA 2VTMA 2VTPA 5IDNA 2C0OA 3U8WA 2ETKA 3PA5A 3UQCA 3KL8A 2V55A 4I6QA 1OMWA 3CBLA 5CY3A 1RQQA 4TT7A 2G1TA 5BVFA 4LRMA 3NR9A 2QOFA 1U5QA 4GK4A 4JG8A 4NKSA 3ZO2A 4EK8A 4DYMA 1R39A 5L2QA 3SGCA 4C3FA 5KHXA 4V04A 2YERA 2PE2A 1MQ4A 4PX6A 5BPYA 3KU2A 3QA0A 3AMBA 4QOXA 4UEUA 3GC9A 1URWA 4EH4A 2XIKA 4OAVB 2HWPA 2B7AA 3LVPA 4V05A 2CDZA 3CCNA 2JBPA 2VWBA 2AC5A 3WBLA 4NM7A 3EMGA 4FUXA 4ACHA 2J2IB 1SVEA 4TWPA 3U9NA 2UZUE 3PXFA 4TYGA 4C38A 5JKGA 3E7VA 2F7ZE 2PULA 4RFMA 3OC1A 4FV8A 4FF8A 3NNWA 3PJ3A 3L9LA 4GU6A 5EDRA 5T68A 4DCAA 3NNUA 2BMCA 3R30A 4MXCA 3V8SA 2ITXA 5HLWA 3PZEA 3TNWA 4NT4A 3BHUA 2UVYA 4FTCA 3DKOA 5L6PA 5EQEA 1FQ1B 4G9CA 3QYZA 1GAGA 4X3FA 2CN8A 2IW6A 1UV5A 4OLIA 1P4FA 1S9IA 3G2FA 4MWHA 5TO8A 4IQ6A 4DGOA 3TTIA 2G15A 3OBJA 4EH5A 3VW8A 4YZ9A 4FSNA 1ZAOA 4GW8A 2PMOX 3PPJA 4GIHA 3RVGA 3FQEA 1WVWA 5HTIA 4QTCA 2XNEA 2QVSE 4X2FA 5AP6A 4Y5HA 4DLJA 4J52A 4F7SA 5IA4A 5KHWA 4FV5A 3E93A 3OY3A 4FR4A 5LMBA 3O8UA 3SDJA 4KRDA 4WG3A 4A9TA 5BVNA 2X7GA 3GQLA 5BUEA 3CTQA 2VD5A 4PL4A 2PZRA 4M12A 1LEZA 3UNKA 5IQCA 2SRCA 3V04A 5CSWA 2IN6A 4PDPA 4QYHA 1YVJA 4AT3A 2QU5A 4AZFA 4XBRA 1VYWA 2QOKA 1OBGA 4R7IA 3FKOA 4MBJA 3LCKA 4E5BA 4B6LA 5DE2A 3OW3A 1V0BA 3QUPA 5C9CA 4APPA 3PJ2A 3FL5A 4XLIA 4CV9A 1OL5A 5IQFA 1UU9A 1XKKA 2OG8A 2WQNA 2P4IA 1CSNA 3ZTXA 4ALUA 3F7ZA 3O50A 2VWXA 3HLLA 3QZHA 4FKRA 3F3ZA 3EN9A 4DAWA 2VO3A 4IANA 5GIOE 2Y6MA 3FSFA 4JAJA 2JD5A 1P5EA 2QOBA 2CLXA 4IX6A 4YHFA 5A3XA 5DRDA 4KB8A 2OICA 4I93A 4LI5A 2R7IA 4PPBA 2YLFA 4USEA 4GG5A 3R02A 2EWAA 4E4XA 3UO4A 2OFVA 3R22A 2HZNA 2ZV2A 3R8LA 5DG5A 4DEDA 3COMA 4QMWA 1UWHA 3I6UA 4IVBA 4OTHA 5IMEA 2IG7A 3WYYA 4AZTA 3FDNA 4ZEGA 2IW9A 3KXHA 4H3QA 3SAYA 2WTWA 2UV2A 1PMNA 2XK3A 2XEZA 4FKGA 4KIKA 2VWYA 5D9HA 4P5QA 4J97A 2XK9A 5M4CA 4LRJA 1J3HA 3HA8A 4WA9A 5AX3A 3JUHA 4ANLA 1AQ1A 3CJFA 1PMUA 4UY9A 4AA5A 4XOYA 5CANA 2ZM3A 4WO5A 5DBXA 3QRJA 5EW8A 2YFXA 4ERKA 4M15A 5DOSA 3TNHA 4CFUA 3NIEA 4L00A 3B8QA 2VTSA 4U97A 3CXWA 3C0GA 4G3EA 5E8WA 3EZRA 5AWMA 3RPYA 3VS4A 4EQMA 4EZ5A 5J1WA 4DT9A 4QP7A 4DH5A 1NY3A 2ACXA 3GNIB 1XBBA 4QP9A 3FMEA 4BCIA 3Q4TA 3R9RA 4KA3A 4PF4A 2QKWB 3I79A 5DYJA 2R3LA 2Y9QA 3HV7A 4NZWB 5HE2A 5K5NA 3VUMA 4G6OA 1R1WA 3L8SA 3Q60A 1OPJA 2ITYA 4FT5A 3AQVA 3CD8A 4IC8A 2W1IA 3BYVA 4WHZA 5AM6A 1UU8A 5AV3A 1OUYA 2WKMA 2CNUA 2UUEA 1UA2A 3NWWA 5E90A 1STCE 2R3IA 3D9VA 3FZPA 4CSVA 4BKZA 2RSVA 4GT4A 3GP0A 2WU6A 4U6RA 5CI6A 3GEQA 3R00A 4FKOA 2J0KA 4RWKA 5GJDA 3QTSA 3H4JA 4GUBA 3V5QA 4B7TA 3BGZA 3HV5A 5I9VA 3VS6A 3R7EA 5KZ0A 5CALA 3GQIA 4IXPA 4DITA 2WMRA 5F1ZA 2P2HA 5HNBA 5I9UA 5IUGA 1PF8A 4JG7A 1O6KA 1GZ8A 3VS0A 4ASZA 3KMWA 3P5KA 2AYPA 4BC6A 3QKMA 5HNIX 2XVDA 3Q4CA 2F7XE 2PZPA 4C4FA 4D4VA 2VTOA 4QMQA 3EZVA 2FA2A 5L2TA 4IJ9A 1TVOA 4WRGA 2EXMA 2XNMA 4D1XA 4RVMA 3V6RA 4W4VA 4U3YA 3R0TA 4YO6A 1FPUA 5F9EA 2V5QA 4XX9A 3L9MA 3W10A 2FSOX 4CTBA 3B2TA 2OXYA 2R7BA 3SOAA 5DA3A 4IVDA 1SZMA 5AP0A 4FEWA 2X0GA 3OD6X 2WEVA 4G3DA 4CFMA 2FO0A 4JL9A 4FVQA 4V01A 1YOLA 5CYIA 3ZO4A 1PMEA 5AV2A 3MFTA 3UQFA 2YIYA 1SVGA 3NMUF 5LMKC 2I0HA 5A4TA 3MWUA 4LOOA 2ETMA 3D5UA 3QZGA 3WILA 4YR8A 4MBLA 4DINA 4JBVA 3S0OA 3PA4A 2Z7LA 3SG9A 2Z2WA 3R8ZA 5L6OA 4HYUA 3G0FA 3E64A 3QD0A 4BN1A 3ERKA 4BZNA 5AR8A 4FEVA 4E1ZA 4OW8A 4FL2A 4NTSA 3E8CA 4QQ5A 2GQSA 5JSMA 5LVPA 3O71A 2BAQA 4O1OA 3EQHA 3R6XA 4M97A 3BEAA 2HWOA 1YDSE 4XG6A 4D5KA 5HQ0A 5E8VA 2J5FA 2FVDA 4JQ8A 4TYEA 2GNIA 2C6LA 3I1AA 5AR7A 5LQFA 2BUJA 4FBXA 2CGUA 4IAIA 2ZDTA 4AACA 5KCVA 1UKIA 3BBWA 4YTFA 3EQGA 1Q8UA 2VO6A 4O1PA 2WMSA 1JKSA 4YLJA 4KIPA 4IH8A 3NVMB 4EZ3A 3VF8A 4L3PA 4MF0A 4BF2A 2UZBA 4NCTA 3HRFA 4L7FA 4TNDA 3RCJA 4PMPA 4FTKA 3ZRLA 2BRMA 4HJOA 4ITHA 1LR4A 2A4LA 2DQ7X 5GZ8A 1K2PA 4ZLZA 1REKA 2HY81 5FM2A 2B9IA 2B9JA 5FEDA 4FVRA 3ZRKA 1BX6A 5JFVA 2UZDA 1PKGA 2QR8A 3FMNA 4FKVA 3ZSIA 1Q97A 3AT4A 4QYYA 4B0GA 3G9NA 5I9XA 5EOLA 5KMJA 3DKGA 3SD0A 5B2LA 3ZLSA 4IACA 1PXOA 4S30A 1TKIA 2WO6A 3TZ9A 1UNGA 4AFJA 4YSJA 4UXLA 2VZ6A 4EHVA 4AGWA 3FBVA 4J7BA 2YWPA 3A2CA 2BRGA 4FV6A 1ZRZA 5A4CA 1ZYJA 2VAGA 4FKJA 4CD0A 1ZARA 2WFYA 3K5UA 3QGWA 1FVVA 3SHEA 5HE3A 3MPAA 1LPUA 3PSCA 4FIIA 3KRLA 1O9UA 5CAPA 3L9NA 4D5HA 2PWLA 3KKVA 4FODA 2BAJA 2OZOA 2EB3A 2O64A 5J5SA 3JY9A 2HXQA 2VGPA 3CY3A 5DVRA 4FSYA 4PTEA 1PMVA 2B4SB 2G2IA 1YI6A 3DFAA 3FPQA 4WSQA 5HIBA 3L8PA 1YHWA 1ZYLA 5IA0A 3DJ5A 1WCCA 4Y46A 3JYAA 3W18A 4EEVA 4F7NA 2CHLA 3HAVA 3NCGA 3P7AA 1ZOHA 4F63A 4BCMA 4MF1A 3JS2A 4MCVA 4E6CA 4C0TA 2VTHA 5FM3A 2PVJA 3CJGA 2PUIA 5DEYA 1JPAA 4HNIA 3EIDA 2VU3A 2RIOA 3H0YA 3QALE 4AZSA 4Y83A 4MXAA 4RGJA 4OTWA 3K3IA 4EH3A 5IPJA 2YM3A 3KXMA 4HVIA 3O23A 1VZOA 3DDPA 4FYOA 5L2WA 4EH9A 4JLCA 1P14A 3ZUTA 4LM5A 4S31A 3RALA 4ZSJA 1R78A 1ZZLA 5A54A 3OHTA 3V8TA 4O0UA 3C5IA 1JWHA 3DKCA 5CXHA 3HP2A 4QP1A 2VTAA 4FNYA 1JSUA 4LGGA 4R6VA 1UU3A 1REJA 4QTBA 5AR4A 4FVPA 2C6MA 3A99A 2C68A 2KTYA 3PWDA 4NFNA 1PXLA 5H8EA 1Z9XA 4CNHA 4DTKA 5B2KA 5HU3A 3TDWA 4ASEA 3UYTA 3W2SA 4F08A 4ENYA 1ND4A 2RL5A 5DMZA 1H28A 2WB8A 3MH0A 1JQHA 2A19B 2CMWA 3DAKA 1VEBA 3MH1A 3P86A 3QX4A 4WSYA 1OL6A 4X6RA 3P9JA 3W55A 2WXVA 4QMYA 1FINA 4GL9A 4O7NA 1OUKA 3AC1A 4CEGA 4QPSA 3R9DA 5CENA 5C8KA 2OJIA 2OLCA 5AP3A 3PDTA 4QRCA 2BKZA 4I24A 1PXNA 1M2QA 2XYNA 1H1SA 2CCIA 4KIOA 4Q5HA 5D12A 5EDPA 3IO7A 5HX8A 5CU6A 3QXPA 3UIBA 2WTDA 3KULA 3RCDA 2FUMA 2PVKA 2GNLA 3F3UA 2BTRA 3NNXA 1YOJA 2ZMCA 5FXQA 5CF6A 2JDTA 4YZDA 2QO7A 3KXNA 4IAZA 3O8TA 4FEXA 4Y73A 4LL5A 4I6FA 3OWKA 3TJDA 4FKWA 4G2FA 3D2KA 3EKNA 4KKEA 3CKWA 5ANJA 3F82A 4DG0E 4EL9A 5GINE 4EKLA 4EHZA 4C35A 2VO0A 5I3OA 2ITZA 2OBJA 3MTLA 3ZM4A 2ZAZA 4QMZA 4X2NA 3VS2A 4R7BA 2UZWE 2X2MA 5FBNC 2ZJWA 4FX3A 3L1SA 4IJPA 3NUAA 2GS2A 1GZKA 5IEXA 3K3JA 5CEIA 3Q52A 3RZFA 3FE3A 3LJ2A 3SW4A 4BWKA 5AUWA 4C62A 2G01A 4AGUA 2X4FA 4Y95A 1OKWA 5FLFA 4EK4A 1I09A 4HPUE 2XKFA 4XJ0A 1U54B 3DLSA 4HVHA 2WAJA 5HHWA 4DH7A 1MQBA 4J99A 3KRRA 4CVAA 1U59A 3RK5A 3OTUA 3IDBA 4D4YA 5G1XA 4GU9A 4OBOA 4EKKA 5BYLA 2YIRA 4I21A 5KKRC 4IC7A 4O7RA 5CU4A 4YLLA 4D4SA 3LPBA 3TNIA 3P79A 1V0PA 4NTTA 5HO8A 3LAUA 4M66A 3C4EA 3DS6A 2ZMDA 3GU7A 1BUHA 4ZOGA 1WBSA 2YM6A 3UIUA 5C4LA 2UZLA 2C0IA 3LXKA 5LJJA 3V5JA 4D9TA 2QG7A 4EK3A 4FZAB 4LMNA 3T3VA 4RIOA 4D0WA 4OTRA 4AQCA 4IB1A 3FHRA 5JK3A 5DGZA 5JGAA 5M09A 1FMKA 3UPXA 2XBAA 5I9YA 4O7TA 2AUHA 3FXXA 4O2ZA 3VUHA 5TE0A 3ZLWA 3MSSA 4I3ZA 2ITVA 2VX0A 1Y91A 3OF0A 5FEQA 4BGQA 3KREA 1E1XA 3RJCA 3VUGA 2X8DA 5A4LA 4AT5A 1J7LA 4RQVA 3NYXA 1WBWA 3NSZA 3MI9A 3DNDA 3UGCA 2OJ9A 3UMWA 3REPA 5EKOA 3VBTA 4HYSA 4LRKA 3UPZA 2PZIA 3OMVA 3PVWA 4NEUA 4NUSA 1H01A 4E6DA 3DPKA 5TR6A 3VN9A 2ZB0A 3FZTA 3AT3A 4L44A 1X8BA 3KK8A 4JRVA 4EOLA 1HCLA 1UVRA 4J98A 2WOUA 3WF9A 2YZLA 2IW8A 4F4PA 3ORIA 3OT3A 4FV3A 4PY1A 4FSUA 3ZUUA 3T9TA 5IQEA 5IUIA 3NDMA 5F4NA 3VS5A 4IM0A 4ZIMA 5DT3A 3M42A 4G16A 2BHEA 4IZ5A 5CNOA 1KV2A 2E9OA 3FV8A 2ZV7A 3QC4A 3MESA 5CQWA 3G33A 4AUAA 4FIFA 4R1YA 3ZS5A 4EOOA 1O6LA 3GU6A 2R0UA 3M1SA 3BPRA 3RBWA 5AR3A 3WZUA 3I5ZA 5GJFA 1OM1A 3LLAA 1BMKA 2WGJA 2BDFA 5HVKA 2C4GA 3EB0A 4CFWA 4AU8A 3AMYA 4EYJA 5L8JA 2B1PA 2C1BA 4NM5A 5HG7A 4LQMA 1Q62A 2VWWA 2Z7RA 3LCTA 4YJRA 3ZRMA 2P55A 3R1YA 4FNXA 5B7VA 3C4XA 4U81A 4GK3A 4FKTA 5ANIA 2C5OA 1YDRE 3C7QA 3IGOA 4RIWA 2YCFA 2J9MA 3UOKA 4BCJA 3VUKA 3PJ1A 4DGMA 4AT4A 2CCHA 3F61A 3FLQA 3WIKA 1OBDA 2H8HA 2C5NA 5CNNA 5HO7A 4HNFA 3OEZA 4ANNA 2C3KA 4NIFA 4P7EA 3MDYA 5EG3A 5I0BA 3ACKA 3ORPA 4IFCA 4R5SA 5E8ZA 3E7OA 4DH3A 4ERWA 1ZWSA 1JBPE 4U79A 3SW7A 3E92A 3LXLA 2OJGA 3RPVA 4D1ZA 3MVMA 4IAFA 4HZSA 3IK3A 3IKAA 3U4WA 2WIHA 3R1NA 4H3PA 4E8AA 4Z7GA 1QL6A 3BHYA 3BYMA 4KBKA 4MVFA 4RIYA 4DFYA 3W1FA 5J5TA 4U42A 4JQEA 3HDMA 3UE4A 3MH3A 2QKRA 4M68A 3E8NA 4HVDA 2BRNA 5IH6A 3KGAA 3U54A 2GS7A 4N4SA 3GU5A 3QUEA 5LCJA 1H08A 4GCJA 4TTHB 4B99A 3CS9A 5E1SA 5FP6A 3V5WA 5IG1A 3LE6A 2J4ZA 3H9RA 3SXRA 4L3LA 3U87A 3UQGA 4E5AX 4ZLOA 4EYMA 4Q9ZA 3OXIA 3GCSA 4YNOA 4BL1A 4EBWA 1YI3A 1H0VA 1AD5A 2OXXA 3DAEA 5K0KA 3C51A 2JFLA 2R3NA 4FT7A 4GG7A 2HIWA 5I9ZA 2V7AA 2PU8A 3R1QA 2GQGA 4DFUA 4CYIA 5BMMA 3DK6A 3BIZA 3CTHA 2GFSA 3FMJA 3GC7A 2JC6A 3NGAA 3PWYA 4OTGA 4TYJA 3RPOA 5BNJA 1YWVA 4FNZA 4FIHA 5AFVA 1NT2A 2GS6A 3VQHA 4D28A 3ZLXA 1QPJA 1VJYA 3QTIA 2C6EA 4IHPA 4C7TA 4DFZE 2OGVA 4O2PA 3NW5A 1CKJA 4IWPA 4FOCA 1ZMUA 1QPCA 3MH2A 4LGHA 4YGAA 1PKDA 3R28A 3JR1A 3B8RA 1RE8A 2JKKA 2CKOA 2PY3A 3HV6A 3LFSA 4O6LA 4W8DA 5TOZA 1KV1A 4I5MA 4XH6A 2PVRA 4UN0C 3KF4A 2ZV8A 1CMKE 2W1CA 4IWOA 3G6GA 2EXCX 3ZEPA 3K5VA 4G34A 1MUOA 3EN7A 4KS7A 3BHTA 1BYGA 1IR3A 4CQGA 5J7HA 4MXXA 5FG8A 2JFMA 5ACBC 5CAVA 5IQIA 3E87A 4O22A 2WZJA 1WFCA 5JZJA 3EQRA 3PVBA 5HOAA 4XRLA 3G9LX 2RFEA 5CVGA 1OECA 3HL7A 2R3KA 2CGXA 3BZ3A 4IZYA 4RIXA 4FMQA 5IU2A 1HOWA 1Q41A 1Z57A 2R64A 3EKKA 3OOGA 3QAME 4J53A 4NU1A 4TZRA 3A8XA 5CX9A 5J95A 3TZ7A 3C0HA 4A4OA 4BY9E 3Q96A 3BQCA 4M69A 2Y6OA 4II5A 5E1EA 3ZC6A 1BKXA 3IDCA 3NUPA 4G1WA 4S32A 4YJSA 4MHAA 2GHLA 3TDVA 3LFAA 2OW3A 2ZM1A 5ETCA 4DG3E 5AADA 4I0TA 4MNEB 4ONAA 3UIXA 3K2LA 2JAMA 1JVPP 2VX1A 3PVUA 3F7WA 4NJ3A 1XH4A 3P4KA 4OBQA 2HYYA 4QMSA 4QPMA 3TXOA 2PUNA 5E8YA 1OPLA 3BU3A 4RZWA 4YPDA 4NM3A 3BKBA 4GFOA 2QI8A 2VO7A 2WD1A 4IIRA 2YIQA 1JKLA 2P33A 4FTIA 3FMDA 3U6HA 4C4EA 4BCPA 2NNWB 4C59A 3G15A 2ITOA 2IVUA 3PXZA 2NP8A 4TPTA 5IH4A 4YNEA 2PYWA 3TKUA 4PV0A 2GSFA 4FEUA 2WMXA 1A06A 5IDPA 3D4QA 2GNGA 4Y8DA 3VUTA 4I92A 4QMLA 2Q0NA 3Q2MA 5IZFA 4ZMEA 2GCDA 2VGOA 4EH6A 1YOMA 3P0MA 3QRTA 4F7LA 2X6EA 5DWRA 4L46A 3CTJA 4X2GA 1OL1A 4K77A 1GIHA 5IEVA 5DR6A 2WTKC 4R78A 3TUBA 3QCSA 4NCTC 2WPAA 4PMMA 3QTQA 4EHEA 3POOA 4QD6A 1SNXA 1NA7A 1I44A 4RC4A 3ET7A 3Q6UA 1W82A 3MY1A 2HW6A 3ACJA 5LVLA 2GHMA 3W2QA 2IZUA 3BLQA 4JNWA 5CEPA 3ANQA 3FI8A 3ANRA 3RK9A 4CTCA 3QD2B 3W2PA 4P90A 4E4LA 2OWBA 3E3PA 1XH8A 4DGLC 4EHGA 3DCVA 3FPMA 4ZTMA 5C1QB 4EOIA 1UWJA 4D1SA 5F94A 2HW7A 3TKIA 2XB7A 4L43A 2C3IB 5CF4A 4E5WA 2VX3A 3A8WA 4QP2A 3ALNA 4EI4A 2V22A 1OVEA 4DBXA 2W9ZB 4J8NA 4O27B 2QNJA 4HYIA 2VTLA 2YCQA 4TNBA 4C4IA 4A06A 4P4CA 4AX8A 4ZSGA 3IQ7A 4V0GA 3R8VA 5ETFA 4CMOA 4EOKA 3GU4A 3GB2A 5KX8A 5D7VA 3QZFA 3TEIA 3R7OA 2GQRA 5KBQA 3G6HA 5AJQA 5DHJA 4CMTA 5JZNA 2XIZA 2ITNA 3TL8A 1GIJA 3WZDA 5I3RA 1ZOEA 1VR2A 4FTTA 3KRXA 3G0EA 3ZFMA 1J1CA 2BVAA 2ZB1A 4EONA 3F6XA 2C1AA 5M56A 3KMUA 4YJVA 2C0TA 4FV4A 4ZSAA 4DGNA 3NUYA 5FXRA 3ZHPC 2WMQA 5H9BA 4FNWA 3KF7A 5BVKA 3FEGA 4OGRA 4WNOA 5D10A 4BCKA 4O0SA 2OIQA 3ATTA 1WVXA 4DBNA 4F99A 2JDVA 3QC9A 4L9IA 3LHJA 3DU8A 2E9PA 3WE4A 5J7BA 4GS6A 3ZO1A 3LMGA 3U51A 4K33A 2PVMA 2UZTA 3AC5A 3F2NA 3KXXA 4R3PA 4BTMA 2F4JA 4U80A 3P78A 4YURA 4AA4A 2EU9A 2C6TA 5GZAA 3OWPA 4FYNA 2IZRA 4N70A 3ZFXA 4NL0A 3ZMMA 4KBAA 4LOPA 3UJGA 3HVCA 4BCGA 4BDCA 2WTIA 2YM8A 3PRIA 4UWBA 4TYHB 4G31A 4WUAA 4ZTSA 3UC3A 3VNTA 5ICPA 5KMKA 4DEEA 3NCZA 3R7YA 3C50A 2W5AA 3KXGA 2JITA 5BYYA 4CLJA 2XRWA 4I22A 5GNKA 5HLPA 2BIYA 3R8MA 2QQ7A 1SMHA 4FKQA 1MRYA 3PPKA 2PPQA 4QP8A 4CFFA 5IA3A 4Z16A 2I0VA 2FSLX 2J51A 4Q2AA 4EBVA 1PXPA 1YWNA 4FTMA 4BI1A 3VULA 5JGDA 3RAWA 3PP0A 3FMLA 3AD5A 3OWLA 3BYOA 3PJCA 4FIEA 4ORKA 1QCFA 4JS8A 4B9DA 4GYIA 1IA9A 2WIPA 1SVHA 4H1JA 4A9YA 2OF2A 4KUJA 3I5NA 3O8PA 3A60A 5FDPA 4XOZA 3CSVA 4OUCA 2BHHA 5LWNA 3MB6A 4QP6A 5AP7A 4F0IA 3DBEA 2YHVA 4FZ7A 5I9WA 4B4LA 3OCSA 4G3FA 4L8MA 4CKJA 4FIGA 4JQ7A 4UWYA 2QD9A 3R1SA 4AN2A 4EC8A 1W8CA 1H1PA 1R0PA 4TY1A 4XMOA 4FSQA 1Q8WA 3RAKA 5CF8A 5EFQA 4L6QA 4RLLA 4JDIA 4FGBA 4CZUA 3DQXA 2I1MA 3OW4A 2HZIA 3R63A 3ZUVA 4O7LA 3TNPC 3VBVA 5KUPA 1G3NA 2OFUA 5IQGA 3RKBA 3GCVA 4OTQA 3TV4A 1H26A 3FLWA 4BZDA 4I20A 3DOGA 2OJFE 2B9HA 4CFVA 3Q2JA 2C5YA 4O91A 2W5BA 4BCNA 3VO3A 2YDJA 1YW2A 4YC3A 2C6DA 3DZQA 3TCPA 3PXQA 1WMKA 4F65A 4EJNA 3I6WA 4ITJA 3PY0A 4AOIA 2XM8A 3ZBFA 3EQPA 3W2RA 1LUFA 3QWKA 1OPKA 4C37A 3QXOA 2B55A 4CQEA 3PE1A 4FTLA 3ZZEA 4OTPA 1OZ1A 5FDXA 1JAMA 2XA4A 4R1VA 3UVQA 3POZA 5CWZA 3RPSA 2OZAB 4G5PA 4L67A 3ZCLA 5JEBA 4X6QC 3SLSA 4CG8A 2HAKA 3JPVA 2BPMA 4ACCA 4BFMA 4BGHA 2ZV9A 3V8WA 4RWJA 4EOMA 4WG4A 1YXXA 2PE1A 3GI3A 4EC9A 3OP5A 3QWJA 5D11A 5CLPA 3R7VA 4EZ7A 5J9ZA 1YWRA 1PXMA 2WMAA 3RGFA 4N57A 3BLRA 4B8MA 4I6HA 3L8XA 2R3QA 3G5DA 5T3QA 3DXQA 2JIIA 2CPKE 4M8TA 4ZTLA 2IWIA 3O2MA 2YISA 2ONLA 3OWJA 1XO2B 4U8ZA 4CCUA 5IF1A 3D5WA 1A9UA 4RZVA 5H8GA 3FKNA 3VBYA 4I6BA 5HCZA 4FV9A 3QQFA 1KE9A 2YDIA 3FYJX 5HCYA 3UZPA 1DM2A 3ZONA 2Z8CA 3JVSA 3H10A 5AUUA 1Y6AA 4C61A 5HIEA 3MV5A 2I7QA 4Q5EA 3ALOA 4FV1A 2YIXA 4U5JA 2BKKA 5KMOA 1JOWB 4GJ2A 4AE6A 2O65A 2PMIA 4K11A 5DH3A 4E6AA 2B53A 2XYUA 3V3VA 5LOHA 3EQCA 4ZY6A 1P4OA 3AXWA 4WBBB 5IUHA 1XH6A 3OTVA 2QC6A 3GT8A 4FIJA 1WBVA 3CGOA 3QQKA 4OTIA 5KE0A 2Y0AA 4APCA 4I0SA 4MYGA 4BBFA 2XK8A 5J9LA 5AIKA 2R3GA 4K18A 3IOKA 3DBDA 4PWNA 3GCQA 4GEOA 4QTDA 3LZBA 3EQDA 4HGLA 3FMHA 3ELJA 4GT3A 4KWPA 4PTGA 3E88A 1GY3A 3GC0A 2Y4IC 5K9IA 5B0XA 5DFPA 3FI4A 1XR1A 4FSZA 4MX9A 4NFMA 5E8XA 3IPHA 5KZIA 4WG5A 3ATSA 3EYGA 1XH9A 2OI4X 5I5ZA 3QHWA 3NYOA 3MIAA 2GNFA 4M13A 5BVEA 2XNBA 3S1HA 2PUPA 4M67A 4WNPA 4RT7A 3VHEA 3SRVB 2O2UA 1FOTA 4FEQA 3I60A 3Q32A 5T6KA 2BDJA 2QG5A 4ACDA 3EFWA 4OR5A 3AC4A 4D2RA 2JKMA 1JNKA 2H96A 1ATPE 4RC3A 3QCQA 3A7JA 3R9NA 2J0JA 3DT1A 4I94A 4AP7A 4IEBA 1UKHA 4PTCA 1YQJA 3ZFYA 4IMYA 1PXIA 2PUUA 3UDBA 5HO6A 3UZRA 4BTFA 3UOJA 3UTOA 2YM5A 3PY1A 3QX2A 3FZRA 3RI1A 4HGTA 3RINA 4A9RA 4BYIA 4DE4A 2EB2A 1DI9A 4E20A 3MVLA 2UW6A 4J71A 3PRFA 5CVFA 2FSMX 4IVAA 4L42A 4M0ZA 4AOJA 3II5A 4QMMA 2R3OA 4MAOA 1V0OA 2RF9A 5J79A 1FBNA 3GU8A 5EDQA 5D41A 4K0YA 2O5KA 2W96B 3NS9A 3OVVA 4KD1A 4RFZA 3NUXA 3D7ZA 4EH2A 2ITPA 3QD3A 3TTJA 4ZP5A 4ENXA 2FGIA 3F5XA 5HG9A 2J0LA 5HG5A 4F70A 4C34A 3FZOA 4QO9A 2XRUA 4IAKA 5EM5A 3F2RA 5E4HA 4UMPA 1M17A 2R3FA 4NH1A 1W0XC 4PL3A 4TKSA 1KE8A 4XG2A 3P7CA 5AX9A 3C9WA 1M52A 2ITUA 5M55A 5HLNA 4PMTA 4DTBA 3VIDA 3FWQA 3N9XA 5KMMA 2VTRA 3R83A 5ETIA 3PIYA 1FGKA 3CKXA 3W32A 3ENHA 2QLUA 3BX5A 2PZYA 2XUUA 3UBDA 4DH8A 4JG6A 4E73A 2OO8X 2W1ZA 3R71A 2QURA 1RJBA 5CS6A 4BCQA 3RAHA 4BIEA 5AA9A 2RKUA 3QL8A 4IB0A 4IX5A 2F57A 2E9NA 2W5HA 4RQKA 5EOBA 4QNAA 3RAIA 4LFIA 4JJRA 4HOKA 1J7UA 3UIMA 4YHTA 4NK9A 4CFNA 4RWIA 5JT2A 4CFXA 3ZXZA 1WVYA 2W7XA 2VTTA 4A7CA 2C30A 5AAGA 3GFWA 3EL7A 4BDIA 4PP7A 2YA9A 1SYKA 3QLGA 3AC2A 3ZC5A 2W05A 3R2BA 3LCDA 4JDKA 1WZYA 4XV1A 4FT9A 3FZ1A 4MH7A 3PY3A 3E63A 3HYHA 3O0GA 4G3GA 5FWKK 3UC4A 1J7IA 3F3VA 3UNZA 4ZZMA 1OL7A 4QYGA 4AE9A 4IX3A 2BZJA 5JRSA 3BV2A 3FQHA 5EYCA 3W2CA 5HBJA 4XLVA 5AP4A 5CTPA 2OU7A 5GJGA 4ASDA 2C6KA 4CLIA 5M08A 4UB7A 4A4LA 2NO3A 4F09A 3SA0A 2RG5A 4DFBA 3H0ZA 3KXZA 2BDWA 3QBNA 5CSVA 4USFA 3DK3A 4QYEA 3JVRA 5DT0A 3QGYA 1FGIA 4QP3A 3D7TB 3MTFA 4RJ3A 4RJ7A 5DR2A 4QPAA 5LMAA 3U55A 4IAAA 3E62A 4GUEA 3VJNA 5EHYA 3L9PA 3BU6A 4XNEA 5EK7A 2XNPA 4QQTA 4YO4A 3QTZA 1OL2A 2YM4A 4U45A 1OI9A 3UZTA 4U0IA 3MBLA 2WQOA 2PVHA 5E7RA 1OIRA 2PE0A 3EOCA 2XP2A 4KRCA 3ZOSA 3BE9A 3HA6A 4ZTQA 3R9HA 3PUPA 4L68A 5K4JA 3NEWA 3PTGA 3AD4A 3LOKA 3PG3A 3PYYA 2PVLA 4FG8A 4MXYA 5CSXA 2WELA 2WTVA 3QTXA 3QKKA 3D83A 4G17A 4ZMFA 5F20A 4FSRA 4J8MA 1KSWA 4WNMA 5CAUA 4DCEA 3TI1A 3WF5A 5JRQA 2J7TA 3EFLA 1IRKA 4H36A 1K9AA 5JH6A 2JAVA 3PSBA 4U9AA 5EYMA 3PG1A 3NUUA 1PY5A 3LXNA 2QR7A 5C01A 4DEIA 5LWMA 2GPHA 4K2RA 5AUXA 5BVDA 4IFGA 3DBQA 3D0EA 5A46A 4IWQA 4YSMA 4FKUA
chains in the Genus database with same CATH superfamily
2GNJA 2EUFB 4X3FC 1CTPE 3UOHA 4F0FA 4PPCA 1PHKA 3VQUA 1NVRA 3NIZA 1YXTA 2QHNA 2YACA 2X9EA 4BRXA 5ANOA 4L45A 1F0QA 3FXWA 4FV0A 4JRNA 4N6ZA 3KFAA 2BTSA 3LCSA 2PZ5A 4X21A 2UW0A 4O7ZA 1DAWA 2UW9A 1Q8TA 2R3JA 3DZOA 3EQIA 3PPZA 3QZIA 4YJPA 3W8LA 4ANOA 1G5SA 4Z9LA 4JT3A 3RM7A 3VRZA 4B8LA 3MYGA 3DB8A 3MB7A 1ZXEA 3RPRA 3B2WA 4AW5A 3WF6A 3HMPA 3VF9A 5HVJA 3WE8A 1H1WA 1WAKA 3HECA 1Y57A 3Q53A 5M44A 1PW2A 4I0RA 5EQYA 1H0WA 3QCYA 2FYSA 4JX7A 3FZSA 1ZMWA 1MP8A 4R3RA 4H58A 3UP2A 3P5JC 3W0NA 4ZS4A 2PHKA 2HZ4A 3FAAA 2VUWA 3QHRA 3A4OX 4IWDA 4BVUA 1BL7A 4RJ4A 2Y4PA 4BDHA 3BL7A 2XJ2A 4AW2A 3NYNA 3FMMA 2WMUA 4J96A 4KAOA 4XG8A 2NPQA 4YTHA 4AZVA 3LIJA 3COHA 1WBPA 2YN8A 2OH0E 2W17A 3Q5IA 4I23A 3FY2A 5K4IA 1W7HA 2PVFA 3GOKA 1JKKA 4F1TA 4FTNA 2V62A 1WBTA 4BDFA 2EVAA 3AGMA 4XUFA 3DA6A 3S2PA 4IM3A 5KKRB 4C02A 4NSTA 5M51A 3S4QA 5A6OA 4IX4A 5DNRA 4FTUA 4KSQA 5K3YA 5LVNA 4BCFA 4ZJVA 3FLNC 4IDVA 2XK4A 4WNKA 1ZY4A 2A1AB 4F1MA 5AV4A 5CEQA 4ASXA 2DUVA 5DT4A 4BI2A 4XYFA 2LGCA 3RNYA 4D2VA 5L8KA 4XCUA 4C3RA 2E2BA 3LFCA 2RGPA 4FK6A 3CPBA 3CQWA 4HYHA 2HZ0A 4LMUA 4UZHA 4I4FA 4R7HA 5CT0A 2ITTA 4DFNA 4KKHA 3W33A 4XEYA 2VRXA 5HEZA 1ZYSA 3O51A 4MBIA 1OKVA 3P08A 3RWPA 3SKCA 4DHFA 3ID6C 4PRJA 5KNJA 5M07A 1YRPA 4BWPA 4AW0A 5ANGA 4F9CA 4O21A 4QMXA 4YLKA 4RX5A 2YCSA 3WZJA 4X3FB 3UVRA 3COKA 2W4KA 2YM7A 4CXAA 3OBGA 1H1RA 3BHHA 4JBOA 4LG4A 4TL0A 1U46A 3OT8A 2JIUA 5HU9A 4HPTE 4AG8A 3UNJA 1DAYA 3V5LA 5ANDA 1Q3DA 2ZVAA 4GFGA 4ZY4A 3CPCA 4QYFA 5LXMA 2XAMA 4ZLYA 2IZTA 2Z7SA 4F1OA 5D7AA 1ZOGA 2VN9A 2YAKA 4YJQA 2CLQA 4C3PA 4RSSA 4GKIA 3QYWA 2CN5A 3IW4A 2HENA 1E9HA 1APME 3D2IA 4TRLA 2XEYA 2UW5A 1ZLTA 3EYHA 3DAJA 3PFQA 5TKDA 3F5PA 1R3CA 3FXZA 4L01A 1U54A 4QMOA 4ZK5A 4U3ZA 3WF7A 5C4KA 1YI4A 2C3JA 3HV3A 1Y8GA 4RMZA 2WTJA 2JBOA 2WOTA 3EN5A 4EQCA 3HP5A 4FG7A 5HTBA 5IMXA 4AXDA 4YU2A 2F2UA 3BBTB 4L53A 5FGKA 2IVSA 3AT2A 2WTCA 3PZHA 5C8NA 4A9SA 1DI8A 3CY2A 2A27A 4DHIB 3E8EA 2B9FA 2BZKB 1H07A 2IPXA 4ANSA 2OSCA 3VC4A 2CGWA 3FUPA 4X2JA 4YBKA 4LV5A 4ZTHA 5AAFA 4QMPA 4WBOA 4EK5A 1A48A 1B39A 2GNHA 3D5XA 5AMNA 1H4LA 3BWJA 4DT8A 2Q0BA 1Q24A 4BWXA 3DXPA 4MKCA 2X9FA 4QTEA 4BKJA 3ZBXA 4O4FA 2WMWA 4FTAA 2XMYA 2XKCA 1H27A 4E26A 3R2YA 2QO9A 4ARKA 4K9YA 2BILB 3C1XA 3OCGA 3ORNA 4C4GA 1Q8YA 5HD7A 4K8AA 5HGIA 1KE7A 3LFFA 3RHKA 4KIKB 3ZEWA 3NUSA 3LFEA 2XKEA 3R01A 4IADA 4DG2E 4F9YA 2J6MA 4FKIA 4IZAA 4YHJA 3RMFA 2I6LA 3HX4A 2HCKA 2HOGA 1W2DA 4YJNA 4C4JA 2XIXA 2UW7A 4OT5A 3NAXA 4Y72A 3MVHA 2JKOA 4G6NA 4ZS0A 4JIAA 3F2AA 2X4ZA 2GDOA 2R3HA 3RM6A 1QPDA 3U4UA 1G8AA 3P1AA 3LM5A 4QTAA 5BQ0A 5CU0A 3Q9WA 5IH5A 1Q4LA 4PL5A 3BYSA 3H30A 3NX8A 4ACGA 4E6QA 2VV9A 2C5VA 3FYKX 4F9AA 2F9GA 4QDVA 5HKMA 4FTRA 5BVWA 5KO1A 3UG2A 5BYZA 3MFUA 3QTRA 4A9UA 1G8SA 2ONLC 4EWQA 4JR7A 2XZSA 5C8MA 3DKFA 3W16A 4CG9A 4EJ7A 1Q61A 4MTAA 5FD2A 1JSVA 2W06A 4LGDA 3QLFA 3RNIA 2Q83A 5FQDC 3OXZA 4BIDA 1IAHA 3VUIA 5HICA 4ZAUA 4BCOA 1J1BA 5A9UA 1PYXA 4CRLA 5L6WL 4ZJJA 3IONA 3D5VA 3NRMA 4XG7A 4HCTA 3LCOA 4YJUA 2VTNA 2R3MA 3DTWA 4CRSA 3TIZA 3R9OA 3SG8A 4L3JA 4U43A 2QCSA 4BTJA 5JQ8A 3HUCA 3V51A 5JQ5A 5EYDA 4PQNA 2VNWA 4FV7A 4M3QA 2CNQA 4U7ZA 3R7GA 2UW4A 4NW6A 4QQCA 5D1JA 5G6VA 2XK7A 3R7IA 3Q9ZA 3TUDA 5FTGA 3PLAE 4MQ1A 3Q3BA 3FY0A 3LKMA 3OS3A 4EH8A 3GCPA 1Q5KA 1YXUA 3BL9A 1B38A 1CKPA 3BU5A 4H05A 4AN3A 3DV3A 4Y5QA 2W1DA 5K0XA 4M14A 4BDAA 3S00A 4JI9A 2GHGA 3HRBA 3ORZA 3UODA 4ZTRA 3OCBA 3IS5A 3MPTA 3QQHA 2F2CB 4G6LA 4I5CA 4RJ5A 1Z5MA 3VJOA 3EFJA 4R77A 5E9EA 4U44A 3TYKA 4XP0A 3UP7A 4FG9A 2JDRA 3UO5A 2QOIA 5JMSA 4JIKA 1JKTA 3C5UA 2J0MB 3IW8A 5CZHA 5JGBA 5M4IA 4NYEA 4AOTA 4CYJA 1BI8A 5AR2A 5AR5A 4RRVA 1CKIA 2XNNA 4DC2A 2Y8OA 2C6OA 5DR9A 4BI0A 1UNHA 3EQBA 2BZHB 3BHVA 3GXLA 4O0XA 3HZTA 1Q3WA 3OUKA 3TJCA 5CXZA 3QRUA 5LCKA 3RZBA 4F6WA 5IEYA 1XQZA 3TACA 3CP9A 3FQSA 3TZMA 1NXKA 3F66A 3LQ3A 5IQAA 2QONA 3MW1A 3QTWA 2YITA 3CQEA 3GVUA 1VYZA 4FKSA 3BYUA 1XBAA 2WMVA 3ZLYA 3HMNA 3AC8A 2REIA 4CT1A 3MVJA 4KNBA 5FP5A 5AUYA 3C4CA 3TWJA 4NKAA 2G2FA 2XK6A 2VWIA 4FI1A 3RHXA 4UBAA 2X39A 4GVJA 4L7SA 4RX7A 4AFEA 5IKWA 4BDKA 4HVSA 3DXNA 3LXPA 3IGGA 3TUCA 1UNLA 3TKHA 3WZEA 2WEIA 4MD8E 4CKRA 2V7OA 5FTOA 5HZNA 1IASA 4TWOA 2ITWA 3DBFA 3WOWA 3H9OA 3A7HA 1OKZA 2WU7A 4D58A 4BJJA 4IAYA 3FKLA 3RWQA 2WTKB 4EOJA 3ZDIA 2XKDA 1CDKA 3KA0A 3QU0A 4FKPA 4FSMA 2O8YA 4G9RA 5KMNA 5IQDA 2I0YA 5CEMA 1EH4A 3CGFA 1RDQE 2XH5A 3S3IA 4GJ3A 3SV0A 4I41A 5H3QA 4HVGA 5FUTA 5FTQA 3V5TA 1W98A 3RTPA 1OGUA 1NVSA 1L3RE 4BDBA 1IA8A 5CZIA 4Y85A 1W2FA 3PIZA 5DRBA 1O6YA 4DTAA 4LUDA 4W4WA 4RVTA 3DBCA 1PRYA 3NUNA 2X6DA 4YZBA 5CVHA 3JY0A 3VBWA 4ITIA 2QOCA 3EFKA 5HIDA 5AUTA 3KVXA 3SOCA 3BE2A 1T45A 4X2KA 4XV2A 5L2SA 2P3GX 4KIQA 2PVNA 4X7QA 3OUNB 5EHOA 3LQ8A 4FT3A 1XWSA 3NZ0A 5TT7A 4GV1A 4MNEA 3M2WA 1QPEA 2W1FA 4BR3A 2XAOA 4IVCA 5EM6A 3RP9A 4YTCA 4EOQA 2VWUA 4YMJA 2BZIB 1GJOA 2R0IA 1KOAA 4FTOA 4GK2A 2O63A 2XJ1A 2Z60A 1OKYA 4ALWA 4P5ZA 2W1GA 3QTUA 3S95A 1M2RA 2NRUA 3ZDUA 2JDOA 4DN5A 3E8DA 4CGAA 2W4OA 4BDEA 4GYGA 3KC3A 4K1BA 5FBOA 4EUUA 5IQHA 2QO2A 4USDA 2IO6A 5LVMA 3BV3A 4XP3A 2H34A 2JIVA 4NM0A 3CC6A 4RC2A 5CT7A 3LFNA 3A4PA 2GTMA 3PIXA 4XV9A 5AUZA 4BICA 5J8IA 2HY0A 2J90A 5AP1A 1FMOE 4D55A 4DEBA 5EQPA 4OAUC 2NRYA 2OIDA 4I5HA 3V5PA 2FB8A 3KMMA 3BI6A 4XBUA 2XANA 4HCVA 2XCKA 2BAKA 3FMKA 1U4DA 2OKRA 3HEGA 2JDSA 3R8UA 5HBHA 3ZZWA 5JFXA 5M4UA 2X7FA 3KK9A 1VLRA 4GSBA 4EOPA 4CT2A 4S34A 3QKLA 1KE5A 5A4EA 3AKJA 2IJMA 3D14A 3C0IA 1IEPA 4D0XA 2BIKB 5HI2A 3GGFA 2RG6A 1U5RA 2WQEA 3CIKA 4FA2A 1OIYA 5AUVA 3TG1A 1JLUE 1TQIA 2UW8A 3H9FA 3MIYA 2ZOQA 4WOVA 3T8OA 1XJDA 3I7BA 4TWNA 2Y7JA 2VTJA 3DK7A 4WIHA 3EL8A 3HNGA 4FTQA 3LFQA 1GIIA 3F69A 1S9JA 2R5TA 4TN6A 5ETAA 1SM2A 4UV0A 3FHIA 2X0OA 4FTJA 3F9NA 4MXZA 4W9XA 3VS3A 4C2WA 4YJOA 5DEWA 3LMHA 4RJ6A 2C3LA 3AC3A 3PLSA 4RX8A 5GIPE 1YHSA 3ULIA 5EKNA 2BRBA 4UALA 2C69A 2UVZA 4LV8A 5ANEA 3VUDA 1BI7A 3OY1A 5ACKA 4UMQA 4YZNA 4QEBA 3E5AA 4Z55A 3QF9A 4YUQA 4FL1A 4RG0A 3MN3A 1JSTA 3LMIA 3UDTA 1Y6BA 3LQ5A 4MD7E 3N4VA 4O82A 5CI7A 3SXFA 3KULB 3EQFA 3DLZA 2HELA 3KY2A 2QHMA 5LARA 5JFWA 4I5PA 4PUZA 2QOOA 3VS1A 4WT6A 4JMQA 2W0JA 3FLSA 5CU2A 1ZZ2A 3VBXA 4AGCA 4K6ZA 4QQJA 2HXLA 1OIUA 2B52A 2QOQA 1KE6A 4AA0A 3FC2A 4MD9E 1YHVA 3PXRA 4H1MA 4MUQA 4YZMA 2LAVA 3N51A 4A07A 4BYJA 4GKHA 4X0MA 3QQGA 1Q99A 4OT6A 3ULZA 2OJJA 3WARA 4E4MA 3FLYA 4EWHA 4F6SA 4DHZA 1TQMA 2JLDA 2XCHA 3ODZX 3BWFA 4ANBA 5CEOA 2IZSA 4E4NA 2FH9A 4CMUA 4DEGA 3ORXA 2XNOA 4IE9A 2A0CX 1KOBA 2VNYA 3MA3A 4EUTA 3AGLA 3BEGA 3DJ6A 4RBLA 4UMTA 2YZAA 2YDKA 3LLTA 3Q9YA 3DGKA 4BHNA 1GZNA 4FZ6A 2CGVA 2WQMA 4TYHA 4BGGA 3AMAA 3Q9XA 4FOBA 1GNGA 3R21A 4F7JA 4QT1A 5H8BA 4RPVA 3TN8A 4AW1A 2X8IA 2YEXA 2X2KA 2KULA 3H3CA 3P7BA 3R73A 5BV3A 3HKOA 3DY7A 4FUYA 1F5QA 3O7LB 3IOPA 1PXKA 3EWHA 4GFMA 2EXEA 3WI6A 5FRIA 3OROA 4TW9A 4AZWA 3ORMA 5FXSA 1URCA 4R3CA 4NWMA 2R9SA 2Z7QA 2R3PA 3MFSA 4GH2A 4EQUA 3SX9A 5KMLA 5CASA 4DA5A 1FVRA 1PYEA 5HESA 5DIAA 4N6YA 2PVYA 3COIA 2XBJA 3QQUA 4ZY5A 3PA3A 1PJKA 2J5EA 1XH5A 2UZVA 3PE2A 4IW0A 2PL0A 4PP9A 5E8UA 5FEEA 3PXYA 4FJVA 5J1VA 4XS2A 4D2PA 2W1HA 4MWIA 3W8QA 3F3WA 3I81A 4AZEA 3R04A 4J95A 3SXSA 2PK9A 3BQRA 4UZDA 2E9UA 2PMNX 3Q4ZA 4JR3A 2I0EA 5AEPA 4MNFA 4DDGA 4XP2A 4DEHA 3OZ6A 3DQWA 4O4EA 5AA8A 3GENA 1L8TA 4QMTA 2GFCA 2I40A 2H6DA 2QODA 5TF9A 2C6IA 3L8VA 4XG3A 1UU7A 3CLYA 3I4BA 4GVAA 3HMIA 2QU6A 3QCXA 4MQ2A 4UYNA 4HGSA 4YJTA 4ZJIA 4D2TA 5B2MA 5HD4A 4BIBA 3MFRA 3KQ7A 3R8PA 4F9WA 5F95A 3EN6A 1KWPA 4O0TA 5M53A 2P2IA 3LW0A 3PJ8A 3JXWA 3MGYA 1LEWA 3WYXA 1CM8A 4O81A 4AF3A 4BCHA 1SNUA 5EI2A 5H2UA 1XH7A 3I7CA 3TNQB 4OTFA 3UG1A 5L4QA 5E8TA 5BUJA 4O7YA 5EI6A 5KBRA 2OIBA 4FC0A 3PVGA 2Y4IB 4J1RA 3VRYA 2PMLX 5IISA 4BB4A 3GOPA 4ID7A 2ZFYA 3HGKA 2OZAA 2JEDA 4DFXE 3A61A 1OITA 4O0RA 4QMUA 3O7LD 4AWIA 3K54A 5EM8A 2VWZA 4CV8A 1LP4A 4BBEA 3QQJA 3DTCA 5L8LA 4BZOA 2XNGA 3HRCA 3W0QA 3E3BX 4IDTA 3A7GA 4KINA 4L52A 2DYLA 2G9XA 2HK5A 3AD6A 3F5GA 3EJ1A 4FV2A 2YJSA 3ROCA 2X1NA 3BLHA 3CR0A 4C8BA 4AS0A 3KIOC 1B6CB 3TM0A 2RFNA 3ODYX 4U40A 4RIWB 5A14A 2WHBA 3VVHA 3FLZA 4P2KA 2R4BA 2UZOA 3FI3A 3IG7A 2IVVA 3FC1X 3VWAA 4MEDA 5M4FA 4YBJA 3MA6A 4YZCA 5BX0A 2R2PA 4W9WA 4BDGA 3EH9A 3SC1A 4QNYA 4KS8A 4N0SA 4GRBA 4NIFB 5BVOA 3G90X 2ITQA 4JBQA 4AXAA 3U9CA 3Q04A 5EYKA 4A4XA 4BDDA 2CNVA 4DFLA 3NFGB 4FZFB 2CSNA 3HV4A 2QOHA 5EW9A 3NW7A 2X8EA 1AGWA 2FSTX 5J9YA 5HX6A 3KCKA 4FT0A 3KVWA 4FRFA 2O3PA 4MK0A 1W83A 2XF0A 2GU8A 3TV7A 3VS7A 4KSPA 4E7WA 3C4WA 4JAIA 1M7QA 3NLBA 4NW5A 4DH1A 3FL4A 4PNIA 4XHKB 5IQBA 2DWBA 4RIYB 1HCKA 2AC3A 4IB5A 4F6UA 4GMYA 3MS9A 3V01A 4KABA 4R5YA 1FVTA 2YABA 5KMIA 3ZH8A 3AOXA 4UMRA 4O7VA 2BR1A 4C57A 1W84A 4ZZOA 3NYVA 5AM7A 2W99B 2YIWA 3ORLA 4O0VA 2ZM4A 3GFEA 5AV1A 4FE2A 3ROYA 3ZM9A 4NJDA 4UX9A 3Q5ZA 5CU3A 4ACMA 4RA5A 3HMMA 2CJMA 2VTIA 4IB3A 2BFYA 3SRVA 4O96A 5IA1A 3BGQA 3BRBA 4HZRA 5L2IA 5C03A 4FSTA 3GCUA 2BROA 2JKQA 4JBPA 2IF8A 1RW8A 2ERKA 5BMSA 2BCJA 5EM7A 3THBA 3V6SA 3M11A 3DNEA 5HVYA 4ALVA 4ZSEA 4HGEA 4O4DA 2X81A 2UW3A 1P2AA 2WNTA 3PXKA 2YCRA 2ZDUA 4I1ZA 4PDSA 4C4HA 4WD5A 4PPAA 3VHKA 2X0PA 4LL0A 3VAPA 2OH4A 4TXCA 4F64A 5HTCA 4LUEA 1H1QA 3NW6A 4D2SA 4RVLA 2XM9A 3SVVA 4IM2A 4M84A 3W0MA 3CQUA 2YAAA 2BFXA 5LMKA 4O86A 4PDOA 3LFBA 5HCXA 2CKEA 5I4NA 1TQPA 2R3RA 4O7SA 4O84A 5J87A 3U6JA 4UWCA 4QP4A 4GIIA 3UMXA 5EI8A 3T9IA 2OXDA 2WMBA 3ORTA 4JOAA 4WRSA 3UOLA 3HUBA 3U6IA 1OB3A 4C36A 3PSDA 2PTKA 5C27A 2RFDA 3BELA 3GUBA 3GBZA 3HDNA 2H9VA 4YC6A 4YTIA 5CF5A 4MXOA 3G51A 3Q4UA 4RVKA 3TIYA 3NVKI 2PSQA 4IZ7A 3TV6A 4I4EA 5E92A 3SQQA 4ANQA 1MRUA 3DB6A 3C4ZA 3OG7A 3F88A 3ORKA 4R8QA 4RFYA 3BCEA 4RIXB 4W8EA 1M2PA 1BLXA 2ZYBA 4PDYA 4KBCA 4O6EA 4M69B 3AG9A 4BHZA 4F0GA 2CKQA 4M7IA 2QOLA 2XJ0A 4G5JA 3TMOA 3TT0A 2UVXA 3A7FA 4WUNA 4RWLA 5LVOA 1K3AA 3D94A 3N4UA 3Q6WA 4ZXTA 1QMZA 3IDPA 1ZYDA 4IBMA 4QMVA 3IECA 3LFDA 5AP5A 3HMOA 4RX9A 3VW6A 2P0CA 4FKLA 2E9VA 4O0YA 2V0DA 3A62A 5CSPA 4HCUA 2XIRA 2F49A 5IA2A 2W9FB 1IG1A 2X2LA 3QFVA 5AP2A 5HE1A 5EH0A 3T3UA 2YLEA 2F7EE 4O0WA 5DLSA 2UZNA 4G3CA 5DN3A 5ANKA 2CKPA 4ANMA 2ERZE 4EOSA 2O0UA 4FZDB 4JX3A 1ZMVA 4UYAA 1NW1A 3IW5A 2JGZA 2OF4A 3KN5A 3QD4A 3TZ8A 3KCFA 4PMSA 3ZU7A 3ZSHA 3IW6A 3ZXTA 4PNKA 4W4XA 2XS0A 5AAEA 1E1VA 3EHAA 5M06A 1H24A 1WBNA 1YDTE 3KRJA 3O96A 3NAYA 4RJ8A 1F3MC 5E8SA 5GZ9A 1OIQA 2G2HA 3GC8A 5CQUA 5EW3A 4C58A 4XV3A 3D15A 4UXQA 4H3BA 4X3JA 4UMUA 5A6NA 3A7IA 4F9BA 2A2AA 3ENMA 4BKYA 4AXEA 4ZTNA 3BGPA 3OEFX 3KN6A 5AV0A 3EN4A 3D7TA 4JDHA 4DLIA 2VWVA 3MJ1A 4QMNA 4H39A 4JDJA 4Z3VA 4AGDA 4HW7A 1H00A 5L3AA 4O7WA 2Z02A 1M14A 4EH7A 2C5XA 3KB7A 4Z7HA 2W1EA 3LJ1A 1ERKA 4ZSLA 4EK6A 1PXJA 3QUDA 1YXSA 1KUTA 1ST0A 4KKGA 4OTDA 3O17A 4U41A 5IA5A 5HNGA 2B0QA 5EHLA 4AN9A 3DFCB 2J0IA 4CCBA 5DI1A 4AAAA 1G8JA 2B54A 2BALA 3OXTA 4V0GB 3WIGA 1H8FA 3P23A 3OCTA 3UYSA 1NVQA 2WMTA 2YJRA 3KEXA 3UVPA 4S33A 5M57A 4BBMA 4TYIA 1DS5A 1Y8YA 1R0EA 3LM0A 3ZYAA 4DEAA 4JVGA 3NNVA 4DGGA 3MJ2A 3HAMA 5CAOA 3ZO3A 4TWCA 4D9UA 3MY0A 1M7NA 1MRVA 1GOLA 3MPMA 5CAQA 3I0OA 4RLKA 4LYNA 4M0YA 4FICA 3PP1A 2W4JA 4O38A 5HORA 5HG8A 2IVTA 2OK1A 4CZTA 2ETRA 4S2ZA 1BL6A 4FK3A 2C47A 3OFMA 4E93A 5DPVA 4E3CA 3LJ0A 4YP8A 4YC8A 4GT5A 5CSHA 4WKQA 3CEKA 4EORA 1GZOA 4XG9A 2DS1A 4BTKA 3WZKA 5JFSA 2X7OA 4LV7A 2RFSA 3ITZA 2VTQA 1XBCA 4CKIA 4RA4A 3VBQA 3I0QA 3QQLA 3OOMA 4FGRA 4DF3A 4XG4A 4BDJA 5E91A 1T46A 3N4TA 3UO6A 3RK7A 5CEKA 1XHAA 5C26A 1WBOA 3CD3A 3WF8A 1YXVA 3QA8A 3ETAA 2BRHA 5HBEA 3FJQE 3R7UA 2ESMA 2XIYA 3FSKA 4C33A 1YKRA 3W2OA 3FI2A 2WQBA 4OBPA 5JN2A 1ZY5A 3DDQA 4Q9SA 2GMXA 2QLQA 4D2WA 3QRIA 3QRKA 2YWVA 3F5UA 3ZSGA 5AIRA 4YPSA 1Q8ZA 4JXFA 3KRWA 4C2VA 4XRJA 5GHVA 1ZYCA 3MY5A 5K5XA 5BUIA 1J91A 4ZZNA 4D4RA 5A4QA 1H25A 4LOQA 1V1KA 3NPCA 3C13A 3DJ7A 4FSWA 1IAJA 3C4FA 3F3TA 2J50A 2UZEA 5ITAA 3W0SA 4CZYB 4FL3A 4W4YA 3IW7A 3CE3A 5HE0A 4O83A 2GTNA 2VTMA 2VTPA 5IDNA 2C0OA 3U8WA 2ETKA 3PA5A 3UQCA 3KL8A 2V55A 4I6QA 1OMWA 3CBLA 5CY3A 1RQQA 4TT7A 2G1TA 5BVFA 4LRMA 3NR9A 2QOFA 1U5QA 4GK4A 4JG8A 4NKSA 3ZO2A 4EK8A 4DYMA 1R39A 5L2QA 3SGCA 4C3FA 5KHXA 4O4CA 4V04A 2YERA 2PE2A 1MQ4A 4PX6A 5BPYA 3KU2A 3QA0A 3AMBA 4QOXA 4UEUA 3GC9A 1URWA 4EH4A 2XIKA 4OAVB 2HWPA 2B7AA 3LVPA 4V05A 2CDZA 3CCNA 2JBPA 2VWBA 2AC5A 3WBLA 4NM7A 3EMGA 4FUXA 4ACHA 2J2IB 1SVEA 4TWPA 3U9NA 2UZUE 3PXFA 4TYGA 4C38A 5JKGA 3E7VA 2F7ZE 2PULA 4RFMA 3OC1A 4FV8A 4FF8A 3NNWA 3PJ3A 3L9LA 4GU6A 5EDRA 5T68A 4DCAA 3NNUA 2BMCA 3R30A 4MXCA 3V8SA 2ITXA 5HLWA 3PZEA 3TNWA 4NT4A 3BHUA 2UVYA 4FTCA 3DKOA 5L6PA 5EQEA 1FQ1B 4G9CA 3QYZA 1GAGA 4X3FA 2CN8A 2IW6A 1UV5A 4OLIA 1P4FA 1S9IA 3G2FA 4MWHA 5TO8A 4IQ6A 4DGOA 3TTIA 2G15A 3OBJA 4EH5A 3VW8A 4YZ9A 4FSNA 1ZAOA 4GW8A 2PMOX 3PPJA 4GIHA 3RVGA 3FQEA 1WVWA 5HTIA 4QTCA 2XNEA 2QVSE 4X2FA 5AP6A 4Y5HA 4DLJA 4J52A 4F7SA 5IA4A 5KHWA 4FV5A 3E93A 3OY3A 4FR4A 5LMBA 3O8UA 3SDJA 4KRDA 4WG3A 4A9TA 5BVNA 2X7GA 3GQLA 5BUEA 3CTQA 2VD5A 4PL4A 2PZRA 4M12A 1LEZA 3UNKA 4AXFA 5IQCA 2SRCA 3V04A 5CSWA 2IN6A 4PDPA 4QYHA 1YVJA 4AT3A 2QU5A 4AZFA 4XBRA 1VYWA 2QOKA 1OBGA 4R7IA 3FKOA 4MBJA 3LCKA 4E5BA 4B6LA 5DE2A 3OW3A 1V0BA 3QUPA 5C9CA 4APPA 3PJ2A 3FL5A 4XLIA 4CV9A 1OL5A 5IQFA 1UU9A 1XKKA 2OG8A 2WQNA 2P4IA 1CSNA 3ZTXA 4ALUA 3F7ZA 3O50A 2VWXA 3HLLA 3QZHA 4FKRA 3F3ZA 3EN9A 4DAWA 2VO3A 4IANA 5GIOE 2Y6MA 3FSFA 4JAJA 2JD5A 1P5EA 2QOBA 2CLXA 4IX6A 4YHFA 5A3XA 5DRDA 4KB8A 2OICA 4I93A 4LI5A 2R7IA 4PPBA 2YLFA 4USEA 4GG5A 3R02A 2EWAA 3NFFB 4E4XA 3UO4A 2OFVA 3R22A 2HZNA 2ZV2A 3R8LA 5DG5A 4DEDA 3COMA 4QMWA 3W0RA 3W0PA 1UWHA 3I6UA 4IVBA 4OTHA 5IMEA 2IG7A 3WYYA 4AZTA 3FDNA 4ZEGA 2IW9A 3KXHA 4H3QA 3SAYA 2WTWA 2UV2A 1PMNA 2XK3A 2XEZA 4FKGA 4KIKA 2VWYA 5D9HA 4P5QA 4J97A 2XK9A 5M4CA 4LRJA 1J3HA 3HA8A 4WA9A 5AX3A 3JUHA 4ANLA 1AQ1A 3CJFA 1PMUA 4UY9A 4AA5A 4XOYA 5CANA 2ZM3A 4WO5A 5DBXA 3QRJA 5EW8A 2YFXA 4ERKA 4M15A 5DOSA 3TNHA 4CFUA 3NIEA 4L00A 3B8QA 2VTSA 4U97A 3CXWA 3C0GA 4G3EA 5E8WA 3EZRA