4XNEA

Crystal structure of erk2 in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
346
structure length
344
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining `dry' co-crystallization and in situ diffraction to facilitate ligand screening by X-ray crystallography.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 107
structure length 344
sequence length 346
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xneA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xneA01
3R01A 4GYIA 4J1RA 5DGZA 1PXMA 4D4VA 3TNQB 4EOIA 3HP2A 4FSWA 1BL7A 3GQIA 3I5ZA 3I6WA 5ANEA 3UVQA 3EN9A 2IW8A 3UO4A 4C0TA 2HENA 3VUHA 1CM8A 4K9YA 2O2UA 4FTKA 5BYZA 5C27A 2UZBA 4X3FB 3GFWA 3SC1A 5CEPA 2KTYA 5JQ5A 4WG3A 3R71A 5FEQA 4YHJA 3EN5A 2QKWB 4HZSA 3RHKA 2Q0BA 4FK6A 3DDPA 4GMYA 4A9TA 2ZV9A 4ACDA 4NT4A 4I5MA 2YM4A 2W1ZA 4FSMA 3QALE 5AUUA 1J1CA 3QU0A 4PWNA 4YPSA 3RINA 1ZAOA 4TNDA 5HLWA 3DV3A 3O0GA 5AR3A 3FI2A 5ETCA 5AUWA 3FXZA 3LLTA 2XKFA 4YU2A 2OG8A 3IK3A 3O51A 4EQMA 4GS6A 3D83A 5EG3A 4U9AA 2JC6A 4GV1A 2WELA 3R7UA 3MY5A 3TZMA 3W32A 4EH9A 4ARKA 4F70A 3U6JA 3QHWA 5IQCA 3HMNA 3KXZA 3PXKA 3AOXA 2LGCA 2VTSA 3R7EA 1YWVA 1RQQA 3D7TB 4FZ7A 5DR9A 1XBCA 4YO4A 5GZAA 3SV0A 5EYCA 5EYDA 2VX0A 2GTNA 3TIYA 3WOWA 4QTAA 4PP7A 2WMBA 4IBMA 4PL5A 2CNUA 2C47A 2UW7A 4RIXA 3E64A 4AFEA 2WIPA 3CCNA 4IX5A 4CNHA 4YNOA 5DT0A 2JBOA 5AP3A 4C4EA 3PXRA 3QX2A 2JIIA 4M15A 3EFLA 3IW4A 2WO6A 4F99A 3SXRA 1Q4LA 2PE2A 2PU8A 1H8FA 1O6YA 3OF0A 4G3FA 4R7BA 4S31A 4LOQA 3I0OA 2WTWA 3OXTA 4JBVA 5AUVA 4UWBA 4FVRA 3QQGA 3LCDA 2O5KA 1YHSA 3MFUA 5LMBA 5M09A 3LFBA 3L8SA 3FZPA 1XO2B 2QOCA 4IJPA 3PXFA 3NPCA 4AN9A 4ZTQA 2C6KA 4ALUA 4CYJA 5G1XA 4F64A 3HA8A 4C4GA 2BDFA 3E7OA 1L3RE 5E9EA 3QGWA 1PKGA 2HAKA 2OZOA 3MTLA 5FTQA 3UP7A 4BDJA 4W8EA 4YJQA 1OL6A 2C68A 4G34A 4K8AA 4X2JA 3FZRA 4EH6A 4RQKA 1E9HA 3AT3A 4CFMA 4KUJA 3QQUA 4QMQA 4U41A 3SKCA 1O9UA 4NL0A 3KGAA 5AR7A 3DAKA 2HOGA 3WZUA 4TYJA 2P55A 2XK6A 3QD0A 4KRCA 4R3PA 1ZYCA 2AC5A 3GENA 3VS1A 4EKLA 2VWBA 3MJ1A 2UW4A 2VGPA 3D7TA 4CG8A 4F0IA 5JRSA 4FTQA 2YDKA 4Q9ZA 3RZBA 3GQLA 4CT2A 1MRYA 2ONLA 4IAYA 4O6LA 4ACGA 1YI3A 3UO6A 2GMXA 2A1AB 2HWPA 4Z7HA 5C1QB 4E8AA 4BI0A 3R02A 5EDQA 4QMOA 4BHNA 3PJCA 4RQVA 5HNBA 1KE8A 4HYSA 4EOLA 4IFCA 4F9AA 2X1NA 1OUKA 5J5TA 3JXWA 1K9AA 2PVHA 4X6RA 5FRIA 3T3VA 3MH1A 3PVUA 2C0OA 2WMTA 2FVDA 4FIIA 4KS8A 3GU6A 3ERKA 3OCGA 3QTIA 1YKRA 3H0ZA 3I60A 4GT3A 4O7ZA 1P4OA 2UV2A 2O0UA 2VTTA 1SNXA 4XS2A 1ZZ2A 3AGMA 2EXMA 4FICA 1PXPA 3P7BA 3HX4A 4RX7A 4U3YA 2BHEA 4CQGA 3PIYA 5CENA 5T3QA 1OBGA 4IE9A 4D2WA 4J7BA 3L8VA 2VO3A 1V0OA 4PX6A 4WRGA 3DXQA 3PXQA 3UYSA 4O7RA 1KOAA 4MXCA 1QPJA 3JVSA 1H0VA 3RMFA 3BWJA 4QT1A 2HELA 2PZPA 5M44A 3Q60A 4YGAA 3DDQA 1OKZA 1U4DA 2BILB 4QMMA 5ANGA 4ITJA 4AT4A 3MW1A 1XHAA 3P4KA 4FTUA 3I6UA 5HCZA 4D2RA 3LQ5A 3LKMA 5A4CA 1E1XA 1K3AA 3C0GA 3Q9XA 2NRUA 4Y73A 1PY5A 4L44A 5AJQA 4I24A 1FGIA 2GTMA 4G31A 2WIHA 4HPTE 3TJDA 1JPAA 4XEYA 4HNIA 4XV1A 4EH7A 2GQGA 4ANBA 2JFLA 4IDTA 4HYIA 3GU7A 2QVSE 4O6EA 5DFPA 3DBQA 3EKKA 4IVBA 4UMTA 4WBBB 4IWOA 2C3LA 1XWSA 3PA4A 1YWRA 5JEBA 3LFQA 2C6MA 3C4ZA 1GZKA 2XIXA 2YM5A 5HIBA 3TV6A 2QKRA 3HV5A 4DEDA 1JVPP 2YIYA 3PA3A 4YZ9A 3KXXA 3QHRA 5BNJA 5LVPA 4BR3A 1ZYJA 2OGVA 3L9NA 3QRTA 2RG6A 2HZIA 4K77A 3VS7A 3QKKA 3R7OA 1CSNA 3D9VA 1URWA 4LL0A 5EW3A 3FYKX 3ODYX 4EI4A 4ZZOA 3QQFA 2BKKA 5IPJA 2FYSA 4DBXA 4EH4A 2IN6A 2F7ZE 4JG7A 5JGAA 3TNPC 4RZVA 5AR8A 3UQGA 4AGUA 4EBVA 2GDOA 2BFXA 3QA8A 4ZSGA 1M52A 5IQEA 3TIZA 2RFDA 1TQIA 3LFSA 1YOMA 3FLWA 4IB5A 3TJCA 2G15A 3QXPA 4LMNA 2G2HA 3H3CA 4C36A 2F2UA 3UOJA 3P23A 4PTCA 4LUDA 5F95A 3KU2A 2W1EA 4E4LA 1U54B 3FMMA 3NCZA 1JQHA 3ZONA 4RA5A 4D0XA 4IAIA 5EQPA 2W5HA 1WBSA 2BCJA 5CAVA 2QR7A 4ANQA 3DZQA 3QRJA 3QWKA 4A4OA 4DC2A 2QOIA 2VN9A 3NR9A 4DLIA 1J7LA 4AZSA 4MYGA 3ROYA 1XH9A 4CRLA 2OIDA 3FMNA 4JL9A 3VW8A 4EZ5A 2FH9A 4O84A 5LQFA 4MQ2A 1PRYA 4FTOA 4FODA 3ZBXA 2RF9A 2VX1A 4L8MA 2HCKA 1UKHA 2VX3A 4TWPA 3CGFA 2UZVA 2XJ1A 2R3OA 3LJ1A 3CE3A 4ALVA 1UVRA 2UW9A 3AT2A 5AR2A 1R39A 5EHOA 5HGIA 1VYWA 4MD7E 3KVXA 5KMKA 4BC6A 3GEQA 5LARA 2C6TA 3KMMA 4IWDA 3DXNA 3UDBA 1NY3A 1KE5A 1SM2A 3R83A 4TT7A 5IUIA 4D0WA 2QONA 4LFIA 4L9IA 3ENHA 1REKA 4DT9A 2X81A 2W4JA 2Z7LA 3ENMA 2QO7A 3FZTA 5FWKK 3BRBA 4FA2A 2B1PA 2YAAA 4PPBA 4IAZA 3DGKA 5TO8A 3IW5A 3COMA 5IQIA 3WI6A 3GCPA 2QI8A 4O83A 5BX0A 2FO0A 4C59A 2W1FA 3LXNA 4NJDA 2ZOQA 3QF9A 2BROA 4FGBA 5BUEA 2JEDA 2WAJA 3NNWA 4KIKB 2FSLX 3EQFA 3VWAA 4QMSA 3FMEA 3T3UA 4F6UA 3CTQA 2Y8OA 2IZTA 2JDRA 4GK4A 2PVFA 3NIZA 4FC0A 2VUWA 3OOGA 3PRIA 4YZCA 2W1HA 2YJRA 4BCJA 3UG2A 2ZYBA 5HLPA 5AP4A 3D5VA 4GL9A 3ATSA 1YOLA 1P14A 3HGKA 4L67A 3EJ1A 3QTRA 3T8OA 4BCGA 2ESMA 3S3IA 3PRFA 4EYMA 4XV2A 1FOTA 4EJNA 5LWNA 5BMSA 4W9XA 3MB6A 4F1MA 3K3IA 5EI2A 4FOBA 5I4NA 3W1FA 2A19B 3FMJA 5DE2A 2J0MB 2YACA 2XA4A 4FUXA 2YJSA 4IDVA 4G3EA 4ZSEA 3R8ZA 4AQCA 3NUYA 3QZGA 2R3LA 4YLKA 3C5IA 3HUCA 5HOAA 2CCHA 2WTKC 4GH2A 1SVEA 4NTSA 4U45A 4OW8A 4NM7A 3AMAA 2E2BA 4AOTA 4UN0C 2E9PA 4EONA 3BBTB 4LRJA 1YHWA 4BHZA 1BUHA 3L8XA 2RL5A 1ZZLA 3UO5A 2WMQA 4S30A 3V6RA 1OIRA 4F7JA 5HG9A 3DKFA 4L46A 5BVOA 5CU0A 1LR4A 2WMXA 4FI1A 2JFMA 3DT1A 4S32A 3JR1A 2WEIA 3CSVA 1PXLA 2XJ0A 4MWIA 3F66A 4IM3A 3W33A 3QZFA 4USEA 1URCA 4N57A 2ZVAA 4G9RA 3VS4A 3ZSGA 2ERKA 2EUFB 4DH8A 3EOCA 2OJIA 3QAME 4S33A 3W10A 1OKYA 4D1XA 1OGUA 2PVLA 2DWBA 3PLAE 1OKVA 1DI9A 2ETRA 2WNTA 3FUPA 2JDTA 3KXNA 4FTAA 4G6NA 4GIIA 3NUXA 4FSZA 4PL3A 3V01A 4C4IA 5JKGA 5KMMA 2CKPA 2Z02A 2PVNA 4ZTRA 4ID7A 5BVDA 4YSMA 5KBQA 2WMRA 5CU6A 4FSYA 4WOVA 4FV7A 3HECA 2QLUA 3E8CA 2VRXA 3GI3A 3R8VA 1VEBA 1OL5A 4CFWA 1JLUE 2CKEA 2X7GA 3I4BA 5IEXA 1G8SA 3WILA 1SVGA 4IX4A 2C5VA 2XCKA 3LCSA 5L2TA 3CD3A 2BMCA 4QP8A 4BIDA 5CEOA 2XUUA 3H0YA 5C01A 4OAUC 4UMPA 3WF5A 3FKNA 2QLQA 4PRJA 1R1WA 2ZB1A 1H28A 3ZC6A 3BHVA 3MFTA 3FLZA 4FKIA 3FHIA 2O64A 4E5WA 4B6LA 1H1SA 4GG5A 3AC3A 4WHZA 5H2UA 4E3CA 3MIAA 4ANLA 4M8TA 4A9SA 5HBHA 4QPAA 5AX9A 2PULA 4BF2A 2XIKA 2CDZA 4LI5A 2XNOA 4RFMA 5CSPA 4EZ7A 2I0EA 4ZTNA 4ZEGA 3TTIA 1L8TA 1H4LA 5DEWA 3VF8A 4AGDA 3LQ3A 4JXFA 4N4SA 4XOYA 2V7OA 5FXQA 5A6OA 5CAOA 5IEYA 2ITQA 4G16A 4D5HA 3A99A 2C0IA 4I0SA 4B99A 1UNGA 3RBWA 4B4LA 3ULIA 2J50A 5KMNA 1HOWA 3A4OX 4R3CA 2R3NA 2OXXA 5BVEA 3GP0A 2NO3A 1R78A 2W1CA 2WGJA 1YI4A 3NW5A 4NIFA 3F3ZA 5BVWA 2GHLA 5H9BA 4DA5A 3HMPA 2GNHA 4GG7A 4MF1A 1TKIA 3NUUA 1M2RA 3OC1A 4DFYA 2X6EA 4IM2A 4FKQA 5EFQA 5EI8A 3ODZX 1LPUA 3EN7A 4ANSA 3EZRA 5LCKA 2BALA 3KRXA 1ATPE 4FIHA 5AADA 3KVWA 2QURA 4EQUA 4M3QA 4XV3A 5C9CA 4YJRA 3G33A 4I23A 5G6VA 4BCKA 5HVJA 3VUKA 2OBJA 4ANMA 3DCVA 2X8DA 3KREA 1JKLA 3HAMA 2W99B 3RM6A 2UW5A 4FYOA 1KE9A 4IZAA 5BMMA 1GJOA 1B39A 3EIDA 3TNIA 5BYLA 5F20A 5TE0A 2ZM4A 5JN2A 4MEDA 3Q53A 4OTHA 2DS1A 3PPZA 3FHRA 4V0GB 5EW8A 2BIYA 3B8QA 3GC7A 5GIOE 5DBXA 3Q4CA 4FZFB 5A6NA 1HCKA 4QMZA 4YTCA 4DCAA 3F3VA 3R30A 4FTLA 3R9NA 1ZY4A 5M08A 4ZTLA 4CV9A 5IQDA 2HXQA 5I9VA 2V55A 3G15A 3MJ2A 1M14A 4JIAA 4E1ZA 3ZRMA 2HY81 4ITIA 4RLLA 4BBMA 4DH5A 4EK5A 4Z3VA 4CKJA 4FBXA 4YJPA 2GQRA 3LW0A 4MXXA 1JOWB 3MVMA 4J97A 1BI7A 5IEVA 3D94A 4WNPA 4O7TA 5A9UA 3ZTXA 3GBZA 4UMUA 4BYJA 3EQPA 4MXZA 1REJA 4UXLA 4O27B 5J1VA 3U4UA 2FSOX 3A7HA 3E8NA 4Z9LA 3PJ2A 3QD3A 4KIPA 3U51A 5KKRB 3HLLA 1PXNA 4O0RA 3E63A 2R0IA 4F9YA 3BIZA 4AU8A 3DNEA 3WZJA 4WUNA 4RIWA 4Q2AA 5JQ8A 2R7IA 1XH4A 2ITUA 1BYGA 3OBGA 5HHWA 2E9UA 4J99A 4L00A 4OGRA 5DHJA 2YABA 2ONLC 4EK8A 4LRMA 1FBNA 1K2PA 3JPVA 4GRBA 3MSSA 1P5EA 3NAXA 3H9FA 1PF8A 4CKRA 5J7BA 1AD5A 3W2QA 1ND4A 2AC3A 4RVKA 5K0XA 3OY1A 3V5TA 3C50A 3KMWA 3LFFA 5AV3A 4RIOA 5J5SA 1OIUA 3CEKA 4BCMA 4CT1A 5JFWA 3DTWA 3CJGA 4GK3A 3SW7A 2XS0A 3O7LB 3NLBA 4KKHA 3RAIA 4BTJA 3I81A 4FKTA 2RFEA 1OB3A 2JAMA 3IW8A 2CKOA 1XKKA 5IH5A 2Q0NA 3TG1A 5IQFA 3VW6A 2VTMA 3DA6A 5EYKA 2ZMCA 4OT5A 2W1GA 4O0SA 5FLFA 4GVJA 1YDTE 3KKVA 2H96A 2WQMA 2JKKA 4B7TA 3EN6A 3C1XA 2CLXA 3OCSA 5CU4A 5D9HA 5DT3A 4C02A 3M1SA 5TT7A 4RPVA 3ZU7A 2IZRA 3SG8A 2YIRA 4FL1A 2BZHB 2RGPA 1XQZA 4XG4A 3UBDA 1BL6A 3V8WA 3TI1A 2B9JA 3HV7A 2YISA 4MD9E 5IA5A 3PZHA 5FDPA 5AUZA 2HW7A 4DHFA 2VWXA 5JFSA 3P79A 4FV8A 3H9OA 4RC3A 3RNIA 3FL4A 1YOJA 4FVPA 4O82A 3VULA 1J1BA 3P1AA 3RK5A 4I5CA 3IGOA 2XZSA 1I09A 3QQKA 1Y8YA 3RCDA 3PE2A 3L1SA 3CLYA 2YWPA 4CD0A 3FXWA 4NKSA 3LXLA 2FSMX 4TXCA 3DLZA 2R3JA 2E9NA 4R1YA 3V6SA 1CKPA 5CU2A 3ORLA 4E26A 3AC2A 5LMKA 4RJ3A 4U7ZA 1LUFA 4GJ2A 5E91A 4AE9A 3OP5A 4BZOA 4RBLA 3OVVA 2A27A 4IMYA 4RFYA 5D1JA 3KXMA 4I0RA 5B7VA 3BQRA 4NK9A 1OZ1A 2R3RA 4E6QA 3UNZA 4HYUA 4JDKA 4PQNA 5CSHA 4B0GA 3DBCA 1NVQA 3CPCA 4UB7A 2WTCA 2WZJA 2NRYA 3HRCA 3EH9A 3HV3A 3U4WA 4RRVA 5AR4A 2C6LA 4R7HA 4AOJA 3VNTA 3G2FA 2G2FA 4NM5A 3VAPA 5K5XA 3HZTA 1H27A 3LQ8A 1PYXA 3BELA 2Y4IC 2WKMA 3EL7A 5HE0A 3COIA 1Q8YA 4QTDA 5CZHA 3SXFA 4HGLA 1RE8A 2DQ7X 4IVDA 2O63A 3U55A 2GNLA 2UW6A 2XK7A 3F6XA 4BI1A 2BPMA 2CSNA 3AT4A 4BCQA 4TKSA 4G5PA 1A06A 3D0EA 4M69B 1MUOA 3SQQA 4NW5A 5FP5A 4K33A 4Y46A 4QMNA 4MX9A 3COKA 4I6QA 1XH6A 4AP7A 2PYWA 4O7VA 1PHKA 5LVNA 2OJ9A 4IACA 4MHAA 5AM6A 3KCFA 3MBLA 4LOPA 2IPXA 3KRJA 3SXSA 3QRUA 5C8MA 3ACJA 3KL8A 2FB8A 4NYEA 3C4XA 4W4YA 2R3IA 5EHLA 3ZFXA 4XP2A 1Q8UA 4H1MA 2VTRA 5B2KA 2CCIA 4QYHA 4HVGA 4R5YA 2XK8A 5KNJA 5AUYA 3E88A 3G0FA 3PWDA 4NM3A 4DEHA 3DBFA 3S00A 4I6FA 4BZDA 3NDMA 4BWXA 4JG8A 5IA2A 2BTSA 5E8UA 4QP2A 1ZOHA 4ZSAA 4LUEA 1YXVA 4YJOA 3ZLWA 4FSRA 3PP1A 3KXHA 4A9UA 4CV8A 4XLVA 3AD4A 1J91A 1WBTA 1Z9XA 2QOHA 4IWPA 3VS0A 5IUHA 2R3QA 2OU7A 3BU6A 4IB3A 5GHVA 4O96A 1FPUA 3F2NA 4WSQA 3IKAA 3NNXA 3R1QA 5CQWA 4FMQA 2F57A 3PVWA 4JJRA 3ZLSA 5AUXA 1OPJA 4L01A 5FEEA 4ZAUA 4RVTA 3AC1A 4BIBA 5HCXA 2OICA 2W1IA 1Y6AA 3RZFA 4GT5A 4U0IA 3SLSA 3WF8A 4ASXA 3VVHA 3DKOA 1CMKE 2ITOA 5AUTA 3RAKA 1P4FA 4C62A 4PDYA 3DK3A 4BVUA 4R5SA 2J0LA 2XB7A 2YIWA 4F09A 3ZS5A 2EB3A 4IQ6A 3TV4A 2B4SB 4O0XA 4V04A 3HA6A 2B7AA 4AG8A 5BYYA 2YM6A 4M97A 1Q97A 1OUYA 3Q9YA 4JG6A 3ZCLA 3CKXA 4MWHA 4YNEA 2CGVA 3HMMA 1WBOA 3C4WA 3OUNB 1T46A 1ZOEA 2OJJA 4M7IA 2GFSA 2BRGA 4O1OA 3ZRKA 4A06A 4WT6A 5K3YA 3LFNA 3RCJA 3A7JA 5GINE 5IMXA 2XNEA 3OCTA 3VJNA 4TWOA 4QNAA 3QBNA 5FXRA 4ZY6A 2BZIB 3VBTA 1KV1A 3LJ0A 3DJ6A 4RZWA 3NW7A 5GJDA 3LM0A 1OL1A 3RJCA 3Q9WA 5BUJA 1YHVA 3ZUTA 4FNXA 3QRIA 1X8BA 3R63A 3U87A 2ITXA 5M4UA 4BTMA 3GB2A 3KY2A 4YZMA 5KMLA 3DU8A 2UW8A 4FT7A 3L9LA 3NIEA 4O0WA 5D10A 3UE4A 4IAAA 3UPXA 5HEZA 3R9OA 3DFCB 4W8DA 1FGKA 2R3MA 3C7QA 1UA2A 2C5NA 2PY3A 3TEIA 3F5PA 4FIJA 4CLIA 5HTBA 2GPHA 2WTKB 3PSCA 3KRRA 5CASA 4EH2A 4KSPA 2WMSA 4QO9A 2QHMA 4PF4A 4FZ6A 4JRVA 3GUBA 3OCBA 3FXXA 4Y5QA 3BU3A 5CF6A 2A2AA 3PIXA 5JFXA 2X0GA 4MNEA 2BR1A 2I1MA 2X9EA 4G3DA 1Q3WA 1PKDA 2PE0A 4IZ7A 4EZ3A 3DAJA 3PXZA 4FIFA 5H8EA 4FVQA 5CNOA 3R7IA 4FSTA 5JGDA 4NTTA 4C38A 3QCQA 3QWJA 5EM5A 5IKWA 5BQ0A 3S1HA 4OLIA 2ZMDA 2VO0A 3DAEA 4JQ8A 4NIFB 2EXCX 3DNDA 2DUVA 3IONA 3LE6A 5TOZA 4XV9A 2VNWA 3BGZA 4D28A 3V5WA 4FT5A 4J98A 5F1ZA 1QMZA 4LQMA 2IZUA 2OJFE 3FZ1A 5L2QA 5CSWA 3DY7A 3TDVA 2OWBA 4DEGA 2C3JA 4L52A 4O2ZA 5ETIA 2ZDUA 2JKOA 3MVHA 5EH0A 4W4VA 5EW9A 2WD1A 3C5UA 3ZRLA 4TYEA 3BLRA 4USFA 2PE1A 4GT4A 2YN8A 3AQVA 3MH3A 1GIJA 5T68A 4BKJA 2XRWA 4YC8A 1WZYA 1JSTA 1STCE 2ETMA 3R9HA 4AE6A 3IECA 5CTPA 4CMOA 4DGMA 4BDKA 3R9RA 2XBAA 4PPCA 2OFVA 5CT0A 4APCA 4RX5A 3THBA 2J5FA 4EJ7A 4I22A 4WNOA 4DE4A 3W8LA 5M4CA 3H4JA 4QQJA 5B2LA 3FZOA 4IEBA 3RPOA 4DT8A 3KULB 5ETFA 4AA0A 2VTPA 4FNWA 4CLJA 3QCYA 3NYOA 3D2KA 4L3PA 3EL8A 3FMHA 3SVVA 4TZRA 5M53A 2OO8X 3M2WA 1E1VA 2HYYA 5HTCA 5AIKA 5B2MA 2YIQA 1BX6A 2GCDA 5CEKA 5CEMA 4AS0A 1ERKA 3KFAA 5CAUA 3ORTA 4LGDA 1M7NA 3R22A 4W4XA 1IG1A 4AZFA 2OLCA 2YM8A 4QMXA 4YPDA 1ZMWA 2GQSA 3ZHPC 3FKLA 3CC6A 4QMVA 5IH6A 3E87A 4IC8A 4QYEA 3RWPA 2VAGA 5LWMA 2XYNA 3PTGA 4YJNA 2B55A 4TTHB 3WZEA 3P5KA 4RC2A 3NEWA 4FG7A 4KIQA 2PSQA 2HK5A 3G90X 1B38A 1YXXA 3IOKA 3OT3A 2BHHA 1R0PA 2PVRA 4I4FA 4F9CA 5HD4A 3BU5A 4XH6A 3V5JA 2WU6A 1W84A 4AW2A 5IA1A 5KHXA 3IW7A 3AGLA 3F5XA 3R1YA 3EFWA 2PHKA 4XBRA 1PMUA 3ORMA 4BKZA 4ZS4A 4E6CA 5AV0A 4FSUA 2GNFA 3GU8A 3E3PA 1H1WA 4YJUA 4G17A 4X0MA 3VS3A 5LMAA 4U81A 3TL8A 3FC1X 4LV5A 3EQGA 4LOOA 5ANJA 4YTFA 4MTAA 3JS2A 3MPMA 4EC9A 4RG0A 4HJOA 4QMUA 4R7IA 3ET7A 5L8JA 4OBOA 3Q52A 4UMRA 4I92A 2W0JA 3CTJA 5FTGA 4OTWA 1H1QA 4RVLA 1W82A 4RT7A 5ETAA 2O65A 3R2BA 3O8TA 4D1ZA 1ZARA 1CTPE 3UMXA 1DI8A 1NVRA 2PK9A 1CDKA 1Q61A 3VBXA 2VWZA 4FG9A 3VHEA 2UVZA 2Z60A 5J87A 2XRUA 4O1PA 4RSSA 4C35A 1ZYDA 2OFUA 2W06A 1OECA 4RIXB 3NVMB 5AAGA 5E7RA 4BIEA 3CR0A 4P90A 5EDRA 3ZM4A 4FE2A 4D2PA 3EQBA 5EM8A 2Y4PA 2W1DA 3F69A 3HV4A 3Q9ZA 4NCTC 4EL9A 3QTUA 2I6LA 5IUGA 2QOKA 2F7EE 1GIIA 1IR3A 3NYXA 3GCVA 2YLFA 4A4LA 2P4IA 1TVOA 3GU4A 4DG2E 2XJ2A 2ZJWA 4AT5A 4FTTA 3VC4A 4TL0A 4ZZMA 5AP6A 4ZZNA 4PTGA 3JY0A 2Q83A 3CS9A 1OL2A 2GHGA 5CX9A 1VYZA 5LXMA 2GNJA 2VV9A 4QP1A 2CLQA 5KO1A 4N70A 4D2SA 3HNGA 3QXOA 5DPVA 5HCYA 3UYTA 4QPSA 5A4EA 5IDPA 2DYLA 1GZ8A 2VGOA 4FKPA 4GU6A 4EHZA 4FTIA 2Z7RA 2ZDTA 4MBLA 4M12A 4AGCA 4ASDA 3MFSA 4Y85A 3QYZA 4L7SA 4DH1A 5EQYA 4UWYA 4JDIA 4USDA 3WYYA 1IRKA 4IJ9A 4CVAA 2B9FA 2I0HA 3MTFA 4DG0E 4FTMA 2BRHA 2W7XA 2J4ZA 1BKXA 4XG6A 4HGSA 3DKGA 4XMOA 4W9WA 4DITA 1YXSA 1YRPA 3OWLA 2UZNA 3O50A 5AA9A 5M51A 1IA8A 3IW6A 4ALWA 3N9XA 4X2FA 4FEXA 4L53A 1M2PA 4DN5A 5F9EA 4C3PA 1G8AA 1H26A 2J5EA 3MGYA 4V05A 4YZDA 3P7AA 3A60A 4U5JA 1PYEA 5DOSA 5HQ0A 3OEZA 4Q5HA 5GJGA 3V5LA 5HX8A 4XG9A 2YDIA 4ZLOA 2IVTA 2XK9A 3EQRA 3MDYA 5HE2A 5FGKA 4QP6A 3PXYA 4GFOA 3TT0A 2J51A 3D15A 2B53A 4JX3A 5AA8A 4QYYA 2JIUA 4ITHA 4OTFA 2CN5A 3K5VA 5JGBA 3L8PA 4GIHA 3FLYA 3DTCA 5CF4A 3VRYA 5GZ8A 4FG8A 3PE1A 4FV2A 4F1OA 5CSVA 3COHA 3POOA 2ERZE 3V51A 4LYNA 4MF0A 5I9WA 4MBJA 4EH8A 5DVRA 2XMYA 4M84A 1W83A 4AF3A 5CS6A 3EKNA 4BCNA 3G5DA 1APME 1YQJA 5E8SA 2EWAA 4BDHA 5KE0A 3BE9A 4O91A 5JSMA 4RIYB 5IQHA 4OTQA 4DGLC 2YLEA 4ZSJA 4BFMA 3C4EA 4C61A 1PJKA 3R21A 4C7TA 5LVMA 1PXIA 4O7NA 1HCLA 3TDWA 4E5AX 4XHKB 3RWQA 1O6KA 4BBEA 2PVKA 5IA0A 5E8WA 3KQ7A 3NW6A 4RIYA 4TYHA 5LVLA 2ZM3A 2QD9A 2XCHA 4JX7A 5KX8A 4EWQA 4ZS0A 5DIAA 4JI9A 5HI2A 3PPKA 5E8YA 4G2FA 3BCEA 1YWNA 4AXAA 2ITVA 4C4HA 5CT7A 3QUEA 4FV9A 4QPMA 3CQEA 3SAYA 4O7LA 3LMGA 2VTHA 3EHAA 3QFVA 1ZOGA 3TKIA 3RPSA 2PPQA 3FLQA 4HZRA 4XG7A 4AACA 4NUSA 2IVSA 4DFNA 1BMKA 4HGEA 4DAWA 4KBAA 4KRDA 3WZDA 1I44A 5ACBC 3UP2A 2J2IB 1M2QA 3WF6A 5E8VA 4I3ZA 2UVXA 2QOQA 3ZBFA 4MXYA 4XYFA 3K2LA 4D9UA 4EUTA 1UWJA 2CPKE 2PZIA 3NRMA 3DLSA 1ZRZA 3BGPA 3LMHA 2JBPA 2VO7A 2Y4IB 5DNRA 5HBJA 1UV5A 2CNVA 3LFEA 4MXAA 4E4MA 5J8IA 1GOLA 2WMWA 3ZDUA 3BBWA 3E5AA 4GSBA 4WSYA 5AX3A 4IC7A 2VZ6A 4ZY4A 3OS3A 2PZRA 4BDDA 2VU3A 5EOBA 3ZEWA 2G2IA 3DK6A 2UW3A 4QMLA 3BV3A 5CVGA 3NUAA 2C4GA 3M11A 2I0VA 2VTJA 3Q4UA 3LM5A 5HE3A 5T6KA 4F65A 4ASZA 3DXPA 4I6HA 3ZXZA 2WOTA 4PMTA 1JBPE 4KA3A 3ANRA 1YXTA 5C4LA 1S9IA 1FMKA 4A4XA 3TZ8A 3IDCA 1NVSA 4YBKA 5FEDA 5TKDA 4G9CA 3S95A 3FL5A 3FPMA 4JDJA 3TKHA 1PXJA 3RP9A 4X3FA 4ZP5A 3TNWA 5KUPA 4X7QA 2ITPA 5HVKA 4HYHA 3NUSA 3HYHA 2A0CX 4FKUA 3LHJA 2IVVA 2I0YA 2QR8A 4FEVA 2X8EA 3NZ0A 2XP2A 2ITTA 3AD5A 5E1SA 3SOAA 4YBJA 3ZO4A 4DBNA 4GFMA 3D5XA 4BCIA 1TQMA 3RAWA 4NKAA 1DM2A 1MRVA 2OXYA 4CSVA 4KABA 3MS9A 1YVJA 2PMLX 1NW1A 5HO6A 4M0ZA 3GCSA 4KWPA 4QNYA 1ZWSA 4CTCA 3VS2A 3UIMA 1NA7A 3LIJA 3U54A 1A9UA 2XK4A 3BLHA 3MIYA 5JRQA 4AZTA 3G0EA 3ORXA 5AP0A 3VO3A 4D4SA 3HMIA 1QPDA 2YCRA 3JUHA 4O0YA 4XG8A 4KD1A 2OF4A 2W4KA 4PPAA 3PVBA 4MKCA 5BVKA 3U8WA 3NMUF 4ZLYA 2IVUA 2PVJA 3VRZA 3BQCA 1ZXEA 2R5TA 4U42A 4HPUE 4CG9A 2QOOA 4KBCA 4FTCA 4LV8A 4GKIA 3SGCA 4CMTA 3BEGA 3POZA 2PZYA 3W2SA 4Q9SA 4IM0A 4EK4A 3C0IA 2VTLA 5CEIA 4DYMA 4EEVA 2VTOA 4LGGA 3EFKA 3O17A 4JLCA 4YHTA 2CN8A 3Q4ZA 3ZSIA 4ACHA 4AZWA 1FQ1B 2EXEA 4FKGA 5BUIA 3NWWA 2WQOA 2Y9QA 1Y8GA 3QZHA 5DI1A 2C0TA 2RSVA 3QGYA 2HIWA 3D4QA 4MXOA 4FF8A 3I5NA 2R0UA 2PUIA 3IQ7A 2LAVA 5HO7A 4XG2A 2XKDA 3FLSA 2JIVA 4UZDA 2OZAA 3VN9A 2X7OA 3KK9A 4BDIA 4U40A 3ZO2A 4OTIA 4UXQA 4RJ5A 3DS6A 4IX6A 2PL0A 5JMSA 3CD8A 3JVRA 2XNBA 3LVPA 4JAJA 5D7AA 3R8LA 3UODA 5IH4A 2GS6A 5L8KA 2QHNA 4FR4A 3CXWA 2BUJA 2P33A 1GZOA 1IASA 2XF0A 2YZLA 2R3KA 4UMQA 4WD5A 4X2NA 3WF9A 3T9IA 3Q6WA 5CI6A 2W4OA 2XEZA 3BYOA 4FL3A 2OIQA 4JQEA 4E5BA 4AW5A 1J3HA 3GOPA 2SRCA 3BKBA 3P9JA 1U5QA 3QUPA 2C3IB 3W55A 1T45A 4UWCA 4IHPA 5L2WA 4P7EA 4V0GA 1ZLTA 2BDJA 3BEAA 4IB1A 4JRNA 5DEYA 5HG7A 1UU9A 4L7FA 3Q5IA 1WVYA 5JZNA 5EM7A 4D5KA 5IZFA 5CXHA 5AFVA 2OK1A 3TM0A 3DKCA 4NWMA 4DH7A 3NAYA 4F6SA 4CQEA 5EKNA 2BVAA 1XR1A 4Y72A 3OW4A 3KULA 2J0IA 2J9MA 4ZSLA 4FGRA 3VBYA 3QUDA 4I0TA 5I3OA 4YZBA 4H58A 4LMUA 4MBIA 3WARA 4P4CA 4C33A 1KE7A 3L9PA 5FM2A 2OKRA 3REPA 4AZEA 3R6XA 4TN6A 3EQDA 4N6YA 5AV1A 4R3RA 4E4NA 3TNHA 3VBQA 3RPRA 3NYNA 1OM1A 1XBAA 3GC9A 3QTWA 4O22A 3MA3A 5JZJA 3Q4TA 4HNFA 4YJVA 3I0QA 2YCFA 5GNKA 3NUPA 5HTIA 3SG9A 3OW3A 2GS2A 3FPQA 3A8WA 4A9RA 5BVFA 4IFGA 3DJ7A 4L42A 1XH5A 3BX5A 4R6VA 4J95A 3I7CA 3ORNA 4FIGA 3JY9A 4IZYA 4C2WA 3D7ZA 3R9DA 4FV0A 3ETAA 1VZOA 3V8SA 4U3ZA 2BFYA 3ORPA 4PMPA 1AGWA 2F4JA 2W9ZB 4Z55A 2B0QA 5J9ZA 2XM8A 3MFRA 5C03A 1LEZA 4TY1A 3GGFA 4YJSA 3HDNA 1FVVA 4U43A 3R8PA 1B6CB 5L2IA 2G9XA 3CQUA 2WFYA 3TWJA 3A7GA 3KXGA 5EKOA 3F7ZA 4OBQA 4WG4A 4GVAA 2ITYA 3R7VA 5CF8A 3C9WA 4BRXA 3F3WA 3PFQA 3UIBA 3FI4A 3BYMA 2J7TA 5JK3A 4U80A 4KKEA 4Y8DA 4QMWA 3MH2A 3AC8A 3QL8A 2QO2A 3LCOA 4WKQA 5CVFA 1WFCA 4MQ1A 5DLSA 4O7WA 3OZ6A 3F7WA 5H8BA 3SRVB 4QOXA 1R0EA 4P5QA 4GKHA 3PP0A 3ZFMA 3VS6A 4UY9A 5AV4A 4MH7A 4FTRA 3ALNA 2RG5A 1AQ1A 4H05A 3UOKA 4UYAA 4JBQA 3I7BA 4GFGA 5E8ZA 5M07A 4L45A 4EOPA 3MVJA 1M7QA 2JD5A 4H3QA 2QO9A 1GIHA 3EZVA 3R0TA 2Z2WA 2AUHA 4ZTMA 1CKJA 2P3GX 3NSZA 4F7SA 5CY3A 1O6LA 3V5PA 4AZVA 3LFDA 4FT9A 3CQWA 4NM0A 5HLNA 1MQ4A 4P5ZA 4C4JA 5JFVA 4PNIA 4ANOA 5D41A 3GNIB 5L3AA 2YITA 1WVXA 2PWLA 2VWVA 2YFXA 2YZAA 4I20A 2WQEA 1BI8A 2R3GA 3H10A 3VUGA 1SMHA 4QMYA 2JDSA 1WBWA 3KF4A 4X2KA 5AAFA 1OL7A 3W8QA 1QCFA 4HVHA 1OPKA 5FBNC 5HU3A 3LAUA 2YCSA 4N0SA 1OMWA 3PYYA 4G6LA 4G3GA 4XOZA 3TZ9A 2PMOX 4NCTA 3UQFA 1F0QA 5D7VA 5ITAA 2WOUA 3E62A 4QD6A 4DTBA 3N4UA 4G5JA 4PTEA 4AA5A 1SNUA 2OF2A 3V5QA 4QTEA 5AEPA 3TUCA 4D1SA 4IXPA 1QPCA 3RKBA 4FZAB 2W5AA 3W16A 3U6IA 4X6QC 2HW6A 2QQ7A 5AP7A 1ZMUA 1GNGA 2GS7A 5ANDA 3PLSA 2WXVA 5EYMA 1OIQA 2FA2A 2VTIA 3QRKA 4AN3A 1W8CA 4ZLZA 1V1KA 1TQPA 2X4ZA 1R3CA 4DINA 3O8UA 4FV1A 4JVGA 3ZZEA 2C5OA 4I5HA 3VJOA 3EB0A 3WE8A 5F94A 5TF9A 3FMDA 4WNKA 4CZYB 1IAHA 3CJFA 3F3TA 4ERWA 4KAOA 3UNJA 5EOLA 3KA0A 2C5XA 4U44A 4ZY5A 5L6PA 4C3FA 5CANA 3A2CA 5LVOA 5EQEA 4D55A 3MPTA 2VTNA 3KN5A 4AAAA 4CZTA 1IAJA 2BAJA 3AD6A 5K4IA 3KN6A 4JNWA 4XP3A 5GJFA 3Q96A 5CZIA 4BDGA 4FTJA 3UIXA 3CGOA 2X2KA 5DRDA 3QD4A 2JLDA 4QP9A 4C8BA 3S0OA 2HXLA 3OHTA 3PIZA 4PL4A 5AWMA 4EH3A 2WTVA 3E92A 5I9YA 1WVWA 2Z7QA 2C6OA 1YDSE 3N51A 5ANIA 4FKWA 4QMPA 5HIEA 3VIDA 2GFCA 2B52A 2X2MA 4UYNA 1UKIA 4H1JA 4H39A 4G1WA 3F5GA 4RC4A 1UU8A 4PV0A 4ZTHA 4OTPA 4BZNA 2CKQA 3V8TA 4EORA 3QYWA 1LEWA 3TCPA 3VF9A 4APPA 1YXUA 5I9XA 2IO6A 3PJ1A 4OTDA 1F5QA 3FZSA 4KKGA 2IW9A 4E93A 3F88A 3D14A 3RPVA 2FGIA 3I1AA 3AXWA 4U97A 4WIHA 3EQCA 3PG1A 1U59A 3ZYAA 5FQDC 5L2SA 3HV6A 3FV8A 2VTAA 3QCXA 4HCVA 2HY0A 4BL1A 3H9RA 3KC3A 4CFUA 5IDNA 4BY9E 2VWYA 2Y6OA 5CAPA 2ITNA 4DFBA 1Q5KA 2QCSA 3B8RA 3LZBA 5HD7A 3ZDIA 4BN1A 3N4TA 2ZB0A 2R4BA 2XNMA 3BLQA 3C4FA 3CY3A 3FLNC 4RJ6A 3R04A 3JYAA 3IG7A 4DGNA 3VBVA 1JKTA 4DLJA 3EYGA 1H01A 4EC8A 2G1TA 4RA4A 3ZZWA 3EQIA 2WU7A 4GCJA 3DQWA 3R7GA 4K11A 3BPRA 1CKIA 2V0DA 2YIXA 4RLKA 5EI6A 4F4PA 4YR8A 4DF3A 3MVLA 4WG5A 4PY1A 3F9NA 4QTCA 3GXLA 4BDCA 3NYVA 4JDHA 1GZNA 1WBPA 1Q3DA 2J6MA 4LG4A 2X4FA 3ORKA 4O81A 3MWUA 4MNFA 2QOBA 4WBOA 5DH3A 4O38A 1WCCA 2YERA 3QLFA 4GUBA 1PXKA 5J79A 2ZV2A 3DZOA 3HKOA 4EWHA 4HVIA 3AC4A 3F5UA 2CGXA 3WF7A 4DEBA 4ZMFA 4P2KA 3C4CA 3NGAA 4NJ3A 1KOBA 5E90A 4A7CA 2PTKA 4GYGA 4FV3A 1WBVA 1V0PA 3FQHA 5ICPA 3FY2A 4RJ7A 2BZKB 2B9IA 4D4RA 2C5YA 4IB0A 5CNNA 4EYJA 5DMZA 1ZYLA 2WMUA 3ELJA 4FNYA 5AMNA 2YAKA 2VWWA 3U6HA 3WZKA 1MP8A 5FUTA 4KIKA 1JAMA 2RIOA 3QC4A 3R2YA 4BDAA 1Q41A 2F9GA 3QC9A 5DWRA 5CALA 3KRLA 2UVYA 4GUEA 3DFAA 4FSNA 3MA6A 1G5SA 1SYKA 3ORZA 1OVEA 5DN3A 3UZRA 5IA4A 2QG7A 3QCSA 3C51A 2JDVA 5I5ZA 4CEGA 3FJQE 3LFAA 3CBLA 3F2RA 4E4XA 4G6OA 2UZLA 4FKRA 4GJ3A 4BKYA 2F49A 3T9TA 1OI9A 2H8HA 3II5A 3FI8A 3SDJA 4FYNA 4Q5EA 3HRFA 4YHFA 3TACA 3RAHA 3C0HA 4MCVA 5C8KA 4FKJA 4DGOA 4Z7GA 1FINA 3PY0A 5IF1A 1S9JA 2W17A 3QD2B 3DOGA 4IX3A 3ZO1A 3OY3A 2C30A 4L43A 2YWVA 4E6AA 2VD5A 4NW6A 4OBPA 4IVCA 3DPKA 3UPZA 3F2AA 4ZIMA 4ZJIA 5M4FA 4X3JA 5L4QA 5HIDA 3TXOA 5FD2A 4XX9A 3OG7A 3GVUA 3GC0A 4BWKA 3MY1A 2WQNA 3TTJA 2X6DA 4CGAA 4D58A 3GFEA 5HG8A 3EN4A 1OKWA 4WO5A 5FM3A 4RMZA 4ZJJA 4BTKA 2PVMA 4DGGA 2GSFA 2XYUA 3IGGA 4EOOA 1NT2A 2VNYA 4FV6A 1H1PA 4J53A 3LCKA 3WE4A 4CZUA 3ULZA 2QG5A 2YHVA 4OUCA 4R1VA 1H24A 5HBEA 3R7YA 3UGCA 4FV5A 4RWJA 4ZXTA 4E20A 5CLPA 5F4NA 3QKLA 3LPBA 3BHHA 3SA0A 2R9SA 3R73A 4W4WA 5E92A 3H30A 3QTSA 4AN2A 4F9BA 2V7AA 3KF7A 4DTAA 4IANA 4U79A 3OXZA 4M69A 4I6BA 5C8NA 2XK3A 4I93A 4TWNA 4ACMA 4Y83A 4ACCA 4EKKA 2OH0E 5A4LA 4EK6A 2FSTX 3F3UA 3K5UA 3QQHA 3KB7A 2H6DA 2ZAZA 3MH0A 4J8MA 1H00A 4CFFA 2B9HA 3D2IA 5CQUA 4IADA 3GCUA 3QTQA 3FQSA 1JSVA 5A14A 2WPAA 3SW4A 1IEPA 1WMKA 3QQLA 4BI2A 5AAEA 4CXAA 5CI7A 3E8EA 3BYVA 2W05A 5KMJA 2PUPA 2OI4X 2VO6A 4U8ZA 3ZXTA 4HW7A 4M13A 3OTUA 3VBWA 4JR7A 3FAAA 4QYGA 5KZ0A 3B2TA 2OSCA 4OT6A 1Q24A 4C2VA 5K0KA 5M4IA 1M17A 5D12A 1LP4A 1PMNA 5LOHA 3OFMA 3NVKI 2WQBA 1PW2A 5AP5A 4B8LA 3I79A 3UZPA 3WBLA 1VJYA 2UZDA 3HMOA 4YURA 1WBNA 3R1NA 4V01A 4F7NA 3QQJA 5H8GA 1XBBA 5HICA 4E73A 2P2IA 1FVRA 3QA0A 5JH6A 1PMVA 2G01A 4EQCA 2ZV7A 4RWKA 3L9MA 1XJDA 5A46A 2Y7JA 1J7UA 2UZTA 4KINA 4IW0A 4EOQA 3QKMA 2JDOA 3HAVA 2QOFA 2BZJA 2J90A 4JOAA 4X3FC 5KHWA 2Y6MA 2X39A 4FNZA 1KSWA 4O0TA 3C13A 4FT3A 1XH7A 5HNGA 4R77A 3HL7A 4RWIA 4EOSA 5LMKC 4X21A 4AW1A 5K5NA 1Z57A 3W2OA 2C6IA 2V5QA 2IJMA 4QP3A 4JIKA 3RM7A 1UNLA 2XNNA 1H25A 5I9UA 2QC6A 3W18A 4J96A 2ITWA 2BKZA 3R28A 4PMMA 1PXOA 2HZ4A 3ZUUA 2YCQA 3D5UA 5HG5A 3V3VA 5FDXA 4FZDB 4YLJA 1Q8TA 2BIKB 3UOHA 4ZTSA 3F61A 4TWCA 5ACKA 3A61A 2WMVA 4QMTA 2W96B 4R8QA 3BYUA 5M06A 3B2WA 4FK3A 4FUYA 1ZY5A 4X2GA 4O21A 4OTRA 4CFXA 4U6RA 3PWYA 2RFSA 5KCVA 3DQXA 4ANNA 5B0XA 4AA4A 4Y5HA 3ALOA 3FE3A 3OROA 2PMIA 4NEUA 4FTNA 4CRSA 2BRNA 3GC8A 2WMAA 4RX9A 1DS5A 4O0VA 4TRLA 4F0GA 2UZUE 3FBVA 4A07A 3TV7A 4UALA 4HVSA 3BHUA 3OUKA 4R78A 1EH4A 2Y0AA 5KMOA 3EMGA 3PPJA 4KSQA 2A4LA 4KS7A 3O71A 4BBFA 5BVNA 1A48A 3UOLA 5J9YA 4EHEA 5CVHA 4J8NA 3E3BX 3MYGA 2XIRA 3NUNA 2NPQA 3P7CA 2ZV8A 1ZYSA 5FTOA 4JBPA 4QQ5A 4HOKA 2EB2A 1DAYA 5E4HA 4L3JA 3RI1A 3KEXA 5IMEA 4RVMA 5CF5A 2ACXA 4M0YA 1Q8ZA 2IWIA 4IIRA 3DBEA 4OR5A 3VUIA 4GU9A 4YTIA 3ORIA 2NP8A 2IW6A 2QU6A 3OWJA 2X8IA 4GEOA 5A54A 2O3PA 4FKLA 1RW8A 2JKMA 4FX3A 4TYIA 2QOLA 1OIYA 4B9DA 4DCEA 5IISA 4XRJA 2WB8A 3RNYA 3UTOA 4AFJA 5TR6A 3ZO3A 2NNWB 2FUMA 2E9OA 2WTIA 1H0WA 3V04A 2GNGA 1Q62A 3OWKA 3S2PA 4CFVA 3ZH8A 4QYFA 1JKSA 2OXDA 4F6WA 3FC2A 1BLXA 1SZMA 4NZWB 3QZIA 2XKEA 3G51A 5AV2A 2B54A 5I0BA 1JNKA 3GCQA 4BDFA 3Q04A 3A8XA 2C1AA 3RVGA 1GY3A 3OWPA 5IQGA 2IZSA 4Z16A 2XBJA 1FMOE 2V22A 2XNGA 3DBDA 4UEUA 5DG5A 3E93A 4M14A 3SOCA 3IDPA 5KBRA 3RGFA 4AWIA 4LM5A 1U46A 4TNBA 5AP2A 3FEGA 4YMJA 3P86A 2V62A 4L68A 2R2PA 4YC3A 4XLIA 5HE1A 3RALA 4ZOGA 2BDWA 2JGZA 3IDBA 3MY0A 3OD6X 4E7WA 1QPEA 2BAQA 3BHYA 5E8XA 4EOJA 4BB4A 3PVGA 4BYIA 2WTDA 5IQAA 5C26A 5EHYA 4DFZE 2UZWE 4C4FA 1OITA 5KKRC 3ANQA 3ZOSA 2IG7A 4O7YA 4JR3A 1U54A 4RJ8A 3PY3A 4RGJA 1UU7A 3LOKA 5DRBA 4FEWA 4QP4A 4L3LA 2XEYA 3VUTA 4EBWA 4DH3A 3KCKA 1YDRE 2QNJA 2C1BA 4C57A 4FKVA 3PJ8A 3TKUA 1JKKA 3FDNA 4MAOA 5KZIA 5HNIX 1J7IA 4NSTA 2H9VA 4D9TA 3O23A 1Q99A 4CKIA 1GAGA 4ENXA 3CY2A 5EM6A 2GU8A 2UZOA 3QTXA 3OOMA 4PDSA 1F3MC 4PMSA 2QODA 5E1EA 4UV0A 3HDMA 2PUUA 3R00A 4AOIA 4F0FA 5A4QA 5L8LA 4YSJA 3G6GA 5M57A 3IO7A 4M68A 2E9VA 4RWLA 4S2ZA 4I94A 5GZ9A 3W2CA 3LMIA 3EYHA 1V0BA 3O2MA 4NFMA 3OEFX 4J52A 4PP9A 3SD0A 2P0CA 4FIEA 4EHVA 3G9LX 2UUEA 4RX8A 5EK7A 5DR2A 5A4TA 3VUDA 2JITA 4WUAA 3FYJX 4AX8A 3NNUA 4E6DA 3OTVA 1MQBA 1SVHA 3CPBA 5HVYA 2VTQA 2XM9A 4H3PA 4BCOA 4DG3E 5FXSA 4J71A 4IVAA 3QLGA 4FKSA 3KRWA 1PMEA 4FSQA 1YI6A 3D5WA 3BGQA 5DYJA 3CP9A 4F7LA 3TUBA 4PDOA 4S34A 5L6OA 3P0MA 3IS5A 3AC5A 3S4QA 4I21A 4D2VA 4RJ4A 4ZMEA 1W0XC 4K0YA 4GK2A 4ZK5A 4CTBA 5A3XA 5CXZA 2C6EA 4BWPA 2GHMA 4I4EA 4ERKA 2YDJA 3OT8A 4LRKA 4TPTA 4PDPA 5HESA 3UVRA 3PG3A 4FL2A 5BPYA 3MB7A 4C3RA 3U9NA 4AW0A 3PUPA 4XP0A 3GU5A 4YJTA 5J95A 3RK7A 4ENYA 4PNKA 4BDEA 3CIKA 3FWQA 4IH8A 3F82A 5LJJA 4JT3A 2F7XE 4O0UA 4ONAA 3R8MA 3PDTA 1H1RA 1WAKA 3UC4A 3WIKA 4M67A 4UZHA 5FG8A 4HVDA 5KMIA 4WNMA 4Y95A 3WYXA 4BGQA 3N4VA 5I9ZA 3PA5A 3FMKA 1IA9A 3ROCA 2YEXA 3FY0A 4JAIA 5CYIA 4UBAA 3W2PA 4C37A 4BICA 1H07A 4HCUA 2OJGA 5IQBA 3BHTA 1ZMVA 2RFNA 4XG3A 5M56A 3VQHA 4RFZA 2PUNA 5HU9A 4XRLA 3LXKA 5CEQA 3UC3A 4BDBA 3PSBA 2EU9A 3AMBA 1KUTA 4F08A 5C4KA 5IA3A 2WTJA 1Z5MA 3K54A 4I1ZA 3O96A 1KE6A 3DB8A 5CU3A 5DT4A 3ITZA 3HVCA 3KK8A 4YO6A 4QRCA 1Y91A 3E8DA 4XUFA 3U9CA 3FKOA 4BTFA 4CMUA 3MESA 3CTHA 2UW0A 4QTBA 2KULA 4YC6A 4ORKA 4H36A 2BAKA 2WEVA 2XNPA 1KV2A 4IAFA 5L6WL 3NS9A 3R8UA 1QL6A 2X2LA 3UIUA 3ZMMA 5GIPE 4CCBA 4WRSA 5AP1A 4GW8A 2F2CB 4G3CA 4K1BA 4YZNA 2XIYA 2R3PA 4IZ5A 4PUZA 1OPLA 3KMUA 3G6HA 4IWQA 2HZNA 3ZM9A 3K3JA 4CCUA 4M66A 4MNEB 3Q6UA 3HUBA 2C3KA 3FI3A 3P78A 5FBOA 1FVTA 2RKUA 2OIBA 3HEGA 4DTKA 1W7HA 2YM7A 3BZ3A 2R3HA 5K9IA 4MK0A 2HWOA 2R64A 3HP5A 3ATTA 2REIA 3A7FA 4TYHB 4FEUA 3G9NA 5EDPA 3RPYA 1YW2A 4LL5A 4XBUA 3RK9A 4F1TA 5J7HA 2C6DA 3SX9A 4IAKA 5HZNA 2BRMA 5CSXA 3FSFA 4A9YA 1OBDA 2W9FB 2CGWA 3ACKA 3FSKA 4HCTA 3PY1A 1Y6BA 2AYPA 2ITZA 2Z7SA 3GOKA 4L6QA 3BV2A 1H08A 2X9FA 4BCHA 2JKQA 4F63A 1JWHA 5HKMA 2J0JA 4DEAA 2I40A 3QTZA 4ZJVA 2YM3A 3NNVA 3ZSHA 3IOPA 4C34A 3UMWA 4JS8A 3A62A 3ZFYA 4DFXE 2XIZA 3LJ2A 3MI9A 3MPAA 3OBJA 2O8YA 3CKWA 2P2HA 4I5PA 4KB8A 3Q3BA 2PVYA 3UJGA 5HO8A 2XH5A 2XKCA 4YLLA 4DFLA 3ZEPA 2H34A 2CMWA 3R1SA 4XCUA 3BWFA 3EQHA 3ZLXA 4DEEA 3LFCA 2CJMA 3LLAA 5HX6A 3PZEA 3P08A 4XNEA 3ZC5A 1Y57A 3LCTA 4EHGA 4FOCA 4DFUA 3VQUA 4OAVB 2I7QA 4O7SA 4K6ZA 3Q5ZA 5D11A 3ID6C 4TYGA 5IU2A 5FP6A 3UZTA 3TN8A 4EOKA 4N6ZA 4UX9A 2PZ5A 2HZ0A 4BCPA 5IG1A 2UZEA 3VUMA 4QP7A 3RHXA 1JSUA 4OTGA 4QQCA 2YA9A 4JQ7A 5ANOA 3ZUVA 3AMYA 5LCJA 3M42A 5CWZA 5E8TA 4YP8A 1RJBA 4YTHA 3BYSA 3Q2JA 5K4JA 1UWHA 2J0KA 5DR6A 3MV5A 3VS5A 4EK3A 4O2PA 4EUUA 4HGTA 4K2RA 2OW3A 3O7LD 5J9LA 2JAVA 3BI6A 4F9WA 3SHEA 1VR2A 2QU5A 4MD8E 3ZLYA 4CFNA 4O86A 2PMNX 4BGGA 3UG1A 4K18A 2CNQA 5JT2A 1KWPA 4H3BA 3GT8A 2XVDA 4MVFA 5H3QA 4C58A 4FKOA 3UNKA 5DA3A 1DAWA 2BTRA 2ZM1A 3O8PA 3TUDA 3DJ5A 1G3NA 5J1WA 3DK7A 4XJ0A 3TZ7A 5I3RA 2R7BA 2OZAB 1MRUA 3EWHA 4RIWB 4QQTA 4AT3A 2CHLA 2C69A 2ETKA 3IPHA 3Q32A 2R3FA 4FEQA 2CGUA 4ASEA 4BGHA 3OMVA 3FQEA 3WIGA 3A4PA 4TW9A 3VHKA 2BRBA 4NH1A 3EFJA 1UNHA 3BE2A 4II5A 4NU1A 2Z8CA 3A7IA 1W98A 3W2RA 4YUQA 3UQCA 3E7VA 4B8MA 1Q8WA 4DEIA 1U5RA 1P2AA 4AUAA 5HORA 4LGHA 4WA9A 5M55A 1NXKA 2WHBA 4EH5A 5CAQA 3PJ3A 4FT0A 3QX4A 3UVPA 3DB6A 2VWIA 5AR5A 3Q2MA 3MN3A 3HRBA 4BCFA 4KIOA 3PSDA 3AG9A 4NFNA 4D2TA 4CYIA 5ANKA 4AGWA 3SRVA 3OXIA 5AIRA 4EOMA 2OH4A 3FMLA 1XH8A 3LXPA 4I41A 1RDQE 2EVAA 4JBOA 2W5BA 4KNBA 4KBKA 2VWUA 2X7FA 5AM7A 2GNIA 4FV4A 1UU3A 4D4YA 3RTPA 3NX8A 3NCGA
chains in the Genus database with same CATH superfamily
3R01A 4GYIA 4J1RA 5DGZA 1PXMA 4D4VA 3TNQB 4EOIA 3HP2A 4FSWA 1BL7A 3GQIA 3I5ZA 3I6WA 5ANEA 3UVQA 3EN9A 2IW8A 3UO4A 4C0TA 2HENA 3VUHA 1CM8A 4K9YA 2O2UA 4FTKA 5BYZA 5C27A 2UZBA 4X3FB 3GFWA 3SC1A 5CEPA 2KTYA 5JQ5A 4WG3A 3R71A 5FEQA 4YHJA 3EN5A 4QDEA 2QKWB 4HZSA 3RHKA 2Q0BA 4FK6A 3DDPA 4GMYA 4A9TA 2ZV9A 4ACDA 4NT4A 4I5MA 2YM4A 2W1ZA 4FSMA 3QALE 5AUUA 1J1CA 3QU0A 4PWNA 4YPSA 3RINA 1ZAOA 4TNDA 5HLWA 3DV3A 3O0GA 5AR3A 3FI2A 5ETCA 5AUWA 3FXZA 3LLTA 2IF8A 2XKFA 4YU2A 2OG8A 3IK3A 3O51A 4EQMA 4GS6A 3D83A 5EG3A 4U9AA 2JC6A 4GV1A 2WELA 3R7UA 3MY5A 3TZMA 3W32A 4EH9A 4ARKA 4F70A 3U6JA 3QHWA 5IQCA 3HMNA 3KXZA 3PXKA 3AOXA 2LGCA 2VTSA 3R7EA 1YWVA 1RQQA 3D7TB 4FZ7A 5DR9A 1XBCA 4YO4A 5GZAA 3SV0A 5EYCA 5EYDA 2VX0A 2GTNA 3TIYA 3WOWA 4QTAA 4PP7A 2WMBA 4IBMA 4PL5A 2CNUA 2C47A 2UW7A 4RIXA 3E64A 4AFEA 2WIPA 3CCNA 4IX5A 4CNHA 4YNOA 5DT0A 2JBOA 5AP3A 4C4EA 3PXRA 3QX2A 2JIIA 4M15A 3EFLA 3IW4A 2WO6A 4F99A 3SXRA 1Q4LA 2PE2A 2PU8A 1H8FA 1O6YA 3OF0A 4G3FA 4R7BA 4S31A 4LOQA 3I0OA 2WTWA 3OXTA 4JBVA 5AUVA 4UWBA 4FVRA 3QQGA 3LCDA 2O5KA 1YHSA 3MFUA 5LMBA 5M09A 3LFBA 3L8SA 3FZPA 1XO2B 3W0MA 2QOCA 4IJPA 3PXFA 3NPCA 4AN9A 4ZTQA 2C6KA 4ALUA 4CYJA 5G1XA 4F64A 3HA8A 4C4GA 2BDFA 3E7OA 1L3RE 5E9EA 3QGWA 1PKGA 2HAKA 2OZOA 3MTLA 5FTQA 3UP7A 4BDJA 4W8EA 4YJQA 1OL6A 2C68A 4G34A 4K8AA 4X2JA 3FZRA 4EH6A 4RQKA 1E9HA 3AT3A 4CFMA 4KUJA 3QQUA 4QMQA 4U41A 3SKCA 3KIOC 1O9UA 4NL0A 3KGAA 5AR7A 3DAKA 2HOGA 3WZUA 4TYJA 2P55A 2XK6A 4BJJA 3QD0A 4KRCA 4R3PA 1ZYCA 2AC5A 3GENA 3VS1A 4EKLA 2VWBA 3MJ1A 2UW4A 2VGPA 3D7TA 4CG8A 4F0IA 5JRSA 4FTQA 2YDKA 4Q9ZA 3RZBA 3GQLA 4CT2A 1MRYA 2ONLA 4IAYA 4O6LA 4ACGA 1YI3A 3UO6A 2GMXA 2A1AB 2HWPA 4Z7HA 5C1QB 4E8AA 4BI0A 3R02A 5EDQA 4QMOA 3P5JC 4BHNA 3PJCA 4RQVA 5HNBA 1KE8A 4HYSA 4EOLA 4IFCA 4F9AA 2X1NA 1OUKA 5J5TA 3JXWA 1K9AA 2PVHA 4X6RA 5FRIA 3T3VA 3MH1A 3PVUA 2C0OA 2WMTA 2FVDA 4FIIA 4KS8A 3GU6A 3ERKA 3OCGA 3QTIA 1YKRA 3H0ZA 3I60A 4GT3A 4O7ZA 1P4OA 2UV2A 2O0UA 2VTTA 1SNXA 4XS2A 1ZZ2A 3AGMA 2EXMA 4FICA 1PXPA 3P7BA 3HX4A 4RX7A 4U3YA 2BHEA 4CQGA 3PIYA 3W0OA 5CENA 5T3QA 1OBGA 4IE9A 4D2WA 4J7BA 3L8VA 2VO3A 1V0OA 4PX6A 4WRGA 3DXQA 3PXQA 3UYSA 4O7RA 1KOAA 4MXCA 1QPJA 3JVSA 1H0VA 3RMFA 3BWJA 4QT1A 2HELA 2PZPA 5M44A 3Q60A 4YGAA 3DDQA 1OKZA 1U4DA 2BILB 4QMMA 5ANGA 4ITJA 4AT4A 3MW1A 1XHAA 3P4KA 4FTUA 3I6UA 5HCZA 4D2RA 3LQ5A 3LKMA 5A4CA 1E1XA 1K3AA 3C0GA 3Q9XA 2NRUA 4Y73A 1PY5A 4L44A 5AJQA 4I24A 1FGIA 2GTMA 4G31A 2WIHA 4HPTE 3TJDA 1JPAA 4XEYA 4HNIA 4XV1A 4EH7A 2GQGA 4ANBA 2JFLA 4IDTA 4HYIA 3GU7A 2QVSE 4O6EA 5DFPA 3DBQA 3EKKA 4IVBA 4UMTA 4WBBB 4IWOA 2C3LA 1XWSA 3PA4A 1YWRA 5JEBA 3LFQA 2C6MA 3C4ZA 1GZKA 2XIXA 2YM5A 5HIBA 3TV6A 2QKRA 3HV5A 4DEDA 1JVPP 2YIYA 3PA3A 4YZ9A 3KXXA 3QHRA 5BNJA 5LVPA 4BR3A 1ZYJA 2OGVA 3L9NA 3QRTA 2RG6A 2HZIA 4K77A 3VS7A 2AQXA 3QKKA 3R7OA 1CSNA 3D9VA 1URWA 4LL0A 5EW3A 3FYKX 3ODYX 4EI4A 4ZZOA 3QQFA 2BKKA 5IPJA 2FYSA 4DBXA 4EH4A 2IN6A 2F7ZE 4JG7A 5JGAA 3TNPC 4RZVA 5AR8A 3UQGA 4AGUA 4EBVA 2GDOA 2BFXA 3QA8A 4ZSGA 1M52A 5IQEA 3TIZA 2RFDA 4LV7A 1TQIA 3LFSA 1YOMA 3FLWA 4IB5A 3TJCA 2G15A 3QXPA 4LMNA 2G2HA 3H3CA 4C36A 2F2UA 3UOJA 3P23A 4PTCA 4LUDA 5F95A 3KU2A 2W1EA 4E4LA 1U54B 3FMMA 3NCZA 1JQHA 3ZONA 4RA5A 4D0XA 4IAIA 5EQPA 2W5HA 1WBSA 2BCJA 5CAVA 2QR7A 4ANQA 3DZQA 3QRJA 3QWKA 4A4OA 4DC2A 2QOIA 2VN9A 3NR9A 4DLIA 1J7LA 4AZSA 4MYGA 3W0SA 3ROYA 1XH9A 4CRLA 2OIDA 3FMNA 4JL9A 3VW8A 4EZ5A 2FH9A 4O84A 5LQFA 4MQ2A 1PRYA 4FTOA 4FODA 3ZBXA 2RF9A 2VX1A 4L8MA 2HCKA 1UKHA 2VX3A 4TWPA 3CGFA 2UZVA 2XJ1A 2R3OA 3LJ1A 3CE3A 4ALVA 1UVRA 2UW9A 3AT2A 5AR2A 1R39A 5EHOA 5HGIA 1VYWA 4MD7E 3KVXA 5KMKA 4BC6A 3GEQA 5LARA 2C6TA 3KMMA 4IWDA 3DXNA 3UDBA 1NY3A 1KE5A 1SM2A 3R83A 4TT7A 5IUIA 4D0WA 2QONA 4LFIA 4L9IA 3ENHA 1REKA 4DT9A 2X81A 2W4JA 2Z7LA 3ENMA 2QO7A 3FZTA 5FWKK 3BRBA 4FA2A 2B1PA 2YAAA 4PPBA 4IAZA 3DGKA 5TO8A 4AXDA 3IW5A 3COMA 5IQIA 3WI6A 3GCPA 2QI8A 3ML1A 4O83A 5BX0A 2FO0A 4C59A 2W1FA 3LXNA 4NJDA 2ZOQA 3QF9A 2BROA 4FGBA 5BUEA 2JEDA 2WAJA 3NNWA 4KIKB 2FSLX 3EQFA 3VWAA 4QMSA 3FMEA 3T3UA 4F6UA 3CTQA 2Y8OA 2IZTA 2JDRA 4GK4A 2PVFA 3NIZA 4FC0A 2VUWA 3OOGA 3PRIA 4YZCA 2W1HA 2YJRA 4BCJA 3UG2A 2ZYBA 5HLPA 5AP4A 3D5VA 4GL9A 3ATSA 1YOLA 1P14A 3HGKA 4L67A 3EJ1A 3QTRA 3T8OA 4BCGA 2ESMA 4O4FA 3S3IA 3PRFA 4EYMA 4XV2A 4I6LA 1FOTA 4EJNA 5LWNA 5BMSA 4W9XA 3MB6A 4F1MA 3K3IA 5EI2A 4FOBA 5I4NA 3W1FA 2A19B 3FMJA 5DE2A 2J0MB 2YACA 2XA4A 4FUXA 2YJSA 4IDVA 4G3EA 4ZSEA 3R8ZA 4AQCA 3NUYA 3QZGA 2R3LA 4YLKA 3C5IA 3HUCA 5HOAA 2CCHA 2WTKC 4GH2A 1SVEA 4NTSA 4U45A 4OW8A 4NM7A 3AMAA 2E2BA 4AOTA 4UN0C 2E9PA 4EONA 3BBTB 4LRJA 1YHWA 4BHZA 1BUHA 3L8XA 2RL5A 1ZZLA 3UO5A 4F78A 2WMQA 4S30A 3V6RA 1OIRA 4F7JA 5HG9A 3DKFA 4L46A 5BVOA 5CU0A 2XANA 1LR4A 2WMXA 4FI1A 2JFMA 3DT1A 4S32A 3JR1A 2WEIA 3CSVA 1PXLA 2XJ0A 4MWIA 3F66A 4IM3A 3W33A 3QZFA 4USEA 1URCA 4N57A 2ZVAA 4G9RA 3VS4A 3ZSGA 2ERKA 2EUFB 4DH8A 3EOCA 2OJIA 3QAME 4S33A 3W10A 1OKYA 4D1XA 1OGUA 2PVLA 2DWBA 3PLAE 1OKVA 1DI9A 2ETRA 2WNTA 3FUPA 2JDTA 3KXNA 4FTAA 4G6NA 4GIIA 3NUXA 4FSZA 4PL3A 3V01A 4C4IA 5JKGA 5KMMA 2CKPA 2Z02A 2PVNA 4ZTRA 4ID7A 5BVDA 4YSMA 2XARA 5KBQA 2WMRA 5CU6A 4FSYA 4WOVA 4FV7A 3HECA 2QLUA 3E8CA 2VRXA 3GI3A 3R8VA 1VEBA 1OL5A 4CFWA 1JLUE 2CKEA 2X7GA 3I4BA 4DDGA 5IEXA 1G8SA 3WILA 1SVGA 4IX4A 2X0PA 2C5VA 2XCKA 3LCSA 5L2TA 3CD3A 2BMCA 4QP8A 4BIDA 5CEOA 2XUUA 3H0YA 5C01A 4OAUC 4UMPA 3WF5A 3FKNA 2QLQA 4PRJA 1R1WA 2ZB1A 1H28A 3ZC6A 3BHVA 3MFTA 3FLZA 4FKIA 3FHIA 2O64A 4E5WA 4B6LA 1H1SA 4GG5A 3AC3A 4WHZA 5H2UA 4E3CA 3MIAA 4ANLA 4M8TA 4A9SA 5HBHA 4QPAA 5AX9A 2PULA 4BF2A 2XIKA 2CDZA 4LI5A 2XNOA 4RFMA 5CSPA 4EZ7A 2I0EA 4ZTNA 4ZEGA 3TTIA 1L8TA 1H4LA 5DEWA 3VF8A 4AGDA 3LQ3A 4JXFA 4N4SA 4XOYA 2V7OA 5FXQA 5A6OA 5CAOA 5IEYA 2ITQA 4G16A 4D5HA 3A99A 2C0IA 4I0SA 4B99A 1UNGA 3RBWA 4B4LA 3ULIA 2J50A 5KMNA 1HOWA 3A4OX 4R3CA 2R3NA 2OXXA 5BVEA 3GP0A 2NO3A 1R78A 2W1CA 2WGJA 1YI4A 3NW5A 4NIFA 3F3ZA 5BVWA 2GHLA 5H9BA 4DA5A 3HMPA 2GNHA 4GG7A 4MF1A 1TKIA 3NUUA 1M2RA 3OC1A 4DFYA 2X6EA 4IM2A 1G8KA 4FKQA 5EFQA 5EI8A 3ODZX 1LPUA 3EN7A 4ANSA 3EZRA 5LCKA 2BALA 3KRXA 1ATPE 4FIHA 5AADA 3KVWA 2QURA 4EQUA 4M3QA 4XV3A 5C9CA 4QEBA 4YJRA 3G33A 4I23A 5G6VA 4BCKA 5HVJA 3VUKA 2OBJA 4ANMA 3DCVA 2X8DA 3KREA 1JKLA 3HAMA 2W99B 3RM6A 2UW5A 4FYOA 1KE9A 4IZAA 5BMMA 1GJOA 1B39A 3EIDA 3TNIA 5BYLA 5F20A 5TE0A 2ZM4A 5JN2A 1ST0A 3TMOA 4MEDA 3Q53A 4OTHA 2DS1A 3PPZA 3FHRA 4V0GB 4O4EA 5EW8A 2BIYA 3B8QA 3GC7A 5GIOE 5DBXA 3Q4CA 4FZFB 5A6NA 1HCKA 4QMZA 4YTCA 4DCAA 3F3VA 3AKKA 3R30A 4FTLA 3R9NA 1ZY4A 5M08A 4ZTLA 4CV9A 5IQDA 2HXQA 5I9VA 2V55A 3G15A 3MJ2A 1M14A 4JIAA 4E1ZA 3ZRMA 2HY81 4ITIA 4RLLA 4BBMA 4DH5A 4EK5A 4Z3VA 4CKJA 4FBXA 4YJPA 2GQRA 3LW0A 4MXXA 1JOWB 3MVMA 4J97A 1BI7A 5IEVA 3D94A 4WNPA 4O7TA 5A9UA 3ZTXA 3GBZA 4UMUA 4BYJA 3EQPA 2XAMA 4MXZA 1REJA 4UXLA 4O27B 5J1VA 3U4UA 2FSOX 3A7HA 3E8NA 4Z9LA 3PJ2A 3QD3A 4KIPA 3U51A 5KKRB 3HLLA 1PXNA 4O0RA 3E63A 2R0IA 4F9YA 3BIZA 4AU8A 3DNEA 3WZJA 4WUNA 4RIWA 4Q2AA 5JQ8A 2R7IA 1XH4A 2ITUA 1BYGA 3OBGA 5HHWA 2E9UA 4J99A 4L00A 4OGRA 5DHJA 2YABA 2ONLC 4EK8A 4LRMA 1FBNA 1K2PA 3JPVA 4GRBA 3MSSA 1P5EA 3NAXA 3H9FA 1PF8A 4CKRA 5J7BA 1AD5A 3W2QA 1ND4A 2AC3A 4RVKA 5K0XA 3OY1A 3V5TA 3C50A 3KMWA 3LFFA 5AV3A 4RIOA 5J5SA 1OIUA 3CEKA 4BCMA 4CT1A 5JFWA 3DTWA 3CJGA 4GK3A 3SW7A 2XS0A 3O7LB 3NLBA 4KKHA 3RAIA 4BTJA 3I81A 4FKTA 2RFEA 1OB3A 2JAMA 3IW8A 2CKOA 1XKKA 5IH5A 2Q0NA 2A98A 3W0QA 3TG1A 5IQFA 3VW6A 2VTMA 3DA6A 5EYKA 2ZMCA 4OT5A 2W1GA 4O0SA 5FLFA 4GVJA 1YDTE 3KKVA 2H96A 2WQMA 2JKKA 4B7TA 3EN6A 3C1XA 2CLXA 3OCSA 5CU4A 5D9HA 5DT3A 4C02A 3M1SA 5TT7A 4RPVA 3ZU7A 2IZRA 3SG8A 2YIRA 4FL1A 4MUQA 2BZHB 2RGPA 1XQZA 4XG4A 3UBDA 1BL6A 3V8WA 3TI1A 2B9JA 3HV7A 2YISA 4MD9E 5IA5A 3PZHA 5FDPA 5AUZA 2HW7A 4DHFA 2VWXA 5JFSA 3P79A 4FV8A 3H9OA 4RC3A 3RNIA 3FL4A 1YOJA 4FVPA 4O82A 3VULA 1J1BA 3P1AA 3RK5A 4I5CA 3IGOA 2XZSA 1I09A 3QQKA 1Y8YA 3RCDA 3PE2A 3L1SA 3CLYA 2YWPA 4CD0A 3FXWA 4NKSA 3LXLA 2FSMX 4TXCA 3DLZA 2R3JA 2E9NA 4R1YA 3V6SA 1CKPA 5CU2A 3ORLA 4E26A 3AC2A 5LMKA 4RJ3A 4U7ZA 1LUFA 4GJ2A 5E91A 4AE9A 3OP5A 4BZOA 4RBLA 3OVVA 2A27A 4IMYA 4RFYA 5D1JA 3KXMA 4I0RA 5B7VA 3BQRA 4NK9A 1OZ1A 2R3RA 4E6QA 3UNZA 4HYUA 4JDKA 4PQNA 5CSHA 4B0GA 3DBCA 1NVQA 3CPCA 4UB7A 2WTCA 2WZJA 2NRYA 3HRCA 3EH9A 3HV3A 3U4WA 4RRVA 5AR4A 2C6LA 2IEWA 4R7HA 4AOJA 3VNTA 3G2FA 2G2FA 4NM5A 3VAPA 5K5XA 3HZTA 1H27A 3LQ8A 1PYXA 3BELA 2Y4IC 2WKMA 3EL7A 5HE0A 3COIA 1Q8YA 4QTDA 5CZHA 3SXFA 4HGLA 1RE8A 2DQ7X 4IVDA 2O63A 3U55A 2GNLA 2UW6A 2XK7A 3F6XA 4BI1A 2BPMA 2CSNA 3AT4A 4BCQA 4TKSA 4G5PA 1A06A 3D0EA 4M69B 1MUOA 3SQQA 4NW5A 5FP5A 4K33A 4Y46A 4QMNA 4MX9A 3COKA 4LDTA 4I6QA 1XH6A 4AP7A 2PYWA 4O7VA 1PHKA 5LVNA 2OJ9A 4IACA 4MHAA 5AM6A 3KCFA 3MBLA 4LOPA 2IPXA 3KRJA 3SXSA 3QRUA 5C8MA 3ACJA 3KL8A 2FB8A 4NYEA 3C4XA 4W4YA 2R3IA 5EHLA 3ZFXA 4XP2A 1Q8UA 4H1MA 2VTRA 5B2KA 2CCIA 4QYHA 4HVGA 4R5YA 2XK8A 5KNJA 5AUYA 3E88A 3G0FA 3PWDA 4NM3A 4DEHA 3DBFA 3S00A 4I6FA 4BZDA 3NDMA 4BWXA 4JG8A 5IA2A 2BTSA 5E8UA 4QP2A 1ZOHA 4ZSAA 4LUEA 1YXVA 3BL9A 4YJOA 3ZLWA 4FSRA 3PP1A 3KXHA 4A9UA 4CV8A 4XLVA 3AD4A 1J91A 1WBTA 1Z9XA 2QOHA 4IWPA 3VS0A 5IUHA 2R3QA 2OU7A 3BU6A 4IB3A 5GHVA 4O96A 1FPUA 3F2NA 4WSQA 3IKAA 3NNXA 3R1QA 5CQWA 4FMQA 2F57A 3PVWA 4JJRA 3ZLSA 5AUXA 1OPJA 4L01A 5FEEA 4ZAUA 4RVTA 3AC1A 4BIBA 5HCXA 2OICA 2W1IA 1Y6AA 3RZFA 4GT5A 4U0IA 3SLSA 3WF8A 4ASXA 3VVHA 3DKOA 1CMKE 2ITOA 5AUTA 3RAKA 1P4FA 4C62A 4PDYA 3DK3A 4BVUA 4R5SA 2J0LA 2XB7A 2YIWA 4F09A 2X0OA 2EB3A 3ZS5A 4IQ6A 3TV4A 2B4SB 4O0XA 4V04A 3HA6A 2B7AA 4AG8A 5BYYA 2YM6A 4M97A 1Q97A 1OUYA 3Q9YA 4JG6A 3ZCLA 3CKXA 4MWHA 4YNEA 2CGVA 3HMMA 1WBOA 3C4WA 3OUNB 1T46A 1ZOEA 2OJJA 4M7IA 2GFSA 2BRGA 4O1OA 3ZRKA 4A06A 4WT6A 5K3YA 3LFNA 3RCJA 3A7JA 5GINE 5IMXA 2XNEA 3OCTA 3VJNA 4TWOA 4QNAA 3QBNA 5FXRA 4ZY6A 2BZIB 3VBTA 1KV1A 3LJ0A 3DJ6A 4RZWA 3NW7A 5GJDA 3LM0A 1OL1A 3RJCA 3Q9WA 5BUJA 1YHVA 3UDZA 3ZUTA 4FNXA 3QRIA 1X8BA 3R63A 3U87A 2ITXA 5M4UA 4BTMA 3GB2A 3KY2A 4YZMA 5KMLA 3DU8A 2UW8A 4FT7A 3L9LA 3NIEA 4O0WA 5D10A 3UE4A 4IAAA 3UPXA 5HEZA 3R9OA 3DFCB 4W8DA 1FGKA 2R3MA 3C7QA 4FRFA 1UA2A 2C5NA 2PY3A 3TEIA 3F5PA 4FIJA 4CLIA 5HTBA 2GPHA 2WTKB 3PSCA 3KRRA 5CASA 4EH2A 4KSPA 2WMSA 4QO9A 2QHMA 4PF4A 4FZ6A 4JRVA 4DHIB 3GUBA 3OCBA 3FXXA 4Y5QA 3BU3A 5CF6A 2A2AA 3PIXA 5JFXA 2X0GA 4MNEA 2BR1A 2I1MA 2X9EA 4G3DA 1Q3WA 1PKDA 2PE0A 4IZ7A 4EZ3A 3DAJA 3PXZA 4FIFA 5H8EA 4FVQA 5CNOA 3R7IA 4AXCA 4FSTA 5JGDA 4NTTA 4C38A 3QCQA 3QWJA 5EM5A 5IKWA 5BQ0A 3S1HA 4OLIA 2ZMDA 2VO0A 3DAEA 4JQ8A 4NIFB 2EXCX 3DNDA 2DUVA 3IONA 3LE6A 5TOZA 4XV9A 2VNWA 3BGZA 4D28A 3V5WA 4FT5A 4J98A 5F1ZA 1QMZA 4LQMA 2IZUA 2OJFE 3FZ1A 5L2QA 5CSWA 3DY7A 3TDVA 2OWBA 4DEGA 2C3JA 4L52A 4O2ZA 5ETIA 2ZDUA 2JKOA 3MVHA 5EH0A 4W4VA 5EW9A 2WD1A 3C5UA 3ZRLA 4TYEA 3BLRA 4USFA 2PE1A 4GT4A 2YN8A 3AQVA 3MH3A 1GIJA 5T68A 4BKJA 2XRWA 4YC8A 1WZYA 1JSTA 1STCE 2ETMA 3R9HA 4AE6A 3IECA 5CTPA 4CMOA 4DGMA 4BDKA 3R9RA 2XBAA 4PPCA 2OFVA 5CT0A 4APCA 4RX5A 3THBA 2J5FA 4EJ7A 4I22A 4WNOA 3VONA 3W8LA 5M4CA 4DE4A 3H4JA 4QQJA 5B2LA 3FZOA 1ST4A 4IEBA 3RPOA 4DT8A 3KULB 5ETFA 4AA0A 2VTPA 4FNWA 4CLJA 3QCYA 3NYOA 3D2KA 4L3PA 3EL8A 3FMHA 3SVVA 4TZRA 5M53A 2OO8X 3M2WA 1E1VA 2HYYA 5HTCA 5AIKA 5B2MA 2YIQA 1BX6A 2GCDA 5CEKA 5CEMA 4AS0A 1ERKA 3KFAA 5CAUA 3ORTA 4O4CA 4LGDA 1M7NA 3R22A 4W4XA 1IG1A 4AZFA 2OLCA 2YM8A 4QMXA 4YPDA 1ZMWA 2GQSA 3ZHPC 3FKLA 3CC6A 4QMVA 5IH6A 3E87A 4IC8A 4QYEA 3RWPA 2VAGA 5LWMA 2XYNA 3PTGA 4YJNA 2B55A 4TTHB 3WZEA 3P5KA 4RC2A 3NEWA 4FG7A 4KIQA 2PSQA 2HK5A 3G90X 1B38A 1YXXA 3IOKA 3OT3A 2BHHA 1R0PA 2PVRA 4I4FA 4F9CA 5HD4A 3BU5A 4XH6A 3V5JA 2WU6A 1W84A 4AW2A 5IA1A 5KHXA 3IW7A 3AGLA 3F5XA 3R1YA 3EFWA 2PHKA 4XBRA 1PMUA 3ORMA 4BKZA 4ZS4A 4E6CA 5AV0A 4FSUA 2GNFA 3GU8A 3E3PA 1H1WA 4YJUA 3AKJA 4G17A 4X0MA 3VS3A 5LMAA 4U81A 3TL8A 3FC1X 1TFFA 4LV5A 3EQGA 4LOOA 5ANJA 4YTFA 4MTAA 3JS2A 3MPMA 4EC9A 4RG0A 4HJOA 4QMUA 4R7IA 3ET7A 5L8JA 4OBOA 3Q52A 4UMRA 4I92A 2W0JA 3CTJA 5FTGA 4OTWA 1H1QA 4RVLA 1W82A 4RT7A 5ETAA 2O65A 3R2BA 3O8TA 4D1ZA 1ZARA 1CTPE 3UMXA 1DI8A 1NVRA 2PK9A 1CDKA 1Q61A 3VBXA 2VWZA 4FG9A 3VHEA 2UVZA 2Z60A 5J87A 2XRUA 4O1PA 4RSSA 4C35A 1ZYDA 2OFUA 2W06A 1OECA 4RIXB 3NVMB 5AAGA 5E7RA 4BIEA 3CR0A 4P90A 5EDRA 3ZM4A 4FE2A 4D2PA 3EQBA 5EM8A 2Y4PA 2W1DA 3F69A 3HV4A 3Q9ZA 4NCTC 4EL9A 3QTUA 2I6LA 5IUGA 2QOKA 2F7EE 1GIIA 1IR3A 3NYXA 3GCVA 2YLFA 4A4LA 2P4IA 1TVOA 3GU4A 4DG2E 2XJ2A 2ZJWA 4AT5A 4FTTA 3VC4A 4TL0A 4ZZMA 5AP6A 4ZZNA 4PTGA 3JY0A 2Q83A 3CS9A 1OL2A 2GHGA 5CX9A 1VYZA 3BLAA 5LXMA 2GNJA 2VV9A 4QP1A 2CLQA 5KO1A 1W2CA 4N70A 4D2SA 3HNGA 3QXOA 5DPVA 5HCYA 3UYTA 4QPSA 5A4EA 5IDPA 2DYLA 1GZ8A 2VGOA 4FKPA 4GU6A 4EHZA 4FTIA 2Z7RA 2ZDTA 4MBLA 4M12A 4AGCA 4ASDA 3MFSA 4Y85A 3QYZA 4L7SA 4DH1A 5EQYA 4UWYA 4JDIA 4USDA 3WYYA 1IRKA 4IJ9A 2AEGA 4CVAA 2B9FA 2I0HA 3MTFA 4DG0E 4FTMA 2BRHA 2W7XA 2J4ZA 1BKXA 4XG6A 4HGSA 3DKGA 4XMOA 4W9WA 4DITA 1YXSA 1YRPA 3OWLA 2UZNA 3O50A 5AA9A 5M51A 1IA8A 3IW6A 4ALWA 1TZDA 3N9XA 4X2FA 4FEXA 4L53A 1M2PA 4DN5A 5F9EA 4C3PA 1G8AA 1H26A 2J5EA 3MGYA 4V05A 4YZDA 3P7AA 3A60A 4U5JA 1PYEA 5DOSA 5HQ0A 3OEZA 4Q5HA 5GJGA 3V5LA 5HX8A 4XG9A 2YDIA 4ZLOA 2IVTA 2XK9A 3EQRA 3MDYA 5HE2A 5FGKA 1W2FA 4QP6A 3PXYA 4GFOA 3TT0A 2J51A 3D15A 2B53A 4JX3A 5AA8A 4QYYA 4FJVA 2JIUA 4ITHA 4OTFA 2CN5A 3K5VA 5JGBA 3L8PA 4GIHA 3FLYA 3DTCA 5CF4A 3VRYA 5GZ8A 4FG8A 3PE1A 4FV2A 4F1OA 5CSVA 3COHA 3POOA 2ERZE 3V51A 4LYNA 4MF0A 5I9WA 4MBJA 4EH8A 5DVRA 2XMYA 4M84A 1W83A 4AF3A 5CS6A 3EKNA 4BCNA 3G5DA 1APME 1YQJA 5E8SA 2EWAA 4BDHA 5KE0A 3BE9A 4O91A 5JSMA 4RIYB 5IQHA 4OTQA 4DGLC 2YLEA 4ZSJA 4BFMA 3C4EA 4C61A 1PJKA 3R21A 4C7TA 5LVMA 1PXIA 4O7NA 1HCLA 3TDWA 4E5AX 4XHKB 3RWQA 1O6KA 4BBEA 2PVKA 5IA0A 5E8WA 3KQ7A 3NW6A 4RIYA 4TYHA 5LVLA 2ZM3A 2QD9A 2XCHA 4JX7A 5KX8A 4EWQA 4ZS0A 5DIAA 4JI9A 5HI2A 3PPKA 5E8YA 4G2FA 3BCEA 1YWNA 4AXAA 2ITVA