4XNEA

Crystal structure of erk2 in complex with an inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
346
structure length
344
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Combining `dry' co-crystallization and in situ diffraction to facilitate ligand screening by X-ray crystallography.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 107
structure length 344
sequence length 346
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xneA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xneA01
5KMLA 4U40A 3PFQA 2NNWB 2BDFA 3LCSA 5IQFA 4AZSA 4O7SA 4B8MA 2PVRA 3F5PA 1SVHA 4M97A 4ALUA 2R0UA 5E90A 3SA0A 3UO6A 4LI5A 4DTKA 5L6OA 2XNEA 1DS5A 5FUTA 4M3QA 3KRWA 3QUPA 4DFLA 2FGIA 4EZ5A 2C3IB 5J7HA 3FZSA 4I94A 5H8GA 3RNYA 4EH9A 5KBQA 2XBJA 4DTBA 3IK3A 4QMLA 4X21A 5EDQA 2UZDA 4HW7A 1JAMA 2X7OA 4BCFA 4UMPA 5ITAA 2RFEA 3FXXA 2W1IA 4YZBA 5EHOA 5HG9A 3TZMA 3R83A 4ZXTA 3JR1A 4MYGA 3KY2A 2J0JA 1GIHA 3IDPA 4R7HA 4E1ZA 2VO3A 5BVEA 5T68A 5ANDA 2GQSA 4CFFA 5J79A 2YWPA 5EM8A 3VF9A 2OJJA 3WIGA 5HQ0A 4R7BA 3M42A 3G5DA 3QKKA 4M13A 4OTQA 4RWIA 3UC3A 2XUUA 5AUUA 4U45A 4DGLC 3AGLA 5CAVA 5TF9A 3KK9A 3MI9A 3MV5A 3WE4A 4ERWA 3TTJA 3NUXA 5IEYA 1BLXA 4D2VA 2HK5A 2IN6A 3TNWA 4HYHA 4EK6A 4WO5A 3EQGA 1FPUA 3TT0A 4EHEA 3AD5A 4AZTA 4JR3A 5DT3A 2GCDA 3HMMA 2Q0NA 3QQKA 1YWRA 5AUZA 2PWLA 3QC9A 1H00A 3NVKI 1H1RA 3E64A 5BVOA 4HNFA 3WF8A 1TVOA 2W1CA 4YR8A 4RVTA 2W96B 2HZ0A 3I5NA 3PJ2A 2XZSA 1Q8YA 4E3CA 4M69A 4O22A 2UZVA 4AGCA 2VTJA 4V0GA 3PY1A 3EOCA 4HYIA 2RGPA 2XKFA 4IDVA 3FQSA 4O0RA 5J1VA 5AA8A 2RG6A 3TKUA 4GSBA 3LFDA 1Q62A 4XLIA 2QURA 3QX4A 1YI3A 4E6QA 4QMMA 4MK0A 4DLIA 4CV9A 3RM6A 2OFVA 3ODZX 4E6DA 3F5XA 1H28A 3LFCA 4G5PA 3VS4A 2UZBA 3GOKA 5D12A 4YSJA 3GCPA 4PDYA 3WZEA 2QOBA 5JQ5A 5BYLA 1CMKE 1H24A 5L6PA 3OOMA 5K4JA 1F3MC 4O38A 2QNJA 2PVFA 3E87A 2XIRA 1ATPE 3C1XA 5A6OA 3SW7A 3COKA 1Y6AA 1YW2A 3QYZA 3MH2A 1W98A 3UIXA 4K2RA 4O1PA 3PVBA 5E7RA 4I0RA 5EM7A 3VRYA 4F0IA 3LQ5A 4NKAA 4U80A 2GDOA 4FIEA 3VS3A 4Y95A 4DG2E 3RZBA 5AAEA 5KX8A 2C1AA 4LGDA 5G1XA 5IDNA 5EW9A 4XG3A 3A7FA 4MKCA 1XO2B 2HWPA 3FZOA 4J53A 4E5BA 3FLSA 2YAAA 5CSHA 2BAJA 3ALNA 5DHJA 1Q61A 4DBXA 4ZLOA 3P0MA 4YTCA 5EYCA 4TXCA 2IWIA 3OEZA 1JNKA 3CTJA 3R9DA 4WOVA 4B8LA 3IW7A 2ETKA 3QRUA 3UE4A 3FV8A 3UC4A 1PMNA 5AV1A 1JKLA 1OIQA 4G17A 4FKJA 4Y8DA 1G3NA 3NUUA 2PMIA 3WF5A 4YJOA 3ZO1A 3Q5ZA 2I1MA 2C68A 3CEKA 4FKUA 4O86A 5E91A 1PXPA 5EM6A 4G5JA 3DK7A 5JH6A 4HJOA 4DH3A 3PZHA 3MDYA 1RDQE 2VO0A 5JRQA 4II5A 2ERZE 4ZIMA 3O71A 4V05A 4QOXA 5CEOA 1H0VA 4L8MA 3U6JA 4DLJA 2V62A 2YLEA 3QKMA 2E9UA 4U43A 4A9RA 3R8PA 5A4CA 5DPVA 2GHMA 4QMSA 4BDKA 2WTCA 2Y8OA 4FTJA 4IZAA 4QYYA 4HZSA 4QMPA 4YP8A 4E73A 4I93A 5CEQA 3PG1A 3P9JA 4NL0A 5JGAA 2I0YA 2PVYA 2GS2A 5LXMA 3ZDIA 2XP2A 3MSSA 4BWXA 4FOCA 4NM0A 4JAJA 5DFPA 2QG7A 4I1ZA 2I6LA 5ETAA 5HEZA 3RPVA 3G90X 1GOLA 3EN7A 4RX9A 2A1AB 3ANQA 4CV8A 1JBPE 5JGDA 4YHFA 3PUPA 1JPAA 2V55A 4PL3A 5CI6A 5CF6A 4F9BA 4EOLA 5I5ZA 2NPQA 4D9TA 4L46A 3KB7A 3MVLA 2Z60A 4C3RA 2XRUA 5LWMA 5HI2A 3E92A 3GC0A 5CU4A 4WNPA 4ZSJA 4AT4A 3WF9A 2R2PA 1IRKA 5EW8A 3KXHA 5FD2A 3UO5A 5ETCA 3C4CA 5BX0A 1YXUA 2XKEA 2VTLA 3PRFA 4GCJA 4GIHA 3LIJA 2JEDA 3FMHA 4IB3A 4J8MA 4R8QA 5E8VA 1YXVA 1S9JA 3ENHA 3NW5A 1Q8WA 4FKWA 3P79A 4KIQA 4XG7A 3AMYA 3ZHPC 3HYHA 3I6UA 3R73A 1UWJA 3O17A 4ZY5A 4FKGA 4UV0A 1UNLA 4FA2A 3IW8A 2PUNA 2HZNA 2OFUA 3BU5A 4MXOA 4R3RA 4AFEA 4O0UA 4U79A 5IA5A 3VS1A 3P78A 3KXZA 3AMBA 3KF4A 3S95A 4XG2A 4ZSEA 3SD0A 5ETFA 2PUPA 5M09A 2R64A 2C6DA 3HA6A 1H8FA 4FG8A 2UZEA 4FIJA 5HX8A 4QTDA 2XEYA 3IW4A 3P1AA 3O50A 3ZM9A 4CTBA 4EH4A 1V0PA 2WTKB 3ZCLA 4ZY6A 5M08A 2YAKA 3TV6A 2X0GA 3IW5A 4KSPA 3UVPA 3ORKA 5M51A 4EBVA 3A8XA 3P86A 3A62A 4ZZOA 3O8UA 4LL5A 3POOA 3ZC6A 3S0OA 2C3KA 2AUHA 4D55A 3KA0A 4FT5A 4UMRA 3MPAA 4BDHA 3SV0A 4AW5A 3IGOA 4NIFB 1JOWB 4CFNA 5AAFA 3D5XA 5AAGA 2EB2A 4X7QA 5AP4A 4E20A 2BAQA 3VW8A 4EORA 4D5HA 1MP8A 3QQJA 4CZUA 2I0VA 1DAWA 2XK6A 3GT8A 3OMVA 2WPAA 2BMCA 3IONA 2YERA 4HCUA 3WBLA 3B2WA 3FI3A 2B1PA 2W7XA 3G6GA 4AGDA 4CLJA 5AR4A 3OROA 2YN8A 1PKGA 5IKWA 1R0EA 4D9UA 4DC2A 4BF2A 2PVKA 4M67A 5ANJA 2X4ZA 1WBSA 2RG5A 3IW6A 3LQ3A 2O5KA 2DYLA 3GFEA 1XH5A 4RWKA 5CXZA 3IDCA 2O3PA 1ZLTA 3TCPA 4CRLA 2PSQA 4GK2A 2UUEA 4RC3A 4FVPA 3OEFX 4L7FA 1G5SA 3KULB 5TKDA 3ALOA 3QRTA 3DBCA 4S31A 3OXTA 5AP6A 3WZDA 1P2AA 4C2VA 2XM9A 5CNOA 3KKVA 2J0KA 5AV2A 3BYUA 5CAQA 4JLCA 2CCHA 3BWJA 2XYNA 4W4WA 3KMUA 2CKQA 2WOTA 3QTZA 3A99A 3E8EA 3KQ7A 2G2FA 3NSZA 3LZBA 3RCJA 4I6HA 4JG6A 4MNEA 2VTPA 3DKGA 2ZMCA 4FZDB 3HAVA 5BVNA 4ID7A 5HICA 4FC0A 4FZAB 5HNIX 3UYTA 3RAIA 3ZFXA 3W2OA 3ZBXA 1KWPA 4F0FA 4MD7E 4C4JA 4W4VA 4ASDA 3EFKA 4FTKA 3W16A 5J7BA 1TQIA 3EFWA 3GCUA 2IVSA 2X4FA 3TN8A 5B7VA 4P90A 1QL6A 1O6YA 4ITJA 3D4QA 5HG7A 3RM7A 3VBVA 2B0QA 4JIKA 3K3JA 4UZDA 1RQQA 2R5TA 3KF7A 2WELA 4BDJA 4RZWA 3WYYA 2CNUA 3OCTA 1YDSE 4CFVA 4QNYA 3RHKA 4PY1A 1YQJA 2F49A 5AP2A 5IEXA 3RALA 4TKSA 4U7ZA 5I9YA 4EOIA 3R1NA 5GZ8A 3TI1A 4UYNA 3GC7A 4H3QA 1H0WA 4RG0A 4GT3A 3BLHA 4FVRA 3VUHA 2WEVA 1OL2A 4JL9A 1APME 4YZCA 5HO6A 5HE1A 4BTFA 4XYFA 5DBXA 4PV0A 4AN9A 3PJ8A 5HG8A 5BVDA 2J9MA 4OTFA 4FSRA 5IUHA 1YHVA 4FEXA 3BQRA 4UYAA 3HDMA 4HPUE 1E1VA 4N6ZA 3WF6A 4AX8A 3BKBA 4EOSA 2X2KA 2CKEA 4XS2A 5IH6A 3QTWA 2RFDA 4TTHB 3Q9XA 2ACXA 4D4RA 2A4LA 4ZS4A 1YDRE 5DRBA 2R3KA 4X3FB 4FBXA 2I0HA 3OUKA 4IHPA 5LMKC 3VJOA 4WBOA 4F7SA 5FM3A 3ZFYA 1O9UA 3LXLA 4UALA 4FTUA 4TW9A 1LEZA 3CPBA 4APPA 2PMNX 4AA0A 3KN6A 4RFYA 3TG1A 4EHGA 3LLAA 5K0XA 5AR2A 4GYGA 4MCVA 3MFSA 3QUEA 3MJ2A 4EK5A 3CJFA 2JIUA 3NNXA 4J1RA 5B2LA 2GTNA 4AAAA 5EKNA 4LUEA 3D9VA 5KUPA 3UGCA 4J99A 4AWIA 4XLVA 3ZLWA 4CMUA 2REIA 2QODA 2QONA 4FV2A 3L8XA 4FKQA 4AZFA 2YM8A 4R1VA 4C3PA 4YU2A 2OJGA 4O7NA 2NRUA 3BU3A 3LW0A 4LOPA 4RIYA 4GEOA 3EL7A 4OT6A 3EN5A 5FQDC 4FV5A 5CX9A 4QMYA 4O7LA 5DR6A 4P5QA 4RZVA 4YTFA 3Q52A 2GTMA 2WMQA 4NTTA 4Y72A 5BVFA 3VUGA 3FZPA 3EH9A 5CLPA 5I3OA 3L8PA 3C7QA 3FC1X 4GK4A 4M84A 5K0KA 3F3WA 2UW7A 2WXVA 3PTGA 4GJ2A 4S33A 5KO1A 3SLSA 5E1SA 4KBAA 3F3ZA 3FMJA 3LXKA 3OF0A 3BEAA 3PA4A 4KNBA 3FHRA 3R6XA 3OW4A 4IADA 4C4FA 5CASA 4GUEA 2GNLA 3LM0A 3PYYA 3HKOA 3K5VA 4TYHA 3V04A 4XG4A 5HIBA 3DU8A 4UMQA 2OH0E 2VV9A 2XK3A 4WUAA 3MB6A 4M66A 4QP7A 4QTBA 4FNWA 3ZLYA 3LAUA 5CF5A 5EOBA 3IPHA 3P7CA 1NXKA 4USDA 3ZDUA 5LARA 4XBUA 3R1YA 4JG7A 3U4UA 5FWKK 2Y7JA 3FWQA 3FSKA 5IEVA 3H0ZA 3TNQB 4RWLA 4B4LA 2A27A 4R3CA 2EXMA 5LWNA 5TE0A 4A7CA 2QO9A 1YOMA 3KVXA 2JFLA 2UZTA 2X9FA 3CQEA 3KGAA 3FLYA 4O0WA 5L8LA 3IKAA 4IM0A 3OOGA 4CCBA 4F1MA 4BDEA 1PMVA 4ERKA 2W4JA 1WBVA 2PTKA 2QOFA 4ZZNA 3QLGA 4R5YA 4RJ6A 3E8NA 3LCOA 3NWWA 5J5SA 5AA9A 2UW8A 3RK5A 3QD0A 4Q5HA 5DEYA 5IZFA 1Q5KA 2UZWE 1OPKA 4RLLA 5AMNA 4DFUA 2QCSA 4FNXA 4CEGA 3U54A 4BDIA 3R30A 5EG3A 5AR8A 5DMZA 2F2CB 3ZLXA 4AZVA 3HL7A 2WQBA 4HNIA 4CXAA 3UG1A 5CAOA 1H08A 5I9ZA 3AD4A 3KRLA 2PK9A 3OBGA 4CSVA 2C4GA 1OUKA 2X6DA 4JBPA 2J90A 4BCOA 1IR3A 3Q4UA 4IBMA 2VX1A 4U44A 4GUBA 3R7YA 5KKRB 2BDWA 1TKIA 4D4YA 2JKQA 2YIXA 4IZ7A 2EU9A 2PZ5A 3NIZA 5HVKA 3PLAE 4WG3A 1MQ4A 3ZRKA 3SG8A 2Q0BA 2R7IA 5A6NA 2BVAA 1M14A 3DBQA 1WBTA 4Q5EA 5DNRA 3R8ZA 3ZYAA 2VTOA 2YZAA 4FV1A 2HYYA 2ZOQA 1WBOA 4DGMA 5M57A 2JDOA 4WG5A 5HVJA 2OZAB 4FICA 3GU6A 4O21A 2W4KA 2XJ0A 1ZMVA 3OUNB 4WT6A 3MW1A 4ORKA 3L9LA 2G01A 3F2AA 4FTQA 4QNAA 2QI8A 3DJ5A 3GCQA 2WNTA 4M68A 1PXMA 3EFJA 4I3ZA 3VBXA 4FOBA 1WFCA 4DH1A 3W2SA 3BZ3A 4EZ3A 1OPJA 1PJKA 5T6KA 2CGUA 3EQRA 4FG7A 3N51A 4BI1A 4D2TA 2PMLX 3B2TA 1JVPP 3MIAA 4JBOA 1H07A 2ZMDA 2JDTA 4GFOA 1VZOA 4D0WA 1T45A 4K6ZA 4DH5A 5L8KA 1X8BA 4NWMA 4UBAA 1U59A 4DAWA 3LE6A 5FXRA 2P2IA 2XK9A 1URCA 5DI1A 3NZ0A 5C26A 3HV5A 4I5MA 2GPHA 3C13A 3AXWA 3PIYA 3BBWA 5J1WA 3PE1A 4QTCA 4FG9A 4D0XA 4RFZA 5CSPA 3BYSA 5AFVA 4BIEA 1REKA 2HY81 4RLKA 1BL6A 4BDCA 3CTHA 4IB0A 5CEIA 3MESA 1OIUA 3FKOA 3O7LB 4C35A 5J9ZA 5IUIA 3Q9WA 3ZUUA 5A4EA 3OG7A 1UVRA 2V22A 1U54B 5DT4A 4C61A 3G6HA 1MQBA 2CPKE 4GMYA 4R5SA 4F0GA 4AOIA 4G3FA 5CSVA 5AP0A 5AP1A 3OWKA 4CNHA 5BPYA 5DE2A 2X2MA 5K3YA 3U9CA 4ANSA 5A3XA 4RRVA 4O6LA 5HTCA 1H1PA 3P4KA 3QBNA 4AACA 4PL4A 2C6LA 4R1YA 4WUNA 4N4SA 4ZTHA 3ZZWA 4AZEA 4GFGA 2RIOA 4EH8A 4YJSA 4JBVA 3NVMB 4BB4A 4AN2A 2WMVA 3PE2A 3GFWA 1B38A 5C1QB 2OBJA 4WSQA 3V01A 2XS0A 4C3FA 3RINA 5L2IA 3NUAA 5LJJA 3CSVA 4C02A 4BKJA 5KMMA 2GNFA 4JNWA 4OTGA 4ZTSA 3R7IA 4IWPA 3TTIA 2P55A 5H9BA 4AA5A 4EOQA 1DAYA 1G8AA 5TR6A 4TRLA 3D0EA 3QCQA 5KMNA 4RC2A 1XH8A 2JFMA 1Q97A 5M06A 4RA5A 3KMMA 4L3LA 4A4XA 2OF4A 1FMOE 4XCUA 4EEVA 4NCTC 5L6WL 3FE3A 4FF8A 2ITVA 3FYKX 3HRBA 2H6DA 4TWOA 2OIBA 3DA6A 5M4FA 4QRCA 3ZO3A 3NUSA 1OVEA 4QTAA 3Q6UA 4GU6A 3SDJA 3W18A 4NW5A 4MF1A 4I92A 4L3JA 4HOKA 4N0SA 1YI4A 4YSMA 3ZM4A 2AYPA 3MVMA 2XB7A 2OWBA 4D2PA 3R1QA 3VUTA 1YWVA 4GT4A 3VQHA 4F70A 4FV3A 4FSNA 5I9VA 4PPBA 1EH4A 5ACKA 3UJGA 4HVGA 3HV4A 5DYJA 1E9HA 4DGGA 3FZRA 3FKLA 3MVJA 4I23A 5DVRA 4FEVA 5EM5A 2YIWA 3GQIA 3R9NA 2J6MA 3PXZA 5GZ9A 5HLWA 5AUVA 2WTDA 4R78A 2UZNA 2C6TA 2J7TA 2WB8A 3IO7A 4BR3A 2LGCA 3EZRA 3Q4CA 3PSCA 2BKZA 3QTQA 4HCVA 4FSYA 2UW5A 1ZOGA 4Y85A 3PJ1A 4JRNA 5AJQA 4I5CA 4XP0A 4YJRA 3BCEA 4ZMFA 2X39A 3Q32A 4FNZA 1XH9A 3FMMA 1YRPA 2QOLA 5GJFA 1O6LA 2WFYA 4XX9A 4ACDA 3LFQA 4MD9E 5ICPA 2R3IA 5J9YA 3F5UA 3FMLA 1ZOHA 3NYNA 3QGYA 3RAHA 2QR8A 2EXEA 2J5EA 1Y8YA 2OIQA 2ZDTA 3UO4A 4EWHA 2C0IA 4FODA 3HV6A 4QP6A 2X7FA 4EK3A 3F82A 3F9NA 3BLQA 4EJ7A 1PXOA 3VW6A 2I0EA 3CGOA 1XQZA 3K5UA 3D14A 4AS0A 4U3YA 1Q99A 3F66A 2WIHA 3FSFA 3OTVA 4ZTNA 1OZ1A 5JGBA 1XBAA 3PVUA 5E8YA 3ODYX 5E4HA 2C1BA 4H36A 2CLXA 2FSTX 3A4PA 3MPMA 4GU9A 1YHSA 5BUJA 5CEMA 1REJA 2V0DA 4WKQA 2EVAA 3EB0A 5CYIA 3Q5IA 3SX9A 4BGQA 3ENMA 2HELA 4DFYA 4G2FA 1Y8GA 1YI6A 4YZDA 2CKPA 4FSZA 3LXNA 4OAUC 5EDRA 1WMKA 3QQLA 2OW3A 4LFIA 1ZAOA 4EK4A 4BTJA 3BPRA 3FJQE 4RIWA 3NS9A 2J4ZA 4XV2A 1M2PA 1JKSA 1KE8A 3HV7A 2QOIA 4FT3A 4OBQA 3ZSGA 2R0IA 4BCNA 4QPSA 3ZLSA 3ELJA 1VYZA 4CKJA 3N9XA 3Q3BA 3FMNA 4IAIA 4A9TA 1BUHA 1KE7A 1A9UA 4CFUA 4I24A 2B53A 2HW6A 4ZP5A 2OJ9A 2O63A 2QHNA 4X2FA 4M0YA 5DGZA 1B6CB 2GHLA 2FO0A 4K18A 4O2ZA 5D1JA 3SC1A 2QKRA 3V3VA 2ETMA 2F4JA 4AA4A 3C0HA 4PMSA 4Q2AA 3ZRLA 3E3BX 4IVDA 3REPA 3VC4A 4BBMA 3Q2JA 3H9RA 4I5PA 5JFWA 4Y5QA 2KULA 5EFQA 5CF4A 4QMVA 3UZTA 3ORPA 4HCTA 3LFNA 3BQCA 3FY0A 4FSQA 5EKOA 4F64A 3BHYA 5HZNA 3TZ9A 3CPCA 4DA5A 4U6RA 4RVLA 5L2SA 5IA4A 2XNOA 5E8XA 4APCA 1PW2A 1Q8ZA 1YWNA 4KWPA 5JFVA 2W9FB 4MQ2A 2IW6A 5GIPE 3PWYA 4PPCA 3TACA 4PDOA 4JVGA 1L8TA 3E8CA 4L68A 2WTVA 5DWRA 2OKRA 4KIKB 2FSLX 1UNHA 1NA7A 3D7TA 3I79A 4AG8A 3MH3A 3U6HA 2BAKA 3HV3A 3EQCA 2G2HA 1BMKA 5DOSA 3UMWA 4PQNA 3TNIA 4USFA 1PKDA 4ZSGA 4U8ZA 4YTHA 4IX5A 1AD5A 2YCRA 5DN3A 2R3FA 4DCEA 2ZJWA 2VNYA 3BYMA 3UIBA 3VS5A 2A2AA 1CDKA 2R3RA 4GT5A 4CYJA 4D1ZA 1HCKA 2JIVA 3MFRA 1BYGA 2GS7A 3QRKA 5M44A 2HCKA 4X2JA 4I41A 5J8IA 4TYIA 3QD4A 4FK3A 3L9NA 4IW0A 5KMJA 2YM3A 3HGKA 1UU7A 4GG5A 3TEIA 4FTLA 4PMPA 5CY3A 1STCE 3W2PA 1UKHA 5L2TA 3FBVA 4IEBA 5IQIA 1J7UA 3PIXA 4FV8A 3UODA 1BI8A 3TJDA 1LPUA 3WZKA 4X0MA 2QOOA 3OT3A 2BIKB 2WMXA 4FSWA 2ONLC 4O7WA 2C6KA 4GV1A 2XIXA 3ORNA 3DDPA 3QZFA 4O83A 4BCQA 4UMTA 3R7UA 4U5JA 4ZTRA 3Q96A 3F7WA 3R9OA 5JN2A 1M2QA 3R63A 1OKYA 3BU6A 4RPVA 5KCVA 2WHBA 3O7LD 4EQMA 5LVLA 4F6UA 4B99A 5BUEA 3BIZA 5I4NA 3BELA 5E9EA 3PVWA 3LPBA 3NNWA 3QFVA 2F57A 2Z7QA 4RBLA 4ZJJA 3I0QA 4L7SA 4ALVA 4R77A 4DEAA 1JQHA 4EQUA 4QYEA 2ITWA 2KTYA 1T46A 3TXOA 4YC3A 4B7TA 5E8TA 3T9IA 2J0MB 2WTKC 3SRVB 4WA9A 1PRYA 4YZMA 3R22A 4FT0A 5HD4A 3KMWA 2EB3A 2XEZA 4MVFA 3ULIA 4G6LA 3CR0A 2ZV9A 1KOBA 4Z7GA 3EYGA 4D5KA 4ASZA 5AADA 4R7IA 3MY5A 4O27B 3UQCA 1HOWA 1OL5A 1H25A 3CY3A 5TT7A 3UQGA 4YBJA 2IZUA 5CVHA 4O7YA 5DR9A 5EI2A 2GNGA 3GCSA 2P2HA 3E62A 5EHYA 3FYJX 4AN3A 2VO7A 3DB6A 4AXAA 2X6EA 2ITNA 4C2WA 2WO6A 5HCXA 3Q2MA 3OWJA 5K9IA 5IA1A 3ERKA 2FA2A 5GNKA 5FM2A 4H1JA 3LCDA 4QPMA 4TNDA 4IAKA 5H3QA 3IGGA 1V0BA 2PHKA 3QQUA 3A7IA 1Y91A 1ZOEA 4BGHA 2BRHA 5IQAA 5ANEA 1H1SA 4ACCA 3DZOA 4IVAA 3DNEA 4S2ZA 5AR5A 3R9HA 4F1OA 2AC5A 3GU7A 3P7BA 3MJ1A 4LRMA 4MH7A 5CNNA 4TL0A 2Y6OA 3FL5A 4EOOA 2YWVA 1XH4A 3U6IA 2HXLA 2P0CA 3R7VA 2XIZA 2WQMA 4RIXA 3AQVA 3H4JA 5IH4A 2PVMA 5IA0A 3FHIA 3P5KA 2UZLA 4FKSA 4O6EA 4LGHA 1YXTA 4PMTA 2WKMA 4GFMA 4YC8A 5CSWA 2ZV7A 4DH8A 4ZLYA 3OBJA 4AFJA 4F6SA 5EI6A 4XBRA 3V6SA 1WAKA 4FL2A 4S34A 4BHZA 5LMKA 2HZIA 2ZV2A 2GNJA 4FTNA 4PTCA 4BCJA 2HW7A 3QTSA 2B9FA 3SOAA 5KE0A 4QPAA 5KHWA 2ZM4A 4JDJA 3H0YA 3UOJA 5LVOA 5FXQA 2Y4IB 2XF0A 2PPQA 5LQFA 3OXIA 1CKIA 3QRJA 1W0XC 3T9TA 1NW1A 4PUZA 3KU2A 2ITUA 4BKZA 1KUTA 2UVYA 4KUJA 3DOGA 3A8WA 4FIIA 3C4WA 3JUHA 3JS2A 3S2PA 1VYWA 3QKLA 1FMKA 3CKWA 3MWUA 4OUCA 3ATTA 3FXWA 2YIRA 4NJ3A 3ANRA 3HMIA 4FYOA 4UWBA 4I4FA 5HIDA 4CZTA 3QWKA 4ANBA 3FDNA 4IB1A 4DTAA 3LLTA 1WZYA 3O96A 5AR3A 5CSXA 4PL5A 4CFXA 2NP8A 3MB7A 4FKLA 4K0YA 5FP6A 5C03A 4BCPA 2PVLA 1FOTA 3BYOA 3QAME 4FNYA 4GH2A 4R6VA 5D9HA 4FZFB 4PX6A 4KB8A 4KINA 2G9XA 2YITA 2F7ZE 4MHAA 2RKUA 4O0VA 3VJNA 3HDNA 3L9MA 3DKOA 5CENA 3UIMA 3WF7A 5L2WA 3PPJA 4FSMA 4I0SA 1LUFA 3FEGA 3NMUF 3D2IA 5IUGA 3KCFA 2F2UA 4EH5A 4X3FC 1OPLA 4AZWA 4FEQA 2WMRA 3JVSA 3R02A 3D5VA 3Q60A 4X2KA 4DCAA 3K3IA 1XBCA 1GZOA 1NVRA 3AT2A 3LM5A 4DFXE 1OITA 2QO7A 5CVGA 2Q83A 2UZOA 3WOWA 1XKKA 4JX7A 1GZNA 4G31A 1IEPA 2ZB1A 4EC8A 1KE6A 2VWXA 1DI9A 2YCFA 1KV2A 4FK6A 4J52A 4YO6A 2VWVA 3W2RA 2W99B 5CF8A 1GNGA 4DT9A 3VVHA 5KZ0A 1YOJA 3CCNA 5DH3A 3VBTA 3PJ3A 1H4LA 1ZWSA 1ZARA 2C6OA 4JJRA 3MTLA 3ZO4A 2HWOA 2E9PA 5M07A 4KKEA 2RF9A 4IAYA 4IZ5A 4X2GA 5GZAA 2GU8A 1WCCA 4F99A 2O8YA 4H58A 1XH6A 3QYWA 4IWQA 4MBLA 1YHWA 4KRCA 1JKTA 3KVWA 5CXHA 3FXZA 2OI4X 3I5ZA 2OJIA 4E4XA 1E1XA 3UZPA 3T3VA 5IQCA 3Q4TA 3PXRA 1ZYJA 4G6OA 4W8DA 4BYIA 4IAAA 4NM3A 3RPYA 4DHFA 4LOOA 4YNOA 3FY2A 3ORIA 3AC8A 2QOHA 2BZKB 3GXLA 4IZYA 3EN4A 2Y0AA 4EUUA 2X8IA 5IISA 3R01A 3TIZA 4GVAA 4W8EA 4C37A 2R7BA 1HCLA 5AUYA 4MD8E 2PVNA 3ZXTA 3VS2A 4YGAA 3DAJA 4RSSA 4Q9SA 4BDAA 3ZU7A 4IAZA 4M14A 4UEUA 4ANNA 2WTJA 4E93A 5M4IA 1WBWA 3NCZA 4ZTMA 2RFSA 3CJGA 4FL3A 4YC6A 5A4QA 3MYGA 4NK9A 4I6BA 3F3VA 5KHXA 5K5XA 3LQ8A 4EL9A 5CTPA 4MF0A 2OG8A 3IQ7A 4FV4A 1FVVA 3OFMA 3R8VA 4P7EA 4BBEA 3DCVA 4YLJA 3TZ8A 5HX6A 3F2RA 1IG1A 3MA6A 3I1AA 4ZS0A 4XJ0A 2C5VA 3UBDA 2UW6A 3I6WA 4BZOA 2IZRA 3T3UA 3PVGA 3VBWA 4I20A 4BDGA 1AQ1A 2PL0A 1PHKA 2VX3A 3GBZA 4DINA 1J3HA 3LFAA 3TUCA 3C9WA 3FPQA 4F7NA 5F9EA 1J1BA 4M69B 2GQRA 3ZONA 4QP8A 2VWIA 3UPXA 2HOGA 2V5QA 4V0GB 3EN6A 3QQFA 3VQUA 3QD3A 5C27A 3UPZA 3S3IA 4DE4A 2PE0A 1VR2A 4J8NA 5HORA 3F88A 2E9NA 4G16A 2O2UA 1KE9A 2YFXA 2VTTA 3DDQA 2VAGA 4MWIA 5HBHA 3BI6A 3MY1A 3TDWA 3E7OA 4FUXA 5CT7A 3OXZA 3Q9YA 3SGCA 4YHTA 4G3EA 4JBQA 2Z8CA 4IVCA 2ZVAA 3Q53A 2PZIA 3D94A 3ZSHA 5A4LA 3DPKA 5C8MA 2ITQA 3O23A 2J51A 4E6CA 2HAKA 3KL8A 4BDBA 2QHMA 3UNJA 2PZPA 4Z55A 4YJVA 2ZM3A 2BROA 2R3GA 4RGJA 4EH2A 5AX3A 1UWHA 3IOKA 2VTNA 3VNTA 1OKVA 4AQCA 3HAMA 4XHKB 3ITZA 3OY1A 5F1ZA 2WQOA 4M7IA 3LVPA 2FUMA 3FLWA 4FGRA 3K2LA 2J0IA 1WVWA 5I9XA 5HTBA 3BHUA 3C50A 4F9YA 5ACBC 4KABA 2PULA 3B8QA 5FBNC 2ZB0A 2UVZA 3F3TA 4PNKA 3H9FA 4EHVA 4JXFA 1M7NA 3KRRA 4O91A 4LRKA 1VEBA 2JKMA 2CSNA 3COHA 1OKWA 3QWJA 2C5NA 4D2WA 4RX7A 3QU0A 3NW7A 1K9AA 3EJ1A 4IX3A 3TUDA 4MNFA 2PUIA 4D2RA 2CNQA 2R3PA 2IZSA 4NCTA 2X2LA 3KXGA 4JDIA 4BBFA 5FDPA 4L00A 2QG5A 4FUYA 4C4IA 4YURA 4HYUA 3L8SA 4R3PA 3MIYA 3V5TA 3COMA 3R8LA 4C36A 4CG8A 4IMYA 3TZ7A 2GSFA 1G8SA 2YIYA 4EC9A 2YISA 2BHHA 5CZIA 1FVTA 3AD6A 4FV7A 2JBOA 5AP7A 4C4HA 4HZRA 4BCMA 4QP2A 2XK7A 4YZNA 4ASXA 2OGVA 4GKHA 4XRJA 1CKJA 2XCHA 3C0IA 4KS7A 3O8PA 4PRJA 3THBA 3DAKA 5HD7A 3ROYA 2W5AA 4GS6A 3W1FA 5JFXA 4GKIA 2VX0A 1V0OA 4M0ZA 4CT1A 4MXAA 4W9WA 5GJGA 3F69A 2XH5A 2C6EA 4KBCA 4WRSA 5ANGA 4EH6A 2XMYA 4ZZMA 3WARA 4XP2A 2GFCA 3EZVA 4G3GA 5B0XA 1Q3WA 5E8UA 1RJBA 4RIOA 3GC9A 4D4SA 3AOXA 4ZTLA 1B39A 2WU6A 3DK3A 2A19B 1UU8A 4X6QC 4DFNA 2B9IA 4RX8A 2QLUA 2BZHB 4MBJA 3V6RA 5GINE 1GAGA 2XK4A 4RQVA 4CVAA 1PMUA 4DEDA 4DEEA 4NUSA 1U46A 1YDTE 4FEUA 1XBBA 3A61A 3LFFA 2BUJA 3MN3A 5AV3A 4N57A 5CZHA 3PPZA 4L45A 2B54A 3AT3A 2ESMA 3PXKA 2X1NA 5FEDA 4A06A 4JOAA 4P5ZA 4QMNA 3JY0A 2ITOA 1ZYDA 3C4ZA 3DQXA 4EWQA 4D2SA 2C5OA 3KK8A 4HGEA 4CMTA 4TYGA 4HVSA 2XNPA 3KEXA 4CFMA 5LVPA 1XJDA 5DIAA 5BVWA 1OL1A 2CDZA 5FGKA 3BHVA 2C30A 3NX8A 5A46A 4AGWA 3NDMA 4DGNA 5IQDA 1JSUA 4YJPA 4FKOA 4ANQA 3FMKA 4TN6A 4V04A 3SQQA 3VUKA 4BHNA 3IG7A 4GW8A 3AC1A 5D41A 3W2CA 4E6AA 4EJNA 3I4BA 4XUFA 1ERKA 2PYWA 2ZM1A 5C9CA 2Y9QA 4OW8A 1I09A 3IECA 4CQEA 3RAWA 3BGPA 1TQPA 3TL8A 2BFYA 3AC2A 3EQBA 5CVFA 4F9AA 3UOHA 5CEPA 3RKBA 4MXXA 5HNBA 2BDJA 4GVJA 4NFNA 2BPMA 3CTQA 2XBAA 3QD2B 5I9UA 2GHGA 4LGGA 3PXFA 4QMOA 4TY1A 3UIUA 4O1OA 3PLSA 4LMNA 4A4LA 3N4VA 3F7ZA 4BN1A 1DM2A 5HCZA 2J5FA 3GENA 3UVQA 1BX6A 2WTWA 5AX9A 1JLUE 3HZTA 1PF8A 1LP4A 4ZMEA 5AUWA 5B2KA 2YM6A 1RW8A 5GJDA 5F95A 4S32A 3ETAA 3GNIB 3HUBA 2O64A 3GUBA 4QMTA 4LYNA 4KRDA 4QP9A 3LCTA 3VS7A 5HU9A 5GIOE 3R9RA 3SXFA 3U8WA 1H1WA 4NZWB 5HBEA 2BILB 5HESA 3VN9A 4YO4A 4IACA 4NM7A 4LG4A 4IAFA 4IB5A 4ZLZA 4FKVA 4LL0A 5E8WA 3PIZA 1CSNA 3UTOA 4F9CA 4FV0A 3NR9A 2VO6A 3NAXA 4MAOA 5L8JA 3RK7A 5JRSA 5JK3A 3NUYA 2DWBA 3HMNA 4IFCA 4XV1A 5FXSA 3OCBA 4O7RA 4KKHA 1QCFA 4FEWA 4JG8A 4O7VA 2W06A 3DKCA 4BIDA 2HXQA 4F9WA 2IZTA 4CZYB 4WSYA 3EYHA 1U5QA 3FQEA 3I7CA 3VAPA 4EOKA 4QQTA 5IA2A 2CGWA 3LCKA 4NKSA 1PXJA 3DTWA 1PXNA 2PU8A 3V5PA 4WRGA 3R21A 1S9IA 4L52A 5HLNA 5IA3A 4OAVB 5LCKA 3TM0A 2QKWB 1NVSA 4OTRA 5FDXA 1H27A 2XIYA 4MNEB 5HLPA 4DYMA 5M53A 3HLLA 2YDIA 3C51A 2QC6A 3HEGA 2NO3A 4D58A 4BTKA 4L01A 4EYJA 4YLLA 3PJCA 3WZUA 2YM5A 2WMAA 3POZA 3RTPA 4DF3A 5H8EA 3HECA 4RVMA 3GCVA 2JBPA 4OTPA 4QYHA 2UW0A 4E26A 5JKGA 3E5AA 3LXPA 3LKMA 5JEBA 4A9UA 1LEWA 2YCQA 4IC8A 5CU3A 2VTSA 3PG3A 2JIIA 2HIWA 3NAYA 2JDVA 4CG9A 3JY9A 2R3OA 3EFLA 4BIBA 3EMGA 1M17A 4A9YA 3JVRA 2WMTA 4NH1A 2BRMA 3VF8A 2W5HA 4O84A 2ONLA 1NVQA 3F5GA 5LOHA 2EUFB 1OKZA 1FGKA 3KXNA 3PA5A 2FH9A 2CGXA 1LR4A 2VGOA 4FKTA 2X8EA 3G2FA 4FTAA 4GIIA 3L1SA 1BI7A 4M8TA 3EL8A 3VRZA 2C5XA 5I3RA 4W4YA 3HX4A 3MY0A 4JDHA 2OICA 3WE8A 1SVGA 4QT1A 1H1QA 5DT0A 5M4CA 3VHKA 1O6KA 1BKXA 1A06A 4BCKA 2ITYA 5EK7A 2Z02A 5AUTA 1KSWA 5FP5A 4NFMA 4UN0C 4AOTA 5JFSA 4TNBA 3ACKA 3BGQA 5CU0A 3KXXA 5LMBA 3QXPA 5CS6A 2P4IA 4CMOA 3C4EA 4DEGA 4YJNA 4I6FA 5HE2A 5FRIA 4IFGA 1ZY4A 3U51A 3QZGA 4XG6A 5ANIA 5CQWA 4EOJA 3QHRA 4RFMA 2YM4A 3GB2A 4PTEA 5A14A 3RNIA 3JYAA 4D4VA 4CKRA 4BL1A 1OI9A 1W7HA 3FUPA 2R3HA 4WHZA 5GHVA 5AM7A 3ZS5A 1Y6BA 2CMWA 4NIFA 3QZIA 3BHTA 3QC4A 3ZH8A 3OZ6A 2PZRA 4RC4A 4BICA 4UXQA 4PP7A 2PUUA 4H39A 4RIYB 5HIEA 4BYJA 1FQ1B 2FSMX 3T8OA 5D7VA 3RK9A 3V8TA 1SM2A 3LHJA 5KMIA 3AC3A 2Z7SA 3D5WA 1SZMA 3CD8A 1PXKA 2W5BA 3DXQA 1WVXA 2C6IA 4EK8A 3BRBA 4AT3A 3KRXA 5CEKA 4H1MA 5M4UA 3UVRA 2YDJA 2W1GA 3OWLA 5EYKA 3VHEA 3G0FA 4IX4A 3DZQA 3ACJA 4FTRA 2WAJA 2PE2A 3TJCA 4TYHB 2W1EA 3IOPA 1Q3DA 3KULA 4G34A 3ZMMA 5KBRA 4RWJA 3ZRMA 1U4DA 3BE2A 4GG7A 2LAVA 3D83A 4BI0A 3ROCA 1W8CA 5ANOA 3QTIA 2Z7RA 4IXPA 3LOKA 4G9CA 3R1SA 1IA8A 4K11A 4IH8A 3LJ2A 4BI2A 3FQHA 2NRYA 5CANA 1KE5A 4EYMA 3F6XA 4J95A 1SMHA 4NT4A 5EQEA 1UA2A 2YJRA 3C0GA 4I6QA 3DLSA 4KIOA 4XG9A 2BIYA 2BRBA 4B0GA 3BV3A 3LFBA 4FIHA 4G1WA 2JGZA 4E4MA 4C8BA 2I7QA 4CKIA 1H26A 3BGZA 3ZEWA 5CU6A 3RGFA 3W33A 4DFZE 4AW2A 1QPDA 1IAHA 4J98A 4PTGA 2PY3A 2GNHA 3MA3A 4IVBA 2IO6A 1ZYLA 4PNIA 5HE3A 3I81A 3TKHA 5BMSA 5EYDA 1KV1A 2X7GA 4QQ5A 4A9SA 4L3PA 5C8NA 4GL9A 3GI3A 2R3LA 4XEYA 4HGSA 4UWYA 3NLBA 3PP0A 5DRDA 5AP3A 4WBBB 5BYYA 5KMOA 2UW3A 3ZOSA 4JDKA 4WG4A 4XV9A 4FX3A 1OGUA 5AR7A 5AIKA 4QP1A 1OUYA 2YABA 3NNVA 4XH6A 4J7BA 2W1DA 2XKDA 1RE8A 3MS9A 4ZJIA 1TQMA 4Q9ZA 5HBJA 2YZLA 4IJPA 5HHWA 2WGJA 1Q8UA 1SYKA 5K4IA 4F09A 5F94A 4I0TA 3B8RA 5F4NA 3FI4A 4U41A 4U81A 4I21A 4C57A 3JXWA 3TV7A 3PP1A 3COIA 4JIAA 1SNUA 4WNMA 2QO2A 2OF2A 2FB8A 4XG8A 4LMUA 1K2PA 4AOJA 2B7AA 4E4NA 4DN5A 4FGBA 2WOUA 2C47A 2YACA 3ORLA 4RJ3A 3DBDA 5I0BA 3DV3A 4TT7A 4QYGA 2C3JA 4QQJA 3DNDA 4X3FA 4FYNA 3WILA 4F7LA 4PPAA 4D1XA 4E8AA 5HE0A 4TYJA 4EKKA 5LCJA 2Z7LA 3BHHA 3FPMA 3QA8A 4C4GA 4O7ZA 4DFBA 4IJ9A 5FEQA 2XA4A 3R2YA 1YOLA 2VUWA 4MX9A 3EIDA 4O2PA 2Y4IC 5KZIA 4AE9A 3S1HA 3CIKA 5FEEA 5IU2A 2OZOA 2ITTA 3BEGA 4ANMA 4BCGA 3R00A 2BZIB 4GK3A 4BWPA 4CTCA 3UYSA 5E92A 4PDSA 1Z57A 2UVXA 4YNEA 5IQBA 4YJUA 3DB8A 5LVNA 5BMMA 5BQ0A 2VWZA 2UZUE 4V01A 4F6WA 3QZHA 3UP2A 1PXIA 2G2IA 1QMZA 2G15A 2VN9A 3MH0A 3NEWA 3E8DA 4QP4A 3NW6A 4EBWA 3PDTA 2C5YA 2PE1A 3F2NA 3ZXZA 4QO9A 4QYFA 3DXPA 3NGAA 1CKPA 1YKRA 1W82A 3W55A 3QQHA 4G3DA 4F65A 3L9PA 3R71A 4A07A 4FT9A 4EKLA 3RAKA 4ZEGA 4K77A 2CHLA 5HNGA 3ZSIA 2WZJA 4RMZA 4C62A 2UW4A 4IANA 3U87A 4I4EA 4MXCA 4N6YA 4BWKA 4KD1A 4PF4A 3LFSA 2XJ1A 3DLZA 4Y46A 2P33A 4ANOA 1J91A 3M1SA 4FV9A 5H8BA 1PY5A 4FSUA 3RWQA 4EH7A 1UNGA 4ZTQA 1J7IA 3N4UA 4MWHA 3W8QA 4EUTA 4L42A 2WMWA 4FVQA 4IWDA 3ZC5A 1ZYSA 5G6VA 4XOYA 4JQ8A 3DS6A 3D5UA 1ZMWA 4ZK5A 4YHJA 5CT0A 3TIYA 1IASA 2BALA 4DBNA 4DT8A 4TWPA 4OTIA 3PSBA 4IX6A 4FTCA 4UB7A 4LRJA 3SXRA 3G15A 5HKMA 4IQ6A 4OTWA 5CAUA 5HGIA 4C33A 5JZNA 1CTPE 2JDSA 4K1BA 1L3RE 4EQCA 3DQWA 1JWHA 3TNHA 1I44A 4D1SA 4MBIA 4E5AX 4FTOA 3DTCA 2ZAZA 2UW9A 4NM5A 2XK8A 2BHEA 2J0LA 4ZY4A 4FE2A 2PVHA 2OO8X 3BWFA 3OD6X 3TNPC 3CLYA 3TDVA 5IF1A 4J97A 3U55A 3MFUA 3VWAA 2P3GX 3H3CA 2XNNA 3KXMA 2VTHA 3QCSA 3W32A 4RA4A 2V7OA 3V5WA 5HCYA 1U5RA 3GQLA 5J95A 3RBWA 4HPTE 4BDDA 3FKNA 5C4LA 1SVEA 1F5QA 4ZSAA 2B4SB 2JKKA 3FLQA 2QOCA 5JQ8A 4FTTA 5EOLA 2OH4A 3TKIA 2F7XE 5IG1A 3A7GA 2HENA 3I60A 2GS6A 4NTSA 3C4FA 2BR1A 4O0XA 4QQCA 5D11A 5AM6A 3SOCA 5EI8A 3DXNA 4DITA 3ZFMA 3V5QA 4FL1A 1OB3A 1J7LA 2B9HA 1R1WA 3KRJA 5C8KA 2OZAA 1Z9XA 3OY3A 3OT8A 3PRIA 1Z5MA 2OXDA 2OLCA 3PXYA 4YPDA 4FKIA 4EI4A 5JT2A 4F7JA 1P4OA 2JD5A 5L4QA 2Y6MA 4AF3A 2QLQA 3VUDA 3Q4ZA 2VWUA 1OL7A 2GNIA 1YXXA 1KOAA 3O51A 4ANLA 4AP7A 1UU9A 4FIGA 3BX5A 3HMPA 4JR7A 3QALE 3CP9A 2CN8A 2ITPA 3O0GA 2CJMA 3AG9A 3QX2A 4U0IA 3TWJA 5HO7A 3ET7A 4NJDA 5J5TA 3DFCB 3DJ6A 2GFSA 4E7WA 4Z16A 5ETIA 2R4BA 4DEHA 2F9GA 4QTEA 5IQGA 2CN5A 4HGLA 4C58A 3RHXA 3UNZA 1W84A 4QMWA 2ITXA 4BGGA 3LJ0A 3DGKA 3RPSA 3U4WA 1Q8TA 2XM8A 3G9NA 4M15A 4RQKA 3Q9ZA 1XWSA 5E1EA 1U54A 3V8SA 4JAIA 1OBGA 2WU7A 2X8DA 1ZZLA 4XRLA 1YVJA 3QL8A 1DI8A 4Y5HA 4QP3A 4U97A 3FI8A 3ZUTA 4RIWB 5EHLA 5AEPA 3RZFA 2XYUA 2XRWA 4TWCA 2B52A 3A60A 3KCKA 3H10A 2JKOA 3QGWA 3VO3A 4HVDA 1V1KA 2F7EE 4C4EA 1IA9A 3BV2A 3FMEA 3RI1A 3N4TA 2WIPA 4WNOA 2XNMA 4C59A 3FL4A 3HP2A 4EOPA 2R3NA 3QHWA 3FAAA 4UZHA 4NU1A 1IAJA 5BNJA 4MTAA 3PSDA 3UOKA 4AW0A 4AUAA 4YUQA 2R3MA 4AT5A 4ZJVA 4DEBA 4K8AA 3DBFA 3VBYA 3EQIA 4Z7HA 4O96A 2JDRA 4QMQA 2JITA 4ENXA 2VNWA 2VTRA 1MRVA 2PVJA 3U9NA 3GU4A 3EKKA 1M7QA 3OCSA 4XP3A 3G51A 1QPCA 1XHAA 5DG5A 2VWBA 3UP7A 1FBNA 4B9DA 3AGMA 3RMFA 4FMQA 2WMBA 2CLQA 3PA3A 2ETRA 2OXYA 3QLFA 3M2WA 4FZ7A 2O65A 4XOZA 2O0UA 1ND4A 3HUCA 1MRYA 2X81A 4OBOA 4EOMA 4OT5A 3SVVA 4UXLA 2H8HA 3OHTA 5DEWA 1Y57A 5LVMA 2XCKA 3OP5A 3DFAA 3R7GA 4FZ6A 3RWPA 4KBKA 5EDPA 3W8LA 3D7TB 3DBEA 2WQNA 3LMIA 2JLDA 3NYOA 1UV5A 3EQHA 3FC2A 2BRGA 3OTUA 2RL5A 1ZY5A 2IPXA 2VTQA 3FLZA 4OTHA 4F63A 3K54A 4TWNA 3OS3A 1J1CA 5IH5A 2WQEA 5EYMA 3FLNC 2EWAA 3I7BA 3A7JA 1OMWA 1YXSA 4BVUA 2WEIA 4CQGA 4FIFA 4G6NA 4YJQA 5CI7A 2FSOX 3QCXA 3IDBA 3ORMA 3HP5A 5JSMA 2V7AA 4ALWA 1GIIA 4LM5A 4EONA 5KKRC 4LQMA 3CQUA 3MGYA 1ZRZA 5A54A 2ZV8A 2BKKA 3E7VA 3AC4A 3MVHA 4EZ7A 3G9LX 3S4QA 4MEDA 4BZDA 4J96A 3GP0A 3DK6A 5D10A 3R7EA 3EKNA 2QOQA 3CGFA 4ITIA 4L67A 2G1TA 4PDPA 4RX5A 5A9UA 1GJOA 1FGIA 2XNGA 2XJ2A 2PZYA 4LUDA 5ANKA 5HG5A 4BCIA 4MQ1A 4L53A 2VZ6A 3DT1A 4ONAA 5TO8A 4E5WA 2YJSA 3CBLA 4JQEA 3E93A 1PYEA 3UQFA 3CXWA 4HVIA 5C01A 1A48A 3A7HA 2WMUA 4PP9A 4DEIA 4CGAA 2SRCA 3SHEA 3VIDA 2VD5A 4O81A 5CQUA 4WD5A 3I0OA 4AE6A 3VBQA 3GU5A 3HA8A 4ARKA 3R04A 2W05A 2QU6A 1WBNA 3NUNA 4NSTA 3F61A 5HVYA 4BC6A 4YLKA 3SXSA 3VUIA 1ZXEA 3BYVA 4X3JA 4S30A 4H3PA 2IVUA 1URWA 4YJTA 3QF9A 5HTIA 3ATSA 4YTIA 5IQHA 4FI1A 1GY3A 3QA0A 4AU8A 3LMHA 2VGPA 2E9OA 3FZTA 1JSVA 2VTAA 4AGUA 3SAYA 3PZEA 2YM7A 2R9SA 3R2BA 1OL6A 3H30A 4FKRA 4K33A 2J2IB 2QQ7A 5H2UA 3V51A 2CNVA 3UZRA 3RPRA 4FTMA 3GU8A 3UMXA 1AGWA 3RCDA 2BZJA 5EQYA 3CD3A 2YLFA 4HYSA 4LV8A 3QXOA 5AIRA 2IJMA 3MH1A 3NCGA 4ITHA 2FYSA 3WI6A 4E4LA 3S00A 3WZJA 4RVKA 4QMZA 4MXYA 1JSTA 4IC7A 2VU3A 3BLRA 4FTIA 5E8ZA 3M11A 5E8SA 2BCJA 3Q04A 5BUIA 3VULA 3NIEA 4CD0A 2QU5A 4UMUA 3RP9A 3LFEA 2IW8A 1GIJA 2BTRA 3HMOA 4W4XA 5KNJA 3V8WA 4L44A 4C38A 2DUVA 4ZOGA 4PMMA 4A4OA 1VJYA 2XIKA 3EQDA 5AP5A 3CQWA 2C3LA 2I40A 3DY7A 3L8VA 3NPCA 4H3BA 4BZNA 5AV0A 2ITZA 5LMAA 2FVDA 2W17A 4NYEA 3R8UA 4RJ7A 2VWWA 3OC1A 3OVVA 3ID6C 4AW1A 5CU2A 2X9EA 1GZ8A 3RVGA 3EHAA 4RIXB 4OR5A 5TOZA 3EN9A 4W9XA 4HGTA 3NYVA 4KAOA 3W10A 1OIYA 4EH3A 1R0PA 4NW6A 1P5EA 2QOKA 3OWPA 3QQGA 4KIKA 1ZMUA 4DGOA 3MPTA 5DA3A 5J9LA 5FTOA 5B2MA 1K3AA 2C0OA 4N70A 4GJ3A 5HO8A 4BFMA 3CKXA 4MXZA 5J87A 3DAEA 5FTQA 4BDFA 2IVTA 2OK1A 4GRBA 4P4CA 4JQ7A 1FINA 4P2KA 4IDTA 2QR7A 4IE9A 4LV5A 2YA9A 5HU3A 4O82A 3HNGA 4TZRA 4TYEA 2CCIA 1WBPA 4G3CA 4KS8A 4KA3A 1WVYA 3ZBFA 5JZJA 2DS1A 4FR4A 3QRIA 2C0TA 5EW3A 1F0QA 1Q41A 3PY0A 4O0TA 1PMEA 3E88A 4BRXA 2YEXA 2YIQA 1PYXA 3PPKA 2E2BA 3C4XA 3NYXA 5AWMA 3WYXA 3ORZA 4XMOA 2A0CX 3NRMA 5FG8A 3PY3A 2BRNA 3R7OA 4YZ9A 4ZSLA 1M2RA 1BL7A 2PMOX 4XNEA 2BFXA 2ERKA 3O2MA 2Z2WA 4IM2A 4CT2A 3C5UA 3KN5A 3D7ZA 2GMXA 5IMXA 2YCSA 3EQFA 2WMSA 3O8TA 3LJ1A 3II5A 3Q6WA 2AC3A 5FBOA 4KKGA 4ZAUA 2W9ZB 3D2KA 2VRXA 5KMKA 4XV3A 4LOQA 4O0YA 1OM1A 4CLIA 5D7AA 2W4OA 4IM3A 3EQPA 3HVCA 2XNBA 1R39A 5C4KA 3QTUA 4L9IA 5EH0A 4YPSA 2YDKA 4ACMA 3VUMA 5M56A 4ENYA 4BCHA 1W83A 4F4PA 4X2NA 3VS0A 2OJFE 4KSQA 1MUOA 3DKFA 3RPOA 3ZO2A 4HVHA 3GEQA 4FSTA 3OW3A 2OXXA 3V5JA 5HOAA 5DLSA 3UG2A 3SRVA 1GZKA 4ACGA 3FMDA 4CCUA 3H9OA 4IWOA 3G0EA 4C0TA 4U42A 4TPTA 4FKPA 1QPJA 5F20A 2B9JA 4UY9A 3ZUVA 3GOPA 1MRUA 5IMEA 4I5HA 4IIRA 4KIPA 4UWCA 4JT3A 5EQPA 5AUXA 4L6QA 3AT4A 3BBTB 3GGFA 3F3UA 4RJ4A 4C7TA 4Y73A 4B6LA 3OCGA 4JRVA 2IW9A 3P7AA 3R28A 4USEA 1OECA 3RJCA 4GYIA 2EXCX 3UOLA 4Z9LA 3BE9A 4CFWA 3AC5A 5BVKA 3LMGA 1H01A 5I9WA 4BKYA 2HZ4A 2VTIA 2QD9A 2H34A 3HRCA 1UU3A 4JI9A 2QVSE 2H96A 4Y83A 4CRSA 1NT2A 3SKCA 1Q24A 4QD6A 3KC3A 4L43A 3C5IA 2IVVA 5CWZA 3UNKA 3ORTA 3E3PA 2WD1A 3FZ1A 2B55A 2JAMA 5JMSA 1QPEA 4ACHA 2YHVA 3VS6A 3A2CA 4NEUA 2OU7A 2JC6A 3GC8A 3G33A 3CS9A 1OBDA 2RFNA 4ASEA 2W1ZA 1NY3A 3ZTXA 2XVDA 1UKIA 4OGRA 3GVUA 5BYZA 1ZZ2A 5M55A 4D28A 4M12A 3SG9A 3D15A 2VWYA 3KFAA 2H9VA 3CY2A 3QTXA 4DG0E 2E9VA 1P4FA 3E63A 3JPVA 1OIRA 3A4OX 3QCYA 3MTFA 4JX3A 5IDPA 4FT7A 3W2QA 4PWNA 3QUDA 3R0TA 3V5LA 4EHZA 4WNKA 3R8MA 4G9RA 1R78A 3NNUA 2VTMA 3P08A 2W1HA 5L2QA 5FTGA 3QTRA 5IPJA 3HRFA 1XR1A 3PWDA 4OBPA 2RSVA 2W1FA 4QMXA 4QMUA 2UV2A 1ZYCA 4RJ5A 2ZYBA 5A4TA 5CAPA 2OIDA 4FV6A 1M52A 5T3QA 4F08A 4X6RA 3ZZEA 4U3ZA 4RT7A 3TV4A 2OSCA 3DJ7A 2ZDUA 2C69A 2WTIA 5IQEA 2BTSA 2JAVA 3FI2A 4CYIA 4DH7A 3MBLA 3AMAA 2HY0A 3TUBA 4BY9E 3UDBA 2CGVA 1FVRA 4YMJA 3EWHA 2J50A 4YBKA 3ZEPA 4UX9A 3ULZA 1JKKA 1R3CA 3P23A 4U9AA 2Y4PA 3NUPA 5DR2A 2XKCA 1Q4LA 5FLFA 4O7TA 4OLIA 4OTDA 5L3AA 5AV4A 4H05A 4Z3VA 4JS8A 3ORXA 2R3JA 2GQGA 4RJ8A 3MFTA 3PXQA 5CALA 4I22A 4F1TA 3KREA 4C34A 2DQ7X 2W0JA 1PXLA 2C6MA 2CKOA 3SW4A 4DG3E 1CM8A 3WIKA 2IG7A 3CE3A 1P14A 1XH7A 2R3QA 3IS5A 4BTMA 5K5NA 1SNXA 4J71A 4O0SA 4WIHA 3CC6A 4K9YA
chains in the Genus database with same CATH superfamily
5KMLA 4U40A 2A98A 3PFQA 2NNWB 2BDFA 1W2FA 3LCSA 5IQFA 4AZSA 4O7SA 4B8MA 2PVRA 3F5PA 1SVHA 4M97A 4ALUA 2R0UA 5E90A 3SA0A 3UO6A 4LI5A 4DTKA 5L6OA 2XNEA 1DS5A 5FUTA 4M3QA 3KRWA 3QUPA 4DFLA 2FGIA 4EZ5A 2C3IB 5J7HA 3FZSA 4I94A 5H8GA 3RNYA 4EH9A 5KBQA 2XBJA 4DTBA 3IK3A 4QMLA 4X21A 5EDQA 2UZDA 1W2DA 4HW7A 1JAMA 2X7OA 4BCFA 4UMPA 5ITAA 2RFEA 3FXXA 2W1IA 4YZBA 5EHOA 5HG9A 3TZMA 3R83A 4ZXTA 3JR1A 4MYGA 3KY2A 2J0JA 1GIHA 3IDPA 4R7HA 4E1ZA 2VO3A 5BVEA 5T68A 5ANDA 2GQSA 4CFFA 5J79A 2YWPA 5EM8A 3VF9A 2OJJA 3WIGA 5HQ0A 4R7BA 3M42A 3G5DA 3QKKA 4M13A 4OTQA 4RWIA 3UC3A 2XUUA 5AUUA 4U45A 4DGLC 3AGLA 5CAVA 5TF9A 3KK9A 3MI9A 3MV5A 3WE4A 4ERWA 1XMLA 3TTJA 3NUXA 5IEYA 1BLXA 4D2VA 2HK5A 2IN6A 3TNWA 4HYHA 4EK6A 4WO5A 3EQGA 1FPUA 3TT0A 4EHEA 3AD5A 4AZTA 4JR3A 5DT3A 2GCDA 3HMMA 2Q0NA 3QQKA 1YWRA 5AUZA 2PWLA 3QC9A 1H00A 3NVKI 1H1RA 3E64A 5BVOA 4HNFA 2XANA 3WF8A 1TVOA 2W1CA 4YR8A 4RVTA 2W96B 2HZ0A 3I5NA 3PJ2A 2XZSA 1Q8YA 4E3CA 4M69A 4O22A 2UZVA 4AGCA 2VTJA 4V0GA 3PY1A 3EOCA 4HYIA 2RGPA 2XKFA 4IDVA 3FQSA 4O0RA 5J1VA 5AA8A 2RG6A 3TKUA 4GSBA 3LFDA 1Q62A 4XLIA 2QURA 3QX4A 1YI3A 4E6QA 4QMMA 4MK0A 4DLIA 4CV9A 3RM6A 2OFVA 3ODZX 4E6DA 3F5XA 1H28A 3LFCA 4G5PA 3VS4A 3P5JC 2UZBA 3GOKA 5D12A 4YSJA 4MUQA 3GCPA 4PDYA 3WZEA 2QOBA 5JQ5A 5BYLA 1CMKE 1H24A 5L6PA 3OOMA 5K4JA 1F3MC 4O38A 2QNJA 2PVFA 3E87A 2XIRA 1ATPE 3C1XA 5A6OA 3SW7A 3COKA 1Y6AA 1YW2A 3QYZA 3MH2A 1W98A 3UIXA 4K2RA 4O1PA 3PVBA 5E7RA 4I0RA 5EM7A 3VRYA 4F0IA 3LQ5A 4NKAA 4U80A 2GDOA 4FIEA 3VS3A 4Y95A 4DG2E 3RZBA 5AAEA 5KX8A 2C1AA 4LGDA 5G1XA 5IDNA 5EW9A 4XG3A 3A7FA 4MKCA 1XO2B 2HWPA 3FZOA 4J53A 4E5BA 2XAOA 3FLSA 2YAAA 5CSHA 2BAJA 3ALNA 5DHJA 1Q61A 4DBXA 4ZLOA 3P0MA 4YTCA 5EYCA 4TXCA 2IWIA 3OEZA 1JNKA 3CTJA 3R9DA 4WOVA 4B8LA 3IW7A 2ETKA 3QRUA 3UE4A 3FV8A 3UC4A 1PMNA 5AV1A 1JKLA 1OIQA 4G17A 4FKJA 4Y8DA 1G3NA 3NUUA 2PMIA 3WF5A 4YJOA 3ZO1A 3Q5ZA 2I1MA 2C68A 3CEKA 4FKUA 4O86A 5E91A 1PXPA 5EM6A 4G5JA 3DK7A 5JH6A 4HJOA 4DH3A 3PZHA 3MDYA 1RDQE 2VO0A 5JRQA 4II5A 2ERZE 4ZIMA 3O71A 4V05A 4QOXA 5CEOA 1H0VA 4L8MA 3U6JA 4DLJA 2V62A 2YLEA 3QKMA 2E9UA 4U43A 4A9RA 3R8PA 5A4CA 5DPVA 2GHMA 4QMSA 4BDKA 2WTCA 2Y8OA 4FTJA 4IZAA 4QYYA 4HZSA 4QMPA 4YP8A 4E73A 4I93A 5CEQA 3PG1A 3P9JA 4NL0A 5JGAA 2I0YA 2PVYA 2GS2A 5LXMA 3ZDIA 2XP2A 3MSSA 4BWXA 4FOCA 4NM0A 4JAJA 5DFPA 2QG7A 4I1ZA 2I6LA 5ETAA 5HEZA 3RPVA 3G90X 1GOLA 3EN7A 4RX9A 2A1AB 3ANQA 4CV8A 1JBPE 5JGDA 4YHFA 3PUPA 1JPAA 2V55A 4PL3A 5CI6A 3TMOA 5CF6A 4F9BA 4EOLA 5I5ZA 2NPQA 4D9TA 4L46A 3KB7A 3MVLA 2Z60A 4C3RA 2XRUA 5LWMA 5HI2A 3E92A 3GC0A 5CU4A 4WNPA 4ZSJA 4AT4A 3WF9A 2R2PA 1IRKA 5EW8A 3KXHA 5FD2A 3UO5A 5ETCA 3C4CA 5BX0A 1YXUA 2XKEA 2VTLA 3PRFA 4GCJA 4GIHA 3LIJA 2JEDA 3FMHA 4IB3A 4J8MA 4R8QA 5E8VA 1YXVA 1S9JA 3ENHA 3NW5A 1Q8WA 4FKWA 3P79A 4KIQA 4XG7A 3AMYA 3ZHPC 3HYHA 3I6UA 3R73A 1UWJA 3O17A 4ZY5A 4FKGA 4UV0A 1UNLA 4FA2A 3IW8A 2PUNA 2HZNA 2OFUA 3BU5A 4MXOA 4R3RA 4AFEA 4O0UA 4U79A 5IA5A 3VS1A 3P78A 3KXZA 3AMBA 1TFFA 3KF4A 3S95A 4XG2A 4ZSEA 3SD0A 5ETFA 2PUPA 3BL7A 5M09A 2R64A 2C6DA 3HA6A 1H8FA 4FG8A 2UZEA 4FIJA 5HX8A 4QTDA 2XEYA 3IW4A 3P1AA 3O50A 3ZM9A 4CTBA 4EH4A 1V0PA 2WTKB 3ZCLA 4ZY6A 5M08A 2YAKA 3TV6A 2X0GA 3IW5A 4KSPA 3UVPA 3ORKA 5M51A 4EBVA 3A8XA 3P86A 3A62A 4ZZOA 3O8UA 4LL5A 3POOA 3ZC6A 3S0OA 2C3KA 2AUHA 4D55A 3KA0A 4FT5A 4UMRA 3MPAA 4BDHA 3SV0A 4AW5A 3IGOA 4NIFB 1JOWB 4CFNA 5AAFA 3D5XA 5AAGA 2EB2A 4X7QA 5AP4A 4E20A 2BAQA 3VW8A 4EORA 4D5HA 1MP8A 3QQJA 4CZUA 2I0VA 1DAWA 2XK6A 3GT8A 3OMVA 2WPAA 2BMCA 3IONA 2YERA 4HCUA 3WBLA 3B2WA 3FI3A 2B1PA 2W7XA 3G6GA 4AGDA 4CLJA 5AR4A 3OROA 2YN8A 1PKGA 5IKWA 1R0EA 4D9UA 4DC2A 4BF2A 2PVKA 4M67A 5ANJA 2X4ZA 1WBSA 2RG5A 3IW6A 3LQ3A 2O5KA 2DYLA 3GFEA 1XH5A 4RWKA 5CXZA 3IDCA 2O3PA 1ZLTA 3TCPA 4CRLA 2PSQA 4GK2A 4AXCA 2UUEA 4RC3A 4FVPA 3OEFX 4L7FA 1G5SA 3KULB 5TKDA 3ALOA 3QRTA 3DBCA 4S31A 3OXTA 5AP6A 3WZDA 1P2AA 4C2VA 2XM9A 5CNOA 1TZDA 3KKVA 2J0KA 5AV2A 3BYUA 5CAQA 4JLCA 2CCHA 3BWJA 2XYNA 4W4WA 3KMUA 2CKQA 2WOTA 3QTZA 3A99A 3E8EA 3KQ7A 2G2FA 3NSZA 3LZBA 3RCJA 4I6HA 4JG6A 4MNEA 2VTPA 3DKGA 2ZMCA 4FZDB 3HAVA 5BVNA 4ID7A 5HICA 4FC0A 4FZAB 5HNIX 3UYTA 3RAIA 3ZFXA 3W2OA 3ZBXA 1KWPA 4F0FA 4MD7E 4C4JA 4W4VA 4ASDA 3EFKA 4FTKA 3W16A 5J7BA 1TQIA 3EFWA 3GCUA 2IVSA 2X4FA 3TN8A 5B7VA 4P90A 1QL6A 1O6YA 4ITJA 3D4QA 5HG7A 3RM7A 3VBVA 2B0QA 4JIKA 3K3JA 4UZDA 1RQQA 2R5TA 3KF7A 2WELA 4BDJA 4RZWA 3WYYA 2CNUA 3OCTA 1YDSE 4CFVA 4QNYA 3RHKA 4PY1A 1YQJA 2F49A 5AP2A 5IEXA 3RALA 4TKSA 4U7ZA 5I9YA 4EOIA 3R1NA 5GZ8A 3TI1A 4UYNA 3GC7A 4H3QA 1H0WA 4RG0A 4GT3A 3BLHA 4FVRA 3VUHA 2WEVA 1OL2A 4JL9A 1APME 4YZCA 5HO6A 5HE1A 4BTFA 4XYFA 5DBXA 4PV0A 4AN9A 3PJ8A 5HG8A 5BVDA 2J9MA 4OTFA 4FSRA 5IUHA 1YHVA 4FEXA 3BQRA 4UYAA 3HDMA 4HPUE 1E1VA 4N6ZA 3WF6A 4AX8A 3BKBA 4EOSA 2X2KA 2CKEA 4XS2A 5IH6A 3QTWA 2RFDA 4TTHB 3Q9XA 2ACXA 4D4RA 2A4LA 4ZS4A 1YDRE 5DRBA 1ST0A 2R3KA 4X3FB 4FBXA 2I0HA 3OUKA 4IHPA 5LMKC 3VJOA 4WBOA 4F7SA 5FM3A 3ZFYA 1O9UA 3LXLA 4UALA 4FTUA 4TW9A 1LEZA 3CPBA 4APPA 2PMNX 4AA0A 3KN6A 4RFYA 3TG1A 4EHGA 3LLAA 5K0XA 5AR2A 4GYGA 4MCVA 3MFSA 3QUEA 3MJ2A 4EK5A 3CJFA 2JIUA 3NNXA 4J1RA 5B2LA 2GTNA 4AAAA 5EKNA 4LUEA 3D9VA 5KUPA 3UGCA 4J99A 4AWIA 4XLVA 3ZLWA 4CMUA 2REIA 2QODA 2QONA 4FV2A 3L8XA 4FKQA 4AZFA 2YM8A 4R1VA 4C3PA 4YU2A 2OJGA 4O7NA 2NRUA 3BU3A 3LW0A 4LOPA 4RIYA 4GEOA 3EL7A 4OT6A 3EN5A 5FQDC 4FV5A 5CX9A 4QMYA 4O7LA 5DR6A 4P5QA 4RZVA 4YTFA 3Q52A 2GTMA 2WMQA 4NTTA 4Y72A 5BVFA 3VUGA 3FZPA 3EH9A 5CLPA 5I3OA 3L8PA 3C7QA 3FC1X 4GK4A 4M84A 5K0KA 3F3WA 2UW7A 2WXVA 3PTGA 4GJ2A 4S33A 5KO1A 4AXDA 3SLSA 5E1SA 4KBAA 3F3ZA 3FMJA 3LXKA 3OF0A 3BEAA 3PA4A 4KNBA 3FHRA 3R6XA 3OW4A 4IADA 4C4FA 5CASA 4GUEA 2GNLA 3LM0A 3PYYA 3HKOA 3K5VA 4TYHA 3V04A 4XG4A 5HIBA 3DU8A 4UMQA 2OH0E 2VV9A 2XK3A 4WUAA 3MB6A 4M66A 4QP7A 4QTBA 4FNWA 3ZLYA 3LAUA 5CF5A 5EOBA 3IPHA 3P7CA 1NXKA 4USDA 3ZDUA 5LARA 4O4CA 4XBUA 3R1YA 4JG7A 3U4UA 5FWKK 2Y7JA 3FWQA 3FSKA 5IEVA 3H0ZA 3TNQB 4RWLA 4B4LA 2A27A 4R3CA 2EXMA 5LWNA 5TE0A 4A7CA 2QO9A 1YOMA 3KVXA 2JFLA 2UZTA 2X9FA 3CQEA 3KGAA 3FLYA 4O0WA 5L8LA 3IKAA 4IM0A 3OOGA 4CCBA 4F1MA 4BDEA 1PMVA 4ERKA 2W4JA 1WBVA 2PTKA 2QOFA 4O4EA 4ZZNA 3QLGA 4R5YA 4RJ6A 3E8NA 3LCOA 3NWWA 5J5SA 5AA9A 2UW8A 3RK5A 3QD0A 4Q5HA 5DEYA 5IZFA 1Q5KA 2UZWE 1OPKA 4RLLA 5AMNA 4DFUA 2QCSA 4FNXA 4CEGA 3U54A 4BDIA 3R30A 5EG3A 5AR8A 5DMZA 2F2CB 3ZLXA 4AZVA 3HL7A 2WQBA 4HNIA 4CXAA 3UG1A 5CAOA 1H08A 5I9ZA 3AD4A 3KRLA 2PK9A 3OBGA 4CSVA 2C4GA 1OUKA 2X6DA 4JBPA 2J90A 4BCOA 1IR3A 3Q4UA 4IBMA 2VX1A 4U44A 4GUBA 3R7YA 5KKRB 2BDWA 1TKIA 4D4YA 2XARA 2JKQA 2YIXA 4IZ7A 2EU9A 2PZ5A 3NIZA 5HVKA 3PLAE 4WG3A 1MQ4A 3ZRKA 3SG8A 2Q0BA 2R7IA 5A6NA 2BVAA 1M14A 3DBQA 1WBTA 4Q5EA 5DNRA 3R8ZA 3ZYAA 2VTOA 2YZAA 4FV1A 2HYYA 2ZOQA 1WBOA 4DGMA 5M57A 2JDOA 4WG5A 5HVJA 2OZAB 4FICA 3GU6A 4O21A 2W4KA 2XJ0A 1ZMVA 3OUNB 4WT6A 3MW1A 4ORKA 3L9LA 2G01A 3F2AA 4FTQA 4QNAA 2QI8A 4DHZA 3DJ5A 3GCQA 2WNTA 4M68A 1PXMA 3EFJA 4I3ZA 3VBXA 4FOBA 1WFCA 4DH1A 3W2SA 3BZ3A 4EZ3A 1OPJA 1PJKA 5T6KA 2CGUA 3EQRA 4FG7A 3N51A 4BI1A 4D2TA 2PMLX 3B2TA 1JVPP 3MIAA 4JBOA 1H07A 2ZMDA 2JDTA 2AEGA 4GFOA 1VZOA 4D0WA 1T45A 4K6ZA 4DH5A 5L8KA 1X8BA 4NWMA 4UBAA 1U59A 4DAWA 3LE6A 5FXRA 2P2IA 2XK9A 1URCA 5DI1A 3NZ0A 5C26A 3HV5A 4I5MA 2GPHA 3C13A 3AXWA 3PIYA 3BBWA 5J1WA 3PE1A 4QTCA 4FG9A 4D0XA 4RFZA 5CSPA 3BYSA 5AFVA 4BIEA 1REKA 2HY81 4RLKA 1BL6A 4BDCA 3CTHA 4IB0A 5CEIA 3MESA 1OIUA 3FKOA 3O7LB 4C35A 5J9ZA 5IUIA 3Q9WA 3ZUUA 5A4EA 3OG7A 1UVRA 2V22A 1U54B 5DT4A 4C61A 3G6HA 1MQBA 2CPKE 4GMYA 4R5SA 4F0GA 4AOIA 4G3FA 5CSVA 5AP0A 5AP1A 3OWKA 4CNHA 5BPYA 5DE2A 2X2MA 5K3YA 3U9CA 4ANSA 5A3XA 4RRVA 4O6LA 5HTCA 1H1PA 3P4KA 3QBNA 4AACA 4PL4A 2C6LA 4R1YA 4WUNA 4N4SA 4ZTHA 3ZZWA 4AZEA 4GFGA 2RIOA 4EH8A 4YJSA 4JBVA 3NVMB 4BB4A 4AN2A 2WMVA 3PE2A 3GFWA 1B38A 5C1QB 2OBJA 4WSQA 3V01A 2XS0A 4C3FA 3RINA 5L2IA 3NUAA 5LJJA 3CSVA 4BJJA 4C02A 4BKJA 5KMMA 2GNFA 4JNWA 4OTGA 4ZTSA 3R7IA 4IWPA 3TTIA 2P55A 5H9BA 4AA5A 4EOQA 1DAYA 1G8AA 5TR6A 4TRLA 3D0EA 3QCQA 5KMNA 4RC2A 1XH8A 2JFMA 1Q97A 5M06A 4RA5A 3KMMA 4L3LA 4A4XA 2OF4A 1FMOE 4XCUA 4EEVA 4NCTC 5L6WL 3FE3A 4FF8A 2ITVA 3FYKX 3HRBA 2H6DA 4TWOA 2OIBA 3DA6A 5M4FA 4QRCA 3ZO3A 3NUSA 1OVEA 4QTAA 3Q6UA 4GU6A 3SDJA 3W18A 4NW5A 4MF1A 4I92A 4L3JA 4HOKA 4N0SA 1YI4A 4YSMA 3ZM4A 2AYPA 3MVMA 2XB7A 2OWBA 4D2PA 3R1QA 3VUTA 1YWVA 4GT4A 3VQHA 4F70A 4FV3A 4FSNA 5I9VA 4PPBA 1EH4A 5ACKA 3UJGA 4HVGA 3HV4A 5DYJA 1E9HA 4DGGA 3FZRA 3FKLA 3MVJA 4I23A 5DVRA 4FEVA 5EM5A 2YIWA 3GQIA 3R9NA 4JMQA 2J6MA 3PXZA 5GZ9A 5HLWA 5AUVA 2WTDA 4R78A 2UZNA 2C6TA 2J7TA 2WB8A 3IO7A 4BR3A 2LGCA 3EZRA 3Q4CA 3PSCA 2BKZA 3QTQA 4HCVA 4FSYA 2UW5A 1ZOGA 4Y85A 3PJ1A 4JRNA 5AJQA 4I5CA 4XP0A 4YJRA 3BCEA 4ZMFA 2X39A 3Q32A 4FNZA 1XH9A 3FMMA 1YRPA 2QOLA 5GJFA 1O6LA 2WFYA 4XX9A 4ACDA 3LFQA 4MD9E 5ICPA 2R3IA 5J9YA 3F5UA 3FMLA 1ZOHA 3NYNA 3QGYA 3RAHA 2QR8A 2EXEA 2J5EA 1Y8YA 2OIQA 2ZDTA 3UO4A 4EWHA 2C0IA 4FODA 3HV6A 4QP6A 2X7FA 4EK3A 3F82A 3F9NA 3BLQA 4EJ7A 1PXOA 3VW6A 2I0EA 3CGOA 1XQZA 3K5UA 3D14A 4AS0A 4U3YA 1Q99A 3F66A 2WIHA 3FSFA 3OTVA 4ZTNA 1OZ1A 5JGBA 1XBAA 3PVUA 5E8YA 3ODYX 5E4HA 2C1BA 4H36A 2CLXA 2FSTX 3A4PA 3MPMA 4GU9A 1YHSA 5BUJA 5CEMA 1W2CA 1REJA 2V0DA 4WKQA 2EVAA 3EB0A 5CYIA 3Q5IA 3SX9A 4BGQA 3ENMA 2HELA 4DFYA 4G2FA 1Y8GA 1YI6A 4YZDA 2CKPA 4FSZA 3LXNA 4OAUC 5EDRA 1WMKA 3QQLA 2OW3A 4LFIA 1ZAOA 4EK4A 4BTJA 3BPRA 3FJQE 4RIWA 3NS9A 2J4ZA 4XV2A 1M2PA 1JKSA 1KE8A 3HV7A 2QOIA 4FT3A 4OBQA 3ZSGA 2R0IA 4BCNA 4QPSA 3ZLSA 3ELJA 1VYZA 4CKJA 3N9XA 3Q3BA 3FMNA 4IAIA 4A9TA 1BUHA 1KE7A 1A9UA 4CFUA 4I24A 2B53A 2HW6A 4ZP5A 2OJ9A 2O63A 2QHNA 4X2FA 4M0YA 5DGZA 1B6CB 2GHLA 2FO0A 4K18A 4O2ZA 5D1JA 3SC1A 2QKRA 3V3VA 4DDGA 2ETMA 2F4JA 4AA4A 3C0HA 4PMSA 4Q2AA 3ZRLA 3E3BX 4IVDA 3REPA 3NFGB 3VC4A 4BBMA 3Q2JA 3H9RA 4I5PA 5JFWA 4Y5QA 2KULA 5EFQA 5CF4A 4QMVA 3UZTA 3ORPA 4HCTA 3LFNA 3BQCA 3FY0A 4FSQA 5EKOA 4F64A 3BHYA 5HZNA 3TZ9A 3CPCA 4DA5A 4U6RA 4RVLA 5L2SA 5IA4A 2XNOA 5E8XA 4APCA 1PW2A 1Q8ZA 1YWNA 4KWPA 5JFVA 2W9FB 4MQ2A 4O4FA 2IW6A 5GIPE 3PWYA 4PPCA 3TACA 4PDOA 4JVGA 1L8TA 3E8CA 4L68A 2WTVA 5DWRA 2OKRA 4KIKB 2FSLX 1UNHA 1NA7A 3D7TA 3I79A 4O4BB 4AG8A 3MH3A 3U6HA 2BAKA 3HV3A 3EQCA 2G2HA 1BMKA 5DOSA 3UMWA 4PQNA 3TNIA 4USFA 1PKDA 4ZSGA 4U8ZA 4YTHA 4IX5A 1AD5A 2YCRA 5DN3A 2R3FA 4DCEA 2ZJWA 2VNYA 3BYMA 3UIBA 3VS5A 2A2AA 1CDKA 2R3RA 4GT5A 4CYJA 4D1ZA 1HCKA 2JIVA 3MFRA 1BYGA 2GS7A 3QRKA 5M44A 2HCKA 4X2JA 4I41A 5J8IA 4TYIA 3QD4A 4FK3A 3L9NA 4IW0A 5KMJA 2YM3A 3HGKA 1UU7A 4GG5A 3TEIA 4FTLA 4PMPA 5CY3A 1STCE 3W2PA 1UKHA 5L2TA 3FBVA 4IEBA 5IQIA 1J7UA 3PIXA 4FV8A 3UODA 1BI8A 3TJDA 1LPUA 3WZKA 4X0MA 2QOOA 3OT3A 2BIKB 2WMXA 4FSWA 2ONLC 4O7WA 2C6KA 4GV1A 2XIXA 3ORNA 3DDPA 3QZFA 1OGYA 4O83A 4BCQA 4UMTA 3R7UA 4U5JA 4ZTRA 3Q96A 3F7WA 3R9OA 5JN2A 1M2QA 3R63A 1OKYA 3BU6A 4RPVA 5KCVA 2WHBA 3O7LD 4EQMA 5LVLA 4F6UA 4B99A 5BUEA 3BIZA 5I4NA 3BELA 5E9EA 3PVWA 3LPBA 3NNWA 3QFVA 2F57A 2Z7QA 4RBLA 4ZJJA 3I0QA 4L7SA 4ALVA 4R77A 4DEAA 1JQHA 4EQUA 4QYEA 2ITWA 2KTYA 1T46A 3TXOA 4YC3A 4B7TA 5E8TA 3T9IA 2J0MB 2WTKC 3SRVB 4WA9A 1PRYA 4YZMA 3R22A 4FT0A 5HD4A 3KMWA 2EB3A 2XEZA 4MVFA 3ULIA 4G6LA 3CR0A 2ZV9A 1KOBA 4Z7GA 3EYGA 4D5KA 4ASZA 5AADA 4R7IA 3MY5A 4O27B 3UQCA 1HOWA 1OL5A 1H25A 3CY3A 5TT7A 3UQGA 4YBJA 2IZUA 5CVHA 4O7YA 5DR9A 5EI2A 2GNGA 3GCSA 2P2HA 3E62A 5EHYA 3FYJX 4AN3A 2VO7A 3DB6A 4AXAA 2X6EA 2ITNA 4C2WA 2WO6A 5HCXA 3Q2MA 3OWJA 5K9IA 5IA1A 3ERKA 2FA2A 5GNKA 5FM2A 4H1JA 3LCDA 4QPMA 4TNDA 4IAKA 5H3QA 3IGGA 1V0BA 2PHKA 3QQUA 3A7IA 1Y91A 1ZOEA 4BGHA 2BRHA 5IQAA 5ANEA 1H1SA 4ACCA 3DZOA 4IVAA 3DNEA 4S2ZA 5AR5A 3R9HA 4F1OA 2AC5A 3GU7A 3P7BA 3MJ1A 4LRMA 4MH7A 5CNNA 4TL0A 2Y6OA 3FL5A 4EOOA 2YWVA 1XH4A 3U6IA 2X0QA 2HXLA 2P0CA 3R7VA 2XIZA 1ST4A 2WQMA 4RIXA 3AQVA 3H4JA 5IH4A 2PVMA 5IA0A 3FHIA 3P5KA 2UZLA 4FKSA 4O6EA 4LGHA 1YXTA 4PMTA 2WKMA 4GFMA 4YC8A 1G8JA 5CSWA 2ZV7A 4DH8A 4ZLYA 3OBJA 4AFJA 4F6SA 5EI6A 4XBRA 3V6SA 1WAKA 4FL2A 4S34A 4BHZA 5LMKA 2HZIA 2ZV2A 2GNJA 4FTNA 4PTCA 4BCJA 2HW7A 3QTSA 2B9FA 3SOAA 5KE0A 3BLAA 4QPAA 5KHWA 3AKKA 2ZM4A 4JDJA 3H0YA 3UOJA 5LVOA 5FXQA 2Y4IB 2XF0A 2PPQA 5LQFA 3OXIA 1CKIA 3QRJA 1W0XC 3T9TA 1NW1A 4PUZA 3KU2A 2ITUA 4BKZA 1KUTA 2UVYA 4KUJA 3DOGA 3A8WA 4FIIA 3C4WA 3JUHA 3JS2A 3S2PA 1VYWA 3QKLA 1FMKA 3CKWA 3MWUA 4OUCA 3ATTA 3FXWA 3W0SA 2YIRA 4NJ3A 3ANRA 3HMIA 4FYOA 4UWBA 4I4FA 5HIDA 4CZTA 3QWKA 4ANBA 3FDNA 4IB1A 4DTAA 3LLTA 1WZYA 3O96A 5AR3A 5CSXA 4PL5A 4CFXA 2NP8A 3MB7A 4FKLA 4K0YA 5FP6A 5C03A 4AQKA 4BCPA 2PVLA 1FOTA 3BYOA 3QAME 4FNYA 4GH2A 4R6VA 5D9HA 4FZFB 4PX6A 4KB8A 4KINA 2G9XA 2YITA 2F7ZE 4MHAA 2RKUA 4O0VA 3VJNA 3HDNA 3L9MA 3DKOA 5CENA 3UIMA 3WF7A 3W0PA 5L2WA 3PPJA 1VLRA 4FSMA 4I0SA 1LUFA 3FEGA 3NMUF 3D2IA 5IUGA 3KCFA 2F2UA 4EH5A 4X3FC 1OPLA 4AZWA 4FEQA 2WMRA 3JVSA 3R02A 3D5VA 3Q60A 4X2KA 2AQXA 4DCAA 3K3IA 1XBCA 1GZOA 1NVRA 3AT2A 3LM5A 4DFXE 1OITA 2QO7A 5CVGA 2Q83A 2UZOA 3WOWA 1XKKA 4JX7A 1GZNA 4G31A 1IEPA 2ZB1A 4EC8A 1KE6A 2VWXA 1DI9A 2YCFA 1KV2A 4FK6A 4J52A 4YO6A 2VWVA 3W2RA 2W99B 5CF8A 1GNGA 4DT9A 3VVHA 5KZ0A 1YOJA 3CCNA 5DH3A 3VBTA 3PJ3A 1H4LA 1ZWSA 1ZARA 2C6OA 4JJRA 3MTLA 3ZO4A 2HWOA 2E9PA 5M07A 4KKEA 2RF9A 4IAYA 4IZ5A 4X2GA 5GZAA 2GU8A 1WCCA 4F99A 2O8YA 4H58A 1XH6A 3QYWA 4IWQA 4MBLA 1YHWA 4KRCA 1JKTA 3KVWA 5CXHA 3FXZA 2OI4X 3I5ZA 2OJIA 4E4XA 1E1XA 3UZPA 3T3VA 5IQCA 3Q4TA 3PXRA 1ZYJA 4G6OA 4W8DA 4BYIA 4IAAA 4NM3A 3RPYA 4DHFA 4LOOA 4YNOA 3FY2A 3ORIA 3AC8A 2QOHA 2BZKB 3GXLA 4IZYA 3EN4A 2Y0AA 4EUUA 2X8IA 5IISA 3R01A 3TIZA 4GVAA 4W8EA 4C37A 2R7BA 1HCLA 5AUYA 4MD8E 2PVNA 3ZXTA 3VS2A 4YGAA 3DAJA 4RSSA 4Q9SA 4BDAA 4AXFA 3ZU7A 4IAZA 4M14A 4UEUA 4ANNA 2WTJA 4E93A 5M4IA 1WBWA 3NCZA 4ZTMA 2RFSA 3CJGA 4FL3A 4YC6A 5A4QA 3MYGA 4NK9A 4I6BA 3F3VA 5KHXA 5K5XA 4DHIB 3LQ8A 4EL9A 5CTPA 4MF0A 2OG8A 3IQ7A 4FV4A 1FVVA 3OFMA 3R8VA 4P7EA 4BBEA 3DCVA 4YLJA 3TZ8A