4QMQA

Mst3 in complex with cp-673451
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmqA01
3R9RA 5CEKA 3MH2A 2XRUA 4RJ6A 4ZTNA 2P2IA 2WTCA 4GFMA 4B9DA 3LFNA 3DAEA 4BC6A 5FEEA 4EH8A 3HVCA 5F4NA 5JQ8A 4FKSA 2PZIA 2J9MA 1SVHA 2PSQA 3AT3A 4MNEB 4FMQA 4XYFA 4DGMA 2OZAB 3C13A 4U6RA 4R5YA 3QTZA 1PHKA 3KULA 3ATSA 3DKCA 3W2QA 3R8PA 3VN9A 1Y8GA 4YZMA 2CKQA 4LG4A 4FSUA 2JGZA 2XNEA 2C4GA 3V6RA 1R0PA 2BRMA 4KB8A 3VWAA 3NW7A 3BYMA 4F64A 5LWNA 4XH6A 1LR4A 3LMHA 4F1OA 3DA6A 3OG7A 3CQUA 3EQIA 3H10A 1PKGA 3O2MA 2YACA 5FM3A 3SGCA 3LFQA 2PVHA 4O0XA 5CEIA 5E90A 1FMKA 1OKYA 3B8RA 4F6WA 2UW0A 3KL8A 4QTAA 4HPTE 3WZJA 3FUPA 4D2RA 5DBXA 1H8FA 2UZOA 2GTMA 3CY3A 4D0XA 4XV9A 1RQQA 3AC3A 4YPDA 4O7VA 3TZMA 4DINA 2RG5A 5CVHA 5DT4A 2WIPA 3PJ3A 4F99A 3RAIA 4FGBA 2IO6A 1FPUA 3OZ6A 4U43A 5TE0A 3V8TA 3A4PA 2ITQA 5ANDA 3S0OA 4LGHA 2VWWA 2Y4IC 4KBKA 4YJRA 1JPAA 3BGPA 4YJSA 2OJJA 4KKGA 3VUIA 3ZHPC 4KS8A 4C34A 5CAOA 3NNVA 3DTWA 4BDKA 3QFVA 2VU3A 2YWPA 1Q61A 4FICA 4RA5A 1MQBA 4WT6A 5DHJA 3DFAA 1H24A 2CJMA 3LMGA 2BRGA 1WZYA 5C4KA 2P4IA 4YBKA 4WNPA 1WBOA 3E8CA 2FO0A 3VHEA 3OXIA 4P2KA 3QD3A 5DYJA 3CD3A 2JFMA 2ZM1A 3TIYA 1H1WA 2E2BA 4EHZA 4JDIA 4AE9A 2BPMA 5CLPA 1GOLA 1M7NA 1OKVA 3K54A 3MTFA 3MTLA 4PMMA 5EQYA 3EN7A 1H0VA 3BGQA 2PTKA 2REIA 3EN4A 3OD6X 4O2ZA 4DGGA 3AC5A 4GJ3A 3NNUA 4EK3A 2J0MB 3OF0A 3BBTB 4XG2A 4C3RA 2IVSA 5BQ0A 4DCAA 2GS7A 4IXPA 4YGAA 3P7AA 5EW8A 4AFEA 4PNIA 5C8NA 3W18A 1VR2A 3ATTA 1GY3A 2OK1A 4OUCA 3CTHA 5A46A 4FV3A 4L7SA 4NFMA 2P3GX 3GU4A 1BL6A 1PY5A 4RVKA 5I9VA 3PA5A 2XH5A 3O51A 4WRGA 2GQRA 2WTDA 3FMJA 3LQ8A 4ZY5A 3R01A 4QTDA 5AAEA 3KQ7A 1ZZ2A 1OL2A 4XV2A 2C1BA 2XEZA 4G31A 3QLFA 5IUHA 5J7HA 2EXEA 3C4EA 3TNIA 3GCPA 4QMSA 3QWJA 4UEUA 1JSTA 3WF7A 3R8ZA 2WTVA 3VBQA 4L00A 3IW5A 5CTPA 4NL0A 4BIDA 4OBOA 4O86A 2WTIA 3EL7A 3EZVA 4J52A 4GV1A 2DUVA 2C5NA 3RPRA 3AT4A 1XR1A 2C6MA 2H8HA 3G0EA 3QRTA 3IS5A 3O96A 4RJ7A 3ZH8A 1FGIA 3FKOA 3BHVA 4WSYA 3F3WA 4I94A 3W33A 3R71A 4FEXA 4FTQA 4I6HA 5CENA 4M15A 1R0EA 1OL7A 3OBGA 3F7WA 3P7CA 3PA3A 5F94A 4QYGA 3U6IA 3TUCA 4GT3A 3LFAA 4LV8A 4IEBA 4ID7A 1Q8ZA 3PXKA 3WARA 1K9AA 2XA4A 4BDIA 5I9XA 4FNZA 1OB3A 4H3BA 5F95A 4BCFA 4U9AA 5FP6A 4O84A 1W82A 1FVVA 4R6VA 3DBEA 4A07A 3MA3A 4AN9A 5HE2A 3ZDUA 4XOYA 1H00A 2BDWA 1PJKA 5FTOA 4LV5A 3RZBA 1PKDA 5M44A 4FEVA 2G2IA 2JKOA 4IMYA 3Q9XA 5DWRA 3A60A 2WPAA 4K77A 5EQEA 5DGZA 2XNGA 2OU7A 4G17A 4F0IA 2B55A 3MPMA 3PIYA 4YO6A 1BX6A 2KTYA 2YDKA 3I4BA 5D7VA 3UP7A 4W4XA 2UW7A 5EKNA 3FEGA 1STCE 3LFCA 4FIIA 3R7IA 3KXMA 3FLZA 4NFNA 3MIYA 4I23A 3MH1A 4DH5A 3UO5A 5J1VA 1DI9A 3N51A 4K9YA 5I9WA 1IG1A 3OT3A 4FL2A 4PTCA 5I3OA 3PLSA 3WIKA 4AOTA 1ZOHA 3KXZA 4GCJA 4TKSA 2QD9A 5IQHA 3D5XA 3F88A 3C50A 2ETRA 3GXLA 2ITPA 3R21A 3WIGA 5K9IA 2B9IA 3E63A 3QXOA 3R1YA 4GYGA 3A7HA 4J95A 4S2ZA 5CU2A 3WZEA 3DBCA 4YJOA 5C01A 5J5SA 3LXLA 4ZSJA 2J90A 2Y8OA 4DEAA 4EK8A 5LCKA 3O71A 4JDHA 4J99A 3HMPA 4Q9SA 4RX9A 2Z7RA 3D5VA 2BIKB 5HIBA 5JFXA 2HXLA 4J8NA 4D55A 3U55A 2XBJA 3ZLXA 4AA4A 3PSBA 4XBUA 2RFEA 3ORMA 4MD7E 3FXXA 1REKA 3UMXA 3QTIA 1UWHA 4L42A 5FM2A 3L9MA 3BHHA 1J1BA 1MP8A 2WIHA 5E9EA 5K0KA 2WO6A 3P86A 2OJGA 4JDJA 3EQDA 5L2SA 2PPQA 3R28A 4MQ2A 3Q5ZA 4FVRA 4S30A 3ZDIA 1W8CA 2QR7A 2C3IB 1CKJA 3F3VA 3KMMA 4FKIA 3ZFYA 5I5ZA 3G5DA 1Q24A 3VF8A 4NKSA 3T3VA 2OIQA 1TQPA 1Y8YA 2IPXA 4FV0A 4L8MA 3UOKA 2R0IA 3R2BA 3UVQA 2C3KA 2XNOA 5L8LA 5LWMA 2IW6A 3JVRA 4BZDA 1SZMA 2W17A 5LQFA 3RBWA 4R7IA 1HCLA 1PMEA 2HZ4A 3IW8A 4PPCA 3FV8A 3PZEA 1S9IA 3UIMA 3FAAA 3VBVA 4QQ5A 2OF2A 3ZO3A 2RFDA 4Y83A 4FV7A 3LZBA 2F4JA 4J8MA 5TKDA 4ANBA 5I4NA 2VTTA 3MVHA 2ETKA 1JBPE 4R3CA 4UZDA 2BILB 4FG7A 2W4KA 5AP5A 4IZ5A 3T8OA 2W05A 5EHYA 2EUFB 3F2NA 4ZY6A 2XK8A 4WBOA 4F6SA 4PMPA 5JFSA 3LFFA 4ALVA 3N9XA 2UW9A 5CYIA 1UV5A 2V7OA 2I0YA 2XKDA 4FNYA 1GZ8A 3KRJA 4QTEA 3R2YA 3GOKA 3ULIA 2BCJA 4IE9A 4RIXB 4UALA 4WNOA 2X6EA 1M2PA 3RPVA 3V8WA 4AGUA 4AZWA 2O65A 4HCUA 3AMAA 4EKLA 3AOXA 4RJ3A 4E5WA 3MJ2A 4AA0A 4QT1A 4BF2A 3I7CA 2ONLC 2VO6A 2JKQA 4G3CA 3FWQA 4G3FA 2PVKA 3L8SA 3EYGA 3LFSA 3ODYX 4PDOA 5HKMA 4MNEA 3KKVA 5IH4A 5IQBA 4RWJA 3A7IA 3PVBA 3QQHA 2OZAA 4R1VA 4C4GA 3IQ7A 4RJ5A 4BDFA 2QKWB 4L52A 4HOKA 4WG3A 5BMSA 3Q5IA 2BUJA 2PMOX 4BKYA 3WILA 5EM6A 4F9WA 4AGDA 3RPOA 4YNOA 3ORIA 4PQNA 3M42A 3F3UA 4EOJA 1OUKA 2FSTX 1IASA 1W84A 5HG9A 4MQ1A 3UODA 4AN3A 2YZAA 2H9VA 2FH9A 5J1WA 1ZWSA 3LXKA 5EW3A 3LJ2A 5TO8A 4JBQA 3U6JA 4R7HA 3R6XA 3MFUA 4C36A 4QPMA 1PXPA 3MIAA 5E8WA 4O7LA 4LM5A 4OBPA 2VO7A 3QUEA 3SAYA 2XP2A 3KCKA 4FKLA 4AT4A 2OKRA 5A4EA 3BE9A 3HP2A 2GMXA 4IAFA 3IDPA 2CCIA 4YMJA 5CSXA 4X21A 3LE6A 4AAAA 4RRVA 3R7YA 1OKZA 2H34A 4IWPA 3AT2A 4DH8A 3CR0A 4I41A 5IQDA 1YWNA 4IAAA 3QL8A 4WKQA 5I9ZA 2CNUA 1SM2A 4C4HA 5DT3A 4BHZA 3I6UA 5JH6A 5FXSA 1OL1A 1F3MC 1YOLA 2CKEA 1UNGA 3MFSA 4O6EA 4P7EA 1F5QA 4FSQA 3NWWA 4IZAA 4JBVA 4DEHA 4IWOA 5HLNA 2X8EA 3CGFA 3CD8A 3UQGA 3C7QA 2B53A 2XKCA 3CKXA 2OG8A 1SNXA 1YDRE 4JG7A 4BBMA 5IMEA 3C0IA 2PZYA 4GYIA 4ACCA 4BI1A 2JKMA 4V04A 4WIHA 3QAME 4AGCA 4BDHA 4ZTQA 1OL6A 2GTNA 5E8VA 4O96A 3ZLYA 2PMIA 3UYTA 4USDA 3IPHA 3POOA 4F0FA 1UKHA 4FT5A 1WBWA 4RJ8A 4BCKA 1XH8A 4UV0A 4PDYA 2C47A 1XH4A 1O9UA 2ZYBA 3C4CA 4K8AA 4KIKB 4CT2A 2JC6A 4C59A 3U8WA 5FWKK 4P4CA 3E93A 3SRVB 2OJIA 4GH2A 5KHWA 3FZOA 1PF8A 3ZFXA 2J5FA 2XS0A 3H9FA 3EN6A 3Q60A 4FKUA 4JI9A 5CXZA 5BVDA 3KFAA 5J9ZA 4IB0A 3LM0A 4CQEA 2GQSA 5IA3A 4CRLA 5IQEA 4NJ3A 2PY3A 2WMUA 4U5JA 2WMBA 5DPVA 4IQ6A 4D4YA 3BPRA 4EH6A 4IDTA 3E8DA 3LLAA 3Q9ZA 3DQWA 5AV0A 2XYNA 3KRXA 4MCVA 3LM5A 5HNBA 4B7TA 5HTBA 3EIDA 1Z5MA 4EH3A 2VTHA 5AR8A 2J51A 5JRSA 4R78A 3UVPA 2ITUA 4O0VA 2GHGA 3NUSA 3NW5A 4NWMA 4XOZA 1BLXA 4YJNA 5H3QA 3BEGA 1MRVA 3SXRA 2R3LA 3G0FA 3LCKA 4JAIA 2ITVA 3G51A 3G15A 5J87A 4AW0A 1FVTA 3QGYA 3PVUA 5H8GA 2JEDA 5JFWA 4L44A 5AADA 3CC6A 4FSYA 2QHNA 4RC4A 3GU6A 3C0HA 3BWJA 4RZVA 3KMWA 5HG7A 3BV2A 5D1JA 2CDZA 1EH4A 4DEEA 2F7ZE 3AMBA 3MFTA 3MH3A 4QMUA 2BHHA 4R1YA 4ZSGA 3GQLA 2ZB0A 3LXPA 4GL9A 4ACMA 3CQEA 4M0ZA 4IANA 2B1PA 4U3ZA 5ETFA 4BBFA 2VZ6A 4S34A 4QYEA 1ZYSA 4OTHA 4ANOA 4E73A 3SX9A 2XEYA 2PVFA 4FYOA 4MXCA 1OZ1A 4XP3A 4ANLA 5M06A 3EKNA 2Z7QA 3DZQA 2F57A 3R1SA 2W96B 1LUFA 4EORA 1Z57A 3I79A 5A4CA 4G6OA 3WF9A 2ZDUA 3DB6A 2XNBA 4EZ7A 1PYEA 4XG3A 3LCSA 5GJGA 2VX1A 5HICA 4BTJA 1H25A 1AD5A 4L6QA 4RWLA 3RK7A 4NTTA 4TZRA 4U41A 3ZYAA 4BL1A 4HYIA 3Q9YA 3QZGA 3ID6C 4A9RA 4WNKA 2WTKC 4G3DA 3B2WA 4RA4A 2WTJA 3MS9A 4O0TA 3W2CA 4AW1A 3P4KA 2XIYA 4LOQA 1H0WA 4D0WA 2YAKA 3NMUF 3TNPC 3BE2A 3DFCB 1QPEA 2R3RA 4G1WA 4FKQA 3Q32A 2ZV9A 3UOLA 2PL0A 4MWHA 3BELA 4QPAA 3TTJA 5CF6A 4O7TA 5E8ZA 4ZSLA 5AAFA 4IAYA 4YLKA 4XLVA 4EBWA 4JIAA 4J98A 4PMTA 4WRSA 2VTAA 3R1QA 5EHLA 3ACKA 4EYMA 3VBXA 1LEZA 4BR3A 4C2WA 1S9JA 4RVMA 4TYGA 4A9UA 3ZM9A 3E8EA 4FKGA 3VS6A 3SC1A 2ITZA 3NW6A 1CSNA 1I09A 2QO9A 5E1SA 4O2PA 4YHFA 5CAPA 4X0MA 2PE2A 5HX6A 3D14A 3HA6A 2WQMA 3DOGA 3F9NA 4AA5A 4GW8A 4A7CA 5JGDA 2WTKB 4OT5A 5DR6A 3DQXA 5IH6A 5EQPA 5GJDA 3TKUA 3CPCA 3FSKA 4EUTA 1H07A 2ZB1A 3NEWA 2FVDA 3HMMA 4W9WA 3HGKA 3TEIA 2X4ZA 2ITNA 5CF4A 3FZTA 4U44A 3QTXA 2UW5A 2ZVAA 4I20A 4OAVB 3VF9A 3FLSA 3JYAA 3DBFA 4FIEA 3GNIB 2V55A 2WAJA 4JVGA 3C4ZA 3FJQE 3I0QA 4GG7A 4HVDA 4FV8A 2HENA 1U4DA 4OR5A 5KMOA 2XZSA 5EOLA 4QTCA 4CKRA 3Q2JA 5CVGA 4QOXA 1URCA 5DN3A 2YM5A 2GPHA 3NS9A 3A2CA 1OPJA 5A3XA 2X1NA 2IW8A 4ENXA 4H1MA 3AG9A 3RAKA 3HMNA 4AU8A 1RW8A 3D4QA 3NUPA 1YXSA 2IG7A 2YERA 2WEVA 3W2SA 3ZLWA 3UZTA 3PE2A 4KIPA 4DEGA 4LRJA 1VEBA 3BI6A 4HYHA 2R3NA 3G2FA 4U0IA 4NJDA 2VWUA 4MH7A 5EKOA 4DTBA 3S3IA 2BVAA 4AG8A 3MB7A 1OM1A 2XIRA 3MVMA 4XNEA 2WOTA 4I21A 3DAKA 4RQVA 2CNVA 4RIYB 3DLZA 4FKOA 3R7GA 1OIQA 4GK2A 5I3RA 1KV1A 4FZ7A 3ZTXA 3ORTA 3L8PA 4EK4A 1XQZA 2R7IA 3BYOA 3D7TB 3VW6A 3R73A 5FDXA 4EQMA 1QPJA 5AP3A 3VO3A 3IONA 5BUIA 3VUGA 3QRJA 5DMZA 4Y8DA 4FTRA 5BMMA 2H96A 3F2RA 5CEOA 4RLLA 4ZTSA 1PXOA 4KSPA 4PF4A 3ROCA 3JUHA 4GT5A 4AFJA 4PTEA 3RP9A 4YHTA 2GNFA 2XF0A 2VTRA 1O6KA 1YKRA 3HZTA 3LLTA 4JR3A 3VULA 1LPUA 2B54A 2ZMDA 4LGDA 1NVQA 3PLAE 3LW0A 1QPDA 3DPKA 1YI4A 2F9GA 4FC0A 3LJ0A 3BKBA 4FKTA 5A9UA 3QCQA 4RT7A 2PMLX 3BYSA 4HYSA 4RG0A 4KS7A 2BRBA 1BL7A 4BVUA 4ACDA 4RIXA 4CFVA 2PE1A 4W9XA 3MA6A 4D2SA 5L6OA 2G2FA 2XIXA 3ANQA 3EWHA 3PRFA 3ZCLA 1JOWB 3K3JA 5HU9A 1Z9XA 1UA2A 3A62A 1YWRA 3MPTA 4N6YA 2YIYA 3BQCA 4IX4A 3IK3A 4KAOA 4OT6A 3O50A 4AT5A 5IQIA 4I0TA 2GNIA 3M2WA 4PPAA 4ACGA 4ALWA 1OBDA 4UXLA 4XS2A 2YM8A 3HRBA 4PV0A 3UIXA 3EH9A 4O0RA 4Z7GA 4F1TA 5FTGA 2VWIA 2Z02A 2W0JA 4HW7A 2QOIA 2QODA 4FUYA 3FZSA 3NDMA 5FGKA 4QMNA 2PMNX 4W4WA 1FVRA 3VC4A 4OTGA 5M4FA 3PVGA 3E7VA 4OTRA 4E6CA 3O7LD 5CAQA 3TNWA 3ZEPA 2I0VA 5DR9A 3UC3A 3VQUA 4O7WA 1YHWA 4V01A 5CEPA 4GKHA 1SVEA 2XCHA 5JZNA 2OLCA 3OW4A 2Y9QA 3GFWA 5CAVA 4I24A 2J0IA 4R8QA 3UQFA 1SYKA 4QP6A 3W32A 5HNGA 3KEXA 1O6LA 4ZTLA 3OROA 5AR4A 3QGWA 5EFQA 4APPA 2X2KA 2GHMA 2WQBA 5EI6A 4I6BA 3TWJA 5HLWA 3F5XA 3UZRA 4GK4A 3ZMMA 4FF8A 5DRDA 3RPSA 3NGAA 4RGJA 2PYWA 5CSPA 3NIEA 5I0BA 3UP2A 3OFMA 3FI3A 3A7FA 3DJ7A 1H28A 3AC1A 3BIZA 3HUBA 5CEMA 4RVLA 4K0YA 3LFBA 5BVOA 1MUOA 4WUAA 5JK3A 5K4JA 4ANSA 4FE2A 4C02A 3NNXA 4YJQA 5K4IA 1OBGA 3JVSA 3GFEA 2X0GA 1Y57A 3HNGA 3L9PA 3M1SA 4GSBA 5KMKA 5KMIA 4O1OA 1OPLA 3GC7A 5GZ8A 2FUMA 3ENMA 5ETAA 4PP7A 5AMNA 2UZVA 3UPXA 5J5TA 4YUQA 2GNJA 3PY3A 4H3PA 3RAWA 4CZTA 1TQIA 3QZHA 5HVYA 3TZ9A 1URWA 2HW6A 4IVAA 1JKSA 4GK3A 2X39A 2BDJA 4O0SA 2A0CX 3NR9A 4CCUA 3HKOA 3H30A 3BX5A 4KIKA 4KNBA 4B8MA 4I22A 3R7OA 2UZNA 4QP1A 3SRVA 5KBRA 2PU8A 3SW7A 2OZOA 3TZ7A 2JITA 3UTOA 4CVAA 4ZK5A 1H1SA 2JAMA 3KRWA 5AR2A 4U7ZA 4L46A 3G9LX 3QUPA 4ZLZA 5C8KA 1Q3DA 4C3FA 1Q8TA 2A19B 3FKNA 3OCTA 2ITOA 5BVEA 3K2LA 3DKGA 4EH7A 3MW1A 1T46A 4DFNA 3SVVA 2OJ9A 2R3FA 4HGSA 5IQGA 4UMPA 5HLPA 2JFLA 4EOMA 4ERKA 1YWVA 3DU8A 5TF9A 4NW6A 5AM7A 3W8LA 4Z55A 5LOHA 3F82A 4I5HA 3NCZA 4IWQA 5C4LA 1ZZLA 4QMWA 2CPKE 4S32A 4O7NA 2VTOA 3W2OA 4JIKA 4RBLA 5D12A 2G2HA 4TWCA 3I5NA 5LXMA 3GU5A 2PZPA 4DN5A 4M67A 5AR5A 1JSVA 3PJ8A 3BGZA 2X9EA 1W7HA 4BDBA 1ATPE 5M51A 2ERKA 3FC1X 4FI1A 4F70A 4RFZA 3OUNB 3AD4A 4G5JA 5H8EA 4E1ZA 4E4LA 4E6AA 4IX5A 3C0GA 4WO5A 3MFRA 2WTWA 3ZRKA 3S4QA 4QMLA 4ZLOA 1LEWA 1R3CA 1AGWA 4QNYA 1M14A 2OW3A 2WMTA 4QD6A 3CCNA 2QOCA 5KMNA 4BGHA 3FY2A 3PIZA 3WE4A 3WF6A 4CZYB 3H3CA 3KN5A 3EMGA 5IMXA 4ZTMA 2J50A 1JLUE 4M8TA 4O1PA 1IA8A 3PJ2A 5DIAA 4BCQA 4BCOA 5BUJA 2R3MA 2W1EA 3GQIA 3EQCA 4XLIA 3Q52A 3UO4A 3FZPA 3JS2A 4FTOA 3NNWA 5FRIA 5B2MA 5BNJA 1BKXA 2DQ7X 3IKAA 3HV7A 4UWYA 2P55A 4AACA 3THBA 2YJRA 3CJFA 3UNJA 2QOBA 4EOOA 2UZBA 3UPZA 1FQ1B 5D11A 2CMWA 4YJPA 2V22A 2UZUE 3LCTA 3E62A 3RWQA 4L53A 2RG6A 4CQGA 3FYKX 5KUPA 2RL5A 2WGJA 4NU1A 4O83A 3D5UA 3COKA 3R04A 4IHPA 4FR4A 5ANEA 2XK3A 4P5QA 2EXCX 4FZAB 4JBOA 5L3AA 1ZRZA 3NZ0A 4QMZA 3LFEA 2Z60A 4RX5A 4DHFA 2QLUA 4L68A 3QTUA 4MAOA 3UO6A 1BI7A 1YHSA 2BIYA 5HU3A 3Q53A 2C5YA 4DFXE 5EOBA 5AA9A 4ASEA 3B8QA 3QQKA 2R3IA 3FSFA 5CF5A 3PZHA 2QOHA 2C6KA 4JNWA 3PP1A 1H01A 3EFLA 1YOMA 2J0JA 3H9OA 3FY0A 4FTUA 3VS4A 1KSWA 1QCFA 4DG0E 4RC3A 5I9UA 4F7SA 1UU8A 4II5A 5HO7A 4G6NA 2NRUA 4AWIA 2WNTA 4M97A 3EHAA 4MEDA 5HO6A 4CEGA 3I81A 4ASZA 5E92A 2WD1A 1NXKA 4L3PA 2BFYA 2YJSA 4NH1A 4CD0A 4YZ9A 1Q8YA 4M69B 1YQJA 2R3GA 3SA0A 2JD5A 4MYGA 5G6VA 4EL9A 4NZWB 5IA1A 3ALNA 4Q5HA 4CV8A 1U5RA 2GFCA 4JXFA 5ANGA 4CFUA 4M68A 4I5MA 1KE8A 2EU9A 5F9EA 3VS0A 2Y4PA 5ETCA 4XP2A 3PYYA 5IA4A 1PYXA 2FSMX 3VJOA 3CBLA 5AX9A 2R2PA 3F69A 2WQOA 4U3YA 5IG1A 4YJVA 3VBTA 4ERWA 4FZ6A 4XUFA 4BTMA 4TYIA 1JSUA 2J7TA 2Y6OA 3EYHA 1XHAA 3IGOA 3PSDA 5AIKA 4EOIA 3FI2A 2F2CB 3GEQA 1ZMWA 4E6QA 4TL0A 2EWAA 5IA2A 5I9YA 4Y85A 1Q99A 2ZMCA 2UUEA 1RDQE 1U54B 4RIYA 4P5ZA 3Q3BA 4X2NA 1KOAA 4MX9A 3SW4A 5HTIA 3OEZA 3SXFA 2I7QA 2VWXA 4UMQA 4EOQA 3CQWA 5GZ9A 3D7TA 1WCCA 4LYNA 3OXZA 4IJ9A 4K2RA 4P90A 3QRUA 3ZONA 4BDEA 3QHWA 3FMKA 2ZDTA 4K33A 5GIOE 1ZYLA 2YCRA 3ZLSA 5HTCA 2BZKB 5M4UA 4EWHA 4RFYA 1WVXA 2XB7A 3FLQA 3HMIA 2VTIA 4TWPA 3K3IA 3HDNA 4GMYA 2C0IA 1HOWA 2R5TA 4FT3A 2HWOA 3QTWA 4IM0A 5AP0A 1GIHA 2PVLA 4N0SA 4E3CA 4WSQA 4CRSA 3T9TA 1E9HA 3DBDA 4FKRA 5JQ5A 4UMTA 2HY0A 3V8SA 3Q04A 4GVJA 2RF9A 2HAKA 4IH8A 2Y0AA 3GU8A 3ZU7A 4AF3A 4D2VA 2W9FB 3LHJA 2QKRA 4X6QC 5DT0A 4APCA 4DH7A 1WVYA 3QTRA 3QX2A 3C1XA 3RINA 2IZUA 3FLNC 5CU6A 2OFVA 3DLSA 5IU2A 5ACBC 4YLLA 1IA9A 1K3AA 4HZRA 4MVFA 3RAHA 5L2WA 5GNKA 1XH5A 3GC0A 1YVJA 3KY2A 2ETMA 4FT7A 2PUPA 2QHMA 3MVJA 3VUMA 4AX8A 4O7YA 4C3PA 4AOJA 4BN1A 3JY0A 4BFMA 4C4EA 4E8AA 4FTKA 5B2LA 3MI9A 2W99B 2W5AA 1Q8UA 3BHYA 4DFBA 4TWNA 5ANIA 3IW6A 3NAXA 5IPJA 5A54A 4DFYA 4B0GA 5CU4A 2JIVA 3V6SA 3LKMA 4RZWA 1GNGA 2C6EA 3NLBA 4ZTRA 3QLGA 3RGFA 4DG2E 2I0EA 4ZSAA 3N4VA 3FHRA 1UU7A 4ITJA 5FEDA 2BHEA 3C51A 4FT9A 5HVKA 5IEXA 3KN6A 2HYYA 3H9RA 3EFJA 3S2PA 2C3LA 3NPCA 4ZXTA 5FQDC 3NUUA 4EC8A 2WELA 3MYGA 3BLHA 2VTJA 2YDIA 3QUDA 1PRYA 2CLXA 4F08A 2W4OA 3P1AA 3DXQA 5DR2A 5AV4A 3QQUA 3FI4A 3DB8A 3FXZA 1SVGA 5KMLA 4PY1A 5AV3A 4A06A 5B0XA 3FZRA 5BVNA 1ZAOA 2OH0E 5EYDA 2X2MA 5C26A 2PZRA 4JL9A 2YM6A 4C57A 4QQJA 4EI4A 2BRNA 2XK7A 3U87A 1NW1A 4ZMEA 2WEIA 3NUYA 3TV7A 4OTPA 5L8JA 3P23A 4BCIA 4BCJA 4RIWB 2VN9A 3UNZA 4CFNA 4GFGA 1WBVA 3ZZWA 5FXRA 4BGQA 3D5WA 4LL5A 3CY2A 3OUKA 5J95A 3GENA 2PUNA 2FA2A 2VTQA 2XK6A 2Y6MA 5LMAA 3EL8A 3TACA 4FZDB 4O22A 2VO0A 2W1CA 1WMKA 3B2TA 2RKUA 3KMUA 4W4VA 3DXPA 3EQBA 2QOLA 3NRMA 2A4LA 3R83A 4I1ZA 3BEAA 2YABA 1V0OA 3ERKA 4CFXA 1PMUA 4EJ7A 4N70A 3MESA 4FOCA 4NM0A 3PXZA 5IZFA 4G9CA 5CI6A 3N4UA 2RFSA 3PIXA 4FZFB 3PG1A 4QMYA 3W2PA 3ZSGA 5HX8A 4C2VA 4TYHB 3RNIA 2W9ZB 3ZXZA 2GQGA 2W1DA 5LVLA 1B6CB 3A8WA 1YXUA 2UVXA 3FQSA 3CKWA 2HIWA 5FTQA 2C6LA 5HQ0A 2OWBA 4XRJA 4KKHA 4R5SA 3QD2B 3F6XA 3W1FA 3SXSA 2O5KA 4FSMA 4LRMA 5M07A 4XBRA 5JZJA 3D83A 2O3PA 4HGTA 4M84A 4CYIA 2J4ZA 2WU7A 5DE2A 2BKZA 5KO1A 2UVYA 4YJUA 4X3FC 1P4FA 4O81A 1I44A 3R7UA 2AUHA 4G9RA 5CS6A 2NP8A 3PWYA 3EQFA 4ARKA 2VX0A 3CP9A 2UZDA 2XUUA 3P08A 3ET7A 4BKJA 2IZRA 4MBIA 3P0MA 4I0RA 4JDKA 5DOSA 3VNTA 4ALUA 3AGMA 4IZYA 5L2IA 2BRHA 2HOGA 3NYNA 4HJOA 5GINE 2XKFA 2A27A 4E6DA 4BB4A 1OMWA 5BYYA 5HNIX 2XM9A 4Z16A 4WHZA 1MRYA 2R3HA 3ELJA 3ZFMA 4QYHA 3HP5A 4X2GA 3CTQA 1IEPA 3P9JA 3F66A 4U40A 2J0LA 1Y6BA 4X2JA 3UJGA 4IFGA 4QRCA 4UYNA 4C37A 4CMTA 3PWDA 4E93A 2VGPA 4YO4A 3SG9A 3F61A 5EI8A 3VHKA 4FYNA 3VUKA 2UZTA 3AQVA 4I4EA 3EQHA 4YJTA 5J7BA 3SHEA 4EHGA 3RPYA 3WZDA 3U9CA 2CGVA 1BUHA 3VBWA 4X3FB 2ZV8A 4FK6A 3FKLA 3LCOA 4MD9E 3NUXA 1J7IA 2IZTA 2QG5A 3LFDA 3GC9A 3BHUA 4FL1A 4O6LA 5GJFA 3GCVA 2XYUA 4NM3A 5KNJA 4ZIMA 3CIKA 3ORPA 4I5CA 2EVAA 4E4XA 2E9VA 3Q2MA 2O64A 2QURA 2VWZA 5CNNA 3VS3A 4IB3A 3RNYA 4W8DA 2Q0BA 3PTGA 3U54A 3E88A 1YI3A 3QWKA 4NUSA 4DGNA 4IAIA 3ETAA 4EZ3A 3KXNA 1U46A 4M66A 5KE0A 3QQLA 2XJ0A 4GIIA 1KUTA 4BCPA 4F7LA 3BYUA 4EH2A 1PXJA 2VTSA 4AT3A 3KVXA 3QRIA 3W55A 2CLQA 1G5SA 4A4LA 2PVNA 3Q4ZA 3ZUVA 5BPYA 4O0YA 4LUEA 4RJ4A 4D1XA 1M17A 3SG8A 4BI0A 4J96A 5IUGA 3BU5A 4MKCA 3PPZA 3HAMA 4D9UA 4RWKA 1CKIA 2YN8A 5HBJA 5BX0A 4NK9A 3MPAA 2B9HA 5C9CA 3HX4A 4FTNA 4E26A 5M09A 3KRLA 5HE1A 4M69A 3OBJA 3MY1A 5KX8A 5EDPA 1JWHA 3VS2A 3PXFA 4HVGA 4L7FA 2XM8A 1MQ4A 2OIDA 3OY3A 5J79A 4TXCA 2O0UA 5ANKA 3WZKA 3EZRA 4R3RA 4RC2A 4YTIA 3R7EA 2HZNA 4C58A 3OWLA 2C69A 4QMVA 5ITAA 4FTMA 4MF1A 2LAVA 2XNNA 4IACA 1WBTA 1YW2A 3KC3A 3QC4A 5TOZA 3ULZA 2XJ2A 3K5UA 5HO8A 4GU9A 3F5PA 2ZOQA 1Q4LA 1YOJA 4A4XA 3V04A 3CSVA 4HNIA 4E5AX 2X4FA 2WMXA 4NCTA 1PXMA 1FBNA 3C9WA 4IAZA 3NX8A 1U54A 2NRYA 4I93A 3V5PA 2W5HA 4GS6A 2QI8A 4DEDA 3FPQA 2PHKA 4ZOGA 2WQEA 4XEYA 5FEQA 5AUWA 3G33A 4Q9ZA 3MY5A 5EM5A 2VNYA 2BDFA 5EDRA 3DS6A 3TKHA 1ND4A 2HELA 3Q96A 4ANQA 3KVWA 3C4FA 5HCYA 3V5TA 5CZIA 5A4TA 5JMSA 4OTIA 5JKGA 3SQQA 5KMMA 2FSLX 4HYUA 4FOBA 4KRCA 5M08A 2VNWA 2WFYA 3UOHA 4USFA 3RHKA 3JY9A 2NNWB 3LAUA 3WE8A 2DWBA 4BCGA 4H05A 4YTFA 4O82A 3F3TA 4KBCA 3M11A 4WUNA 4NKAA 4B4LA 3OWJA 2XIZA 3BBWA 4AQCA 4BBEA 4FUXA 4R77A 2BKKA 5L6PA 3A7GA 3HMOA 4FIFA 3ZOSA 4IM2A 3FQEA 4AW2A 2QCSA 1NA7A 4U80A 4E5BA 2GHLA 3Q6UA 4X7QA 1M2QA 2VV9A 4M12A 4MHAA 4NSTA 2PE0A 4PL3A 5AV1A 4J53A 4AOIA 3BV3A 3HDMA 3V5LA 4PL4A 4BIEA 1P5EA 4IFCA 2BZJA 5HORA 1QPCA 3OEFX 5HBHA 4AZEA 2YDJA 4UY9A 1IAHA 5KZ0A 5L2QA 3TV4A 3ZRLA 5EM7A 3O8PA 5EHOA 4MTAA 4CTBA 1FMOE 1H1PA 4H1JA 5BVFA 3U4UA 1W0XC 3R22A 5D41A 4EH4A 2BALA 3HECA 5AIRA 4O38A 5JGBA 3HV6A 2AYPA 1XBBA 3SOCA 4O7ZA 4FVPA 4CLIA 1YXVA 2GNHA 2SRCA 2YIQA 4OW8A 4A4OA 1CMKE 2IW9A 5C8MA 1VJYA 3KF4A 3OTUA 4F7NA 4DBNA 1Q5KA 3KXGA 3VBYA 4O7SA 3ZUTA 3MGYA 3AD6A 2R3OA 2X7OA 3C4WA 2C1AA 3DDQA 5CALA 4ZJIA 2C30A 3REPA 4UN0C 5LVPA 5HE3A 3OXTA 5AR7A 4GJ2A 4GKIA 4JQ8A 1PXKA 5LVNA 1R78A 2HZIA 4LMNA 3QYWA 4IAKA 4H3QA 4QYYA 5KMJA 2R4BA 5EW9A 4IC8A 1ERKA 1KWPA 3CXWA 4RFMA 4DITA 4RX8A 3IECA 3PE1A 3OOGA 4TYJA 4YPSA 1WBSA 2C6DA 4C4JA 4RIWA 4H36A 4DE4A 3E8NA 4IWDA 2ITTA 2QO7A 3QTSA 4FVQA 5CASA 4AZTA 3A8XA 3GU7A 3QQGA 3QF9A 4PL5A 3GCUA 5G1XA 4F9AA 2BMCA 5BVKA 1GIJA 4EBVA 3A61A 3R30A 4L3LA 1VYWA 3IGGA 4YZBA 4M0YA 4A9SA 3C5UA 3RK5A 4FNXA 2ZM4A 2EB2A 3OCSA 3W10A 4DEIA 4FSZA 4Z7HA 3NYXA 1M52A 2CGWA 3FMMA 3QKLA 5T6KA 5K5NA 3VUTA 1JKTA 4ASDA 2WKMA 2YEXA 4JX7A 3QRKA 1V0PA 3DK6A 1OECA 2QONA 2X7GA 3AD5A 4KINA 4MBJA 5E8TA 5AUYA 5E8XA 3VS7A 4EEVA 3V5QA 5CVFA 4IX3A 4MXAA 2RGPA 2ZV7A 3PJ1A 3QXPA 4FSWA 2QC6A 4BWXA 3UIBA 3W2RA 3MY0A 3ZS5A 2CNQA 4OTQA 4A9TA 5AP7A 3G90X 3GT8A 3HLLA 4ZTHA 2FYSA 3E3PA 1OI9A 5EDQA 3QTQA 3TV6A 2LGCA 3D2IA 4EKKA 5BUEA 4YHJA 2AC3A 4F0GA 2QOOA 5C1QB 4X2KA 4WA9A 4OAUC 4M7IA 2PK9A 3PPKA 4XG4A 3DXNA 3D9VA 4E4NA 1WBNA 2C5OA 3I6WA 4KBAA 4QTBA 2XVDA 4AS0A 3FQHA 3PFQA 3QKMA 4S33A 3O8TA 4YLJA 4XHKB 5AAGA 4NIFB 3UIUA 4OTWA 2ERZE 2C68A 4TW9A 1Q97A 2WB8A 3HL7A 3OP5A 4OTFA 4DC2A 2YCFA 2WOUA 5B2KA 2UW4A 3MN3A 4J97A 5J8IA 4X3JA 3D0EA 4PPBA 5AP2A 4G3GA 5CXHA 3VW8A 4ORKA 3QZIA 2XK9A 3BU6A 5AP6A 2VGOA 2QOFA 3QHRA 2JLDA 4FKJA 1IR3A 2R64A 4MBLA 4BZOA 4CLJA 4M14A 2ZJWA 5HGIA 1GIIA 2QOKA 2QO2A 3EN5A 2R7BA 4IIRA 1KE6A 4FV1A 3LXNA 3ZM4A 4PX6A 4YU2A 2B9JA 4PTGA 4WD5A 1FOTA 2YM3A 4L01A 2PVMA 4DGLC 2R3QA 5A4LA 4CCBA 4Y72A 4XRLA 4Y73A 5BYZA 2JKKA 2QQ7A 1WVWA 4X3FA 5IEYA 2HY81 3W8QA 3DKFA 3NSZA 3IDCA 3QQFA 5DRBA 2O2UA 4CG9A 1YRPA 4Y46A 4Z9LA 5IUIA 3F3ZA 4FTTA 3BHTA 1OPKA 1OL5A 5CEQA 2UW8A 5T68A 4BDDA 4CKJA 3FC2A 4ITIA 4YR8A 4IB1A 1H08A 3ZZEA 4ZZOA 3ANRA 3ALOA 4FV2A 2W06A 3PPJA 2OIBA 5CSWA 3FPMA 3I1AA 2QOQA 2X8DA 4ITHA 2VTPA 4C35A 2F2UA 4D1ZA 4YZNA 2C6TA 2C6OA 2F7EE 2GFSA 4UYAA 2YM4A 4S31A 3K5VA 1H1QA 2IVUA 4FSTA 3VUHA 5LMKA 4UMUA 2R9SA 5M53A 3RALA 3GI3A 4HVHA 1BMKA 4GT4A 4C0TA 2B9FA 1XWSA 2ITWA 3ZBFA 2UW3A 4MD8E 3AC4A 4L67A 2Z7SA 3DJ5A 5FG8A 3VIDA 3DT1A 1KE7A 4KUJA 4QMTA 3OT8A 5C27A 1X8BA 5CWZA 2W1ZA 3QA0A 3O17A 2J6MA 3U9NA 3UMWA 2OICA 3O7LB 4BZNA 4DTAA 1WBPA 4RMZA 4AZFA 1DI8A 2CKOA 5A6NA 2J5EA 5D7AA 1DM2A 2I1MA 2X9FA 4TWOA 4WOVA 4V0GB 3DTCA 4D5HA 3GCSA 4FKWA 4EYJA 2E9UA 4M3QA 4I0SA 3NAYA 3ORKA 2GNLA 1L3RE 3QKKA 2GDOA 4IDVA 4KSQA 3DK3A 4EQUA 4DEBA 3TT0A 2VTLA 2IJMA 3H4JA 2X7FA 4LOOA 3JXWA 4QYFA 3PG3A 4JR7A 4BCHA 4CZUA 3A7JA 5J9YA 3FLYA 3MBLA 1U59A 1OKWA 4JLCA 4W8EA 4LI5A 4QP3A 4ZJVA 3OY1A 4C4IA 4DH1A 4EQCA 4PNKA 2Z2WA 3A4OX 4I3ZA 5D9HA 3QZFA 5DLSA 1NY3A 5AM6A 3VAPA 5DFPA 4BTFA 2Q0NA 3TUDA 3QU0A 1ZYDA 3TTIA 4EWQA 5A6OA 1O6YA 1TVOA 4BHNA 2W5BA 4QP7A 1XO2B 3IO7A 4JRVA 2ACXA 2BTRA 3HRCA 5CY3A 1ZY4A 2BTSA 4TT7A 5E7RA 2NPQA 4FTIA 4DLJA 2XBAA 4TNBA 5LARA 2DYLA 3ACJA 4CV9A 3TI1A 2Y4IB 5IEVA 4JAJA 3TCPA 4ZMFA 4OBQA 5AUVA 5H9BA 3FYJX 3QQJA 3DZOA 3KXHA 3PUPA 3OWPA 1NVRA 4UBAA 2WQNA 4Y5QA 3UC4A 1YDTE 4HCTA 4J7BA 5BVWA 3CJGA 5EK7A 4IBMA 4J71A 3UZPA 4PDPA 2ZV2A 1ZMVA 2XCKA 2NO3A 4AUAA 2GS2A 3PXQA 3TNQB 4DFLA 2W1FA 2B7AA 4FNWA 5HBEA 5KKRC 4NCTC 1W98A 4O21A 4LUDA 3UYSA 3V5WA 3D2KA 3EB0A 2Q83A 1J3HA 5LMBA 1XH9A 4YTHA 2WHBA 2G15A 5L6WL 5HD4A 5F20A 3G6HA 3JPVA 5HD7A 5AX3A 1DS5A 5CT0A 4O7RA 4EOLA 4QP2A 2JDRA 2AC5A 3RVGA 4DFZE 4YC8A 3AC8A 3BRBA 1P4OA 4NT4A 2CCHA 3FMEA 4CFMA 2CKPA 2X2LA 4K18A 2CGUA 3R9DA 2O63A 4BGGA 3DCVA 3PA4A 2B0QA 4DT9A 3II5A 3R0TA 2GU8A 4ZS0A 5HHWA 4KWPA 3QD4A 4NM5A 3ORZA 1OIRA 3I7BA 4BDAA 1BI8A 3ITZA 3D15A 4DH3A 4YSJA 2JBPA 3DDPA 3GGFA 1L8TA 3WYXA 3Q6WA 3OMVA 1F0QA 3E87A 2F49A 3MVLA 3U4WA 4D2PA 4HVIA 2YZLA 4FG9A 4F9YA 3N4TA 2GCDA 5KKRB 5CSVA 4KA3A 4CFWA 3S95A 4UWCA 2BFXA 3EJ1A 4NYEA 3F5GA 4FIHA 5LJJA 4FV4A 3ZXTA 3ORNA 4DF3A 2UW6A 3EFWA 3Q9WA 2PWLA 3WYYA 3CTJA 4CKIA 2UV2A 4UWBA 3PSCA 3HV3A 4WG5A 2E9PA 2IN6A 2YM7A 4ANMA 5EG3A 4DA5A 4TPTA 4IVDA 2V0DA 5JSMA 1GAGA 3LQ5A 2C3JA 4H39A 1WAKA 4O0WA 4WBBB 3LMIA 1YXXA 4KIOA 2PULA 4D58A 2QVSE 4C62A 2YIWA 3DAJA 2PZ5A 4GFOA 1OUYA 3F2AA 5GIPE 4XG6A 3V01A 1HCKA 2BAJA 2BR1A 3E7OA 4A9YA 4U79A 3LPBA 3VQHA 2C0OA 2JDSA 3EKKA 4AZSA 4F65A 3CLYA 5KHXA 2WMRA 4DFUA 2OFUA 2C0TA 3FXWA 4QP8A 4KIQA 5HEZA 3NUNA 2YA9A 3RZFA 1DAWA 1QL6A 3I5ZA 3UNKA 1M2RA 3HEGA 1OGUA 3QALE 4ZS4A 3P5KA 2DS1A 3MWUA 4DCEA 4RWIA 3F7ZA 3FZ1A 5K3YA 4BI2A 1Q41A 4PDSA 4C8BA 3UDBA 1XKKA 3IW7A 4UZHA 3ORXA 2JDVA 1J7LA 2YLEA 3TM0A 2ESMA 4EHVA 4ZZNA 3H0YA 3KU2A 5FUTA 2X81A 3SLSA 4JQ7A 3EN9A 4DG3E 2I6LA 3AXWA 2XK4A 2WMAA 3IW4A 4IX6A 1OIYA 3O23A 2CN5A 3QC9A 4ONAA 5HG8A 3V3VA 3GBZA 5TR6A 4GG5A 2OH4A 4ZEGA 4K6ZA 5JN2A 3LQ3A 1M7QA 4YTCA 4DBXA 5EYMA 3BLQA 3FMLA 2VRXA 4MXYA 1ZYJA 4U45A 4G34A 4W4YA 1SNUA 4FX3A 5HG5A 3SD0A 3DBQA 4IADA 2W1GA 4QNAA 3ZO2A 1YI6A 3AGLA 3HA8A 4KABA 3W16A 1GZKA 2V7AA 3UG1A 2VTNA 4EH9A 5KCVA 2HCKA 4BCMA 4NM7A 5HI2A 3L9LA 1H26A 4XG9A 4JOAA 4AN2A 5CAUA 1XH7A 4ZLYA 1CTPE 2VWBA 1JKKA 1A48A 4G3EA 3WBLA 3WZUA 3TUBA 4HGEA 3SKCA 2BAKA 4YURA 2HZ0A 3R8UA 5A4QA 1KV2A 4QQCA 4AW5A 3KK9A 4WG4A 5IDPA 1IRKA 4DLIA 3E92A 4GUBA 2IZSA 2RFNA 5E91A 3TG1A 1PMNA 4FG8A 3BZ3A 3IDBA 4NIFA 4BYIA 5AP4A 2UZWE 4BYJA 4B6LA 4RLKA 1UU9A 1ZLTA 2XNPA 3RI1A 3WOWA 4ZZMA 1Y91A 2A1AB 4O91A 3IOPA 2XRWA 3BWFA 2JBOA 4BY9E 1DAYA 2XIKA 3SOAA 4ACHA 4AXAA 2WZJA 2XKEA 2VUWA 4FIGA 1KE5A 2IVTA 3COMA 4I4FA 4JJRA 1UNLA 4PRJA 5HE0A 4JRNA 4O27B 3FI8A 4YSMA 3HUCA 3P79A 3TNHA 3EFKA 5IDNA 3A99A 4D4RA 4BWKA 3GUBA 3HYHA 1ZYCA 5D10A 3PXRA 5JGAA 1G8AA 4Y95A 4WNMA 3OCBA 2WMQA 2OSCA 5E8SA 3IOKA 4JQEA 5IH5A 1YHVA 5K0XA 3OWKA 4DGOA 3AC2A 2ZM3A 2RIOA 4JG8A 4BDCA 3RK9A 3RM7A 3R9NA 3KXXA 4I92A 5ETIA 1H27A 1SMHA 2OBJA 1NT2A 2YISA 3R02A 4OTDA 3FHIA 2BZHB 3FMHA 4Q5EA 3GOPA 5E1EA 2Y7JA 2PUUA 4G2FA 1Q3WA 3G6GA 1H1RA 3ZO1A 1PMVA 4F4PA 5B7VA 4ENYA 3P7BA 4HVSA 3QBNA 4C38A 4NEUA 3ZSIA 3I60A 3IG7A 3RCJA 3OTVA 4EOKA 4F9BA 2B4SB 5FDPA 4IW0A 3ROYA 4MXXA 4QMPA 4KD1A 3OOMA 4EONA 2I0HA 4GRBA 4XCUA 1U5QA 4MXOA 1RJBA 3BQRA 2VWYA 3E5AA 2F7XE 5F1ZA 3ODZX 4FT0A 4FV5A 5HESA 3TXOA 4FEUA 4EJNA 1OITA 4EK5A 2E9NA 5AUZA 5AA8A 3BLRA 4BICA 4DAWA 4EC9A 4QMOA 2BROA 1K2PA 2UVZA 1Q62A 5ICPA 4JT3A 5C03A 2BAQA 1UVRA 3DY7A 3L9NA 4AE6A 2J0KA 1PW2A 2J2IB 4MK0A 4EOPA 3QCSA 4FODA 3R8MA 3GC8A 3UBDA 4R7BA 5LMKC 5IQAA 4UB7A 4V0GA 2G9XA 2R3KA 3EOCA 4PUZA 5KZIA 3TJDA 2FSOX 3ORLA 4ZP5A 4FSNA 2G1TA 2YIXA 4YC6A 1UNHA 5CI7A 1P14A 5CQWA 3DKOA 5CU3A 4XMOA 3L8XA 4H58A 3FMDA 4FA2A 4L9IA 2W1IA 4UXQA 3C4XA 4YZCA 4E20A 4X6RA 1J91A 4U8ZA 2QU6A 2YFXA 1MRUA 4TYEA 2W7XA 4JS8A 5IQCA 5HIDA 2OXXA 5DG5A 5JFVA 3UVRA 3TDVA 3H0ZA 3FL5A 3T3UA 3RHXA 4CTCA 3DJ6A 4BTKA 4CNHA 5IKWA 1TKIA 2YAAA 3DNEA 3KULB 1YXTA 5CX9A 4OGRA 1W83A 3HAVA 4PMSA 4FTCA 3TIZA 2R3PA 4B99A 4GUEA 4FEQA 5K5XA 4YZDA 5T3QA 2QNJA 4BCNA 4YP8A 3ZC6A 5E8UA 5IA0A 4F1MA 1JAMA 4FIJA 4FV9A 4E4MA 4F7JA 5FBNC 4N57A 1XBCA 3QYZA 2GNGA 3FDNA 5JRQA 1H4LA 3Q4UA 4I6FA 3E64A 4D4SA 3COHA 3O0GA 3VS1A 4IZ7A 3FMNA 2VAGA 3NYVA 3QA8A 3VS5A 3L8VA 2UZLA 3ZO4A 4B8LA 2W4JA 2V62A 5CZHA 4F63A 2Z8CA 3MJ1A 4EOSA 2VO3A 1NVSA 5HZNA 3NVKI 3VRZA 1XJDA 4I5PA 3OW3A 3NCGA 4HPUE 3BCEA 4IC7A 4XX9A 4YNEA 4LRKA 4QP9A 3RWPA 4AP7A 4XG7A 4I6QA 5AUUA 4MF0A 2WMWA 3KCFA 3ZRMA 3TJCA 3CS9A 5HCXA 5GZAA 2Z7LA 2C5VA 3RCDA 4BIBA 4FKPA 4LMUA 5LVMA 1PXLA 5AEPA 4QP4A 5ACKA 3ZBXA 5DI1A 3VJNA 3T9IA 3PRIA 4PWNA 4AZVA 4D5KA 5CF8A 3QD0A 4MXZA 3BU3A 5H2UA 3NIZA 3F5UA 1KOBA 2R3JA 2EXMA 1WFCA 3TZ8A 5IQFA 2JIIA 4QO9A 4FSRA 2YHVA 1CKPA 3TN8A 3PVWA 1RE8A 2WXVA 3D7ZA 3U6HA 5DVRA 5AJQA 1ZY5A 4KKEA 2C5XA 2GSFA 5M55A 5M4CA 3POZA 4KRDA 4HGLA 3WF5A 4EHEA 1ZARA 2ITYA 3MB6A 2H6DA 4RVTA 5FBOA 2HK5A 4RX7A 2YWVA 4Y5HA 3CE3A 1ZMUA 2OXDA 3FL4A 3RJCA 3RTPA 3S00A 4CG8A 4L43A 5HCZA 3DNDA 4V05A 4FTLA 5H8BA 5BYLA 4F09A 3RKBA 1JQHA 4TRLA 3NUAA 3SV0A 1Y6AA 2YITA 1GZOA 3FBVA 4NTSA 2E9OA 4U42A 4JX3A 3UE4A 3UG2A 4D9TA 5AUTA 3GP0A 1R1WA 3HV5A 4HCVA 4LOPA 3VUDA 4C33A 1UU3A 4LL0A 5L4QA 2OO8X 1FGKA 4QMMA 4QMQA 2VD5A 2PUIA 4G5PA 3L1SA 2QU5A 1JKLA 3LVPA 1ZOGA 3ZEWA 5FLFA 4FBXA 3GCQA 3LJ1A 3OS3A 5IF1A 4C7TA 4R3PA 1IAJA 3QCXA 5EH0A 2P0CA 1UKIA 4N6ZA 3COIA 3CGOA 4N4SA 4XV1A 1QMZA 3I0OA 3P78A 3R00A 1B39A 3ENHA 3R1NA 2I40A 2OJFE 5AP1A 1GJOA 4DYMA 4ZY4A 4EUUA 3PY0A 4CFFA 3KF7A 5AFVA 3VVHA 5M57A 4FL3A 3R8VA 1G3NA 1CDKA 3OHTA 1J1CA 4U97A 5CT7A 2X8IA 1P2AA 2XNMA 3O8UA 4IM3A 2JAVA 4G6LA 4FEWA 4K1BA 4G16A 4FGRA 1VYZA 3ZUUA 5E4HA 4X2FA 3U51A 4UMRA 4RSSA 2RSVA 3R9HA 3KK8A 4EH5A 2CSNA 3KB7A 1LP4A 1YDSE 1B38A 2ITXA 1XBAA 4BWPA 4FK3A 3V51A 3PDTA 2IVVA 4YBJA 4D1SA 1E1VA 1Q8WA 2X6DA 4GU6A 5CU0A 4IB5A 2YLFA 3DV3A 3E3BX 5J9LA 2QG7A 5AWMA 4HZSA 3D94A 4QQTA 2HW7A 5EM8A 3OVVA 4TN6A 4BDJA 1TQMA 3OCGA 4RPVA 3BYVA 2PVJA 4D28A 3KREA 4Q2AA 5EYCA 3UQCA 5DNRA 5KBQA 5CQUA 2OI4X 1T45A 4IVCA 2GS6A 4TTHB 1OIUA 3R8LA 3SDJA 1ZOEA 4D2TA 4ZAUA 1R39A 2JIUA 3HRFA 3OC1A 1A9UA 4O0UA 4CGAA 4ASXA 4GEOA 1ZXEA 3NYOA 3DGKA 3G9NA 3JR1A 4MNFA 5EI2A 4EK6A 2ZAZA 4XV3A 4QPSA 5JEBA 2O8YA 3LIJA 4XG8A 5HOAA 3V5JA 3UOJA 3EQGA 1V0BA 1A06A 4DT8A 4IJPA 4BRXA 4ANNA 5M4IA 1GZNA 5FXQA 5ANJA 4OLIA 3R9OA 3DK7A 5L2TA 2WU6A 4JBPA 2A2AA 3LOKA 4JG6A 5IISA 2BZIB 3UGCA 3VRYA 3PP0A 4FKVA 4L3JA 2UZEA 5IA5A 1PXIA 2P2HA 3WF8A 5DEWA 4C4FA 2G01A 1AQ1A 1VZOA 3EQRA 1PXNA 4FTJA 2C6IA 2XJ1A 2IWIA 2HXQA 1OVEA 4YC3A 4M13A 4TY1A 4AGWA 4QMXA 4CMUA 3QCYA 3WI6A 2WMSA 5EYKA 4Z3VA 3RM6A 3Q4CA 3CPBA 3KGAA 4RQKA 2YCSA 5CNOA 4LFIA 2OF4A 4XJ0A 4F6UA 5HIEA 4CMOA 4FV6A 1JVPP 2QLQA 5E8YA 2CHLA 3PY1A 3Q4TA 4RIOA 3FE3A 4TNDA 4D4VA 5ANOA 4UX9A 1V1KA 4LQMA 2XMYA 2PVRA 1E1XA 2HWPA 4GIHA 3C5IA 3LCDA 4BKZA 3TDWA 2VTMA 5LVOA 4TYHA 2WMVA 2QR8A 2JDOA 2JDTA 4CXAA 4CT1A 2FGIA 3R7VA 5GHVA 3TL8A 1XH6A 5HVJA 4K11A 1KE9A 3GVUA 2KULA 3ZSHA 4D2WA 3ZC5A 4GVAA 3S1HA 4MWIA 2OGVA 5LCJA 1CM8A 3EQPA 5CSHA 1APME 4DTKA 4F9CA 1REJA 3HV4A 4C61A 3PJCA 2W1HA 3MV5A 2VX3A 4IVBA 4BDGA 5L8KA 2CN8A 4FTAA 3AMYA 3NVMB 5DA3A 3RMFA 3MH0A 4L45A 1BYGA 5M56A 5AV2A 2VWVA 4USEA 4PP9A 4XP0A 5FD2A 4HNFA 2YIRA 3QX4A 4CYJA 2P33A 4J1RA 5CANA 5TT7A 3TKIA 2EB3A 2V5QA 4LGGA 1G8SA 5DH3A 2ONLA 4ZJJA 3CEKA 5FP5A 3PXYA 1FINA 3FLWA 4EZ5A 2R0UA 4ZSEA 3GB2A 4CSVA 5AUXA 2YCQA 1UWJA 2FB8A 3MSSA 2CGXA 4U81A 4E7WA 3MDYA 2PVYA 2OXYA 2B52A 3KRRA 1JNKA 4NW5A 5JT2A 5DEYA 5A14A 3KA0A 1J7UA 5AR3A 3R63A
chains in the Genus database with same CATH superfamily
3R9RA 5CEKA 3MH2A 2XRUA 4RJ6A 4ZTNA 2P2IA 2WTCA 4GFMA 4B9DA 3LFNA 3DAEA 4BC6A 5FEEA 4EH8A 3HVCA 5F4NA 5JQ8A 4FKSA 2PZIA 2J9MA 1SVHA 2PSQA 3AT3A 4MNEB 4FMQA 4XYFA 4DGMA 2OZAB 3C13A 4U6RA 4R5YA 3QTZA 1PHKA 3KULA 3ATSA 3DKCA 3W2QA 3R8PA 3VN9A 1Y8GA 4YZMA 2CKQA 4LG4A 4FSUA 2JGZA 2XNEA 2C4GA 3V6RA 1R0PA 2BRMA 4KB8A 3VWAA 3NW7A 3BYMA 4F64A 5LWNA 4XH6A 1LR4A 3LMHA 4F1OA 3DA6A 3OG7A 3CQUA 3EQIA 3H10A 1PKGA 3O2MA 2YACA 5FM3A 3SGCA 3LFQA 2PVHA 4O0XA 5CEIA 5E90A 1FMKA 1OKYA 3B8RA 4F6WA 2UW0A 3KL8A 4QTAA 4HPTE 3WZJA 3FUPA 4D2RA 5DBXA 1H8FA 2UZOA 2GTMA 3CY3A 4D0XA 4XV9A 1RQQA 3AC3A 4YPDA 4O7VA 3TZMA 4DINA 2RG5A 5CVHA 5DT4A 2WIPA 3PJ3A 4F99A 3RAIA 4FGBA 2IO6A 4O4BB 1FPUA 3OZ6A 4U43A 5TE0A 3V8TA 3A4PA 2ITQA 5ANDA 3S0OA 4LGHA 1W2DA 2VWWA 2Y4IC 4KBKA 4YJRA 1JPAA 3BGPA 4YJSA 2OJJA 4KKGA 3VUIA 3ZHPC 4KS8A 4C34A 5CAOA 3NNVA 3DTWA 4BDKA 1TFFA 3QFVA 2VU3A 2YWPA 1Q61A 4FICA 4RA5A 1MQBA 4WT6A 5DHJA 3DFAA 1H24A 2CJMA 3LMGA 2BRGA 1WZYA 5C4KA 2P4IA 4YBKA 4WNPA 1WBOA 3E8CA 3W0MA 2FO0A 3VHEA 3OXIA 4P2KA 3QD3A 5DYJA 3CD3A 2JFMA 2ZM1A 3TIYA 1H1WA 2E2BA 4EHZA 4QEBA 4JDIA 4AE9A 2BPMA 5CLPA 1GOLA 1M7NA 1OKVA 3K54A 3MTFA 3MTLA 4PMMA 5EQYA 3EN7A 1H0VA 4O4CA 3BGQA 2PTKA 2REIA 3EN4A 3OD6X 4O2ZA 4DGGA 3AC5A 4GJ3A 3NNUA 4EK3A 2J0MB 3OF0A 3BBTB 4XG2A 4C3RA 2IVSA 5BQ0A 4DCAA 2GS7A 4IXPA 4YGAA 3P7AA 5EW8A 4AFEA 4PNIA 5C8NA 3W18A 1VR2A 3ATTA 1GY3A 2OK1A 4OUCA 3CTHA 5A46A 4FV3A 4L7SA 4NFMA 2P3GX 3GU4A 1BL6A 1PY5A 4RVKA 5I9VA 2XAOA 3PA5A 2XH5A 3O51A 4WRGA 2GQRA 2WTDA 3FMJA 3LQ8A 4ZY5A 3R01A 4QTDA 5AAEA 3KQ7A 1ZZ2A 1OL2A 4XV2A 2C1BA 2XEZA 4G31A 3QLFA 5IUHA 5J7HA 2EXEA 3C4EA 3TNIA 3GCPA 4QMSA 3QWJA 4UEUA 1JSTA 3WF7A 3R8ZA 2WTVA 3VBQA 4L00A 3IW5A 5CTPA 4NL0A 4BIDA 4OBOA 4O86A 2WTIA 3EL7A 3EZVA 4J52A 4GV1A 2DUVA 2C5NA 3RPRA 3AT4A 1XR1A 2C6MA 2H8HA 3G0EA 3QRTA 3IS5A 3O96A 4RJ7A 3ZH8A 1FGIA 3FKOA 3BHVA 4WSYA 3F3WA 4I94A 3W33A 3R71A 4FEXA 4FTQA 4I6HA 5CENA 4M15A 1R0EA 1OL7A 3OBGA 3AKJA 3F7WA 3P7CA 3PA3A 5F94A 4QYGA 3U6IA 3W0SA 3TUCA 4GT3A 3LFAA 4LV8A 4IEBA 4ID7A 1Q8ZA 3PXKA 3WARA 1K9AA 2XA4A 4BDIA 5I9XA 4FNZA 1OB3A 4H3BA 5F95A 4BCFA 4U9AA 5FP6A 4O84A 1W82A 1FVVA 4R6VA 3DBEA 4A07A 3MA3A 4AN9A 5HE2A 3ZDUA 4XOYA 1H00A 2BDWA 1PJKA 5FTOA 4LV5A 3RZBA 1PKDA 5M44A 4FEVA 2G2IA 2JKOA 4IMYA 3Q9XA 5DWRA 3A60A 2WPAA 1W2FA 4K77A 5EQEA 5DGZA 2XNGA 2OU7A 4G17A 4F0IA 2B55A 3MPMA 3PIYA 4YO6A 1BX6A 2KTYA 2YDKA 3I4BA 5D7VA 3UP7A 4W4XA 2UW7A 5EKNA 3FEGA 1STCE 3LFCA 4FIIA 3R7IA 3KXMA 3FLZA 4NFNA 3MIYA 4I23A 3MH1A 4DH5A 3UO5A 5J1VA 1DI9A 3N51A 4K9YA 5I9WA 1IG1A 3OT3A 4FL2A 4PTCA 5I3OA 3PLSA 3WIKA 4AOTA 1ZOHA 3KXZA 4GCJA 4TKSA 2QD9A 5IQHA 3D5XA 3F88A 3C50A 2ETRA 3GXLA 2ITPA 3R21A 3WIGA 5K9IA 2B9IA 3E63A 3QXOA 3R1YA 4GYGA 2X0PA 3A7HA 4J95A 4S2ZA 5CU2A 3WZEA 3DBCA 4YJOA 5C01A 5J5SA 3LXLA 4ZSJA 2J90A 2Y8OA 4DEAA 4EK8A 5LCKA 3O71A 4JDHA 4J99A 3HMPA 4Q9SA 4RX9A 2Z7RA 3D5VA 2BIKB 5HIBA 5JFXA 2HXLA 4J8NA 4D55A 3U55A 2XBJA 3ZLXA 4AA4A 3PSBA 4XBUA 2RFEA 3ORMA 4MD7E 3FXXA 1REKA 3UMXA 3QTIA 1UWHA 4L42A 5FM2A 3L9MA 4QDEA 3BHHA 1J1BA 1MP8A 2WIHA 5E9EA 5K0KA 2WO6A 3P86A 2OJGA 4JDJA 3EQDA 5L2SA 2PPQA 3R28A 4MQ2A 3Q5ZA 4FVRA 4S30A 3ZDIA 1W8CA 2QR7A 2C3IB 1CKJA 3F3VA 3KMMA 4FKIA 3ZFYA 5I5ZA 3BLAA 3G5DA 1Q24A 3VF8A 4NKSA 3T3VA 2OIQA 1TQPA 1Y8YA 2IPXA 4FV0A 4L8MA 3UOKA 2R0IA 3R2BA 3UVQA 2C3KA 2XNOA 5L8LA 5LWMA 2IW6A 3JVRA 4BZDA 1SZMA 2W17A 5LQFA 3RBWA 4R7IA 1HCLA 1PMEA 2HZ4A 3IW8A 4PPCA 3FV8A 3PZEA 1S9IA 3UIMA 3FAAA 3VBVA 4QQ5A 2OF2A 3ZO3A 2RFDA 4Y83A 4FV7A 3LZBA 2F4JA 4J8MA 5TKDA 4ANBA 5I4NA 2VTTA 3MVHA 2ETKA 1JBPE 4R3CA 4UZDA 2BILB 4FG7A 2W4KA 5AP5A 4IZ5A 3NFGB 3T8OA 2W05A 5EHYA 2EUFB 3F2NA 4ZY6A 2XK8A 4WBOA 4F6SA 4PMPA 5JFSA 3LFFA 4ALVA 3N9XA 2UW9A 5CYIA 1UV5A 2V7OA 2I0YA 2XKDA 4FNYA 1GZ8A 3KRJA 4QTEA 3R2YA 3GOKA 3ULIA 2BCJA 4IE9A 4RIXB 4UALA 4WNOA 2X6EA 1M2PA 3RPVA 3V8WA 4AGUA 4AZWA 2O65A 4HCUA 2XALA 3AMAA 4EKLA 3AOXA 4RJ3A 4E5WA 3MJ2A 4AA0A 4QT1A 4BF2A 3I7CA 2ONLC 2VO6A 2JKQA 4G3CA 3FWQA 4G3FA 2PVKA 3L8SA 3EYGA 3LFSA 3ODYX 4PDOA 5HKMA 4MNEA 3KKVA 5IH4A 5IQBA 4RWJA 3A7IA 3PVBA 3QQHA 4DDGA 2OZAA 4R1VA 4C4GA 3IQ7A 4RJ5A 4BDFA 2QKWB 4L52A 4HOKA 4WG3A 5BMSA 3Q5IA 2BUJA 2PMOX 4BKYA 3WILA 5EM6A 4F9WA 4AGDA 3RPOA 4YNOA 3ORIA 4PQNA 3M42A 3F3UA 4EOJA 1OUKA 2FSTX 1IASA 1W84A 5HG9A 4MQ1A 3UODA 4AN3A 2YZAA 2H9VA 2FH9A 5J1WA 1ZWSA 3LXKA 5EW3A 3LJ2A 5TO8A 4JBQA 3U6JA 4R7HA 3R6XA 3MFUA 4C36A 4QPMA 1PXPA 3MIAA 5E8WA 4O7LA 4LM5A 4OBPA 2VO7A 3QUEA 3SAYA 2XP2A 3KCKA 4FKLA 4AT4A 2OKRA 5A4EA 3BE9A 3HP2A 2GMXA 4IAFA 3IDPA 2CCIA 4YMJA 5CSXA 4X21A 3LE6A 4AAAA 4RRVA 3R7YA 1OKZA 2H34A 4IWPA 3AT2A 4DH8A 3CR0A 4I41A 5IQDA 1YWNA 4IAAA 3QL8A 4WKQA 5I9ZA 2CNUA 1SM2A 4C4HA 5DT3A 4BHZA 3I6UA 5JH6A 5FXSA 1OL1A 1F3MC 1YOLA 2CKEA 1UNGA 3MFSA 4O6EA 4P7EA 1F5QA 4FSQA 3NWWA 4IZAA 4JBVA 4DEHA 4IWOA 5HLNA 2X8EA 3CGFA 3CD8A 3UQGA 3C7QA 2B53A 2XKCA 3CKXA 2OG8A 1SNXA 1YDRE 4JG7A 4BBMA 5IMEA 3C0IA 2PZYA 4GYIA 4ACCA 4BI1A 2JKMA 4V04A 4WIHA 3QAME 4AGCA 4BDHA 4ZTQA 1OL6A 2GTNA 5E8VA 4O96A 3ZLYA 2PMIA 3UYTA 4USDA 3IPHA 3POOA 4F0FA 1UKHA 4FT5A 1WBWA 4RJ8A 4BCKA 1XH8A 4UV0A 4PDYA 2C47A 1XH4A 1O9UA 2ZYBA 3C4CA 4K8AA 4KIKB 4CT2A 2JC6A 4C59A 3U8WA 5FWKK 4P4CA 3E93A 3SRVB 2OJIA 4GH2A 5KHWA 3FZOA 1PF8A 3ZFXA 2J5FA 2XS0A 3H9FA 3EN6A 3Q60A 4FKUA 4JI9A 5CXZA 5BVDA 3KFAA 5J9ZA 4IB0A 3LM0A 4CQEA 2GQSA 5IA3A 4CRLA 5IQEA 4NJ3A 2PY3A 2WMUA 4U5JA 2WMBA 5DPVA 4IQ6A 4D4YA 3BPRA 4EH6A 4IDTA 3E8DA 3LLAA 3Q9ZA 3DQWA 5AV0A 2XYNA 3KRXA 4MCVA 3LM5A 5HNBA 4B7TA 5HTBA 3EIDA 1Z5MA 4EH3A 2VTHA 5AR8A 2J51A 5JRSA 4R78A 3UVPA 2ITUA 4O0VA 2GHGA 3NUSA 3NW5A 4NWMA 4XOZA 1BLXA 4YJNA 5H3QA 3BEGA 1MRVA 3SXRA 2R3LA 3G0FA 3LCKA 4JAIA 2ITVA 3G51A 3G15A 5J87A 4AW0A 1FVTA 3QGYA 3PVUA 5H8GA 2JEDA 5JFWA 4L44A 5AADA 3CC6A 4FSYA 2QHNA 4RC4A 3GU6A 4FJVA 3C0HA 3BWJA 4RZVA 3KMWA 5HG7A 3BV2A 5D1JA 2CDZA 1EH4A 4DEEA 2F7ZE 3AMBA 3MFTA 3MH3A 4QMUA 2BHHA 4R1YA 4ZSGA 3GQLA 2ZB0A 3LXPA 4GL9A 4ACMA 3CQEA 4M0ZA 4IANA 2B1PA 4U3ZA 5ETFA 4BBFA 2VZ6A 4S34A 4QYEA 1ZYSA 4OTHA 4ANOA 4E73A 3SX9A 2XEYA 2PVFA 4FYOA 4MXCA 1OZ1A 4XP3A 4ANLA 5M06A 3EKNA 2Z7QA 3DZQA 2F57A 3R1SA 2W96B 1LUFA 4EORA 1Z57A 3I79A 5A4CA 4G6OA 3WF9A 2ZDUA 3DB6A 2XNBA 4EZ7A 1PYEA 4XG3A 3LCSA 5GJGA 2VX1A 5HICA 4BTJA 1H25A 1AD5A 4L6QA 4RWLA 3RK7A 4NTTA 4TZRA 4U41A 3ZYAA 4BL1A 4HYIA 3Q9YA 3QZGA 3ID6C 4A9RA 4WNKA 2WTKC 4G3DA 3B2WA 4RA4A 2WTJA 3MS9A 4O0TA 3W2CA 4AW1A 3P4KA 2XIYA 4LOQA 1H0WA 4D0WA 2YAKA 3NMUF 3TNPC 3BE2A 3DFCB 4JMQA 1QPEA 2R3RA 4G1WA 4FKQA 3Q32A 2ZV9A 3UOLA 2PL0A 4MWHA 3BELA 4QPAA 3TTJA 5CF6A 4O7TA 5E8ZA 4ZSLA 5AAFA 4IAYA 4YLKA 4XLVA 4EBWA 4JIAA 4J98A 4PMTA 4WRSA 2VTAA 3R1QA 5EHLA 3ACKA 4EYMA 3VBXA 1LEZA 4BR3A 4C2WA 1S9JA 4RVMA 4TYGA 4A9UA 3ZM9A 3E8EA 4FKGA 3VS6A 3SC1A 2ITZA 3NW6A 1CSNA 1I09A 2QO9A 5E1SA 4O2PA 4YHFA 5CAPA 4X0MA 2PE2A 5HX6A 3D14A 3HA6A 2WQMA 3DOGA 3F9NA 4AA5A 4GW8A 4A7CA 5JGDA 2WTKB 4OT5A 5DR6A 4DDIA 3DQXA 5IH6A 5EQPA 5GJDA 3TKUA 3CPCA 3FSKA 4EUTA 1H07A 2ZB1A 3NEWA 4AAYA 2FVDA 3HMMA 4W9WA 3HGKA 3TEIA 2X4ZA 2ITNA 5CF4A 3FZTA 2NYAA 4U44A 3QTXA 2UW5A 2ZVAA 4I20A 4OAVB 3VF9A 3FLSA 3JYAA 3DBFA 4FIEA 3GNIB 2V55A 2WAJA 4JVGA 3C4ZA 3FJQE 3I0QA 4GG7A 4HVDA 4FV8A 2HENA 1U4DA 4OR5A 5KMOA 2XZSA 5EOLA 4QTCA 4CKRA 3Q2JA 5CVGA 4QOXA 1URCA 5DN3A 2YM5A 2GPHA 3NS9A 3A2CA 1OPJA 5A3XA 2X1NA 2IW8A 4ENXA 4H1MA 3AG9A 3RAKA 3HMNA 4AU8A 1RW8A 3D4QA 3NUPA 1YXSA 2IG7A 2YERA 2WEVA 3W2SA 3ZLWA 3UZTA 3PE2A 4KIPA 4DEGA 4LRJA 1VEBA 3BI6A 4HYHA 2R3NA 3G2FA 4U0IA 4NJDA 2VWUA 4MH7A 5EKOA 4DTBA 3S3IA 2BVAA 4AG8A 3MB7A 1OM1A 2XIRA 3MVMA 4XNEA 2WOTA 4I21A 3DAKA 4RQVA 2CNVA 4RIYB 3DLZA 4FKOA 3R7GA 1OIQA 4GK2A 1TZDA 5I3RA 1KV1A 4FZ7A 3ZTXA 3ORTA 3L8PA 4EK4A 1XQZA 2R7IA 3BYOA 3D7TB 3VW6A 3R73A 5FDXA 4EQMA 1QPJA 5AP3A 3VO3A 3IONA 5BUIA 3VUGA 3QRJA 5DMZA 4Y8DA 4FTRA 5BMMA 2H96A 3F2RA 5CEOA 4RLLA 4ZTSA 1PXOA 4KSPA 4PF4A 3ROCA 3JUHA 4GT5A 4AFJA 4PTEA 3RP9A 4YHTA 2GNFA 2XF0A 2VTRA 3BL7A 4AQKA 1O6KA 1YKRA 3HZTA 3LLTA 4JR3A 3VULA 1LPUA 2B54A 2ZMDA 4LGDA 1NVQA 3PLAE 3LW0A 1QPDA 3DPKA 1YI4A 2F9GA 4FC0A 3LJ0A 3BKBA 4FKTA 5A9UA 4AXCA 3QCQA 4RT7A 2PMLX 3BYSA 4HYSA 4RG0A 4KS7A 2BRBA 1BL7A 4BVUA 4ACDA 4RIXA 4CFVA 2PE1A 4W9XA 3MA6A 4D2SA 5L6OA 2G2FA 2XIXA 3ANQA 3EWHA 3PRFA 3ZCLA 1JOWB 3K3JA 5HU9A 1Z9XA 1UA2A 3A62A 1YWRA 3MPTA 4N6YA 2YIYA 3BQCA 4IX4A 3IK3A 4KAOA 4OT6A 3O50A 4AT5A 5IQIA 4I0TA 2GNIA 3M2WA 4PPAA 4ACGA 4ALWA 1OBDA 4UXLA 4XS2A 2YM8A 3HRBA 4PV0A 3UIXA 3EH9A 4O0RA 4Z7GA 4F1TA 5FTGA 2VWIA 2Z02A 2W0JA 4HW7A 2QOIA 2QODA 4FUYA 3FZSA 3NDMA 5FGKA 4QMNA 2PMNX 4W4WA 1FVRA 3VC4A 4OTGA 5M4FA 3PVGA 3E7VA 4OTRA 4E6CA 3O7LD 5CAQA 3TNWA 3ZEPA 2I0VA 5DR9A 3UC3A 3VQUA 4O7WA 1YHWA 4V01A 5CEPA 4GKHA 1SVEA 2XCHA 5JZNA 2OLCA 3OW4A 2Y9QA 3GFWA 5CAVA 4I24A 2J0IA 4R8QA 3UQFA 1SYKA 4QP6A 3W32A 5HNGA 3KEXA 1O6LA 4ZTLA 3OROA 5AR4A 3QGWA 5EFQA 4APPA 2X2KA 2GHMA 2WQBA 5EI6A 4I6BA 3TWJA 5HLWA 3F5XA 3UZRA 4GK4A 3ZMMA 4FF8A 5DRDA 3RPSA 3NGAA 4RGJA 2PYWA 5CSPA 3NIEA 5I0BA 3UP2A 3OFMA 3PUFC 3FI3A 3A7FA 3DJ7A 1H28A 3AC1A 3BIZA 3HUBA 5CEMA 4RVLA 4K0YA 3LFBA 5BVOA 1MUOA 4WUAA 5JK3A 5K4JA 4ANSA 4FE2A 4C02A 3NNXA 4YJQA 5K4IA 1OBGA 3JVSA 3GFEA 2X0GA 1Y57A 3HNGA 3L9PA 3M1SA 4GSBA 5KMKA 5KMIA 4O1OA 1OPLA 3GC7A 5GZ8A 2XANA 2FUMA 3ENMA 5ETAA 4PP7A 5AMNA 2UZVA 3UPXA 5J5TA 4YUQA 2GNJA 3PY3A 4H3PA 3RAWA 4CZTA 1TQIA 3QZHA 5HVYA 3TZ9A 1URWA 2HW6A 4IVAA 1JKSA 4GK3A 2X39A 2BDJA 4O0SA 2A0CX 3NR9A 4CCUA 3HKOA 3H30A 3BX5A 4KIKA 4KNBA 4B8MA 4I22A 3R7OA 2UZNA 4QP1A 3SRVA 5KBRA 2PU8A 3SW7A 2OZOA 3TZ7A 2JITA 3UTOA 4CVAA 4ZK5A 1H1SA 2JAMA 3KRWA 5AR2A 4U7ZA 4L46A 3G9LX 3QUPA 4ZLZA 5C8KA 1Q3DA 4C3FA 1Q8TA 2A19B 3FKNA 3OCTA 2ITOA 5BVEA 3K2LA 3DKGA 4EH7A 3MW1A 1T46A 4DFNA 3SVVA 2OJ9A 2R3FA 4HGSA 5IQGA 4UMPA 5HLPA 2JFLA 4EOMA 4ERKA 1VLRA 1YWVA 3DU8A 5TF9A 4NW6A 5AM7A 3W8LA 4Z55A 5LOHA 3F82A 4I5HA 3NCZA 4IWQA 5C4LA 1ZZLA 4QMWA 2CPKE 4S32A 4O7NA 2VTOA 3W2OA 4JIKA 4RBLA 5D12A 2G2HA 4TWCA 3I5NA 5LXMA 3GU5A 2PZPA 4DN5A 4M67A 5AR5A 1JSVA 3PJ8A 3BGZA 2X9EA 1W7HA 4BDBA 1ATPE 5M51A 2ERKA 3FC1X 4FI1A 4F70A 4RFZA 3OUNB 3AD4A 4G5JA 5H8EA 4E1ZA 4E4LA 4E6AA 4IX5A 3C0GA 4WO5A 3MFRA 2WTWA 3ZRKA 3S4QA 4QMLA 4ZLOA 1LEWA 1R3CA 1AGWA 4QNYA 1M14A 2OW3A 2WMTA 4QD6A 3CCNA 2QOCA 5KMNA 4BGHA 3FY2A 3PIZA 3WE4A 3WF6A 4CZYB 3H3CA 3KN5A 3EMGA 5IMXA 4ZTMA 2J50A 1JLUE 4M8TA 4O1PA 1IA8A 3PJ2A 5DIAA 4BCQA 4BCOA 5BUJA 2R3MA 2W1EA 3GQIA 3EQCA 4XLIA 3Q52A 3UO4A 3FZPA 3JS2A 4FTOA 3NNWA 5FRIA 5B2MA 5BNJA 1BKXA 2DQ7X 3IKAA 3HV7A 4UWYA 2P55A 4AACA 3THBA 2YJRA 3CJFA 3UNJA 2QOBA 4EOOA 2UZBA 3UPZA 1FQ1B 5D11A 2CMWA 4YJPA 2V22A 2UZUE 3LCTA 3E62A 3RWQA 4L53A 4DHIB 2RG6A 4CQGA 3FYKX 5KUPA 2RL5A 2WGJA 4NU1A 4O83A 3D5UA 3COKA 3R04A 4IHPA 4FR4A 5ANEA 2XK3A 4P5QA 2EXCX 4FZAB 4JBOA 5L3AA 1ZRZA 3NZ0A 4QMZA 3LFEA 2Z60A 4RX5A 4DHFA 2QLUA 4L68A 3QTUA 4MAOA 4MUQA 3UO6A 1BI7A 1YHSA 2BIYA 5HU3A 3Q53A 2C5YA 4DFXE 5EOBA 5AA9A 4ASEA 3B8QA 3QQKA 2R3IA 3FSFA 5CF5A 3PZHA 2QOHA 2C6KA 4JNWA 3PP1A 1H01A 3EFLA 2ZFYA 1YOMA 2J0JA 3H9OA 3FY0A 4FTUA 3VS4A 1KSWA 1QCFA 4DG0E 4RC3A 5I9UA 4F7SA 1UU8A 4II5A 5HO7A 4G6NA 2NRUA 4AWIA 2WNTA 4M97A 3EHAA 4MEDA 5HO6A 4CEGA 3I81A 4ASZA 5E92A 2WD1A 1NXKA 4L3PA 2BFYA 2YJSA 4NH1A 4CD0A 4YZ9A 1Q8YA 4M69B 1YQJA 2R3GA 3SA0A 2JD5A 4MYGA 5G6VA 4EL9A 4NZWB 5IA1A 3ALNA 4Q5HA 4CV8A 1U5RA 2GFCA 4JXFA 5ANGA 4CFUA 4M68A 4I5MA 1KE8A 2EU9A 5F9EA 3VS0A 2Y4PA 5ETCA 4XP2A 3PYYA 5IA4A 1PYXA 2FSMX 3VJOA 3CBLA 5AX9A 2R2PA 3F69A 2WQOA 4U3YA 5IG1A 4YJVA 3VBTA 4ERWA 4FZ6A 4XUFA 4BTMA 4TYIA 1JSUA 2J7TA 2Y6OA 3EYHA 1XHAA 3IGOA 3PSDA 5AIKA 4EOIA 3FI2A 2F2CB 3GEQA 1ZMWA 4E6QA 4TL0A 2EWAA 5IA2A 5I9YA 4Y85A 1Q99A 2ZMCA 2UUEA 1RDQE 4BJJB 1U54B 4RIYA 4P5ZA 3W0RA 3Q3BA 4X2NA 1KOAA 4MX9A 3SW4A 5HTIA 3OEZA 3SXFA 2I7QA 2VWXA 4UMQA 4EOQA 3CQWA 5GZ9A 3D7TA 1WCCA 4DHJA 4LYNA 3OXZA 4IJ9A 4K2RA 4P90A 3QRUA 3ZONA 4BDEA 3QHWA 3FMKA 2ZDTA 4K33A 5GIOE 1ZYLA 2YCRA 3ZLSA 5HTCA 2BZKB 5M4UA 4EWHA 4RFYA 1WVXA 2XB7A 3FLQA 3HMIA 2VTIA 4TWPA 3K3IA 3HDNA 4GMYA 2C0IA 1HOWA 2R5TA 4FT3A 2HWOA 2X0QA 3QTWA 4IM0A 5AP0A 1GIHA 2PVLA 4N0SA 4E3CA 4WSQA 4CRSA 3T9TA 1E9HA 3DBDA 4FKRA 5JQ5A 4UMTA 2HY0A 3V8SA 3Q04A 4GVJA 2RF9A 2HAKA 4IH8A 2Y0AA 3GU8A 3ZU7A 4AF3A 4D2VA 2W9FB 3LHJA 2QKRA 4X6QC 5DT0A 4APCA 4DH7A 1WVYA 3QTRA 3QX2A 3C1XA 3RINA 2IZUA 3FLNC 5CU6A 2OFVA 3DLSA 5IU2A 5ACBC 4YLLA 1IA9A 1K3AA 4HZRA 3TMOA 4MVFA 3RAHA 5L2WA 5GNKA 1XH5A 3GC0A 1YVJA 3KY2A 2ETMA 4FT7A 2PUPA 2QHMA 3MVJA 3VUMA 4AX8A 4O7YA 4C3PA 4AOJA 4BN1A 3JY0A 4BFMA 4C4EA 4E8AA 4FTKA 5B2LA 3MI9A 2W99B 2W5AA 1Q8UA 3BHYA 4DFBA 4TWNA 5ANIA 3IW6A 3NAXA 5IPJA 5A54A 4DFYA 4B0GA 5CU4A 2JIVA 3V6SA 3LKMA 4RZWA 1GNGA 2C6EA 3NLBA 4ZTRA 3QLGA 3RGFA 4DG2E 2I0EA 4ZSAA 3N4VA 3FHRA 1UU7A 4ITJA 5FEDA 2BHEA 3C51A 4FT9A 5HVKA 5IEXA 3KN6A 2HYYA 3H9RA 3EFJA 3S2PA 2C3LA 3NPCA 4ZXTA 5FQDC 3NUUA 4EC8A 2WELA 3MYGA 3BLHA 2VTJA 2YDIA 3QUDA 1PRYA 2CLXA 4F08A 2W4OA 3P1AA 3DXQA 5DR2A 5AV4A 3QQUA 3FI4A 3DB8A 3FXZA 1SVGA 5KMLA 4PY1A 5AV3A 4A06A 5B0XA 3FZRA 5BVNA 1ZAOA 2OH0E 5EYDA 2X2MA 5C26A 4O4EA 2PZRA 4JL9A 2YM6A 4C57A 4QQJA 4EI4A 2BRNA 2XK7A 3U87A 1NW1A 4ZMEA 4AXEA 2WEIA 3NUYA 3TV7A 4OTPA 5L8JA 3P23A 4BCIA 4BCJA 4RIWB 2VN9A 3UNZA 4CFNA 4GFGA 1WBVA 3ZZWA 5FXRA 4BGQA 2XAMA 3D5WA 4LL5A 3CY2A 3OUKA 5J95A 3GENA 2PUNA 2FA2A 2VTQA 2XK6A 2Y6MA 5LMAA 3EL8A 3TACA 4FZDB 4O22A 2VO0A 2W1CA 1WMKA 3B2TA 2RKUA 3KMUA 4W4VA 3DXPA 3EQBA 2QOLA 3NRMA 2A4LA 3R83A 4I1ZA 3BEAA 2YABA 1V0OA 3ERKA 4CFXA 1PMUA 4EJ7A 4N70A 3MESA 4FOCA 4NM0A 3PXZA 5IZFA 4G9CA 5CI6A 3N4UA 2RFSA 3PIXA 4FZFB 3PG1A 4QMYA 3W2PA 3ZSGA 5HX8A 4C2VA 4TYHB 3RNIA 2W9ZB 3ZXZA 2GQGA 2W1DA 5LVLA 1B6CB 3A8WA 1YXUA 2UVXA 3FQSA 3CKWA 2HIWA 5FTQA 2C6LA 5HQ0A 2OWBA 4XRJA 4KKHA 4R5SA 3QD2B 3F6XA 3W1FA 3SXSA 2O5KA 4FSMA 4LRMA 5M07A 4XBRA 5JZJA 3D83A 2O3PA