4QMQA

Mst3 in complex with cp-673451
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 289
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmqA01
4NCTC 4XBRA 4M69B 4FG8A 3F3UA 4U3ZA 4BI0A 2BILB 2YEXA 3ACKA 4O21A 5AP5A 4UMPA 5A54A 2BHHA 2WQEA 3FLQA 1U59A 4XHKB 1T45A 4J8NA 5CSHA 2PE0A 3E64A 2WQOA 4F08A 4YJPA 4Z16A 4MD8E 3OCBA 4NM7A 5AAEA 3I7BA 3UMXA 3DKGA 1FGIA 3ORXA 3V8TA 2PMNX 5IMXA 4F7SA 2AC3A 5CASA 3UPXA 4BCNA 4GJ3A 4DLIA 2FUMA 1O9UA 4BDBA 3DA6A 4YJRA 4CLIA 5AUUA 4GT4A 5TE0A 5B2MA 3BQRA 2V62A 3CKWA 3KRXA 4YJNA 4CYIA 2DYLA 4PMTA 5DR2A 5M07A 4IMYA 4UMQA 5J79A 2WIHA 4FTRA 3RK5A 4ASEA 5JFWA 5BVWA 3SW4A 3LJ2A 4PQNA 3MH1A 3MSSA 1YI4A 4GEOA 4D4VA 4EBVA 4O7ZA 3L9MA 5EQEA 2QOKA 4NSTA 2BDWA 3WF5A 5KCVA 5BYZA 4MNEA 4U79A 5M53A 4D58A 2YLEA 2BIKB 3OFMA 4O86A 1JAMA 4HZSA 3SX9A 3TWJA 3R1SA 3A7IA 5IDNA 5B2LA 3RGFA 2XM9A 2AYPA 4OTQA 4Y73A 3H3CA 4K18A 3GP0A 2B54A 4JX3A 2PWLA 2VTIA 1OUYA 4BCGA 3HNGA 4FZAB 4O7TA 4BZNA 3CQUA 5EFQA 4FZFB 1OPLA 3JYAA 3ZS5A 3V6SA 2QOCA 4LUEA 4N6YA 4DT9A 4A4OA 5M4CA 5GINE 3QC9A 3E8CA 4GCJA 3R22A 4RA5A 4U43A 3L9NA 3RNYA 5HO7A 4S30A 3M42A 4O0SA 5EI6A 3FLNC 1H0WA 3C0IA 3Q3BA 2X7FA 5JK3A 3DNDA 1OMWA 1URCA 5K4IA 3LHJA 4GIIA 4DFNA 3BBTB 4XBUA 3I81A 3VS4A 4CMTA 1E1VA 2WMSA 3BHTA 2BHEA 4L42A 3R7VA 4O38A 4XRLA 4XV9A 4LGDA 3I7CA 2C6OA 5EG3A 4HGSA 4NW5A 5CQWA 3GCQA 5M09A 1H1QA 5IMEA 4D2TA 4I5HA 4QYYA 2KTYA 4YTHA 4MX9A 3R2BA 3M11A 2B9FA 4EBWA 3F6XA 4EOJA 2J9MA 3ATTA 4AZFA 5A6OA 4EWQA 2PPQA 4X6QC 5CS6A 4UMTA 2VN9A 4RFZA 4RZVA 4FSZA 4RIWA 2PMIA 3V8WA 2XB7A 4L9IA 5DEWA 4MHAA 1XH8A 2YDKA 4FA2A 4CKRA 4DG2E 3IECA 3D14A 3ENMA 5IA4A 1LR4A 3GCPA 3AQVA 4RWKA 3KEXA 3DK6A 2HYYA 2WKMA 5HG9A 3WZEA 5KMKA 5E91A 3OBJA 5HO6A 3UO6A 3MVMA 2OZOA 4QMXA 4V0GB 4QTBA 2JC6A 3MVJA 1H1WA 3PSBA 3ZRLA 2HWOA 4O6EA 2JAMA 3FDNA 4QP8A 4C0TA 5K0KA 5M4UA 3OMVA 2VTNA 4WNOA 3PVUA 4NW6A 4UMUA 3E5AA 1SVHA 3MYGA 4IAZA 2PUIA 1ZAOA 4KIKA 1OKVA 5L4QA 4M69A 2WQBA 5A4CA 4RJ6A 5KKRC 1M7NA 3N9XA 3OY1A 5BX0A 3P1AA 3NX8A 4KKEA 3R8VA 2H96A 2HK5A 3KXMA 3ZUTA 4K11A 1FVVA 3QYZA 3LIJA 3KRWA 4FV8A 4FTOA 4BCKA 3KGAA 4RVTA 4AFEA 3AC8A 3JVSA 5HESA 4BDCA 4QT1A 2FSOX 2W5BA 4C61A 1FBNA 3PIZA 3QKMA 4J8MA 2OIDA 1KE9A 3T8OA 1Q97A 5J5SA 4NUSA 3Q2JA 4DINA 2I1MA 5F1ZA 1V0PA 3E63A 4WSYA 2ITQA 4FV5A 3WARA 3I0OA 4FIGA 4PRJA 4B0GA 4ACDA 5DT3A 4CFVA 4RVKA 2UZNA 5HBHA 4EI4A 4CD0A 2IW6A 2FO0A 3SG9A 2RFEA 4CMUA 2ZMCA 5I3OA 3QQHA 1JKTA 1ND4A 5D7VA 3RPOA 3ZRKA 2WOTA 3GC9A 1TQMA 4ZTHA 3SXSA 4QYHA 3W8LA 5L2QA 5CU6A 3NGAA 2QLQA 2RL5A 2ETMA 4JBVA 4BB4A 2FSMX 3ZBFA 2HXQA 3MBLA 4FTJA 3FMLA 2XKCA 4O7RA 2W5HA 4I41A 4I6BA 4AZVA 2XK3A 4JG8A 3G33A 3FMMA 3GU7A 1KE6A 5DT0A 2JLDA 4EOKA 4MQ2A 2GQRA 3HAMA 2VWIA 4MXZA 4I4FA 2REIA 3G0FA 4QOXA 5CF8A 3LFEA 3MA3A 4ZTNA 5IUGA 3TUBA 3HRFA 4GG5A 3MTLA 4AUAA 5I0BA 3VBYA 4LUDA 4F99A 4RJ8A 3NUPA 4F63A 5C4KA 4IQ6A 2PZ5A 5L6PA 2W05A 3HZTA 3OROA 1ZYLA 2CLQA 5L8JA 3OHTA 1CTPE 4BI2A 4EK3A 3DK3A 5CAQA 1ZYSA 2QC6A 4W4XA 3RNIA 3DBEA 3VIDA 5JFVA 2YFXA 1R0PA 2UVZA 4LL0A 2QLUA 3ORIA 3ORLA 2YCSA 3V6RA 3BKBA 4RVLA 3U9CA 4ASXA 4WG5A 4FK3A 4V01A 3BHYA 4QPAA 2XMYA 1XQZA 3IK3A 3Q4UA 4ARKA 3MPMA 2WPAA 3F2AA 4ALVA 1ZY5A 3ETAA 4OAVB 4BDAA 2PUNA 3Q9YA 5KHWA 3QAME 2UW4A 4G1WA 3KKVA 3F7WA 2IN6A 4NH1A 5HTBA 4IX5A 3ZZWA 4FVRA 3A8XA 3R1YA 4AT5A 3F2RA 3CY2A 1OGUA 2GTMA 3DJ6A 4RJ4A 3O23A 2PVNA 4RGJA 2UZDA 2BRNA 5AMNA 3QQFA 2GHGA 3WILA 4AAAA 2ITNA 2CN8A 4WG4A 4N0SA 3COHA 5ITAA 3D0EA 3UIUA 3EL8A 2B9JA 4Q2AA 3ZU7A 1OIQA 4BTJA 5LVOA 4U9AA 1KE8A 2QOHA 4EH8A 4EKLA 2YIXA 4L52A 2WTVA 4O27B 2R3QA 1BMKA 2G2IA 2XK7A 1Y91A 3I0QA 4V0GA 2W96B 4MK0A 4F9YA 4A9UA 4ZZOA 5D1JA 5FEDA 4QMTA 3ZUVA 1RE8A 5CQUA 4FIHA 4LYNA 2UW0A 4WUAA 2EB3A 2ITUA 2GMXA 1LEWA 3FQHA 1PXJA 5HE2A 2VWBA 2SRCA 2ITVA 1GZ8A 1K3AA 3L1SA 4L53A 3PPZA 1M52A 5CU2A 3ZH8A 4CFNA 2PVFA 3QRUA 1FPUA 3G9LX 3W10A 5C26A 5AR5A 3FXZA 3MS9A 4DGMA 1IA8A 3G0EA 4UZDA 3CQWA 5LWMA 4TYHB 1JKKA 2YIWA 5ANDA 5CNOA 1ZXEA 3VRZA 3D2IA 3E8EA 2JKMA 3FZPA 4IB3A 1QCFA 3Q5ZA 4XMOA 4L00A 2FVDA 4U8ZA 5EK7A 1YQJA 4LOQA 5HNGA 4HVSA 1XHAA 5HE0A 3SRVB 5CEOA 2VD5A 3ZM4A 3N4TA 4DEAA 3GB2A 4BFMA 4BICA 3EQIA 4M13A 4DGGA 4TN6A 4J52A 1H24A 3DKOA 1WBVA 4R7HA 1V0OA 4FI1A 3E7VA 1ATPE 5D41A 1NY3A 2ONLC 2XF0A 5FTQA 2Y7JA 2FB8A 4IHPA 2UV2A 1J1BA 3FYJX 3CE3A 2W1ZA 5AFVA 2J7TA 2AUHA 3PRFA 4GVJA 3REPA 3UVQA 4BYIA 4IVAA 5ANGA 2EXEA 3LLAA 2UVXA 1X8BA 4EQUA 3GU5A 4FIIA 5H9BA 4BDDA 5JSMA 4J1RA 3SQQA 3TG1A 2F57A 3DAJA 4E6CA 4I0RA 1CKPA 3RAIA 1IAJA 2I0EA 2CLXA 4FTCA 3LVPA 2X8DA 4XEYA 4YC8A 4FT7A 5JGAA 3EQPA 3O50A 3PTGA 5FEQA 3LCSA 2C47A 3PXZA 4L46A 2VTOA 3S2PA 4WRGA 5HBJA 3BELA 2FSTX 2H9VA 3PXQA 3R01A 4W8DA 4DGOA 5IQBA 1ZMUA 2BFXA 3WIGA 5EKOA 3VNTA 4TL0A 2HW7A 3MIYA 1UU3A 5AV3A 3PXFA 3F61A 4FZDB 5K0XA 2IVTA 3UNZA 5D12A 4ALUA 5J1VA 4HYHA 3D5VA 4H36A 5ETIA 3F5GA 1H27A 4FG7A 3U9NA 4BYJA 4FEQA 4FSRA 4XG9A 3C51A 3QXOA 3VS1A 3A7JA 5IUHA 1APME 5KMNA 3JXWA 2HY0A 4P7EA 3RI1A 3IO7A 5AP1A 5G6VA 3V3VA 5JT2A 1CKJA 3VUDA 4AACA 2PSQA 3PVBA 1ERKA 4GRBA 3OCGA 5M08A 5G1XA 1PXIA 1JSUA 2ERKA 4YTIA 3GC8A 2QKWB 5KHXA 3UE4A 3NYNA 4AT3A 2HIWA 3BYOA 2JIIA 2W9ZB 4RQKA 4DH5A 2WEVA 4C7TA 1LEZA 3V5LA 1PKGA 4TWPA 2QO7A 4C4IA 1QL6A 2P2HA 5KBRA 2OLCA 3C4CA 3QC4A 2OK1A 4J7BA 2YJRA 4KS7A 3P5KA 2ZB0A 4MH7A 3CGFA 4QTCA 3FBVA 3F9NA 4RJ5A 4RIYA 4AA0A 5KNJA 2BZJA 4FT3A 5CAUA 3KULB 4E4XA 3BE2A 1OL1A 2B7AA 2BRHA 2RSVA 4FE2A 2XNPA 4OT6A 3AT4A 3QGYA 4W9XA 4EOMA 3G15A 2BMCA 4AE9A 5CY3A 4BBMA 3II5A 4N6ZA 4D5KA 5J5TA 2C6KA 3BHUA 3FKOA 5KZ0A 4QP2A 3R9RA 4CQGA 4EH4A 4BCHA 1KOAA 3P86A 3PRIA 1DI9A 4QQ5A 2X7OA 2BDFA 3UGCA 4G31A 1OITA 1YXUA 5CEPA 4XH6A 4K8AA 3PJ2A 4ZXTA 2GFSA 3IQ7A 4JG6A 3HLLA 1Q62A 4YJQA 1JKLA 3Q52A 3SLSA 2I7QA 1OPKA 3CJGA 3MWUA 3TIYA 2V0DA 4WBOA 4GK2A 3LCTA 4BWXA 3OCTA 3COIA 3UIBA 3L9PA 4KABA 3IGOA 4M97A 4V04A 2P2IA 3FY2A 4ZTMA 2CN5A 2C4GA 4FICA 1YXXA 4KD1A 1ZY4A 3TEIA 4KBAA 4LRKA 5EHOA 5CVHA 3PG3A 2PZYA 2RFSA 3I5NA 3LJ0A 3R0TA 4FF8A 4PTCA 5E8SA 3ZEWA 2RGPA 2WMAA 2J4ZA 3MFSA 4D0WA 3IW7A 4J71A 4RX7A 3WBLA 1R1WA 4JX7A 1BKXA 3ZYAA 4IZAA 4TWCA 5CU4A 4O82A 4G3EA 2ACXA 3FMKA 5HORA 4S31A 4UBAA 3VS6A 3LMGA 4RFYA 5DEYA 2V7AA 4M0ZA 3BEAA 3NUSA 2YACA 4L45A 3EN5A 4KSQA 5HE3A 3UVRA 4GKHA 3HV6A 2R3KA 2C0OA 3E8NA 2X6DA 3LXKA 2BRBA 4MBJA 3TUCA 5HIEA 3VUHA 4FR4A 4BF2A 4YPDA 4FV9A 3UODA 2BVAA 4D2WA 3F88A 3FL4A 2F7ZE 5CNNA 1I09A 1GNGA 2Y0AA 4JDHA 5CEKA 5IA5A 3WE4A 3C9WA 3O71A 5LWNA 2J2IB 4TPTA 1H08A 4KB8A 4OBPA 1OKWA 2VO7A 1UV5A 4TNDA 4DEBA 1F3MC 1Q3WA 2VWYA 3WYXA 4YO4A 3UQGA 1YWVA 2YIYA 4G5JA 3ZOSA 4IH8A 3BQCA 5GJFA 3RCDA 1H07A 4C3FA 4ZS0A 3CSVA 5HIBA 5D7AA 3QTSA 2WTKB 4II5A 4IZ7A 4QQJA 3IDPA 5J9LA 1MP8A 3P08A 3AD5A 2Y8OA 3DNEA 3NAXA 2V7OA 4IBMA 4FZ7A 5DLSA 4PP9A 4F4PA 3E3PA 5HE1A 1OZ1A 4AZWA 4BCOA 4ITIA 1WCCA 4RIXB 3SDJA 4GL9A 3IOKA 2CGVA 3O51A 1ZOEA 4FL3A 4PDPA 2CNUA 5A4QA 3OW4A 4FKTA 2Y4IC 5J7BA 3A7GA 2UZBA 3OWKA 4IC8A 3BYSA 4U7ZA 2EXMA 4RLKA 3H30A 4CG9A 2IZSA 3DV3A 5FDXA 3EQRA 2QKRA 3FZRA 3R30A 3AT2A 4EONA 3UYSA 3DJ7A 4NL0A 5LVLA 1WAKA 4V05A 4FV1A 3OUNB 2BFYA 3NZ0A 4FV4A 3NDMA 1PW2A 4A9TA 5AR3A 1Y8GA 2W4JA 3LFNA 1ZOHA 4NU1A 3K5UA 4UMRA 4I4EA 1W0XC 2G2HA 1H8FA 3AT3A 3DQXA 3PJ8A 4X2NA 2C5XA 4Q5HA 3ZLXA 3N4UA 3FC1X 3DQWA 4IAFA 5IEYA 1P14A 4M67A 4EYMA 3QUDA 5HLPA 4DYMA 4QP7A 4A07A 1ZMWA 3GU8A 2WIPA 2F4JA 2OXYA 3R7OA 1QPJA 4NJDA 2PE1A 2XYUA 3PP0A 4FUXA 4U3YA 4GFOA 3DKCA 2G15A 3G90X 2XJ2A 4XG4A 2ERZE 4B9DA 4C4HA 3W32A 2VTMA 4O6LA 2WTIA 4PUZA 1SVGA 5AUXA 2OW3A 5DMZA 2JDVA 3LQ5A 3FZTA 2YCRA 3I6WA 3DPKA 3F2NA 4FKGA 3QD4A 4FV6A 1JBPE 2PVMA 2ZB1A 4DITA 3PDTA 3BV3A 5K5XA 4EK8A 1SM2A 5D11A 5ANOA 4O0UA 3K2LA 4EOLA 3CS9A 4XYFA 3LCDA 4RFMA 3LCOA 3EFKA 4HJOA 4I5PA 1WBSA 4FOBA 4JLCA 3RK9A 3K5VA 2O0UA 3KFAA 4CFWA 2VNWA 4DTBA 2CGWA 1ZRZA 4ZY6A 3O17A 2BKKA 5CZHA 1KWPA 2YLFA 4MXYA 2OICA 3KMUA 3KA0A 1K2PA 3OZ6A 3RAKA 3GXLA 4IFCA 2FYSA 1DS5A 2EU9A 2W99B 3EYHA 2PVHA 4GMYA 4UB7A 5HBEA 3TNWA 4DH1A 2ZJWA 3GCUA 3VO3A 2BUJA 2VTLA 3S4QA 5BVNA 4EK6A 4W4VA 4CSVA 3LXPA 1H4LA 3RK7A 4D2VA 1OIYA 4DEDA 3P79A 4G3FA 3DBFA 4ZZMA 3P9JA 3C7QA 4U40A 3FC2A 4IFGA 4HCUA 3FMDA 4OGRA 3EQBA 3KY2A 3R8ZA 5EHYA 3PSDA 2OIQA 2Z2WA 4IM2A 4AN9A 2XKFA 4P90A 4A7CA 1SVEA 2UZWE 2VTRA 4S32A 3NYVA 5E8VA 4QTEA 3ZFXA 4JR7A 4XCUA 2CKQA 4C8BA 2JD5A 3A7FA 1YRPA 1H1RA 4YNEA 1G8SA 4C34A 2C3KA 3E3BX 4HVIA 1IA9A 3I79A 4FTLA 3IDCA 4QPSA 3ZC5A 3EB0A 3NAYA 3CC6A 4FC0A 5KMMA 5EW3A 4EC9A 1REKA 5IEVA 2I0YA 4AA5A 4AGUA 4YLLA 2VTPA 3KCFA 3F7ZA 3QHRA 4N57A 3SAYA 3A61A 4U81A 1VEBA 3WE8A 4AZEA 4BZOA 2QOIA 5BMSA 3VBTA 2GHMA 4YGAA 4HVDA 2OJIA 2PVKA 2Y6OA 3PPKA 1WMKA 3LKMA 3AC5A 1XH9A 5FWKK 4EJNA 5DRBA 4K2RA 3BEGA 5CLPA 2J0LA 2P55A 3E87A 4RIXA 3RZBA 1UU8A 4JXFA 2ITWA 3D5UA 4H1JA 2IWIA 1MUOA 1OPJA 1Q8YA 3DDPA 5HG7A 4BHNA 1BI7A 2HY81 5F94A 3AGMA 3TNHA 4O2PA 1CDKA 3MJ2A 2YN8A 5DPVA 5T68A 2X9FA 3W2SA 4E6QA 3HX4A 2XBAA 4E4LA 2VRXA 4YHTA 2C1AA 3C4WA 4WNKA 3ZLSA 4EUTA 1KV1A 1T46A 4ANMA 1ZWSA 4WSQA 2A1AB 4NM5A 5EYKA 3HVCA 5IQFA 5M56A 3W55A 2VTQA 4LQMA 2ESMA 3MGYA 5DE2A 2QOFA 4ZIMA 1V1KA 4L01A 5EI2A 3VF9A 1PXNA 3SG8A 3SD0A 3AC3A 1M2PA 3SKCA 3VS3A 2IVSA 4O81A 5KX8A 3NUNA 3CCNA 4BI1A 3AD6A 2GNFA 5H8BA 4I3ZA 3U8WA 3HL7A 1Q41A 5IISA 5IQAA 3HMOA 4E6DA 5IH6A 3S1HA 1MRVA 4K0YA 4QTAA 3KQ7A 4CV9A 4I22A 4W8EA 4ZY5A 2ZOQA 3ZLYA 2HELA 3GQIA 2HZ0A 4O0VA 1V0BA 2GNGA 1WBPA 4LM5A 3MB7A 1YDRE 4ZOGA 2A4LA 4H39A 4AOTA 4K1BA 4ITHA 1FMOE 4QYFA 4F7LA 5HOAA 2YZLA 4WOVA 1BLXA 3FMHA 2Z02A 4FUYA 4H05A 1CKIA 1PJKA 2YIQA 3MFTA 4KBKA 1WVYA 3ANQA 3GCVA 4X2GA 4NYEA 4BCIA 1Q8UA 4GU9A 4ZSGA 4IDTA 3OF0A 3DXNA 2ITPA 3G2FA 3HUBA 4BDFA 2JKOA 4U42A 4WIHA 3ITZA 4EOIA 2RG5A 4OTWA 5JQ8A 3FY0A 3EN9A 4JR3A 2Z60A 1SYKA 3HMIA 3RHKA 1S9IA 4FTAA 2YITA 3TJCA 1PYXA 4WT6A 4WD5A 2ZDUA 4FSMA 4X6RA 3BV2A 3SHEA 2EB2A 1YOLA 2DUVA 4D1ZA 4ERKA 5IG1A 5IKWA 1GIHA 5EDPA 4BTKA 3EL7A 2J50A 4Y8DA 2PULA 3FXWA 3MV5A 4JT3A 1YXTA 3F3WA 4RRVA 3ZO4A 3G5DA 4F6UA 3QQJA 2RG6A 3QKLA 3AMAA 4PL4A 1H28A 3G9NA 3Q96A 4QMPA 5HVYA 5E4HA 3FZOA 1TQIA 3BCEA 3FI3A 2WEIA 4FKSA 2O65A 3PVGA 4FKJA 4O1OA 5BNJA 4DA5A 3OCSA 5HG8A 3MVHA 4RX9A 2R3PA 3R7EA 4FTIA 4AU8A 4A06A 4O0WA 5T3QA 3VW6A 3KXHA 3PY3A 2HXLA 2PVJA 4DFZE 3VBQA 3GQLA 4X2FA 3ROCA 4Q9SA 3HEGA 4G5PA 4AW0A 4EL9A 2X7GA 2JGZA 4AG8A 2WELA 3NS9A 2PY3A 2X8EA 4M0YA 3IG7A 4OTDA 4RPVA 5E8UA 4FKOA 4IZ5A 1URWA 3R2YA 4U97A 4ZSLA 3WIKA 4H3PA 3TNIA 1UWHA 3TT0A 4L6QA 3ID6C 5ACKA 4NM3A 2CSNA 2I0VA 3P23A 4IADA 1Y57A 2XK6A 1P4FA 4YZ9A 4MWHA 2WB8A 5CSVA 2WTKC 5B2KA 3OS3A 2F2UA 2P0CA 2H8HA 4A9RA 3Q60A 3EFWA 4RQVA 3UQFA 3ZRMA 3EFJA 3RAWA 4KIPA 4LOPA 2R3OA 4K6ZA 3VUIA 4CV8A 1U5QA 5HD4A 4RG0A 3LLTA 3QTXA 3R8LA 4DGLC 2HOGA 2XVDA 5AA8A 5CALA 4PL5A 5EHLA 4NKAA 5CVFA 2BIYA 3PWYA 4CZTA 2BDJA 5IU2A 4DCAA 4I0TA 4CRLA 4QYGA 2OXXA 5CAPA 3QGWA 4IB0A 2XCKA 2LAVA 4HPTE 4M15A 3VW8A 4FKPA 4ANNA 2QOOA 3RP9A 1WBOA 1QPDA 3QFVA 5LVMA 2UZOA 4XOYA 2X2MA 5AV2A 4XV2A 1J3HA 5CT0A 4DN5A 2J5EA 1QPEA 4I0SA 2OH0E 4CCUA 2PMLX 1TQPA 3BI6A 1H26A 3BLHA 3TZMA 3W2PA 3UDBA 4ANSA 4DFBA 3NNVA 5IQGA 5FM3A 2XH5A 5EKNA 3UOJA 5F95A 3HMNA 3R1NA 3I6UA 4L68A 4OBOA 3OTVA 5AP7A 5FQDC 4F1OA 5A4TA 2OXDA 2PMOX 3HDMA 4FKLA 1M2QA 4LL5A 4JRNA 3H9FA 5BVEA 4O84A 2ONLA 4I1ZA 4MYGA 4BHZA 4C4EA 2XZSA 1H0VA 4O7WA 4ZTRA 5DYJA 4AE6A 2R3FA 2PVLA 4X7QA 4A9SA 3RZFA 5AUTA 4UV0A 3ZO2A 1L3RE 2W9FB 3N4VA 3NRMA 3UIMA 4FK6A 4GV1A 1PMVA 3W33A 1CM8A 1PF8A 2QQ7A 3E92A 3NW5A 2ITOA 2JITA 3Q04A 3Q32A 4FNWA 3PFQA 5FBOA 3QZGA 4BKYA 5HU9A 4OLIA 4IWPA 4QMZA 3R9HA 5EYMA 1U54B 3WF8A 2ITXA 3FZ1A 4FV0A 2X8IA 4WO5A 4FTQA 5LCKA 4HW7A 4UX9A 4YNOA 2ITZA 3DBDA 3GU4A 2HENA 4RWLA 3VBVA 4JQ7A 4YJUA 5IH4A 4ALWA 1UNHA 1PXKA 3PJ1A 4YC6A 4EWHA 4RVMA 4YR8A 4X3FB 5AR7A 3DBCA 5M55A 4ANOA 4FEWA 1J91A 4JJRA 2YM7A 5H2UA 3AXWA 4QP6A 3QZIA 4PF4A 5ETFA 2Y4PA 2ZM1A 4Y5HA 4YZDA 2A19B 2C3LA 3R9OA 5CENA 2JKQA 4WRSA 3TZ7A 4PDOA 1EH4A 2GNLA 3MJ1A 4IB5A 4BBEA 5M51A 2J0JA 4CZUA 1L8TA 2C6TA 2XS0A 4ZEGA 4R78A 3LXNA 3UZPA 4RLLA 4D4YA 4BR3A 4YJSA 5T6KA 1RJBA 2Y4IB 1XJDA 5TR6A 4DT8A 4FNYA 3DB8A 4GUBA 5HTIA 3NVMB 4X21A 3W2OA 2C69A 4PWNA 2I40A 5DHJA 3VHEA 1Q5KA 3P7BA 4FNXA 4GIHA 4UY9A 3EMGA 4PTGA 4HNFA 3VQHA 3R8PA 5C8NA 5DGZA 3I5ZA 1YWNA 3KMMA 2NPQA 3DKFA 4ACGA 4E73A 2IG7A 4CT2A 5IH5A 4EH9A 3W16A 3TNPC 4QNAA 5M57A 5LVPA 3NSZA 3A7HA 3QD0A 4OW8A 2AC5A 4QMWA 5AAFA 4FL1A 4CZYB 4JDIA 4NM0A 3VS0A 3GU6A 5GZAA 2PUUA 2UZUE 2YERA 2CJMA 5M44A 4IW0A 3AMYA 3W18A 2VTAA 4XOZA 3W2RA 3QBNA 4NJ3A 3U6JA 3CPBA 4P2KA 4ASDA 1STCE 4QMVA 3ZEPA 2QURA 4D55A 4DH7A 4Z3VA 3OT3A 3QUPA 2F2CB 4QP4A 1OIRA 2QU6A 4PMSA 3VUGA 3O8TA 4C2VA 1PMUA 4YP8A 4YPSA 3PY0A 4P5ZA 3TZ8A 4ENXA 2UUEA 5HX8A 2E9UA 3LQ8A 4OTHA 3UP7A 3NLBA 4HOKA 5FEEA 2VO3A 3SA0A 4EH2A 3AC2A 4IIRA 2JEDA 1OUKA 5CU0A 4DEIA 4XP0A 4F0IA 4O0RA 3VULA 3SOAA 2OZAB 3A60A 3OOGA 4TYEA 4ZTSA 3LM0A 2QHNA 3U87A 3ZONA 3LMIA 2XJ1A 4YJVA 5AV1A 2DWBA 4HVGA 1JSVA 3QLGA 3PSCA 4ZZNA 4X0MA 5DH3A 4BDEA 3NUXA 2GTNA 3KCKA 4GUEA 3DU8A 3BYMA 3DAKA 4AW5A 4WNMA 5CXZA 4I92A 2V5QA 5IQEA 1B6CB 5IA2A 1XBCA 3F5XA 3KRRA 3UC3A 3RCJA 4BN1A 3DK7A 5AP3A 3BHVA 4RA4A 4ASZA 3HECA 3QQGA 2WGJA 4DFYA 2F7EE 3D2KA 3KN6A 2XRUA 2A2AA 5DN3A 4FTMA 3VUTA 2YISA 2ZVAA 3OXIA 4IAIA 4WG3A 3T9TA 1WBWA 3OY3A 4C38A 1MRYA 3F3VA 4FZ6A 1BL7A 1U54A 4F09A 4G6LA 4JIAA 2VX3A 2XRWA 4JVGA 3EOCA 4KSPA 5HNBA 1ZYDA 5IF1A 3L8XA 5GIOE 1FGKA 3IW6A 2OO8X 4CGAA 4U44A 2XEYA 4XG3A 3HKOA 2X39A 2XNBA 5E8ZA 4EOPA 1QPCA 3BU6A 5BUIA 4X3FA 4KIKB 4PDYA 4E4NA 1YHVA 4BCPA 4BIEA 4IACA 3M1SA 2FGIA 2I6LA 2OH4A 1Z9XA 5C03A 3VS7A 3NUUA 1UKIA 3N51A 4TT7A 1FOTA 3FPMA 3IONA 2Q83A 3Q9XA 2UW3A 4LGHA 3VAPA 4XRJA 4AOIA 4MEDA 2CMWA 3EQCA 2C68A 2WOUA 4R1YA 3R21A 4Q9ZA 1AD5A 2XNGA 5JN2A 3D83A 2PUPA 4IAYA 4BCFA 2YIRA 1YOMA 3DS6A 3LFQA 5FP6A 4XX9A 3GFEA 1DI8A 3P0MA 5JFXA 3QTRA 5IQDA 2ETKA 2VGOA 3C4FA 3B2WA 2YDJA 4JS8A 2ZDTA 4E5WA 2IJMA 3OXZA 3E93A 3EJ1A 1Q4LA 1ZYJA 4NTTA 1DAYA 2X2LA 4TYGA 3FHIA 4MQ1A 4QP3A 4JDKA 4AZSA 2UW5A 4D2SA 4DAWA 5KZIA 5LOHA 3PVWA 1Q8WA 5ETCA 4ZLOA 4JI9A 5C8KA 3L8VA 2XCHA 1KV2A 1OIUA 2XJ0A 2BTRA 4D1SA 4FKIA 4XP2A 4BDIA 5A46A 3R7IA 2PL0A 3IS5A 2OG8A 3D7TB 3ET7A 2CCHA 5A4EA 3RTPA 2YM5A 3H0YA 3UIXA 3LCKA 1XH7A 4CCBA 3R6XA 4CRSA 3FJQE 3QL8A 3R00A 3FPQA 4I6QA 3FXXA 4WNPA 3QLFA 5LARA 3NCZA 4NKSA 4QP9A 2OF4A 2WNTA 3CKXA 1J7LA 4FTUA 2BAKA 3PIYA 4PPBA 2QNJA 5KMLA 3TTJA 1JVPP 2PYWA 3KK8A 4WUNA 5AP0A 3GBZA 1FINA 2Z7QA 2W4OA 3QTIA 2PZIA 2WMWA 4D1XA 4CKJA 5JFSA 2OJGA 1Y6AA 5LJJA 4DBXA 3ATSA 4TYHA 3EKKA 3HMMA 1W84A 4GYIA 2ZYBA 3LFCA 3E8DA 4WBBB 3QRIA 3BYVA 4RC4A 3KVXA 2UZEA 1IR3A 3ZO3A 4C35A 5LCJA 3U55A 1UWJA 4O7NA 3RAHA 3QQKA 4BL1A 2OZAA 3P4KA 2C6LA 4B8LA 4EEVA 3NUAA 1DM2A 4WA9A 3SRVA 3I60A 4JAIA 3CTHA 1A06A 3O8UA 3QF9A 1PKDA 5DRDA 2R3LA 3C1XA 2UW8A 3KB7A 3QUEA 2A27A 4PMMA 4HPUE 4KWPA 3UZTA 2X81A 4PL3A 4I6FA 1YKRA 5HU3A 4PV0A 4QYEA 1H1PA 3QRTA 3KF4A 4PNIA 2YWVA 4YZCA 3RPRA 2X9EA 4TWNA 2EWAA 2RFNA 4APCA 3CTQA 2EVAA 4BTMA 4CG8A 2QG7A 4GG7A 5A14A 4ANBA 4U0IA 4BRXA 3Q4TA 3ZDUA 1OKYA 3W8QA 2IZTA 4H3QA 3UO5A 3EQHA 2XA4A 3VJNA 4JDJA 3UJGA 2BROA 4AXAA 3PE2A 3UZRA 4O7SA 5AX3A 3MPAA 1F0QA 4J98A 3KC3A 4PPAA 3K54A 3DT1A 4I23A 1Y8YA 4RC3A 3NR9A 1ZARA 4E93A 5EI8A 3UVPA 4KRDA 4MBIA 3GT8A 3ZHPC 4HCTA 4ZK5A 4M3QA 3TACA 3DY7A 4BWKA 1U4DA 4XV3A 4G9RA 1J1CA 5GJDA 3ZFYA 4BGQA 4EH6A 4F70A 1VYZA 2G1TA 4X3FC 2WMTA 3IDBA 5ANJA 1MRUA 4QTDA 4YC3A 5K9IA 2JDRA 3Q4ZA 4BKZA 4DFLA 2C1BA 3HV3A 3MY5A 4HGTA 4MKCA 4N4SA 4XG7A 4Z7HA 2NP8A 2XIZA 4QMYA 4QD6A 5KMJA 4AFJA 3QCQA 2QHMA 5DI1A 4QP1A 2XBJA 1O6LA 5HG5A 4ACHA 2HZNA 4XG8A 2GS7A 1YI3A 3F5UA 4RWIA 2IW9A 3RPYA 4LV5A 2GS2A 4LG4A 2VO0A 4YHFA 4FEXA 5AUYA 1F5QA 3T9IA 1KE5A 3AG9A 4BCJA 4NWMA 5AA9A 4TYJA 3K3JA 3CY3A 5ETAA 5GNKA 4EHEA 4FYNA 3FHRA 5J87A 3BX5A 3FI2A 2XUUA 4RC2A 1AGWA 3TXOA 4ZP5A 4BIBA 5JZJA 3KULA 2OSCA 4M84A 3QD2B 4MBLA 5HVJA 5CU3A 1CMKE 4CXAA 1IAHA 1MQBA 3GGFA 2Z7LA 4A4XA 2GSFA 1FVRA 4IWQA 4DG3E 5FUTA 5K3YA 1Q8TA 4F7NA 4FSWA 2C5OA 3VHKA 3WZJA 3D7TA 4IVDA 4LOOA 1AQ1A 2OF2A 3CGOA 2W1IA 1BUHA 3RM7A 3OWLA 3R63A 4X2KA 3CPCA 4CLJA 3LXLA 3QTQA 2A0CX 3PZEA 3A62A 5ACBC 1M14A 1SNUA 3PJCA 3ACJA 4IE9A 3BBWA 4JAJA 1WZYA 3IOPA 4OTPA 1W8CA 5HKMA 5D10A 3ULIA 5L6OA 2IPXA 2YA9A 3KRLA 3JUHA 2GHLA 2QODA 4KIOA 4FX3A 1P4OA 4FTKA 4C3PA 2ZM3A 4PTEA 3D9VA 4J53A 5HHWA 1DAWA 3Q5IA 2DS1A 3LFAA 2R0UA 5L6WL 1W82A 5CXHA 4FBXA 5GZ8A 4O7VA 3RALA 4PDSA 2NNWB 3Q9ZA 5JH6A 1H25A 4FT5A 2R64A 3FMNA 4IX4A 4AZTA 3S00A 1GJOA 4CFXA 4IZYA 5KMIA 2B55A 5I4NA 2CGXA 2VUWA 3UO4A 3FL5A 4D4RA 4IXPA 3R7YA 4G6NA 4S33A 4D5HA 2GNJA 2BZHB 2I0HA 2YM8A 2HZIA 3R04A 4IB1A 2X6EA 3PWDA 3MW1A 3EHAA 4ZLZA 4QRCA 3COMA 4MNEB 2VU3A 4DHFA 5BPYA 3QTZA 5I9UA 4KKHA 1PXMA 4F1MA 3TJDA 4S2ZA 4MCVA 2OKRA 4HYSA 3ZC6A 4GFGA 3BU3A 4XG6A 3TDWA 4DH3A 2JIUA 2VWZA 4P4CA 2WU7A 3KU2A 2YAKA 3WI6A 4BKJA 2IZRA 3PY1A 4EZ3A 2QG5A 5TKDA 5CF6A 3DZOA 3P7AA 1PXLA 4FYOA 1WBNA 3NEWA 3ZUUA 2CKPA 5CSWA 4APPA 3HAVA 3MI9A 4JBOA 2HW6A 3LFSA 3UG2A 4GU6A 3LQ3A 3BHHA 2CKOA 3NMUF 3ZXZA 3ORMA 2NO3A 3BE9A 3BIZA 5EM8A 3FSFA 4QMOA 5HD7A 2HCKA 3BWJA 4UXQA 1ZLTA 4BDJA 3ROYA 3TN8A 5L2TA 5CAVA 1H01A 4AGCA 5CYIA 4FGRA 3PYYA 2WHBA 2OIBA 4YO6A 3QCSA 4JIKA 5BYYA 3JR1A 4FV2A 3KK9A 4QPMA 5FD2A 4M7IA 3ZO1A 4QQTA 5C4LA 3TUDA 1K9AA 3R9DA 2RKUA 5EW8A 4ANLA 2QD9A 3NYXA 4M12A 2PVRA 4XLVA 3AC4A 4F1TA 1UNGA 2R3JA 2XNMA 5EM6A 3V5JA 2IZUA 2GNIA 2VTTA 1ZZLA 1NVRA 4NT4A 4BDGA 5M4IA 2PZRA 2UW6A 4NIFB 3JY9A 2G01A 2W1DA 4QNYA 4QMSA 2FA2A 3UTOA 1ZZ2A 4BCQA 1JKSA 5L2IA 3QTUA 3GVUA 4GH2A 4FODA 2BCJA 3U54A 5AP4A 5CSXA 2CNQA 4YURA 4NFNA 3R8MA 1VJYA 2VX0A 5AWMA 3HYHA 3NW7A 1G5SA 1KE7A 4IDVA 4FV3A 1VZOA 1H1SA 4CQEA 4O0TA 4CFFA 3GNIB 5BUJA 4TY1A 5EOLA 2ZM4A 1HOWA 3V5WA 2E9OA 3KN5A 2XIRA 3BPRA 3OP5A 4E5AX 2YCFA 5GHVA 3U6HA 4ZSEA 2YJSA 4TKSA 4AOJA 2C3JA 1YOJA 4G3GA 4HCVA 5CEIA 4USFA 3HA6A 1GZKA 1XH6A 3ORPA 1JWHA 2P4IA 5F9EA 5FGKA 4OAUC 3UC4A 3EKNA 3M2WA 2CGUA 3QZFA 5J95A 5J9YA 4EQCA 3Q9WA 5IQIA 1KOBA 4QQCA 1WBTA 3FSKA 5JGDA 4YJTA 4Z9LA 5HVKA 3GI3A 4E4MA 3C5IA 3HUCA 3NUYA 5A6NA 5L2SA 3PE1A 3SW7A 5IQCA 2J0KA 3FI8A 2OJFE 3O7LB 1KUTA 3BWFA 3THBA 3CEKA 4CFMA 5FTOA 3L8PA 5KUPA 4CMOA 3VWAA 5E8TA 3D4QA 4UWYA 5M4FA 4GVAA 4EK4A 2VAGA 3RWPA 5I9ZA 1YDSE 1A48A 5FLFA 3WF7A 3HDNA 4E20A 4UYAA 1OKZA 1WVXA 1GIIA 2J51A 3ZLWA 1GOLA 2W5AA 3EIDA 1RQQA 3G51A 4FVPA 4F0GA 2ZMDA 3QU0A 2J0MB 4FEUA 5DR6A 2JDOA 5JMSA 2PK9A 1BI8A 4DEEA 4YU2A 4MF0A 4B7TA 4EHZA 4U6RA 2OGVA 3WYYA 2WTCA 2OJ9A 4EZ7A 2GDOA 5AADA 5DBXA 3KMWA 3MY0A 4FSQA 3V5PA 1OI9A 3LAUA 1B39A 2QVSE 4AT4A 3V5QA 3DFAA 3QWJA 4FOCA 3QQUA 5DOSA 1OL2A 3EQDA 4ZMFA 4O83A 3LFDA 4IJ9A 3VS5A 4MD7E 1PXPA 3VS2A 2BKZA 4RX5A 2F7XE 4PMPA 4BBFA 5J8IA 1REJA 4YLJA 2XIYA 4AF3A 1W7HA 3I1AA 4BZDA 4HVHA 1R39A 2JFMA 4D9TA 4TTHB 2XKDA 1OL6A 2IVVA 3H9RA 3QKKA 4DEGA 2HWPA 4FV7A 4L7SA 2Z7SA 3FWQA 5I9WA 3TM0A 3WZUA 4ZJVA 4HYIA 1YDTE 2VNYA 1XO2B 4A9YA 2OJJA 2P3GX 3DAEA 2B9HA 3B2TA 4GFMA 3W2CA 3PIXA 2XIKA 3TIZA 4USEA 1Z57A 5AP6A 5FXSA 3A2CA 4EK5A 4D4SA 4YHJA 3R1QA 3VBXA 3A4PA 4EOOA 5DG5A 1Q99A 3BZ3A 4PP7A 3LOKA 2CHLA 4MXOA 2XKEA 3NW6A 3KXGA 5HZNA 2V55A 3IGGA 3ODZX 3QRKA 4MXAA 4NIFA 1FQ1B 4LV8A 3MVLA 3RHXA 3TV7A 3BLQA 3GOKA 2C5NA 5J7HA 3A4OX 1UNLA 3ERKA 3DTCA 2XIXA 3MH0A 3OD6X 3NVKI 4LGGA 5CAOA 2O5KA 1JNKA 4QMNA 3PXKA 5M06A 2QOQA 2WO6A 3MIAA 4NFMA 5HTCA 3ENHA 4MVFA 4R7BA 2C6MA 4FT9A 4ZTQA 3FMEA 3DLSA 2YHVA 4GS6A 5DFPA 5HIDA 4UEUA 3UOLA 3DFCB 2W17A 3SXFA 4YZNA 5KE0A 2B0QA 4FL2A 1ZYCA 4ENYA 4DGNA 4YTFA 5KBQA 3OUKA 3ZMMA 1Q24A 3O96A 4RJ3A 4B6LA 4S34A 2EXCX 4IWDA 4JQ8A 4YSMA 4LFIA 2PE2A 4TYIA 4XP3A 4BDHA 4KNBA 3QD3A 3D5XA 4E26A 1PY5A 4FNZA 1PYEA 4L3PA 4QMLA 5EDQA 4YTCA 3PPJA 3ORNA 3ODYX 2OI4X 4FGBA 5E7RA 3FKNA 1CSNA 4UYNA 3D94A 4F6WA 3O2MA 5L8KA 4XV1A 3F5PA 3H0ZA 2DQ7X 2WQNA 4CVAA 3GC7A 2VWXA 2J5FA 3HV4A 2QI8A 4ACCA 4DF3A 2YDIA 3L9LA 4FG9A 4EORA 5CI7A 5EM7A 1NVSA 3KXZA 2PVYA 3EH9A 2ZAZA 3KVWA 3VN9A 5L3AA 3DLZA 4DG0E 4HYUA 4OUCA 5AUWA 2ZV7A 4BGHA 5E90A 3WZKA 4NTSA 2VWWA 4ERWA 5IA3A 5EM5A 4BTFA 5DA3A 3DZQA 3VC4A 4K9YA 3CTJA 4R7IA 2ZV9A 4O7YA 4U41A 3PUPA 4YBJA 5FG8A 4CEGA 3SVVA 4FKWA 5A3XA 3NCGA 3FUPA 2XNEA 4EH5A 2WTWA 3KF7A 5H8EA 1Y6BA 3DTWA 4UZHA 3OT8A 3BRBA 3JVRA 5AIKA 4KA3A 1PXOA 1YWRA 4HNIA 1HCKA 1BYGA 4H58A 3RWQA 4AN2A 2VZ6A 4GJ2A 5CZIA 4IC7A 2PTKA 1XWSA 4IEBA 3FLZA 4E6AA 4G9CA 3DXQA 3SGCA 1M17A 4E7WA 3P7CA 4KINA 5IQHA 3ZTXA 3ZCLA 4TRLA 1YVJA 4IM3A 4O7LA 3DB6A 3F66A 3TZ9A 2R3IA 5DNRA 5HO8A 3IW4A 3E88A 3BGQA 2YM6A 3DJ5A 3MFRA 4B99A 2UZVA 4ZJJA 4AGWA 4AW1A 2R3MA 4YJOA 3F3ZA 3TV4A 2C5YA 4Y46A 4JNWA 5CEQA 4CTCA 4EZ5A 5B7VA 4IVCA 2R9SA 2C0IA 5HEZA 3VUMA 2R3NA 2RIOA 2W1GA 2C5VA 3OTUA 5HNIX 5JZNA 3HRBA 4NEUA 5TO8A 3E62A 3JY0A 2BR1A 2C6EA 3QHWA 3VBWA 5LMKA 1GZNA 5IUIA 3QQLA 2W1EA 3W2QA 3KRJA 4LRJA 5EH0A 3TKIA 3RPSA 4C33A 2GQSA 4R1VA 2QR7A 2FSLX 1R3CA 1RDQE 5CX9A 4PPCA 2JAVA 4GT5A 4TXCA 4GT3A 4RSSA 5AAGA 4AS0A 4E5BA 1GIJA 4ZMEA 4IAKA 3WZDA 1XBAA 2C3IB 3UPZA 4EC8A 3VQUA 5J9ZA 5C01A 3ANRA 5I3RA 3HA8A 3OC1A 2E2BA 2O2UA 1RW8A 4L7FA 2WD1A 2WFYA 3DXPA 2ZV2A 4EQMA 1Q61A 1Q8ZA 3O0GA 1Q3DA 2BZKB 2YM3A 3HP2A 2OBJA 1J7IA 2IVUA 3R02A 4BWPA 5BQ0A 1E9HA 1JSTA 1OBDA 3L8SA 4EJ7A 3VRYA 3ZZEA 4QO9A 2VTJA 4G16A 2W1HA 4Y83A 2PHKA 3COKA 4BCMA 3GC0A 2WMXA 1ZMVA 2R3GA 4I5CA 3LJ1A 2C0TA 3IPHA 3Q6UA 3QWKA 3RM6A 4FKRA 5FTGA 4RIYB 2BAJA 4F9CA 2XNNA 3CR0A 3CIKA 4B8MA 3MH2A 4PNKA 2JFLA 2B9IA 3Q6WA 3FMJA 3QA0A 5HCZA 4RBLA 3ZFMA 4L43A 4AGDA 2FH9A 2X4ZA 1YXSA 3NNUA 4C62A 2UW7A 3EZRA 2HZ4A 2XK4A 1SNXA 3D7ZA 4YZMA 3MH3A 3O8PA 3HV7A 4KKGA 3FQSA 4B4LA 4O0YA 5AEPA 4ONAA 2R7IA 2WMVA 4KBCA 3FLSA 3Q4CA 2JBOA 3PXRA 4W4YA 5EQYA 1NA7A 5K5NA 1A9UA 3R8UA 2PU8A 1XBBA 4LRMA 3MA6A 2CPKE 3ULZA 5CF4A 4ZS4A 5AR4A 4MNFA 2WZJA 3CD3A 2H34A 3ELJA 2BRMA 4G3CA 2GCDA 4LI5A 5BVOA 4TNBA 5AM6A 1QMZA 3QYWA 3NIEA 4FSNA 3ZDIA 1S9JA 2OFVA 4FVQA 4ORKA 4FKVA 3PA4A 4RJ7A 4W9WA 5HQ0A 5I9VA 3C50A 1UU9A 1SZMA 2WMQA 3TV6A 3MESA 5CTPA 1I44A 4G17A 4C4FA 3POZA 3MY1A 4PX6A 2V22A 5ANIA 5E1SA 5AP2A 3MFUA 4IX3A 3NIZA 3RINA 2VV9A 3OEFX 5HI2A 4MD9E 3HV5A 4A4LA 3VF8A 4FIFA 1XH5A 1P2AA 2RF9A 3NYOA 2IO6A 4GW8A 4RWJA 1LPUA 2OFUA 5DR9A 3DGKA 4ZTLA 2BTSA 1E1XA 1YHSA 5AUVA 3H9OA 3NNWA 2C6IA 2XK8A 3PA5A 4J96A 4L8MA 4AN3A 1JPAA 4NK9A 4C58A 4G3DA 1TVOA 2VO6A 5A4LA 3FKLA 3VVHA 3AD4A 4CT1A 5JKGA 4RX8A 4GK4A 3OWPA 3GCSA 4R3CA 4C36A 1NXKA 3R28A 2VWVA 3OOMA 4MTAA 2E9NA 5CF5A 5I9YA 3UNKA 3R9NA 2GPHA 2VX1A 3PZHA 3UBDA 5BVDA 3QCXA 3DBQA 3B8QA 4D0XA 1ZOGA 4F7JA 1XH4A 1YW2A 2ITTA 2C6DA 5C9CA 5IZFA 3PLAE 2R5TA 2YM4A 4Y72A 4FSUA 3RKBA 3PP1A 4U5JA 3FEGA 4YLKA 3OXTA 4FIJA 4FKQA 3AMBA 3F3TA 3OBGA 4M66A 3C5UA 4TWOA 1FVTA 3RJCA 4BIDA 4DC2A 4YUQA 5LMKC 3DCVA 3UOKA 5FP5A 4EOQA 4LMUA 1OL5A 2JKKA 4F9BA 3LM5A 4XUFA 4DH8A 4DTAA 2ZV8A 4WKQA 1OM1A 3ZXTA 2BAQA 3ZSHA 1PHKA 4Z55A 1M7QA 2NRYA 2O8YA 2XYNA 4IX6A 1Z5MA 1IRKA 4FKUA 4BC6A 2VWUA 1NVQA 3WF6A 5L8LA 3IW8A 3Q2MA 3FQEA 5CEMA 4E3CA 1O6KA 4M14A 2EUFB 4HGEA 5DWRA 3C4ZA 4P5QA 3CJFA 5AIRA 3CP9A 1PMNA 5HICA 5FM2A 4DBNA 4E1ZA 3T3VA 1FMKA 2H6DA 4AWIA 3R7UA 4O96A 3SOCA 3I4BA 2XNOA 3OG7A 4PY1A 2Z8CA 5E8WA 3TCPA 4XLIA 4YZBA 3GENA 4IJPA 5C27A 4CNHA 2BRGA 3MDYA 3OW3A 3EZVA 2X1NA 4I93A 3MTFA 4LMNA 5FXQA 2X4FA 2XP2A 4I24A 4C3RA 5F20A 2X2KA 1TKIA 4MAOA 3BGPA 5I9XA 2VGPA 2YWPA 3QX2A 3AC1A 4ZAUA 2JDSA 2O3PA 4D9UA 5TOZA 3EN6A 2PZPA 3SXRA 3EYGA 5CI6A 3FLWA 2XEZA 5F4NA 3V01A 4EH3A 5GZ9A 1NW1A 4CFUA 4FTTA 2ETRA 4U45A 3S3IA 5FRIA 3H10A 2YZAA 4JRVA 5TT7A 2HAKA 3A99A 2GNHA 1BX6A 3LMHA 1UVRA 3ALNA 5DVRA 5JGBA 2ITYA 3C13A 2BALA 3OEZA 1GZOA 4R3PA 3KREA 3NNXA 4IVBA 4EHGA 4R5YA 4YSJA 1HCLA 4J97A 3R71A 4JOAA 3ZSIA 2WAJA 5L2WA 4C4GA 4G2FA 5IA1A 3LFBA 3C4EA 4OR5A 5IPJA 3EFLA 4TW9A 5LXMA 4Q5EA 4CYJA 1U5RA 4EKKA 2CNVA 3RMFA 5H3QA 2JIVA 2W4KA 3F69A 4G6OA 3EWHA 4AQCA 4QMQA 4ID7A 4L67A 4C59A 4DEHA 4O1PA 2GQGA 2QO9A 5AM7A 3R83A 4WHZA 3U4WA 2B1PA 4X2JA 3TTIA 4OTIA 1OL7A 3QCYA 2R3HA 4KIQA 4USDA 4Y95A 2KULA 5AR2A 2B52A 5CSPA 1G8AA 3U4UA 4JL9A 3QA8A 2CCIA 2J90A 1IEPA 2UZLA 4K77A 1OECA 4MXXA 1OVEA 5DIAA 2GS6A 5CWZA 3TKHA 5A9UA 4KRCA 4UN0C 2R0IA 5E8YA 5IEXA 4AA4A 3OVVA 3KXXA 4DFXE 5BVFA 4F9WA 4M8TA 3W1FA 4AX8A 4DTKA 5AV4A 4FSYA 5JRSA 3IKAA 3SC1A 3R73A 4FTNA 2GFCA 4UXLA 5IDPA 4H3BA 4Y85A 4F64A 3C0HA 5EQPA 3BU5A 3CBLA 3FI4A 3A8WA 5CT7A 2B53A 3V04A 2WMUA 3BLRA 4L3JA 4OTFA 4E8AA 3FZSA 4FSTA 3UMWA 2J0IA 1IG1A 2YABA 5AR8A 4ZSAA 5AJQA 2F49A 1KSWA 4I20A 4XS2A 3EN7A 3WF9A 3PJ3A 4RMZA 1P5EA 3UP2A 2QU5A 2WMRA 4FMQA 1UKHA 4H1MA 5AX9A 4EH7A 5JEBA 2QOLA 3ORKA 2O64A 2W1FA 2R4BA 2QR8A 4I5MA 1MQ4A 5BVKA 5AV0A 3NPCA 4DCEA 2W0JA 1H00A 3FE3A 3LW0A 4JG7A 3UNJA 3TI1A 3V51A 4DE4A 3ORZA 2J6MA 4JBPA 1YHWA 3C0GA 2BPMA 3NWWA 5TF9A 3GOPA 5BUEA 3FYKX 4L44A 4C02A 5LMBA 3HRCA 4XG2A 5E8XA 3RVGA 1IASA 2R2PA 3TDVA 5EYCA 1UU7A 1LUFA 2CDZA 1B38A 4RIOA 3D15A 4NCTA 1SMHA 2Q0NA 2X0GA 3FAAA 4FEVA 3DOGA 5KKRB 3G6HA 4X3JA 2XM8A 5FBNC 3TL8A 5LMAA 2WMBA 1R0EA 2JBPA 3ORTA 4MXCA 3ALOA 4Y5QA 5DT4A 1NT2A 3FV8A 4L3LA 3CQEA 3KXNA 2F9GA 4NZWB 3VJOA 2OU7A 3PLSA 3BYUA 4D28A 3U6IA 3GUBA 5E92A 5GJGA 3QXPA 4I6HA 5AUZA 5HCYA 2VTSA 4GYGA 1UA2A 2Z7RA 5FXRA 5ANEA 3UYTA 1J7UA 2W06A 4IM0A 5HGIA 2C30A 4O22A 1GY3A 3RPVA 1BL6A 2W1CA 5IA0A 4U80A 4QMUA 1YXVA 4EOSA 4R3RA 1VYWA 3GEQA 4OTGA 5HCXA 3UG1A 3EQFA 4C37A 3D5WA 4F9AA 3AGLA 3SV0A 2Y9QA 5CVGA 3T3UA 5C1QB 2OWBA 3POOA 3R7GA 2B4SB 5EW9A 3MB6A 4HZRA 4FIEA 1R78A 3B8RA 4KAOA 1G3NA 3U51A 5HLNA 4JBQA 1M2RA 3C4XA 2NRUA 3CD8A 5FDPA 3H4JA 3LE6A 3S95A 3EN4A 4BGGA 3MPTA 4RZWA 5HX6A 4I21A 3JPVA 5GIPE 2YCQA 2G9XA 4JQEA 4IAAA 3IW5A 5LQFA 4BDKA 4OBQA 5J1WA 3QX4A 4IANA 3KL8A 3QALE 3JS2A 1JQHA 1WVWA 4DFUA 1W98A 3PXYA 4I94A 4XJ0A 3LPBA 4QMMA 4YBKA 2WU6A 5H8GA 4C57A 4EHVA 5KO1A 2R7BA 4CKIA 4BY9E 2UZTA 4R6VA 4EUUA 5K4JA 4ZLYA 1W83A 5EOBA 2UVYA 4ZY4A 4AW2A 4J95A 2E9PA 5EYDA 3CXWA 3EQGA 3TKUA 2G2FA 1OBGA 3LFFA 1OB3A 4UWCA 3K3IA 3HP5A 5B0XA 4ACMA 3G6GA 3MN3A 2IW8A 2QOBA 4W4WA 3UOHA 4D2RA 4N70A 5I5ZA 4BVUA 3WOWA 4KS8A 2WTJA 5D9HA 1XKKA 4KUJA 1O6YA 3HMPA 4ZJIA 5EDRA 2GU8A 4Z7GA 4D2PA 3BGZA 4M68A 3UQCA 2UW9A 2CKEA 4ITJA 4MWIA 3VUKA 4C2WA 4GKIA 2P33A 2QONA 1JOWB 4OTRA 2QO2A 3F82A 2VTHA 4G34A 3S0OA 3FLYA 4IWOA 5E1EA 4F6SA 4F65A 5ICPA 5KMOA 4CTBA 1PRYA 5BYLA 4GSBA 4DLJA 5HLWA 4O91A 5JQ5A 2BZIB 2RFDA 1GAGA 3PG1A 4HGLA 5BMMA 2Q0BA 2XK9A 2Y6MA 5JRQA 1JLUE 1YI6A 3E7OA 3RBWA 3OWJA 3QTWA 4R8QA 2LGCA 3DDQA 3QRJA 4GK3A 3TNQB 2WXVA 3LZBA 1VR2A 4J99A 2JDTA 4RIWB 2YAAA 3QZHA 4ZSJA 3ZSGA 3Q53A 3ZM9A 1LP4A 5LVNA 2O63A 4YMJA 2W7XA 3HGKA 4F0FA 3O7LD 1U46A 3AOXA 1XR1A 4UWBA 4FT0A 4K33A 4AP7A 4R77A 1PMEA 2R3RA 4XNEA 4C4JA 4O2ZA 4OT5A 3V8SA 2E9VA 5C8MA 2WQMA 3ZBXA 4RT7A 5CANA 1WFCA 3PA3A 3GFWA 4TZRA 4EYJA 4UALA 4MF1A 5ANKA 4O0XA 3V5TA 2WTDA 5E9EA 3P78A 2QCSA 4R5SA 4ANQA 3CLYA
chains in the Genus database with same CATH superfamily
4NCTC 4XBRA 4M69B 4FG8A 3F3UA 4U3ZA 4BI0A 2BILB 2YEXA 3ACKA 4O21A 5AP5A 4UMPA 5A54A 2BHHA 2WQEA 3FLQA 1U59A 4XHKB 1T45A 4J8NA 5CSHA 2PE0A 3E64A 2WQOA 4F08A 4YJPA 4Z16A 4MD8E 3OCBA 4NM7A 5AAEA 3I7BA 3UMXA 3DKGA 1FGIA 3ORXA 3V8TA 2PMNX 5IMXA 4F7SA 2AC3A 5CASA 3UPXA 4BCNA 4GJ3A 4DLIA 2FUMA 1O9UA 4BDBA 3DA6A 4YJRA 4CLIA 5AUUA 4GT4A 5TE0A 5B2MA 3BQRA 2V62A 3CKWA 3KRXA 4YJNA 4CYIA 2DYLA 4PMTA 5DR2A 5M07A 4IMYA 4UMQA 5J79A 2WIHA 4FTRA 3RK5A 4ASEA 5JFWA 5BVWA 3SW4A 3LJ2A 4PQNA 3MH1A 3MSSA 1YI4A 4GEOA 4D4VA 4EBVA 4O7ZA 3L9MA 5EQEA 2QOKA 4NSTA 2BDWA 3WF5A 5KCVA 5BYZA 4MNEA 4U79A 5M53A 4D58A 2YLEA 2BIKB 3OFMA 4O86A 1JAMA 4HZSA 3SX9A 3TWJA 3R1SA 3A7IA 5IDNA 5B2LA 3RGFA 3NFGB 2XM9A 2AYPA 4OTQA 4Y73A 3H3CA 4K18A 3GP0A 2B54A 4JX3A 2PWLA 2VTIA 1OUYA 4BCGA 3HNGA 4FZAB 4O7TA 4BZNA 3CQUA 5EFQA 4FZFB 1OPLA 3JYAA 3ZS5A 3V6SA 2QOCA 4LUEA 1W2DA 4N6YA 4DT9A 4A4OA 5M4CA 5GINE 3QC9A 3E8CA 4GCJA 3R22A 4RA5A 4U43A 3L9NA 3RNYA 5HO7A 4S30A 3M42A 4O0SA 5EI6A 3FLNC 1H0WA 3C0IA 3Q3BA 2X7FA 5JK3A 3DNDA 1OMWA 1URCA 5K4IA 3LHJA 4GIIA 4DFNA 3BBTB 4XBUA 3I81A 3VS4A 4CMTA 1E1VA 2WMSA 3BHTA 2BHEA 4L42A 3R7VA 4O38A 4MUQA 4XRLA 4XV9A 4LGDA 3I7CA 2C6OA 5EG3A 4HGSA 4NW5A 5CQWA 3GCQA 5M09A 1H1QA 5IMEA 4D2TA 4I5HA 4QYYA 2KTYA 4YTHA 4MX9A 3UDSA 3R2BA 3M11A 2B9FA 4EBWA 3F6XA 4EOJA 2J9MA 3ATTA 4AZFA 5A6OA 4EWQA 2PPQA 4X6QC 5CS6A 4UMTA 2VN9A 4RFZA 4RZVA 4FSZA 4RIWA 2PMIA 3V8WA 2XB7A 4L9IA 5DEWA 4MHAA 1XH8A 2YDKA 4FA2A 4CKRA 4DG2E 3IECA 3D14A 3ENMA 5IA4A 1LR4A 3GCPA 3AQVA 4RWKA 3KEXA 1ST4A 3DK6A 2HYYA 2WKMA 5HG9A 3WZEA 5KMKA 5E91A 3OBJA 5HO6A 3UO6A 3MVMA 2OZOA 4QMXA 4V0GB 4QTBA 2JC6A 3MVJA 3W0NA 1H1WA 3PSBA 3ZRLA 2HWOA 4O6EA 2JAMA 3FDNA 4QP8A 4C0TA 5K0KA 5M4UA 3OMVA 2VTNA 4WNOA 3PVUA 4NW6A 4UMUA 3E5AA 1SVHA 3MYGA 4IAZA 2PUIA 1ZAOA 4KIKA 1OKVA 5L4QA 4M69A 2WQBA 5A4CA 4RJ6A 5KKRC 1M7NA 3N9XA 3OY1A 5BX0A 3P1AA 3NX8A 4KKEA 3R8VA 2H96A 2HK5A 3KXMA 3ZUTA 4K11A 1FVVA 3QYZA 3LIJA 3KRWA 4O4DA 4FV8A 4FTOA 4BCKA 3KGAA 4RVTA 4AFEA 3AC8A 3JVSA 5HESA 4BDCA 4QT1A 2FSOX 2W5BA 4C61A 1FBNA 3PIZA 3QKMA 4J8MA 2OIDA 1KE9A 3T8OA 1Q97A 5J5SA 4NUSA 3Q2JA 4DINA 2I1MA 5F1ZA 1V0PA 3E63A 4WSYA 2ITQA 4FV5A 3WARA 3I0OA 4FIGA 4PRJA 4B0GA 4ACDA 5DT3A 4CFVA 4RVKA 2UZNA 5HBHA 4EI4A 4CD0A 2IW6A 2FO0A 3SG9A 2RFEA 4CMUA 2ZMCA 5I3OA 3QQHA 1JKTA 1ND4A 5D7VA 3TDWA 3RPOA 3ZRKA 2WOTA 3GC9A 1TQMA 4ZTHA 3SXSA 4QYHA 3W8LA 5L2QA 5CU6A 3NGAA 2QLQA 2RL5A 2ETMA 4JBVA 4BB4A 2FSMX 3ZBFA 2HXQA 3MBLA 4FTJA 3FMLA 2XKCA 4O7RA 2W5HA 4I41A 4I6BA 4AZVA 2XK3A 4JG8A 3G33A 3FMMA 3GU7A 1KE6A 5DT0A 2JLDA 4EOKA 4MQ2A 2GQRA 3HAMA 2VWIA 4MXZA 4I4FA 2REIA 3G0FA 4QOXA 5CF8A 4I6LA 3LFEA 3MA3A 4ZTNA 5IUGA 3TUBA 3HRFA 4GG5A 3MTLA 4AUAA 5I0BA 3VBYA 4LUDA 4F99A 4RJ8A 3NUPA 4AXFA 4F63A 5C4KA 4IQ6A 2PZ5A 5L6PA 2W05A 3HZTA 3OROA 1ZYLA 2CLQA 5L8JA 3OHTA 1CTPE 4BI2A 4EK3A 3DK3A 5CAQA 1ZYSA 2QC6A 4W4XA 3RNIA 3DBEA 3VIDA 5JFVA 2YFXA 1R0PA 2UVZA 4LL0A 2QLUA 3ORIA 3ORLA 2YCSA 3V6RA 1XMLA 3BKBA 4RVLA 3U9CA 4ASXA 4WG5A 4FK3A 4V01A 3BHYA 4QPAA 2XMYA 1XQZA 3IK3A 3Q4UA 4ARKA 3MPMA 2WPAA 3F2AA 4ALVA 1ZY5A 3ETAA 4OAVB 4BDAA 2PUNA 3Q9YA 1TZDA 3QAME 5KHWA 2UW4A 4G1WA 3KKVA 3F7WA 2IN6A 4NH1A 5HTBA 4IX5A 3ZZWA 4FVRA 3A8XA 3R1YA 4AT5A 3F2RA 1OGUA 2GTMA 3CY2A 3DJ6A 4RJ4A 3O23A 2PVNA 4RGJA 2UZDA 2BRNA 5AMNA 3QQFA 2GHGA 3WILA 4AAAA 2ITNA 2CN8A 4WG4A 4N0SA 3COHA 3W0RA 5ITAA 3D0EA 3UIUA 3EL8A 2B9JA 4Q2AA 3ZU7A 1OIQA 4BTJA 5LVOA 4U9AA 1KE8A 2QOHA 4EH8A 4EKLA 2YIXA 4L52A 2WTVA 4O27B 2R3QA 1BMKA 2G2IA 2XK7A 1Y91A 3I0QA 4V0GA 2W96B 4MK0A 4F9YA 4A9UA 4ZZOA 5D1JA 5FEDA 4QMTA 3ZUVA 1RE8A 5CQUA 4FIHA 4LYNA 2UW0A 4WUAA 2EB3A 2ITUA 2GMXA 1LEWA 3FQHA 1PXJA 5HE2A 2VWBA 2SRCA 2ITVA 1GZ8A 1K3AA 3L1SA 4L53A 3PPZA 1M52A 5CU2A 3ZH8A 4CFNA 2PVFA 3QRUA 1FPUA 3G9LX 3W10A 5C26A 5AR5A 3FXZA 3MS9A 4AXEA 4DGMA 1IA8A 3G0EA 4UZDA 3CQWA 5LWMA 4TYHB 1JKKA 2YIWA 5ANDA 5CNOA 1ZXEA 3VRZA 3D2IA 3E8EA 2JKMA 3FZPA 4IB3A 1QCFA 3Q5ZA 4XMOA 4L00A 2FVDA 4U8ZA 5EK7A 1YQJA 4LOQA 2X0QA 5HNGA 4HVSA 1XHAA 5HE0A 3SRVB 5CEOA 2VD5A 3ZM4A 3N4TA 4DEAA 3GB2A 4BFMA 4BICA 3EQIA 4M13A 4DGGA 4TN6A 4J52A 1H24A 3DKOA 1WBVA 4R7HA 1V0OA 4FI1A 3E7VA 1ATPE 5D41A 1NY3A 2ONLC 2XF0A 5FTQA 2Y7JA 2FB8A 4IHPA 2UV2A 1J1BA 3FYJX 3CE3A 2W1ZA 5AFVA 2J7TA 2AUHA 3PRFA 4GVJA 3REPA 3UVQA 4BYIA 4IVAA 5ANGA 2EXEA 3LLAA 2UVXA 1X8BA 4EQUA 3GU5A 4FIIA 5H9BA 4BDDA 5JSMA 4J1RA 3SQQA 3TG1A 2F57A 3DAJA 4E6CA 4I0RA 1CKPA 3RAIA 1IAJA 2I0EA 2CLXA 4FTCA 3LVPA 2X8DA 4XEYA 4YC8A 4FT7A 5JGAA 3EQPA 3O50A 3PTGA 5FEQA 3LCSA 2C47A 3PXZA 4L46A 2VTOA 3S2PA 4WRGA 5HBJA 3BELA 2FSTX 2H9VA 3PXQA 3R01A 4W8DA 4DGOA 5IQBA 1ZMUA 2BFXA 3WIGA 5EKOA 3VNTA 4TL0A 2HW7A 3MIYA 1UU3A 5AV3A 3PXFA 3F61A 4FZDB 5K0XA 2IVTA 3UNZA 5D12A 4ALUA 5J1VA 4HYHA 3D5VA 4H36A 5ETIA 3F5GA 1H27A 4FG7A 3U9NA 4BYJA 4FEQA 4FSRA 4XG9A 3C51A 3QXOA 3VS1A 3A7JA 5IUHA 1APME 5KMNA 3JXWA 2HY0A 4P7EA 3RI1A 3IO7A 5AP1A 5G6VA 3V3VA 5JT2A 1CKJA 3VUDA 4AACA 2PSQA 3PVBA 1ERKA 4GRBA 3OCGA 5M08A 5G1XA 1PXIA 1JSUA 2ERKA 4YTIA 3GC8A 2QKWB 5KHXA 3UE4A 3NYNA 4AT3A 2HIWA 3BYOA 2JIIA 2W9ZB 4RQKA 4DH5A 2WEVA 4C7TA 1LEZA 3V5LA 1PKGA 4TWPA 2QO7A 4C4IA 1QL6A 2P2HA 5KBRA 2OLCA 3C4CA 3QC4A 2OK1A 4J7BA 2YJRA 4KS7A 3P5KA 2ZB0A 4MH7A 3CGFA 4QTCA 3FBVA 3F9NA 4RJ5A 4RIYA 4AA0A 5KNJA 2BZJA 4FT3A 5CAUA 3KULB 4E4XA 3BE2A 1OL1A 2B7AA 2BRHA 2RSVA 4FE2A 2XNPA 4OT6A 3AT4A 3QGYA 4W9XA 4EOMA 3G15A 2BMCA 4AE9A 5CY3A 4BBMA 3II5A 4N6ZA 4D5KA 5J5TA 2C6KA 3BHUA 3FKOA 5KZ0A 4QP2A 3R9RA 4CQGA 4EH4A 4BCHA 1KOAA 3P86A 3PRIA 1DI9A 4QQ5A 3AKLA 2X7OA 2BDFA 3UGCA 4G31A 1OITA 1YXUA 5CEPA 4XH6A 4K8AA 3PJ2A 4ZXTA 2GFSA 3IQ7A 4JG6A 3HLLA 1Q62A 4YJQA 1JKLA 3Q52A 3SLSA 2I7QA 1OPKA 3CJGA 3MWUA 3TIYA 2V0DA 4WBOA 4GK2A 3LCTA 4BWXA 3OCTA 3COIA 3UIBA 3L9PA 4KABA 3IGOA 3AKKA 4M97A 4V04A 2P2IA 3FY2A 3W0MA 4ZTMA 2CN5A 2C4GA 4FICA 1YXXA 4KD1A 1ZY4A 3TEIA 4KBAA 4LRKA 5EHOA 5CVHA 3PG3A 2PZYA 2RFSA 3I5NA 3LJ0A 3R0TA 4FF8A 4PTCA 5E8SA 3ZEWA 2RGPA 2WMAA 2J4ZA 3MFSA 4D0WA 3IW7A 4J71A 4RX7A 3WBLA 1R1WA 4JX7A 1BKXA 3ZYAA 4IZAA 4TWCA 5CU4A 4O82A 4G3EA 2ACXA 3FMKA 5HORA 4S31A 4UBAA 3VS6A 3LMGA 4RFYA 5DEYA 2V7AA 4M0ZA 3BEAA 3NUSA 2YACA 4L45A 3EN5A 4KSQA 5HE3A 3UVRA 4GKHA 3HV6A 2R3KA 2C0OA 3E8NA 2X6DA 3LXKA 2BRBA 4MBJA 3TUCA 5HIEA 3VUHA 4FR4A 4BF2A 4YPDA 4FV9A 3UODA 2BVAA 4D2WA 3F88A 3FL4A 2F7ZE 5CNNA 1I09A 1GNGA 2Y0AA 4JDHA 5CEKA 5IA5A 3WE4A 3C9WA 3O71A 5LWNA 2J2IB 4TPTA 1H08A 4KB8A 4OBPA 1OKWA 2VO7A 1UV5A 4TNDA 4DEBA 1F3MC 1Q3WA 2VWYA 3WYXA 4YO4A 3UQGA 1OGYA 1YWVA 2YIYA 4G5JA 3ZOSA 4IH8A 3BQCA 5GJFA 3RCDA 1H07A 4C3FA 4ZS0A 3CSVA 5HIBA 5D7AA 3QTSA 2WTKB 4II5A 4IZ7A 4QQJA 3IDPA 5J9LA 1MP8A 3P08A 3AD5A 2Y8OA 3DNEA 3NAXA 2V7OA 4IBMA 4FZ7A 5DLSA 4PP9A 4F4PA 3E3PA 5HE1A 1OZ1A 4AZWA 4BCOA 4ITIA 1WCCA 4RIXB 3SDJA 4GL9A 3IOKA 2CGVA 3O51A 1ZOEA 4FL3A 4PDPA 2CNUA 5A4QA 3OW4A 4FKTA 2Y4IC 5J7BA 3A7GA 2UZBA 3OWKA 4IC8A 3BYSA 4U7ZA 2EXMA 4RLKA 3H30A 4CG9A 2IZSA 3DV3A 5FDXA 3EQRA 2QKRA 3FZRA 3R30A 3AT2A 4EONA 3UYSA 3DJ7A 4NL0A 5LVLA 1WAKA 4V05A 4FV1A 3OUNB 2BFYA 3NZ0A 4FV4A 3NDMA 1PW2A 4A9TA 5AR3A 1Y8GA 2W4JA 3LFNA 1ZOHA 4NU1A 3K5UA 4UMRA 4I4EA 2XAMA 1W0XC 2G2HA 1H8FA 3AT3A 3DQXA 3PJ8A 4X2NA 2C5XA 4Q5HA 3ZLXA 3N4UA 3FC1X 3DQWA 4IAFA 2XAOA 5IEYA 1P14A 4M67A 4EYMA 3QUDA 5HLPA 4DYMA 4QP7A 4A07A 1ZMWA 3GU8A 2WIPA 2F4JA 2OXYA 3R7OA 1QPJA 4NJDA 2PE1A 2XYUA 3PP0A 4FUXA 4U3YA 4GFOA 3DKCA 2G15A 3G90X 2XJ2A 4XG4A 2ERZE 4B9DA 4C4HA 3W32A 2VTMA 4O6LA 2WTIA 4PUZA 1SVGA 5AUXA 2OW3A 5DMZA 2JDVA 3LQ5A 3FZTA 2YCRA 3I6WA 3DPKA 3F2NA 4FKGA 3QD4A 4FV6A 1JBPE 2PVMA 2ZB1A 4DITA 3PDTA 3BV3A 5K5XA 4EK8A 1SM2A 5D11A 5ANOA 4O0UA 3K2LA 4EOLA 3CS9A 4XYFA 3LCDA 4RFMA 3LCOA 3EFKA 4HJOA 4I5PA 4AXCA 1WBSA 4FOBA 4JLCA 3RK9A 3K5VA 2O0UA 3KFAA 4CFWA 2VNWA 4DTBA 2CGWA 1ZRZA 4ZY6A 3O17A 2BKKA 5CZHA 1KWPA 2YLFA 4MXYA 2OICA 3KMUA 3KA0A 1K2PA 3OZ6A 3RAKA 3GXLA 4IFCA 2FYSA 1DS5A 2EU9A 2W99B 3EYHA 2PVHA 4GMYA 4UB7A 5HBEA 3TNWA 4DH1A 2ZJWA 3GCUA 3VO3A 2BUJA 2VTLA 3S4QA 5BVNA 4EK6A 4W4VA 4CSVA 3LXPA 1H4LA 3RK7A 4D2VA 1OIYA 4DEDA 3P79A 4G3FA 3DBFA 4ZZMA 3P9JA 3C7QA 4U40A 3FC2A 4IFGA 4HCUA 3FMDA 4OGRA 3EQBA 3KY2A 3R8ZA 5EHYA 3PSDA 2OIQA 2Z2WA 4IM2A 4AN9A 2XKFA 4P90A 4A7CA 1SVEA 2UZWE 2VTRA 4S32A 3NYVA 5E8VA 4QTEA 3ZFXA 4JR7A 4XCUA 2CKQA 4C8BA 2JD5A 3A7FA 1YRPA 1H1RA 4YNEA 1G8SA 4C34A 2C3KA 3E3BX 4HVIA 1IA9A 3I79A 4FTLA 3IDCA 4QPSA 3ZC5A 3EB0A 3NAYA 3CC6A 4FC0A 5KMMA 5EW3A 4EC9A 1REKA 5IEVA 2I0YA 4AA5A 4AGUA 4YLLA 2VTPA 3KCFA 3F7ZA 3QHRA 4N57A 3SAYA 3A61A 4U81A 1VEBA 3WE8A 4AZEA 4BZOA 2QOIA 5BMSA 3VBTA 2GHMA 4YGAA 4HVDA 2OJIA 2PVKA 2Y6OA 3PPKA 1WMKA 3LKMA 3AC5A 1XH9A 5FWKK 4EJNA 5DRBA 4K2RA 3BEGA 5CLPA 2J0LA 2P55A 3E87A 4RIXA 3RZBA 1UU8A 4JXFA 4FJVA 2ITWA 3D5UA 4H1JA 2IWIA 1MUOA 1OPJA 1Q8YA 2AQXA 3DDPA 5HG7A 1BI7A 2HY81 5F94A 3AGMA 3TNHA 4BHNA 4O2PA 1CDKA 3MJ2A 2YN8A 5DPVA 5T68A 2X9FA 3W2SA 4E6QA 3HX4A 2XBAA 4E4LA 2VRXA 4YHTA 2C1AA 3C4WA 4WNKA 3ZLSA 4EUTA 1KV1A 1T46A 4ANMA 1ZWSA 4WSQA 2A1AB 4NM5A 5EYKA 3HVCA 5IQFA 5M56A 3W55A 2VTQA 4LQMA 2ESMA 3MGYA 5DE2A 2QOFA 4ZIMA 1V1KA 4L01A 5EI2A 3VF9A 1PXNA 3SG8A 3SD0A 3AC3A 1M2PA 3SKCA 3VS3A 2IVSA 4O81A 5KX8A 3NUNA 3CCNA 4BI1A 3AD6A 2GNFA 5H8BA 4I3ZA 3U8WA 3HL7A 1Q41A 5IISA 5IQAA 3HMOA 4E6DA 5IH6A 3S1HA 1MRVA 4K0YA 4QTAA 3BL9A 3KQ7A 4CV9A 4I22A 4W8EA 4ZY5A 2ZOQA 3ZLYA 2HELA 3GQIA 2HZ0A 4O0VA 1V0BA 2GNGA 1WBPA 4LM5A 3MB7A 1YDRE 4ZOGA 2A4LA 4H39A 4AOTA 4K1BA 4ITHA 1FMOE 4QYFA 4F7LA 5HOAA 2YZLA 4WOVA 1BLXA 3FMHA 2Z02A 4FUYA 4H05A 1CKIA 1PJKA 2YIQA 3MFTA 4KBKA 1WVYA 3ANQA 3GCVA 4X2GA 4NYEA 4BCIA 1Q8UA 4GU9A 4ZSGA 4IDTA 3OF0A 3TYKA 3DXNA 2ITPA 3G2FA 3HUBA 4BDFA 2JKOA 4U42A 4WIHA 4O4BB 3ITZA 4EOIA 2RG5A 4OTWA 5JQ8A 3FY0A 3EN9A 4JR3A 2Z60A 1SYKA 3HMIA 3RHKA 1S9IA 4FTAA 2YITA 3TJCA 1PYXA 4WT6A 4WD5A 2ZDUA 4FSMA 4X6RA 3BV2A 3SHEA 2EB2A 1YOLA 2DUVA 4D1ZA 4ERKA 5IG1A 5IKWA 1GIHA 5EDPA 4BTKA 3EL7A 2J50A 4Y8DA 2PULA 3FXWA 3TMOA 3MV5A 4JT3A 1YXTA 3F3WA 4RRVA 3ZO4A 3G5DA 4F6UA 3QQJA 2RG6A 3QKLA 3AMAA 4PL4A 1H28A 3G9NA 3Q96A 4QMPA 5HVYA 5E4HA 3FZOA 1TQIA 3BCEA 3FI3A 2WEIA 4FKSA 2O65A 3PVGA 4FKJA 4O4EA 4O1OA 5BNJA 4DA5A 3OCSA 5HG8A 3MVHA 4RX9A 2R3PA 3R7EA 4FTIA 4AU8A 3PFYA 4A06A 4O0WA 5T3QA 3VW6A 3KXHA 3PY3A 2HXLA 2PVJA 4DFZE 3VBQA 3GQLA 4X2FA 3ROCA 4Q9SA 3HEGA 4G5PA 4AW0A 4EL9A 2X7GA 2JGZA 4AG8A 2WELA 3NS9A 2PY3A 2X8EA 4M0YA 3IG7A 4OTDA 4RPVA 5E8UA 4FKOA 4IZ5A 1URWA 3R2YA 4U97A 4ZSLA 3WIKA 4H3PA 3TNIA 1UWHA 3TT0A 4L6QA 3ID6C 5ACKA 4NM3A 2CSNA 2I0VA 3P23A 4IADA 1Y57A 2XK6A 3W0QA 1P4FA 4YZ9A 4MWHA 2WB8A 5CSVA 2WTKC 5B2KA 3OS3A 2F2UA 2P0CA 2H8HA 4A9RA 3Q60A 3EFWA 4RQVA 3UQFA 3ZRMA 3EFJA 3RAWA 4KIPA 4LOPA 2XANA 2R3OA 4K6ZA 3VUIA 4CV8A 1U5QA 5HD4A 4RG0A 3LLTA 3QTXA 3R8LA 4DGLC 2HOGA 2XVDA 5AA8A 5CALA 4PL5A 5EHLA 4NKAA 5CVFA 2BIYA 3PWYA 4CZTA 2BDJA 5IU2A 4DCAA 4I0TA 4CRLA 2XALA 4QYGA 2OXXA 5CAPA 3QGWA 4IB0A 2XCKA 2LAVA 4HPTE 4M15A 3VW8A 4FKPA 4ANNA 2QOOA 3RP9A 1WBOA 1QPDA 3QFVA 5LVMA 2UZOA 4XOYA 2X2MA 5AV2A 4XV2A 1J3HA 5CT0A 4DN5A 2J5EA 1QPEA 4I0SA 2OH0E 4CCUA 2PMLX 1TQPA 3BI6A 1H26A 3BLHA 3TZMA 3W2PA 3UDBA 4ANSA 4DFBA 3NNVA 5IQGA 5FM3A 2XH5A 5EKNA 3UOJA 5F95A 3HMNA 3R1NA 3I6UA 4L68A 4OBOA 3OTVA 5AP7A 5FQDC 4F1OA 5A4TA 2OXDA 2PMOX 3HDMA 4FKLA 1M2QA 4LL5A 4JRNA 3H9FA 5BVEA 4O84A 2ONLA 4I1ZA 4MYGA 4BHZA 4C4EA 2XZSA 1H0VA 4O7WA 4ZTRA 5DYJA 4AE6A 2R3FA 2PVLA 4X7QA 4A9SA 3RZFA 5AUTA 4UV0A 3ZO2A 1L3RE 2W9FB 3N4VA 3NRMA 3UIMA 4FK6A 4GV1A 2IEWA 1PMVA 3W33A 1CM8A 1PF8A 2QQ7A 3E92A 3NW5A 2ITOA 2JITA 3Q04A 3Q32A 4FNWA 3PFQA 5FBOA 3QZGA 4BKYA 5HU9A 4OLIA 3W0OA 4IWPA 4QMZA 3R9HA 5EYMA 1U54B 3WF8A 2ITXA 3FZ1A 4FV0A 2X8IA 4WO5A 4FTQA 5LCKA 4HW7A 4UX9A 4YNOA 2ITZA 3DBDA 3GU4A 2HENA 4RWLA 3VBVA 4JQ7A 4YJUA 5IH4A 4ALWA 1UNHA 1PXKA 3PJ1A 4YC6A 4EWHA 4RVMA 4YR8A 4X3FB 5AR7A 3DBCA 5M55A 4ANOA 4FEWA 1J91A 4JJRA 2YM7A 5H2UA 3AXWA 4QP6A 3QZIA 4PF4A 5ETFA 2Y4PA 2ZM1A 4Y5HA 4YZDA 2A19B 2C3LA 3R9OA 5CENA 2JKQA 4WRSA 3TZ7A 4PDOA 1EH4A 2GNLA 3MJ1A 4IB5A 4BBEA 1TFFA 5M51A 2J0JA 4CZUA 1L8TA 2C6TA 2XS0A 4ZEGA 4R78A 3LXNA 3UZPA 4RLLA 4D4YA 4BR3A 4YJSA 5T6KA 1RJBA 2Y4IB 1XJDA 5TR6A 4DT8A 4FNYA 3DB8A 4GUBA 5HTIA 3NVMB 4X21A 3W2OA 2C69A 4PWNA 2I40A 5DHJA 3VHEA 1Q5KA 3P7BA 4FNXA 4GIHA 4UY9A 3EMGA 4PTGA 4HNFA 3VQHA 3R8PA 5C8NA 5DGZA 3I5ZA 1YWNA 3KMMA 2NPQA 3DKFA 4ACGA 4E73A 2IG7A 4CT2A 5IH5A 4EH9A 3W16A 3TNPC 4QNAA 5M57A 5LVPA 3NSZA 3A7HA 3QD0A 4OW8A 2AC5A 4QMWA 5AAFA 4FL1A 4CZYB 4JDIA 4NM0A 3VS0A 3GU6A 5GZAA 2PUUA 2UZUE 2YERA 2CJMA 5M44A 4IW0A 3AMYA 3W18A 2VTAA 4XOZA 3W2RA 3QBNA 4NJ3A 3U6JA 3CPBA 4P2KA 4ASDA 1STCE 4QMVA 3ZEPA 2QURA 4D55A 4DH7A 4Z3VA 3OT3A 3QUPA 2F2CB 4QP4A 1OIRA 2QU6A 4PMSA 3VUGA 3O8TA 4C2VA 1PMUA 4YP8A 4YPSA 3PY0A 4P5ZA 3TZ8A 4ENXA 2UUEA 5HX8A 2E9UA 3LQ8A 4OTHA 3UP7A 3NLBA 4HOKA 5FEEA 2VO3A 3SA0A 4EH2A 3AC2A 4IIRA 2JEDA 1OUKA 5CU0A 4DEIA 4XP0A 4F0IA 4O0RA 3VULA 4BJJB 3SOAA 2OZAB 3A60A 3OOGA 4TYEA 4ZTSA 3LM0A 2QHNA 3U87A 3ZONA 3LMIA 2XJ1A 4YJVA 5AV1A 4QEBA 2DWBA 4HVGA 1JSVA 3QLGA 3PSCA 4ZZNA 4X0MA 5DH3A 4BDEA 3NUXA 2GTNA 3KCKA 4GUEA 3DU8A 3BYMA 3DAKA 4AW5A 4WNMA 5CXZA 4I92A 2V5QA 5IQEA 1B6CB 5IA2A 1XBCA 3F5XA 3KRRA 3UC3A 3RCJA 4BN1A 3DK7A 5AP3A 3BHVA 4RA4A 4ASZA 3HECA 3QQGA 2WGJA 4DFYA 2F7EE 3D2KA 3KN6A 2XRUA 2A2AA 5DN3A 4FTMA 3VUTA 2YISA 2ZVAA 3OXIA 4IAIA 4WG3A 3T9TA 1WBWA 3OY3A 4C38A 1MRYA 3F3VA 4FZ6A 1BL7A 1U54A 4F09A 4G6LA 4JIAA 2VX3A 2XRWA 4JVGA 3EOCA 4KSPA 5HNBA 1ZYDA 5IF1A 3L8XA 5GIOE 1FGKA 3IW6A 2OO8X 4CGAA 4U44A 2XEYA 4XG3A 3HKOA 2X39A 1W2CA 2XNBA 5E8ZA 4EOPA 1QPCA 3BU6A 5BUIA 4X3FA 4KIKB 4PDYA 4E4NA 1YHVA 4BCPA 4BIEA 4IACA 3M1SA 2FGIA 2I6LA 2OH4A 1Z9XA 5C03A 3VS7A 3NUUA 1UKIA 3N51A 4TT7A 1FOTA 3FPMA 3IONA 2Q83A 3Q9XA 2UW3A 4LGHA 3VAPA 4XRJA 4AOIA 4MEDA 2CMWA 4DHIB 3EQCA 2C68A 2WOUA 4R1YA 3R21A 4Q9ZA 1AD5A 2XNGA 5JN2A