4CKRA

Crystal structure of the human ddr1 kinase domain in complex with ddr1-in-1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
314
structure length
295
Chain Sequence
MPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Discovery of a Potent and Selective Ddr1 Receptor Tyrosine Kinase Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 295
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ckrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ckrA01
3R71A 1U54A 5I9UA 1ATPE 3OROA 5AV3A 4AW2A 3ETAA 1YOJA 4D5KA 2I0HA 3Q60A 4C37A 5CEKA 4JG6A 1XJDA 5TR6A 1M7QA 2UZBA 3GFWA 4QYFA 5J87A 4XG9A 4UMTA 4FG8A 4AWIA 2W1HA 1TQPA 2XJ1A 3MIYA 4BCIA 3HL7A 3OCSA 1BUHA 3OVVA 4J71A 1XHAA 5CYIA 4M69A 4DGLC 4UX9A 3MFUA 4IFCA 2I7QA 2BFXA 3AT4A 4FODA 2EXCX 4R8QA 4EC8A 4F63A 5FTOA 1W98A 5KKRC 3E8DA 4KABA 4LL0A 4L43A 4MXCA 3MSSA 2QO7A 2PHKA 5TF9A 3F2AA 2F2UA 2F2CB 4J98A 4JBOA 1E1VA 3GCQA 4CVAA 3CS9A 3BYMA 1XR1A 2OFVA 5FXRA 1TQMA 5LCKA 2ZM4A 3Q2MA 3BYOA 5M56A 2A27A 4IEBA 1OL2A 3K3IA 4O7TA 4AOTA 5E8YA 2O0UA 4MF0A 3O0GA 3WE8A 3D5UA 2GHGA 3C5UA 3WARA 4YBKA 1OKVA 3B8QA 1O6KA 1ZXEA 5L6PA 5F4NA 5KKRB 3HUCA 4QTDA 4KD1A 5LMBA 1VZOA 4G16A 5JEBA 4EOJA 4ANBA 1RJBA 1WBOA 1YXTA 3RVGA 4D2WA 1Q41A 3MS9A 3DXPA 4I24A 4EHZA 2EUFB 4W4VA 4WG4A 5IA4A 2QOBA 4YO6A 2PTKA 1IR3A 4C57A 2OXDA 2F7EE 2VTTA 5HVYA 3DS6A 5M08A 4UMPA 3T8OA 5AX9A 3NS9A 4FT7A 2VO3A 2UW3A 4AT3A 4D1SA 4GJ2A 3ZH8A 3GC9A 4H1MA 4KINA 4OTRA 3FYJX 3U87A 5HBEA 2ZB1A 3EN6A 2O8YA 4IANA 4X3FA 4IHPA 5ANKA 5ITAA 2C4GA 3FL4A 4RFMA 4BCPA 4FGRA 3CPBA 2BRNA 5FGKA 1Y8GA 5H3QA 2QHMA 3E88A 4UWCA 2BKKA 2C3KA 4WNMA 3C5IA 3MB7A 3NNWA 1PMUA 3CTHA 5IEVA 2GS2A 3DNDA 5BVOA 4EQCA 1J7IA 2A2AA 3QAME 4MTAA 5HCZA 3AMBA 5K0KA 3ERKA 5EM8A 4HVHA 4HGSA 1NY3A 3QQHA 4XRJA 3V8TA 3PLAE 3BLQA 2W17A 1DS5A 3F5XA 3QZHA 4NW5A 2JFMA 3F61A 3O23A 5KMNA 3UBDA 2CGWA 4DC2A 1H26A 1Z57A 2WIHA 4QMWA 5JK3A 2QOIA 4M13A 5J1VA 4R78A 3OT8A 5AV0A 4A9RA 5CU2A 3ZDIA 4EHEA 2YWPA 3R02A 4S31A 3TWJA 2IZTA 3PYYA 4JAJA 5IA2A 4NCTC 4DFBA 4K18A 1CKJA 4FIJA 2Z7LA 1UU3A 3KK8A 5F95A 5A46A 1UKHA 3DGKA 4BYJA 3R8LA 3D15A 3MIAA 4GIIA 3BLRA 3ORMA 5BMMA 3D4QA 4QTCA 3RI1A 4GW8A 2YM8A 3DK7A 4LRMA 2XBAA 3HV4A 4ZSLA 3SXFA 2I0YA 4CYJA 2WFYA 5M51A 1FGKA 3ULZA 4AXAA 2VTOA 1GAGA 2PY3A 3IONA 4NEUA 2ACXA 2XCHA 4QTAA 2W5BA 2QONA 5BYZA 3O96A 5AUTA 1KUTA 2WMRA 2F4JA 3MH1A 2VGOA 3A8XA 5LVMA 3ZLSA 3VQUA 2HCKA 5IA5A 3ZCLA 1XBAA 4QQTA 5IDPA 2WNTA 4TNDA 1DAYA 3IW7A 3RCDA 3GC8A 1OL1A 4JXFA 1WBSA 4FKQA 3QLFA 5DG5A 5JMSA 3QYZA 2VO7A 3DJ5A 2WTWA 1XH8A 4I94A 3QWKA 5AP1A 1ZZLA 3G15A 4YZNA 3F2RA 3KGAA 2C0IA 3GU4A 3PDTA 4NWMA 3VAPA 4FSTA 4AU8A 3DCVA 4BI0A 3ATTA 4XG2A 4TYGA 4X21A 2VTMA 4IAKA 3PXYA 5HG7A 4HYIA 2VWZA 5IQFA 5DA3A 5I5ZA 3M2WA 1A06A 1LUFA 4FEQA 5LVPA 4YSMA 4O2ZA 4F99A 2XKDA 5IMXA 3DTCA 2WTKC 2G1TA 4IBMA 4BDGA 4EKLA 3FMEA 5CAUA 3PVBA 2XNBA 4NW6A 3PP0A 4MYGA 2JDOA 3P79A 4GS6A 4KIQA 4XG6A 4ZTSA 4FIHA 5AUZA 4JRNA 3MA6A 4D2RA 2C6EA 3U6IA 3QGYA 2JDRA 5C8MA 1K2PA 4D2VA 4FTQA 4D1ZA 4EOOA 1H1RA 1Q8YA 1PMEA 3N9XA 4QMPA 1OM1A 4UZHA 4N70A 4AZSA 3BU5A 4FKIA 2IG7A 2YAKA 4CGAA 3CTQA 4K1BA 3Q4ZA 3AXWA 3CJFA 2YM5A 3LOKA 4G3DA 4E6CA 1IA8A 2WAJA 3RK7A 4C3FA 4DFLA 4J8MA 4X6QC 2GHMA 3OBJA 4QRCA 4DEIA 4O7NA 5KUPA 5C4KA 4FTJA 4U44A 5LOHA 4CCUA 3FEGA 2Y4IB 4KAOA 4D4SA 3NW7A 5KMKA 3R01A 4F9CA 2V62A 3DT1A 3ENMA 3GEQA 4FZ6A 3HP5A 4FTOA 4GFMA 2J5EA 4GYGA 1ZYDA 2OJIA 4YURA 5EQEA 4OAVB 3R7GA 4RPVA 3Q3BA 3G6HA 4GH2A 4BCFA 4YZCA 1OB3A 3NYNA 4FTUA 3EQBA 3BHYA 1NVSA 1U46A 5KZIA 3WF8A 2X1NA 4D5HA 3NAYA 4QMNA 3V8WA 3AQVA 2QLQA 2YIWA 1KWPA 3GCUA 2BZHB 2YDKA 3O8PA 3QRJA 3FSFA 4J96A 4OBOA 1Q24A 4YLJA 1PRYA 4AOIA 4DHFA 3I7CA 3W2QA 3FMDA 1APME 3DB6A 2E9NA 4LMUA 3MESA 2I40A 4XS2A 3FZSA 4RIWA 3WZDA 3PXRA 4BHNA 1YXUA 4MXZA 4C58A 1LP4A 3OWPA 5TE0A 4G1WA 2XIZA 4F7JA 2ITVA 2WMWA 1FBNA 4ITJA 1GZ8A 2XF0A 3RALA 3WE4A 5B2KA 2EU9A 2PMLX 3K2LA 4NTSA 3EQPA 5GNKA 5KMOA 3KN6A 3EQGA 3F3UA 2W1IA 4G9CA 4KB8A 4P7EA 4XP2A 5FWKK 4EL9A 2ETKA 1Q8ZA 3QA8A 3T9IA 4AZEA 2XKEA 5HZNA 3IO7A 1PXKA 4IB5A 4EONA 4MWHA 3E3BX 2GTNA 3UOLA 2DS1A 1PJKA 4PNKA 2X7OA 5IEXA 3LFAA 3PUPA 3QZGA 4NK9A 3VUGA 1YXSA 2HK5A 3O17A 4EZ7A 3CKWA 1Q8UA 4S30A 4LFIA 3D7ZA 2QOLA 2UW5A 4ZLYA 1WCCA 4RLLA 3QHWA 2CN8A 3PVWA 4MAOA 3TIYA 3HV7A 2NP8A 3HLLA 2WQEA 4V0GB 3ET7A 5E1EA 5FTGA 1M2PA 4ZSGA 4OGRA 2FYSA 5BVNA 3IDBA 4FV1A 3EMGA 2A0CX 4KIKA 1E9HA 4M14A 5IKWA 4F64A 2WQNA 3R73A 3A8WA 3TI1A 3W16A 4CKJA 1OIQA 4WUNA 3DZQA 2XB7A 3GC7A 4WO5A 4QP4A 4GV1A 2BDJA 4MD9E 2W9FB 2XKCA 5HHWA 3C0GA 3LFEA 4MXAA 3EIDA 2YCRA 3MFSA 2F7ZE 1XBCA 4J95A 4ZOGA 4ZS0A 3GNIB 5AM6A 1XKKA 4DTBA 4EZ3A 5IQIA 1VR2A 1YWRA 2PE1A 2WELA 3FMHA 1ZOGA 5BX0A 4YLKA 2PVNA 3Q5IA 4TYJA 4L7FA 3SGCA 3PPKA 4LGHA 4HVIA 4BGGA 2B9IA 4WG3A 4BCGA 2GNGA 4U81A 4F7LA 3FXWA 5CT0A 4FEWA 4IJ9A 2HY81 3TNPC 3OS3A 4WKQA 2VUWA 2CCIA 3ALOA 2Z7RA 4G3EA 2GS7A 5E9EA 1JKKA 3FMLA 2YITA 1XH6A 1G3NA 5EHOA 3ZS5A 5AAGA 3DNEA 4F6UA 3BE9A 3HGKA 3R2BA 2W7XA 4YJNA 5D41A 1JKTA 3FI8A 3RK5A 2Z8CA 1Y8YA 2XRWA 4I22A 4NM3A 3HA6A 3AC2A 3IW5A 3A7GA 4DFZE 4Q9ZA 4ACDA 1AGWA 1BI7A 3A60A 3UQGA 3JVRA 2CN5A 3KRJA 3I6UA 4DE4A 5I3OA 3BU6A 4TYHB 4YLLA 5EHLA 2CGUA 4QQCA 3TNQB 3R9RA 4Q5EA 1GIHA 4G5JA 5EM7A 2V7AA 3R22A 3VW8A 5D9HA 3UZPA 4O6EA 4YTFA 3A2CA 3IECA 4XJ0A 2GHLA 2BRHA 3QKLA 3QRKA 3KRLA 2YIQA 1GZKA 2CNQA 3RHXA 4YHTA 5IQDA 3TUBA 2HXLA 4LV5A 4S32A 3GENA 3V6RA 4OTDA 2VTQA 3CQEA 4PPCA 2E9PA 5CU3A 4KKGA 3AD5A 4IW0A 2UVZA 5CVHA 5KZ0A 4ACMA 2HENA 4E6DA 2NNWB 3BV2A 1SZMA 1ZAOA 2W1DA 3W2PA 1OBGA 3GC0A 1ZMVA 5EW9A 3V5TA 3DBFA 2X39A 2QOHA 3JS2A 1M2RA 1P4OA 3E92A 1JQHA 3UZRA 2OGVA 2CMWA 4BWPA 3QUDA 3QZFA 4J97A 5CU4A 3VBQA 5EDRA 4IZYA 3TZ8A 5HIEA 2BZIB 2YISA 1Z9XA 4PDSA 4ASEA 2E9OA 3P7AA 5IF1A 2XK9A 3G9LX 3EFLA 3UPZA 5E1SA 1A9UA 3GI3A 4Y72A 5C9CA 5HTCA 4QT1A 4R1YA 4RWJA 3BCEA 2PL0A 3VO3A 4C0TA 4FIIA 5FDXA 2J0KA 4L67A 3EFKA 4A4OA 3P7CA 4BTKA 5IQHA 4FTKA 4FTRA 2NRYA 4PPBA 5CALA 3NUYA 4PTCA 4WG5A 3HV3A 5HVKA 4H1JA 3NUUA 4FNWA 2OH4A 4H05A 2OI4X 4I0SA 4M67A 1GOLA 5C03A 4KIOA 4PMPA 2JKQA 1GZNA 4Z9LA 3QCQA 3M11A 3BIZA 3MI9A 3PXZA 3ODYX 4XV1A 3IW6A 5EFQA 3O71A 4P5QA 2R3QA 1YWNA 2X9FA 3ZEWA 1CSNA 1YXXA 4A4XA 4B8LA 4B8MA 3SOAA 1OITA 4B4LA 3ORPA 4GG7A 4CQEA 5J9ZA 4ACGA 4FKUA 4A07A 3H3CA 4B0GA 4F1TA 5DLSA 1OGUA 4QPAA 4F9YA 4QTBA 4C3RA 4OTPA 3RZFA 4AS0A 2XMYA 2X8IA 5H8EA 3LE6A 3QC4A 4M68A 5E8SA 3CY3A 5E8WA 1W83A 2WZJA 3QTZA 5AWMA 3BGZA 2X7GA 3PZEA 3PJ1A 4FV5A 2OZAA 4PWNA 3EQDA 5FM2A 3FPQA 3TNWA 2UZEA 3QQKA 2OK1A 4FSQA 1IAJA 4MNEB 3Q96A 4FG7A 3KXHA 3TKHA 4M7IA 5AP0A 5TT7A 4O38A 2YLFA 3BX5A 3VUIA 4AGWA 4BF2A 2DQ7X 1OVEA 4IAZA 3L8XA 3VBVA 3OY1A 2GDOA 2ERKA 3IDCA 4D4YA 5CF5A 3PZHA 3NRMA 1WBVA 2QR7A 3NZ0A 1O9UA 3O8UA 4FT5A 5IUHA 2QVSE 3NIZA 2C30A 3W8QA 3C4FA 1PMNA 4ZZOA 5AUUA 4DFUA 2QHNA 4E4MA 5M09A 3CR0A 2CGVA 2C6IA 5LVOA 4OBPA 3C4WA 4U3YA 5DEYA 4UXQA 3MTFA 4KWPA 4F0FA 3MY0A 2BALA 4O0SA 2XBJA 2CNUA 2BPMA 2OIBA 2ZM3A 3I60A 5EK7A 2ONLC 4EKKA 5AA9A 4R3CA 1YW2A 2OFUA 4G3FA 3UO4A 4JR7A 2Z02A 4CZUA 2R3IA 1M7NA 3NUXA 3TL8A 3JYAA 1YI3A 4IWDA 2X7FA 4R3RA 1YDSE 2OSCA 2X4FA 4C8BA 3AD4A 3MPTA 4PP7A 2W4KA 5J79A 5JQ5A 3JY0A 4QP3A 2OZOA 3LM5A 4ALWA 4AZTA 2SRCA 4CFFA 1WVWA 4EC9A 1PXIA 1GIJA 2W1EA 4CKIA 5JKGA 4NYEA 1YXVA 1ZMWA 3EWHA 4K8AA 4MVFA 3ZLXA 4BTFA 5A9UA 4WBOA 1IRKA 3FC2A 3G9NA 4Q5HA 2R3PA 3LMGA 4I5MA 5DT3A 2ERZE 3QKKA 3H0ZA 2W96B 4EK3A 3TUCA 3Q9WA 1FGIA 1ZYJA 1GNGA 3KB7A 4GK3A 4BFMA 4O7YA 2C3IB 4P4CA 3ZUTA 5GIOE 4GFOA 3ZYAA 4DLJA 3RPYA 5CAQA 4BN1A 4GVJA 2YA9A 5FEDA 3A99A 3EHAA 3UP2A 4YR8A 1CKIA 2OIDA 4LMNA 2VGPA 4V04A 3JUHA 1NW1A 4XLIA 4YHFA 2C3JA 3BV3A 1Q4LA 1Q8WA 3SG8A 1BKXA 2WMSA 3RWPA 1ZRZA 4FTLA 1AD5A 1ZMUA 4YJOA 2CKEA 3HKOA 5JGBA 1VYWA 2BFYA 1H1SA 4NFMA 1YHSA 2W1FA 2Q83A 3OWJA 3FLWA 4XBRA 1BI8A 1IG1A 2ITPA 4CCBA 4YPSA 5HNGA 4GVAA 4LL5A 5IZFA 2HWOA 3DLZA 4U97A 3ZRKA 3GOKA 2J51A 2OBJA 2KULA 4TKSA 4BB4A 4CYIA 4ANNA 2GSFA 4UYAA 2VTNA 4OUCA 4U8ZA 1SVEA 5DFPA 5HG9A 1REKA 3MH0A 5ACBC 3FI3A 4RVKA 4XV9A 4HNFA 3MH3A 4NIFA 4KKHA 2VWBA 3F5GA 3WZEA 3GU8A 2BR1A 3KVWA 4X6RA 5J95A 3E7OA 4PMMA 2ZV7A 4ANSA 2XNNA 5HIDA 4FSYA 2G9XA 3R7IA 5B2MA 3BLHA 1OPKA 2R5TA 4D9TA 4BDEA 5IH6A 3UNKA 4CT2A 4JR3A 3C50A 3OOMA 4XOZA 2YLEA 4RQVA 1K3AA 3OC1A 5HBHA 1OPJA 2ZVAA 3NNVA 3WOWA 1Q3DA 2C6TA 5CSHA 3HAVA 4EEVA 4QMQA 3ZM4A 2RF9A 4EQUA 2ZDTA 4JDKA 2ITQA 4DGOA 3TM0A 2JFLA 3Q4CA 3COIA 3Q53A 2GU8A 4BKYA 3VUKA 2XNMA 4ANQA 4RA5A 2P33A 4FOCA 1H0WA 4YHJA 4EOQA 2VNYA 4G9RA 3I4BA 3OG7A 4JS8A 2RFDA 3CPCA 5CZIA 3O7LD 2PZYA 3D5XA 5AV4A 1M14A 4UMUA 4AN2A 1JNKA 1Q62A 2FB8A 2ZDUA 4QYHA 3VS5A 2P2IA 3UOHA 4MX9A 5CEMA 3CC6A 1OL6A 3QXOA 4JBPA 3KULB 4NFNA 3LPBA 1MP8A 4E6QA 5TOZA 3EQHA 4KUJA 4O83A 4OTHA 4RT7A 2J4ZA 1CMKE 4HCVA 4G3CA 4WOVA 1Q99A 5IPJA 3DFAA 4DBXA 3LCDA 3R8ZA 4S33A 3W55A 4QP8A 3LZBA 5HBJA 5L2WA 5AIKA 4GT5A 3DY7A 4U42A 4FV3A 4MEDA 3PIXA 5DR9A 3U6JA 1IEPA 1SNXA 2X0GA 4L3JA 5CU6A 2OF2A 4L6QA 4Y73A 3EKNA 3G6GA 2B53A 4IWQA 4MBIA 2QG5A 3QQJA 4E4LA 5HICA 1QPJA 3R7VA 4TXCA 2QODA 4X2JA 5CSVA 2NRUA 3ATSA 3L9MA 3G51A 4OTIA 4X2NA 4DH5A 1H1WA 3POZA 1JVPP 3A61A 4ASDA 3R30A 3IDPA 2JAMA 2GNIA 4R7IA 4M66A 4ZK5A 4WRSA 5GZ8A 5BVDA 3MDYA 3GOPA 5EKNA 1FPUA 3AGMA 2OXYA 3S00A 3BBWA 3POOA 2WHBA 3ORXA 3OWLA 4W9WA 2OJJA 4YZBA 1G8SA 2Y4PA 2F57A 2UZLA 3JR1A 4YZ9A 4XYFA 3PJCA 3RZBA 3KCFA 1B6CB 1WVXA 3UP7A 4AA4A 5TKDA 4S2ZA 1SMHA 5BVWA 2A1AB 3ZDUA 5FP6A 4NH1A 1QL6A 4AGUA 4EJ7A 4GKHA 3SQQA 5CTPA 3R04A 4FGBA 4F0IA 3SA0A 2EXEA 3LFFA 5IQGA 4K6ZA 3B2WA 4FTIA 3B8RA 3F5PA 4I21A 4G34A 4WA9A 5A4CA 4MCVA 2YWVA 4MHAA 3H10A 4EZ5A 3MA3A 4OTQA 3SHEA 1X8BA 2ITOA 4JBQA 3EL7A 2DUVA 4HVDA 3S95A 3OFMA 3PXFA 4CG8A 3OXIA 5HO7A 2IVTA 4OTFA 4BCNA 2YAAA 3GU5A 4O7LA 2R7BA 5L8KA 2J9MA 4AOJA 2WTVA 2IN6A 3AMAA 2X2MA 3QA0A 5CLPA 2IW8A 3WI6A 1R78A 4AA5A 4OR5A 4OBQA 3R9OA 3KN5A 2H6DA 4TTHB 2VWIA 1U54B 5AUYA 4IADA 5AX3A 4CFVA 5LMKA 4YC8A 3R2YA 1LEZA 4QYEA 3FUPA 3BI6A 4FKSA 5D11A 2XK4A 4ERWA 2VO6A 3PSDA 3GXLA 5DRBA 4C4GA 4EORA 5AAEA 5HX6A 3PP1A 5CZHA 3RHKA 2GNHA 5E8XA 4KBAA 5AUVA 2WMQA 3RWQA 3GB2A 4CT1A 3LFSA 3COHA 4DFXE 4USEA 3UOJA 3LQ8A 3W32A 4DG0E 4FEXA 3A62A 3NUSA 4M69B 4YP8A 4I6HA 4RSSA 4XX9A 3TACA 4BBFA 4CZTA 5C4LA 5C26A 3ORKA 4GG5A 5JGDA 1PKGA 2AC5A 2RL5A 5GJGA 3PPZA 3PTGA 4JT3A 3NUAA 2Y0AA 4IAYA 4AGCA 4C35A 5L2TA 3UOKA 3VRYA 5JZJA 2IVUA 3FAAA 2A19B 4NTTA 2GQSA 3NVKI 1WBWA 2OJFE 4LGGA 3SVVA 2EWAA 1YDRE 3TTJA 2PUPA 2JIIA 3FSKA 5GZ9A 4ZJIA 4ZSAA 4LQMA 3KREA 1G5SA 5EM5A 2ITTA 5BVKA 2GMXA 4BRXA 5JGAA 2P3GX 1JWHA 2YHVA 3OP5A 5DGZA 3R7OA 3V6SA 1PXJA 2WTCA 2CJMA 3IGOA 3R28A 5CNOA 3ZFMA 3NNUA 4IX6A 3D0EA 4AF3A 4O7ZA 4DG3E 5EI8A 2R3OA 3OEFX 4X3FC 5EYKA 4F7SA 2ITUA 4DGGA 2XJ2A 3HV6A 4LM5A 5LVNA 4CLIA 1OKWA 4BKZA 4E73A 4KA3A 4L3PA 4BCKA 2YJSA 5AUXA 5M57A 4FV2A 1XH9A 4H36A 5AP4A 3BWJA 3ROYA 5H8GA 4KBCA 4PMSA 2HAKA 4FT9A 1H01A 3FLSA 4M0ZA 3UMXA 5M4IA 5IQEA 2WU6A 5ANJA 4N6ZA 2EB2A 2ZAZA 3GCVA 4JI9A 3VJOA 5BNJA 4CLJA 4AQCA 4FEUA 2PMIA 5G6VA 3VNTA 5CF6A 4FUYA 4IH8A 3BHUA 2BTRA 5DWRA 3N4VA 2XEZA 4O96A 2VAGA 5AAFA 3RKBA 4EH9A 4KNBA 4O0TA 1Y6BA 2GNLA 3P78A 4KKEA 3MB6A 4BR3A 3SOCA 2R3HA 4G17A 3PA4A 4XV3A 2JGZA 4X3FB 3HDNA 4YJRA 3FZOA 4AA0A 2FA2A 3GCPA 2DYLA 3QRIA 5EI6A 3RK9A 1XO2B 3G2FA 3W33A 2FSTX 2P55A 2WMAA 4I1ZA 4RJ7A 1KSWA 3OY3A 3WF5A 4FVPA 2HW6A 3AT3A 2CLQA 2RKUA 3DPKA 4TPTA 4A4LA 3Q4TA 4FYNA 4IB3A 4TT7A 3RAWA 3W8LA 4DTAA 2Q0BA 3L9LA 5I9YA 2WOUA 4HGLA 1OECA 1SVHA 4E4NA 2YDJA 3BGPA 3KK9A 1SYKA 2YFXA 5HG8A 3R9DA 3ZUUA 4UV0A 4IACA 3VS7A 2H9VA 4ACHA 2R3JA 1QPDA 3PY3A 4JDHA 2PVRA 4O1OA 5FBNC 4NKSA 5H2UA 3ROCA 1LEWA 4YMJA 4OTGA 4GEOA 3IKAA 1UWHA 4KIPA 5J8IA 3OD6X 5EYDA 2QOOA 4M84A 3UC3A 4DEGA 3UTOA 1YDTE 3GU7A 2BRBA 4CXAA 1FVTA 3DOGA 1KE8A 3Q6WA 4R7BA 4W4XA 3VS3A 4FIGA 5ANDA 4AFJA 3T3VA 1H00A 2CPKE 3I6WA 3REPA 3LJ2A 3Q4UA 4BZOA 4CRLA 4RWIA 4O86A 4DAWA 2ZJWA 1PYEA 4JG7A 2J0IA 3RPRA 3HX4A 4BCHA 2PVHA 3NX8A 4FV8A 2Y4IC 3OWKA 3S4QA 4ZTHA 5FG8A 4IQ6A 2X2KA 3KCKA 4KS7A 3FC1X 5IDNA 3BYUA 3F5UA 4FTMA 5AMNA 2C6MA 2RIOA 2JIUA 3OXTA 3IS5A 2UW6A 5M4CA 3UNZA 1SM2A 3S1HA 5M06A 3SDJA 3KXZA 4DLIA 3FI2A 4FV6A 2I6LA 2C5XA 3SX9A 1PY5A 3EYHA 1HCLA 1RE8A 2VTIA 4XNEA 4L3LA 4F4PA 5CENA 2PE2A 3TEIA 3O50A 1OZ1A 3L1SA 3AMYA 4F1OA 2ZV8A 2XRUA 3KU2A 3HV5A 4QMMA 5ANOA 4LYNA 4PTGA 3Q2JA 4CQGA 5JZNA 2V22A 4FEVA 3QU0A 2FGIA 4QNYA 2IW9A 3SC1A 3WIKA 1Q3WA 2HZIA 4FV4A 4RX8A 5C8NA 3QCSA 3D5VA 4S34A 4ZLOA 1XQZA 1OL7A 3L9PA 3DKCA 3NUNA 5ETAA 4BDAA 4GKIA 3SW7A 3AC4A 3KFAA 4FL3A 1ZWSA 2WOTA 2BROA 4LRJA 3KXXA 5EW8A 4EHGA 2WTDA 4CZYB 4I4FA 5EQPA 3PG1A 4MBJA 5CVGA 2VZ6A 3ID6C 2REIA 3LXKA 2BRMA 2HYYA 4L8MA 1I09A 4PL5A 5JRSA 5FXQA 4JAIA 2J6MA 4QTEA 3NEWA 4F6SA 3OZ6A 4GT4A 1SNUA 3LXLA 5HE2A 3TDWA 5DRDA 5D7VA 3IW8A 4HPUE 3KF4A 3A4OX 3ZRMA 5B0XA 3FLZA 2O5KA 3K3JA 4C4HA 2Y8OA 3W2RA 1YHWA 2XNEA 3NUPA 4FT3A 2X8DA 3PE2A 3UNJA 4Z7HA 4BI2A 2IVVA 3PY0A 4U43A 4UZDA 5HO6A 3A7IA 5JN2A 3HMOA 4DGNA 3SRVA 3MFRA 4RIXB 2XYUA 3QQUA 4ZJVA 4AN3A 4E26A 1GZOA 5KMLA 5AIRA 3OTVA 3I7BA 2ETRA 2ETMA 2X4ZA 3BE2A 5LXMA 4F9BA 4IX5A 3UMWA 2J0LA 3MVHA 3R9NA 4FZAB 5C8KA 5B7VA 2YM4A 5CF4A 1EH4A 3QLGA 3DJ7A 1U59A 2Y6OA 2YERA 3GT8A 4J1RA 2Z7SA 1YWVA 3R1SA 2CLXA 3EH9A 3OW3A 2XKFA 4PUZA 4BL1A 5IUIA 4Z3VA 3CQWA 2WMTA 3CY2A 3IK3A 3ORLA 2JDSA 1WFCA 3TNHA 2BDFA 3ZBFA 2PVKA 3HMNA 4AT5A 3QUPA 4JDIA 2BTSA 5K4IA 3LFNA 2JEDA 3RP9A 1S9IA 2XNPA 4RIWB 3E3PA 3LHJA 4CTBA 4YO4A 2XK3A 4ORKA 2CSNA 3G0FA 4QMZA 1W84A 3KKVA 2QCSA 2UZNA 4QP6A 3VBWA 1PF8A 4O84A 1XH4A 4BHZA 1F3MC 4L7SA 2OJGA 4ANMA 4ZZMA 3DBDA 4J7BA 5EKOA 3UG1A 5E92A 5M44A 1UWJA 2WGJA 3KMUA 3FMNA 5JFWA 4JRVA 4DITA 3S3IA 4A06A 2OH0E 2W9ZB 3A7FA 1JSTA 4IC7A 4ENYA 5L8LA 2PVLA 4U80A 4D2TA 2CGXA 5J9YA 4D58A 3FE3A 2QKWB 2P2HA 2W1GA 1M52A 3COMA 3EN4A 3FMKA 3CKXA 3PJ2A 1VJYA 5HG5A 5AR3A 3THBA 3GBZA 4QPMA 5A4QA 3V5JA 5I3RA 1ZOHA 2VWUA 4CFXA 4G6OA 5CVFA 4CNHA 1W8CA 4O22A 5HOAA 3RPSA 3FZTA 2VX3A 4O81A 1H27A 4YTHA 4DH8A 4GUEA 3UIBA 1JAMA 3VC4A 3WZJA 4UMRA 3H0YA 4BTMA 1CKPA 3DAKA 2VV9A 2WMXA 3NIEA 4KIKB 4U0IA 5CANA 1LPUA 3RMFA 4KSQA 3GP0A 2VWVA 4E1ZA 3PJ3A 3Q32A 2CCHA 1YVJA 3LFBA 3WILA 2AC3A 1XH5A 2XK8A 4GK4A 4B6LA 4ZTNA 2C5VA 4TRLA 5FEEA 4L44A 2BKZA 3E87A 4APPA 1RDQE 4MXOA 4XG4A 1IAHA 3AC5A 3ZLYA 5JH6A 1UNHA 4GUBA 4MD8E 4XP0A 3UC4A 4AACA 2FSLX 3JPVA 4BIDA 4EWHA 3EQIA 1B38A 2WO6A 5DVRA 2BHHA 5EDPA 2J0MB 2VTSA 3HEGA 2PULA 3HNGA 4UMQA 4TYEA 4HVSA 3FHRA 3FQHA 3DBEA 2BCJA 4JVGA 4Y5HA 4ZP5A 1PKDA 4ZMEA 4HZSA 4YJVA 5FTQA 1QPCA 3AC3A 4D1XA 3QTXA 2W05A 3V5LA 2X9EA 3I79A 3CBLA 3OW4A 4QMUA 3V8SA 2LGCA 4TL0A 2JDVA 3V5QA 2ZB0A 2RFSA 2BVAA 2CNVA 2JBOA 2XEYA 3DB8A 3FXXA 3RNIA 4C7TA 5IQAA 4JOAA 1F5QA 4QMTA 3TKUA 2W5AA 2YM7A 4GK2A 4O7VA 3PVUA 1MRVA 2G15A 2XIRA 2XNOA 4O21A 1YOMA 4O91A 4EH5A 5HQ0A 4FNYA 3D7TA 3T9TA 3NCZA 1ZY4A 3U4UA 3DQWA 4QQ5A 3P1AA 4LV8A 5A14A 5JFXA 3UQCA 1H4LA 4JQ7A 3ZONA 1ZOEA 2NO3A 4WSQA 4IX3A 5M07A 3MPAA 3W2SA 2Y7JA 2O63A 3LM0A 4BICA 4NM7A 3Q9XA 3F7WA 4K0YA 2PVFA 4BZNA 3ZUVA 2QO9A 4F08A 1W0XC 5LMAA 4N6YA 3OF0A 1J1BA 3W18A 3D2IA 3K54A 3QQGA 4K77A 3SAYA 1UU7A 5AV1A 5L4QA 2RGPA 3ZOSA 4EK4A 3TG1A 4BGQA 2PSQA 4ZTMA 5EOBA 2OU7A 1BL6A 4YTCA 3FI4A 4FT0A 4FTAA 5J5SA 4NUSA 1XBBA 4BGHA 5CAOA 4YJPA 2VX1A 4AFEA 4FYOA 3KMMA 3QTRA 4IIRA 4USDA 2W06A 2VTAA 2RFEA 3V3VA 3ZEPA 4IVCA 1J7LA 4O7WA 4FVQA 2RG6A 3NYOA 2BRGA 3QKMA 2WMUA 1UU8A 4C4EA 3MVMA 5BUIA 2I1MA 4DG2E 5KO1A 3E8NA 4EHVA 4O7RA 4GFGA 2PE0A 4XG7A 5M53A 4XMOA 1E1XA 4EUTA 3KC3A 1AQ1A 4UEUA 3C4EA 1FVRA 3RAHA 1WZYA 2QO2A 2C3LA 3A7JA 3KY2A 2GQGA 5E7RA 4HZRA 3RPOA 3NDMA 1FMKA 3ZFXA 4AP7A 3HMIA 5IA3A 4QP7A 2XM9A 2WTIA 3H9FA 4GU6A 1BMKA 3G0EA 4L00A 1YHVA 4RX7A 2GCDA 5DYJA 3LMHA 4LOQA 3ZO2A 3IGGA 4JX7A 3R8VA 4MH7A 3NR9A 4I0TA 5F20A 4FSWA 5A4TA 2WMVA 3R21A 4IAAA 1A48A 2VWWA 1PHKA 2C1BA 3NYXA 4F9AA 1URWA 3NNXA 4QMOA 3MH2A 4U79A 5IISA 5D7AA 4H3QA 5CI7A 5A6NA 4AGDA 4Z16A 5J7HA 2BZJA 2B55A 3QX4A 5DI1A 2C6OA 3QTUA 2WKMA 2ZMCA 2X6EA 3FQSA 3LFDA 3VBXA 4BBEA 2PZIA 2YCSA 4BC6A 4F6WA 2O65A 1JKSA 5DR2A 1KV2A 3PG3A 2CKPA 3S2PA 3GFEA 3EKKA 3PIZA 3LJ1A 1MRYA 4G5PA 2OZAB 3ZXTA 2B4SB 2GPHA 2HZ0A 2G2IA 2O3PA 1R39A 1PXOA 4IM2A 3R1YA 5E8TA 4BKJA 4H39A 2IPXA 4FSMA 2Z2WA 5LCJA 3BYVA 4MQ1A 5CQWA 1ZARA 2B52A 2B9HA 4AX8A 1P4FA 4L9IA 5EYMA 4H3PA 4APCA 2YZAA 3DBCA 4MXXA 5BUEA 3VUDA 3IG7A 2PUIA 3NSZA 1KE6A 3C4XA 4FTCA 4XLVA 1NXKA 2ITYA 4G6LA 5AJQA 3U9NA 4BY9E 2J90A 5KNJA 3BBTB 1TVOA 5CT7A 4IZ5A 4JL9A 1CM8A 4RJ8A 4EYMA 3SKCA 5H9BA 3QTQA 5HIBA 3P9JA 1YRPA 3E93A 4O27B 2DWBA 3U55A 4E5WA 4RGJA 4PNIA 5M55A 5AUWA 2YM6A 3VBYA 4PPAA 5DIAA 2VWYA 3WZUA 1KOAA 3HDMA 3QX2A 5JQ8A 5AFVA 2UW9A 3FKLA 3FY0A 1QPEA 1WMKA 3QWJA 1H1QA 4NJ3A 4QNAA 4ZTQA 4R1VA 3LLTA 2O64A 3QYWA 4PV0A 3HYHA 4Y83A 2X81A 4AE6A 4R77A 2XVDA 5HLNA 3EQRA 3QBNA 4RG0A 5HTIA 5DT4A 5AP5A 3SV0A 2R4BA 4NZWB 4EBVA 2R9SA 2YM3A 3DV3A 4FV9A 4IVBA 4I41A 3FHIA 4IX4A 1MQ4A 2UZTA 4BCQA 3HUBA 5AR2A 3E7VA 5IU2A 4EOLA 4B99A 3KMWA 2RFNA 2JC6A 3P5KA 4EK8A 4JIKA 3DKFA 5I9WA 3AOXA 3H30A 5C1QB 4N57A 4Q9SA 1RW8A 3KVXA 2PUNA 2VTJA 5CAPA 5I4NA 3KRWA 4OW8A 2Z60A 4GIHA 3MWUA 1PYXA 3LJ0A 4E6AA 2H34A 5L6OA 5JT2A 4FSZA 4CFNA 3HMMA 4X2KA 2R3NA 5CY3A 4RA4A 4FKWA 3II5A 3C7QA 4U3ZA 5EYCA 3V5WA 3QTSA 3BYSA 3EQCA 4I5CA 4ONAA 4EI4A 1Z5MA 4D4VA 4K2RA 5I9VA 1H1PA 4XCUA 3HMPA 4NKAA 4PMTA 4E93A 4EH8A 4FKRA 5E8ZA 4ZS4A 3VQHA 5KHXA 1OIUA 3DK6A 2C47A 3ZM9A 4P5ZA 4TZRA 3ITZA 4KBKA 3VS4A 5HORA 2YIYA 4N0SA 3MTLA 4GU9A 4WBBB 4W8DA 1R0EA 3C4ZA 3CD3A 3HRCA 5DNRA 4NIFB 5ETFA 2B7AA 4FKPA 2A4LA 4HNIA 2R2PA 3R1NA 2GTMA 3PJ8A 4JLCA 3U9CA 5AP6A 2GNFA 1JKLA 3HVCA 5FP5A 4YU2A 1VEBA 3GVUA 4FZFB 4RIYA 4CD0A 4DFYA 5IA0A 5HGIA 2I0EA 3UYSA 4ITIA 3ZC6A 4IAIA 4DEHA 4DT9A 4NSTA 4XEYA 2C68A 4IC8A 3WBLA 1Q5KA 4DFNA 3DAJA 2ZV2A 2WQMA 3PRIA 4M97A 1ZYLA 3DTWA 1WAKA 2WTJA 4EH3A 3ZBXA 2EB3A 2G2HA 3QRUA 4V01A 4H3BA 4RVLA 3UPXA 5J5TA 2W5HA 2IVSA 3O2MA 2XM8A 1PXMA 2HELA 4DCEA 5L6WL 4EQMA 3VVHA 4MQ2A 4HW7A 5DEWA 2B0QA 4I93A 5KHWA 2UUEA 4ASZA 3N4TA 4FK6A 2IJMA 2X6DA 1P14A 2YDIA 4QMXA 4PL4A 4IDVA 4FKOA 4L53A 1V0PA 2R64A 1OMWA 2WQBA 4Q2AA 4X2GA 5AV2A 3RJCA 3RM7A 3UVRA 3VW6A 2ZYBA 5KBQA 2WU7A 3AGLA 1H07A 4HGTA 3W1FA 5CXZA 3A4PA 4J52A 2OLCA 3R1QA 4M8TA 3MW1A 5AR8A 3Q52A 1ZYCA 3LVPA 4LOOA 3FZPA 4GSBA 3OHTA 3TJDA 4W4YA 5EG3A 4PF4A 1H8FA 5D1JA 1S9JA 3VULA 4ZAUA 4D0XA 4OLIA 3UZTA 4QPSA 3FMJA 2GFSA 4ACCA 2ESMA 3NGAA 4MXYA 1O6LA 2C5OA 2UVXA 3FQEA 3NVMB 5G1XA 2KTYA 3TNIA 3I0QA 2AUHA 3OBGA 3TV7A 3ZO1A 1LR4A 1KE9A 3H4JA 3ZRLA 2XH5A 5BPYA 4DYMA 3UDBA 4FSUA 4R5SA 4C62A 4XHKB 3ZZEA 1WBTA 3RAIA 5J7BA 4GYIA 4F09A 2QLUA 4XRLA 2UZUE 3UO5A 3F3WA 4QMVA 4G6NA 4UWBA 4IWOA 4C59A 5HEZA 3VJNA 3AC1A 2W0JA 5BVFA 4C61A 4GJ3A 4E4XA 3FKOA 4Y95A 4O0UA 3ZSGA 3PXQA 5HX8A 2PUUA 3HRFA 3CXWA 2PZPA 5K9IA 3GU6A 1RQQA 1GIIA 3VUHA 4CG9A 2JKKA 2V5QA 4P90A 4AAAA 3NAXA 4FV7A 3PXKA 4RRVA 1FMOE 4AZFA 3L8SA 4A9YA 5IEYA 4EH7A 4F7NA 1ZZ2A 1FOTA 2HW7A 4F65A 5C01A 3WF6A 4IB0A 2W4OA 4Z55A 5AR5A 2C5NA 2R3RA 3ZZWA 2BZKB 2BAQA 2BAJA 4ZY6A 3KEXA 5LMKC 4EH6A 4C4IA 2OXXA 4Y8DA 3VS2A 1F0QA 1PXNA 2PVMA 1KE5A 1URCA 3F69A 3PA5A 3VRZA 3WIGA 4I4EA 4CFUA 2XUUA 1IASA 2JD5A 2UZDA 3LCSA 2J5FA 3TZ7A 2QOFA 4YUQA 2XS0A 4QP1A 3KL8A 1MQBA 2JBPA 4IZ7A 2JLDA 3EOCA 3R7UA 4RJ3A 4JG8A 4CEGA 3V01A 5B2LA 4ZLZA 1MUOA 5J9LA 1V1KA 4WNPA 4B7TA 1V0OA 1T46A 2QQ7A 3GUBA 4QD6A 3MFTA 2FSOX 3EQFA 2C1AA 2UZVA 1PMVA 3UVQA 2PMNX 2UV2A 3RNYA 3PSBA 4QYGA 4C02A 4ID7A 3ALNA 4LI5A 3CGFA 4J53A 5ANEA 5IUGA 3CEKA 2W1CA 4BIBA 3G5DA 1I44A 4DEEA 3NW6A 4ZTRA 3TIZA 4MNFA 5BYYA 5HD4A 3MYGA 4I3ZA 4RZVA 4D2PA 3U51A 3FV8A 4CMOA 5L3AA 3DU8A 1DM2A 4JIAA 5JFSA 4G3GA 4FNXA 1OKYA 2CHLA 4ITHA 2EXMA 3RTPA 3DAEA 5L2IA 5DBXA 4RX5A 4NCTA 3U4WA 1UNGA 3FBVA 2YCQA 3ANQA 3LCOA 3P23A 4HGEA 2VN9A 5GHVA 5HE3A 3F66A 1PXLA 1YI6A 4ZY4A 4FTTA 2VD5A 3AC8A 4YJSA 4YJQA 4C3PA 3O8TA 3PY1A 4ANOA 4IAFA 5A6OA 4FE2A 5LJJA 4FIEA 1CTPE 3DDPA 2OW3A 3QHRA 5KMJA 5KE0A 2RSVA 4X7QA 3P86A 3BHTA 4IFGA 1OUKA 5HLPA 1T45A 4UB7A 2HIWA 3M1SA 2Y9QA 3Q6UA 4ARKA 1OBDA 4QMLA 5AR7A 3U54A 1NVQA 3CLYA 2JITA 2FVDA 1UVRA 4TY1A 5ETIA 1YKRA 5CNNA 2HXQA 2WD1A 3R8MA 3E8CA 1JOWB 3LW0A 4KSPA 1ZY5A 4BDBA 4A9UA 3LLAA 4D2SA 4YZDA 4YZMA 4GMYA 5HVJA 3BHVA 3U8WA 4G2FA 2QURA 4EOPA 1FINA 4RJ6A 3FL5A 4UWYA 4DEDA 2QNJA 5FDPA 4BCMA 3MN3A 2GQRA 3Q04A 3E63A 3I1AA 4C34A 4FMQA 3M42A 3PRFA 4U41A 3NMUF 5CEQA 4HOKA 3UQFA 5CAVA 2RG5A 5EHYA 1OKZA 4GL9A 5E90A 4TWPA 4U40A 3ZTXA 1Y6AA 2C6KA 3VS6A 4O2PA 4ZTLA 1M2QA 4D0WA 2R0UA 3UODA 5K5NA 1B39A 3FMMA 4E8AA 3PLSA 3O7LB 3SD0A 2IWIA 3QC9A 4PRJA 4V05A 4O6LA 3EJ1A 1OPLA 4FTNA 4HYSA 3LQ5A 5CEOA 3BRBA 1NVRA 3I81A 4FKLA 4LRKA 3D5WA 3TCPA 4AUAA 4O0WA 5DN3A 2CDZA 3G90X 3COKA 4XV2A 4X3JA 3BEAA 2JKMA 3WYYA 4RFYA 1U5RA 1UA2A 1XH7A 4G31A 4DH1A 1MRUA 3O51A 2YACA 4IVDA 5AP3A 3P7BA 1WBPA 2BAKA 4YJTA 1H08A 2VRXA 5HKMA 3WF7A 2ZV9A 1Q61A 2JKOA 2YABA 3EFWA 2ZM1A 3ENHA 3FYKX 4QP2A 2BIKB 5CS6A 3R00A 3C51A 4OAUC 4TWCA 5ICPA 3L8VA 4EK5A 5BUJA 5ETCA 1L8TA 1JBPE 3I5ZA 4BCJA 3UIUA 3AT2A 3D9VA 3PVGA 3AG9A 2GNJA 4O1PA 3RAKA 4D9UA 5HU9A 4FZDB 5DPVA 2UW8A 3PFQA 2YJRA 3MJ2A 4KS8A 4D4RA 3OCTA 5C27A 3FLQA 5HTBA 3TKIA 3FXZA 3TJCA 5GJDA 1BX6A 4DT8A 4WNKA 1GJOA 3ORZA 1SVGA 2WTKB 5CASA 5I9ZA 3LKMA 1OIRA 4M3QA 4RIXA 1OL5A 3FKNA 4EYJA 1BYGA 3I0OA 4NT4A 5DHJA 3QCYA 1KV1A 4L45A 1YOLA 1OI9A 1KOBA 2XCKA 3ORTA 2VX0A 4FL1A 3R9HA 5AM7A 1Q97A 5GJFA 4J99A 4H58A 1XWSA 4F1MA 4I6BA 2ITXA 5KX8A 2PU8A 2YEXA 3I5NA 2YN8A 1DI9A 5KBRA 3DXQA 3QQFA 4RJ4A 2E9UA 3VF8A 5EM6A 4FG9A 4DGMA 4O82A 3MGYA 4FKVA 4U5JA 4FSRA 4O0RA 2BMCA 4RFZA 3EFJA 2H8HA 4IM3A 5HLWA 2QOQA 3ACKA 4HCUA 2R3LA 4V0GA 2UZOA 3UO6A 3ZSHA 4AT4A 2J50A 4AZVA 5HNIX 4U6RA 3TDVA 3WF9A 2OF4A 2B9FA 3BWFA 4IZAA 4BTJA 4BIEA 4PY1A 4LOPA 3FY2A 1V0BA 3QL8A 3CJGA 2PK9A 3NWWA 3G33A 3ANRA 3VHKA 3ZFYA 5K4JA 2QC6A 2BHEA 4O7SA 5AP2A 5HO8A 4DINA 1L3RE 3PWDA 3A7HA 2QU5A 4K33A 3LQ3A 3W10A 3C9WA 2ITNA 5BQ0A 1YI4A 4A7CA 4I5PA 4XBUA 2OIQA 3MPMA 2PYWA 4DH3A 3OTUA 5FD2A 3NPCA 3V04A 3F7ZA 1TKIA 2QI8A 4CMUA 2P4IA 4E5AX 1R0PA 4QOXA 4UYNA 3VHEA 3GCSA 4XUFA 4BWXA 4USFA 4J8NA 4JQEA 3C4CA 3F88A 1NA7A 4NL0A 2XJ0A 4M0YA 4XP3A 3OEZA 4I20A 4WRGA 3D14A 2P0CA 2WMBA 4WSYA 5E8VA 1U4DA 4TWNA 4O0XA 3MVLA 4DCAA 4AW5A 2Q0NA 3H9OA 4BDDA 3OOGA 3QQLA 3BU3A 4QQJA 5HNBA 2OKRA 1P2AA 4JNWA 5EH0A 4ZSEA 4R7HA 3EZRA 4QO9A 4CSVA 3BQCA 5GIPE 4ZXTA 2H96A 2FSMX 3HECA 3SRVB 4IB1A 3V51A 3QCXA 3HA8A 2F9GA 3CD8A 5IA1A 4ENXA 4Z7GA 3K5VA 4FF8A 4JJRA 4JQ8A 1ND4A 1ERKA 3R8PA 3C0IA 2C6DA 1K9AA 2WQOA 2XNGA 5L8JA 4L42A 4YNEA 3C13A 5E8UA 5JFVA 4O0YA 2HWPA 4C2VA 4GT3A 2F7XE 2QR8A 4DH7A 4TYHA 4KRDA 3C1XA 2FH9A 5EW3A 3DFCB 3CGOA 3ZU7A 4DEAA 1GY3A 4JX3A 3DLSA 3PE1A 4IDTA 4MK0A 2X2LA 4YSJA 2XA4A 2IZSA 4I0RA 2BUJA 3DQXA 4WNOA 3SG9A 2OICA 4YC6A 3LXPA 1WVYA 1J1CA 3NLBA 5F1ZA 4E3CA 3FZ1A 4FI1A 5HCXA 1YQJA 2JAVA 2JDTA 4DTKA 2WPAA 4N4SA 2OJ9A 2PZRA 3EYGA 4BDJA 4AE9A 4EOSA 3TN8A 4EUUA 3EL8A 3EN7A 4FKTA 3VUTA 3JY9A 3F6XA 5DR6A 4X2FA 3R7EA 4Y46A 4IWPA 4DN5A 5KCVA 5FXSA 2QG7A 2VNWA 3P08A 4YGAA 3E62A 4FA2A 1REJA 3DA6A 4FR4A 3EB0A 5DT0A 4AW1A 3ZHPC 3DZOA 4L01A 4W8EA 5ACKA 1CDKA 3QTWA 4ASXA 3RGFA 4BWKA 5CSWA 2W1ZA 5FQDC 5GZAA 3T3UA 2VU3A 2GS6A 5KMIA 2OO8X 2G2FA 3BHHA 3NW5A 4FUXA 5CQUA 5ANIA 4D28A 4YBJA 2VO0A 3D2KA 2E2BA 2HZ4A 3UE4A 4XOYA 3BEGA 3E5AA 3BKBA 3R6XA 2VTLA 4O0VA 4BDKA 4FOBA 5A54A 1ZYSA 3GGFA 4AW0A 3QRTA 5BVEA 4RVTA 2ZOQA 2E9VA 3CCNA 4BYIA 4U7ZA 3V5PA 5BYLA 3QD0A 3W2CA 2XK7A 2PPQA 2W4JA 1R1WA 4NM5A 4QP9A 3PIYA 2IO6A 4UY9A 2C6LA 4W4WA 3KXNA 1H25A 4UN0C 1JSVA 3OCBA 4U9AA 3DKOA 4PX6A 4ZZNA 4FBXA 2FUMA 3FZRA 3QFVA 5HD7A 4A9TA 3MBLA 2YIRA 3CTJA 4E7WA 4F70A 2VTPA 3LFQA 3D94A 4CRSA 4DA5A 4BI1A 1W7HA 3CSVA 2J2IB 3FWQA 4ALUA 3ORNA 3F3TA 5HESA 4NM0A 3QGWA 1J7UA 3TZ9A 4A9SA 1H28A 5CSXA 3VBTA 5T3QA 4X0MA 5CF8A 3OT3A 4WT6A 4QMSA 4QYYA 3RINA 3P4KA 3N4UA 4Y85A 5F9EA 4HYHA 4IJPA 2OG8A 3Q9YA 5F94A 1J91A 4NJDA 5L2QA 2X8EA 4RWLA 5HE0A 3ULIA 4MNEA 3E64A 3FLNC 3LCKA 4YC3A 1M17A 3MV5A 4AZWA 5LWMA 4L52A 4W9XA 4FV0A 4RBLA 1PXPA 4XG8A 4B9DA 3KA0A 4I92A 2UZWE 5DE2A 4YNOA 3UYTA 2XIYA 3KF7A 4HCTA 2F49A 4IE9A 3F9NA 4PTEA 2PZ5A 4FK3A 3F3ZA 3ZLWA 3R0TA 3P0MA 3R83A 2UW4A 2ITZA 5FBOA 2BDWA 3VN9A 4F0GA 4LUEA 4EJNA 3CP9A 4I6FA 4WD5A 2PVYA 3R7YA 2C0TA 4C4FA 4WUAA 5CSPA 2YCFA 4ZJJA 2IZUA 3NYVA 3DBQA 2CKQA 3UJGA 2YZLA 2LAVA 2WEVA 2FO0A 3D7TB 4Y5QA 4CFMA 5E91A 4AG8A 4PL3A 5EOLA 3TV4A 3BELA 3AD6A 3D83A 4I23A 2C69A 1JPAA 4ZMFA 4CTCA 4PQNA 5JSMA 3VS0A 4DF3A 2R0IA 4GRBA 3QD3A 3LCTA 4K9YA 4BDCA 4FICA 5M4UA 2AYPA 3ZMMA 2V7OA 3RM6A 3GQIA 3RCJA 4EK6A 3NCGA 3ODZX 4ANLA 4EH2A 4BDIA 3TZMA 5FLFA 5HCYA 5FEQA 4IVAA 5CEIA 3IOKA 5GINE 2CKOA 3OMVA 3VF9A 5K3YA 3CIKA 5H8BA 2XYNA 3C0HA 5A3XA 3PWYA 4CFWA 2OWBA 4FIFA 3HP2A 4FVRA 3DK3A 4MKCA 4ZEGA 1NT2A 4RZWA 4XG3A 3SXRA 5D12A 2G01A 4TW9A 3SW4A 3WZKA 4BDFA 3MY1A 3PPJA 5BMSA 3CQUA 5HE1A 4RX9A 1QMZA 3BPRA 3ACJA 2ONLA 1HOWA 4UBAA 2R3FA 3TT0A 3QF9A 4R3PA 5LQFA 3RBWA 2ITWA 1ZLTA 2PVJA 4TNBA 3KQ7A 5IMEA 4WIHA 3IQ7A 4FSNA 5FRIA 4JDJA 1DI8A 2JIVA 3BGQA 4FNZA 5AR4A 5AP7A 5CEPA 1H24A 3ZO4A 2C5YA 2I0VA 4GCJA 5IQBA 5IH4A 3QTIA 4FL2A 5IQCA 3F2NA 2XIKA 5I9XA 4I6QA 1G8AA 4RC4A 3VWAA 3HAMA 2XK6A 4II5A 3QD2B 3ELJA 3MJ1A 3FDNA 5A4EA 4PP9A 5IH5A 3ZSIA 3EN5A 4JBVA 1UU9A 3K5UA 4IMYA 4I5HA 1HCKA 3HZTA 4LUDA 4RWKA 2R3GA 4PDOA 4EOMA 4CKRA 3JXWA 5CX9A 3VUMA 2UW7A 4TYIA 3KRXA 4RLKA 3TTIA 4EOIA 3SXSA 4BBMA 5AEPA 2UW0A 4FZ7A 2R3MA 3L8PA 5FM3A 3QD4A 4BCOA 3OXZA 4AN9A 2WXVA 2B1PA 3Q9ZA 1P5EA 2BIYA 1QCFA 2Y6MA 3KRRA 3Q5ZA 4OT6A 4F9WA 1KE7A 4MF1A 4WHZA 1JSUA 2HY0A 5ANGA 3S0OA 3FPMA 2YIXA 4FKJA 5EDQA 1R3CA 4RQKA 4P2KA 3IOPA 3IW4A 5CWZA 3DXNA 5TO8A 2HOGA 2VTHA 2WEIA 3DJ6A 4XH6A 3TXOA 3UGCA 4ZIMA 5LVLA 3QUEA 4YPDA 5T6KA 3UIXA 1IA9A 4C38A 4E20A 4BZDA 4R6VA 4OT5A 1U5QA 2V55A 1JLUE 2XZSA 4RVMA 4MWIA 1BLXA 4R5YA 3RPVA 3ZC5A 1OUYA 4ALVA 3MVJA 4FC0A 4L46A 5M4FA 3IPHA 1OIYA 4C2WA 4TWOA 2EVAA 3ZXZA 3B2TA 5CU0A 3ORIA 2BILB 1UNLA 2UVYA 4RC3A 2R7IA 4TN6A 4BDHA 4FX3A 4LGDA 2R3KA 3KULA 5I0BA 4RJ5A 4BVUA 2XP2A 3ZO3A 3LXNA 4HVGA 4KRCA 5L2SA 5HU3A 4HJOA 4UXLA 3F82A 1H0VA 2B9JA 3OUNB 5LWNA 2V0DA 3WYXA 2VTRA 2J7TA 4IM0A 3KXMA 4YJUA 5T68A 4HPTE 4L68A 5HI2A 3DKGA 4C33A 5FUTA 1UKIA 2VWXA 3OCGA 3LAUA 3VS1A 2IZRA 4K11A 5EQYA 2WIPA 2XIXA 3QZIA 3GQLA 4CV8A 4EOKA 5JRQA 3LIJA 5AA8A 1VYZA 4HYUA 2IW6A 1BL7A 4DEBA 4E5BA 4CMTA 4PDYA 3R63A 4EBWA 3LFCA 2B54A 3TV6A 2WB8A 2Z7QA 3E8EA 1FVVA 4M15A 2GFCA 3H9RA 4MBLA 3TUDA 2QOKA 3JVSA 4UALA 4YTIA 4CV9A 3BQRA 3BZ3A 4PDPA 5CI6A 3EZVA 3PSCA 2HZNA 4QMYA 1FQ1B 3UIMA 4EH4A 4LG4A 5LARA 5IG1A 2QD9A 4OTWA 1Q8TA 4U45A 3R8UA 3DDQA 5EI2A 3L9NA 4RMZA 5DOSA 1O6YA 1UV5A 5K5XA 5DH3A 2QU6A 4C36A 2PMOX 4M12A 5K0XA 1Y57A 4MD7E 4RIOA 1Y91A 5A4LA 3SLSA 3UVPA 5CXHA 3QALE 4C4JA 3EN9A 4ERKA 3OUKA 1PW2A 1STCE 4D55A 2PWLA 2ZMDA 3FLYA 2W99B 1TQIA 4EWQA 3KXGA 5KMMA 3F3VA 2O2UA 3N51A 4ZSJA 1DAWA 3U6HA 3LMIA 3HRBA 4FKGA 3CE3A 3PA3A 5D10A 2NPQA 5DMZA 2C0OA 3FJQE 2QKRA 1J3HA 5J1WA 1W82A 3UG2A 3VIDA 3QXPA 2QOCA 1WBNA 4DBNA 5AADA 4IXPA 3W2OA 5E4HA 4ZY5A 4RIYB 4RC2A 2J0JA 3MY5A 4NU1A
chains in the Genus database with same CATH superfamily
3R71A 1U54A 5I9UA 1ATPE 3OROA 5AV3A 4AW2A 3ETAA 1YOJA 4D5KA 2I0HA 3Q60A 4C37A 5CEKA 4JG6A 1XJDA 5TR6A 1M7QA 2UZBA 3GFWA 4QYFA 5J87A 4XG9A 4UMTA 4FG8A 4AWIA 2W1HA 1TQPA 2XJ1A 3MIYA 4BCIA 4QDVA 3HL7A 3OCSA 1BUHA 3OVVA 4J71A 1XHAA 5CYIA 4M69A 4DGLC 4UX9A 3MFUA 4IFCA 2I7QA 2BFXA 3AT4A 4FODA 2EXCX 4R8QA 4EC8A 4F63A 5FTOA 1W98A 5KKRC 3E8DA 4KABA 4LL0A 4L43A 4MXCA 3MSSA 2QO7A 2PHKA 5TF9A 3F2AA 2F2UA 2F2CB 4J98A 4JBOA 1E1VA 3GCQA 4CVAA 3CS9A 3BYMA 1XR1A 2OFVA 5FXRA 1TQMA 5LCKA 2ZM4A 3Q2MA 3BYOA 5M56A 2A27A 4IEBA 1OL2A 3K3IA 4O7TA 4AOTA 5E8YA 2O0UA 4MF0A 3O0GA 3WE8A 3D5UA 2GHGA 3C5UA 3WARA 4YBKA 1OKVA 3B8QA 1O6KA 1ZXEA 5L6PA 5F4NA 5KKRB 3HUCA 4QTDA 4KD1A 5LMBA 1VZOA 4G16A 5JEBA 4EOJA 4ANBA 1RJBA 1WBOA 1YXTA 3RVGA 4D2WA 1Q41A 3MS9A 3DXPA 4I24A 4EHZA 2EUFB 4W4VA 4WG4A 5IA4A 2QOBA 4YO6A 2PTKA 1IR3A 4C57A 2OXDA 2F7EE 2VTTA 5HVYA 3DS6A 5M08A 4UMPA 3T8OA 5AX9A 3NS9A 4FT7A 2VO3A 2UW3A 4AT3A 4D1SA 4GJ2A 3ZH8A 3GC9A 4H1MA 4KINA 4OTRA 3FYJX 3U87A 5HBEA 2ZB1A 3EN6A 2O8YA 4IANA 4X3FA 4IHPA 5ANKA 5ITAA 2C4GA 3FL4A 4RFMA 4BCPA 4FGRA 3CPBA 2BRNA 5FGKA 1Y8GA 5H3QA 2QHMA 3E88A 4UWCA 2BKKA 2C3KA 4WNMA 3C5IA 3MB7A 3NNWA 1PMUA 3CTHA 5IEVA 4DHZA 2GS2A 3DNDA 5BVOA 4EQCA 1J7IA 2A2AA 3QAME 4MTAA 5HCZA 3AMBA 5K0KA 3ERKA 1G8JA 5EM8A 4HVHA 4HGSA 1NY3A 3QQHA 4XRJA 3V8TA 3PLAE 3BLQA 2W17A 1DS5A 3F5XA 3QZHA 4NW5A 2JFMA 3F61A 3O23A 5KMNA 3UBDA 2CGWA 4DC2A 1H26A 1Z57A 2WIHA 4QMWA 5JK3A 2QOIA 4M13A 5J1VA 4R78A 3OT8A 5AV0A 4A9RA 5CU2A 3ZDIA 4EHEA 2YWPA 3R02A 4S31A 3VONA 3TWJA 2IZTA 3PYYA 4JAJA 5IA2A 4NCTC 4DFBA 4K18A 1CKJA 4FIJA 2Z7LA 1UU3A 3KK8A 5F95A 5A46A 1UKHA 3DGKA 4BYJA 3PUFC 3R8LA 3D15A 3MIAA 4GIIA 3BLRA 3ORMA 5BMMA 3D4QA 4QTCA 3RI1A 4GW8A 2YM8A 3DK7A 4LRMA 2XBAA 3HV4A 4ZSLA 3SXFA 2I0YA 4CYJA 2WFYA 5M51A 1FGKA 3ULZA 4AXAA 2VTOA 1GAGA 2PY3A 3IONA 4NEUA 2ACXA 2XCHA 4QTAA 2W5BA 2QONA 5BYZA 3O96A 5AUTA 1KUTA 2WMRA 2F4JA 3MH1A 2VGOA 3A8XA 5LVMA 3ZLSA 3VQUA 2HCKA 5IA5A 3ZCLA 1XBAA 4QQTA 5IDPA 2WNTA 4TNDA 1DAYA 3IW7A 3RCDA 3GC8A 1OL1A 4JXFA 1WBSA 4FKQA 3QLFA 5DG5A 5JMSA 3QYZA 2VO7A 3DJ5A 2WTWA 1XH8A 4I94A 3QWKA 5AP1A 1ZZLA 3AKKA 3G15A 4YZNA 3F2RA 3KGAA 2C0IA 3GU4A 3PDTA 4NWMA 3VAPA 4FSTA 4AU8A 3DCVA 4BI0A 3ATTA 4XG2A 4TYGA 4X21A 2VTMA 4IAKA 3PXYA 5HG7A 4HYIA 2VWZA 5IQFA 5DA3A 5I5ZA 3M2WA 1A06A 1LUFA 4FEQA 5LVPA 4YSMA 4O2ZA 4F99A 2XKDA 5IMXA 3DTCA 2WTKC 2G1TA 4IBMA 4BDGA 4EKLA 3FMEA 5CAUA 3PVBA 2XNBA 4NW6A 3PP0A 4MYGA 2JDOA 3P79A 4GS6A 4KIQA 4XG6A 4ZTSA 4FIHA 5AUZA 4JRNA 3MA6A 4D2RA 2C6EA 3U6IA 3QGYA 2JDRA 5C8MA 1K2PA 4D2VA 4FTQA 4D1ZA 4EOOA 1H1RA 1Q8YA 1PMEA 3N9XA 4QMPA 1OM1A 4UZHA 4N70A 4AZSA 3BU5A 4FKIA 2IG7A 2YAKA 4CGAA 3CTQA 4K1BA 3Q4ZA 3AXWA 3CJFA 2YM5A 3LOKA 4G3DA 4E6CA 1IA8A 2WAJA 3RK7A 4C3FA 4DFLA 4J8MA 4X6QC 2GHMA 3OBJA 4QRCA 4DEIA 4O7NA 5KUPA 5C4KA 4FTJA 4U44A 5LOHA 4CCUA 3FEGA 2Y4IB 4KAOA 4D4SA 3NW7A 5KMKA 3R01A 4F9CA 2V62A 3DT1A 3ENMA 3GEQA 4FZ6A 3HP5A 4FTOA 4GFMA 2J5EA 4GYGA 3UDZA 1ZYDA 2OJIA 4YURA 5EQEA 4OAVB 3R7GA 4RPVA 3Q3BA 3G6HA 4GH2A 4BCFA 4YZCA 1OB3A 3NYNA 4FTUA 3EQBA 3BHYA 1NVSA 1U46A 5KZIA 3WF8A 2X1NA 4D5HA 3NAYA 4QMNA 3V8WA 3AQVA 2QLQA 2YIWA 1KWPA 3GCUA 2BZHB 2YDKA 3O8PA 3QRJA 3FSFA 4J96A 4OBOA 1Q24A 4YLJA 1PRYA 4AOIA 4DHFA 3I7CA 3W2QA 3FMDA 1APME 3DB6A 2E9NA 4LMUA 3MESA 2I40A 4XS2A 3FZSA 4RIWA 3WZDA 3PXRA 4BHNA 5BV3A 1YXUA 4MXZA 4C58A 1LP4A 3OWPA 5TE0A 4G1WA 2XIZA 4F7JA 2ITVA 2WMWA 1FBNA 4ITJA 1GZ8A 2XF0A 3RALA 3WE4A 5B2KA 2EU9A 2PMLX 3K2LA 4NTSA 3EQPA 5GNKA 5KMOA 3KN6A 3EQGA 3F3UA 2W1IA 4G9CA 4KB8A 4P7EA 4XP2A 5FWKK 4EL9A 2ETKA 1Q8ZA 3QA8A 3T9IA 4AZEA 2XKEA 5HZNA 3IO7A 1PXKA 4IB5A 4EONA 4MWHA 3E3BX 4LDTA 2GTNA 3UOLA 2DS1A 1PJKA 4PNKA 4AAYA 2X7OA 5IEXA 3LFAA 3PUPA 3QZGA 4NK9A 3VUGA 1YXSA 2HK5A 3O17A 4EZ7A 3CKWA 1Q8UA 4S30A 4LFIA 3D7ZA 2QOLA 2UW5A 4ZLYA 1WCCA 4RLLA 3QHWA 2CN8A 3PVWA 4MAOA 3TIYA 3HV7A 2NP8A 3HLLA 2WQEA 4V0GB 3ET7A 5E1EA 5FTGA 1M2PA 4ZSGA 4OGRA 2FYSA 5BVNA 3IDBA 4FV1A 3EMGA 2A0CX 4KIKA 1E9HA 4M14A 5IKWA 4F64A 2WQNA 3R73A 3A8WA 3TI1A 3W16A 4CKJA 1OIQA 4WUNA 3DZQA 2XB7A 3GC7A 4WO5A 4QP4A 4GV1A 2BDJA 4MD9E 2W9FB 2XKCA 5HHWA 3C0GA 3LFEA 4MXAA 3EIDA 3BL9A 2YCRA 3MFSA 2F7ZE 1XBCA 4J95A 4ZOGA 4ZS0A 3GNIB 5AM6A 1XKKA 4DTBA 4EZ3A 5IQIA 1VR2A 1YWRA 2PE1A 2WELA 3FMHA 1ZOGA 5BX0A 4YLKA 2PVNA 3Q5IA 4TYJA 4L7FA 3SGCA 3PPKA 4LGHA 4HVIA 4BGGA 2B9IA 4WG3A 4BCGA 2GNGA 4U81A 4F7LA 3FXWA 5CT0A 4FEWA 4IJ9A 2HY81 3TNPC 3OS3A 4WKQA 2VUWA 2CCIA 3ALOA 2Z7RA 4G3EA 2GS7A 5E9EA 1JKKA 3FMLA 2YITA 1XH6A 1G3NA 5EHOA 3ZS5A 5AAGA 3DNEA 4F6UA 3BE9A 3HGKA 3R2BA 2W7XA 4YJNA 5D41A 1JKTA 3FI8A 3RK5A 2Z8CA 1Y8YA 2XRWA 4I22A 4NM3A 3HA6A 3AC2A 3IW5A 3A7GA 4DFZE 4Q9ZA 4ACDA 1AGWA 1BI7A 3A60A 3UQGA 3JVRA 2CN5A 3KRJA 3I6UA 4DE4A 5I3OA 3BU6A 4TYHB 4YLLA 5EHLA 2CGUA 4QQCA 3TNQB 3R9RA 4Q5EA 1GIHA 4G5JA 5EM7A 2V7AA 3R22A 3VW8A 5D9HA 3UZPA 4O6EA 4YTFA 3A2CA 3IECA 4XJ0A 2GHLA 2BRHA 3QKLA 3QRKA 3KRLA 2YIQA 1GZKA 2CNQA 3RHXA 4YHTA 5IQDA 3TUBA 2HXLA 4LV5A 4S32A 3GENA 3V6RA 4OTDA 2VTQA 3CQEA 4PPCA 2E9PA 5CU3A 4KKGA 3AD5A 4IW0A 2UVZA 5CVHA 5KZ0A 4ACMA 2HENA 4E6DA 2NNWB 3BV2A 1SZMA 1ZAOA 2W1DA 3W2PA 1OBGA 3GC0A 1ZMVA 5EW9A 3V5TA 3DBFA 2X39A 2QOHA 3JS2A 1M2RA 1P4OA 3E92A 1JQHA 3UZRA 2OGVA 2CMWA 4BWPA 3QUDA 3QZFA 4J97A 5CU4A 3VBQA 3NFGB 5EDRA 4IZYA 3TZ8A 5HIEA 2BZIB 2YISA 1Z9XA 4PDSA 4ASEA 2E9OA 3P7AA 5IF1A 2XK9A 3G9LX 3EFLA 3UPZA 5E1SA 1A9UA 3GI3A 4Y72A 5C9CA 5HTCA 4QT1A 4R1YA 4RWJA 3BCEA 2PL0A 3VO3A 4C0TA 4FIIA 5FDXA 2J0KA 4L67A 3EFKA 4A4OA 3P7CA 4BTKA 5IQHA 4FTKA 4FTRA 2NRYA 4PPBA 5CALA 3NUYA 4PTCA 4WG5A 3HV3A 5HVKA 4H1JA 3NUUA 4FNWA 2OH4A 4H05A 2OI4X 4I0SA 4M67A 1GOLA 5C03A 4KIOA 4PMPA 2JKQA 1GZNA 4Z9LA 3QCQA 3M11A 3BIZA 3MI9A 3PXZA 3ODYX 4XV1A 3IW6A 5EFQA 3O71A 4P5QA 2R3QA 1YWNA 2X9FA 3ZEWA 1CSNA 1YXXA 4A4XA 4B8LA 4B8MA 3SOAA 1OITA 4B4LA 3ORPA 4GG7A 4CQEA 5J9ZA 4ACGA 4FKUA 4A07A 2XALA 3W0OA 3H3CA 4B0GA 2XAOA 4F1TA 5DLSA 1OGUA 4QPAA 4F9YA 4QTBA 4C3RA 4OTPA 3RZFA 4AS0A 2XMYA 2X8IA 5H8EA 3LE6A 3QC4A 4M68A 5E8SA 3CY3A 5E8WA 1W83A 2WZJA 3QTZA 5AWMA 3BGZA 2X7GA 3PZEA 3PJ1A 4FV5A 2OZAA 4PWNA 3EQDA 5FM2A 3FPQA 3TNWA 2UZEA 3QQKA 2OK1A 3O5AA 4FSQA 1IAJA 4MNEB 3Q96A 4FG7A 3KXHA 3TKHA 4M7IA 5AP0A 5TT7A 4O38A 2YLFA 3BX5A 3VUIA 4AGWA 4BF2A 2DQ7X 1OVEA 4IAZA 3L8XA 3VBVA 3OY1A 2GDOA 2ERKA 3IDCA 4D4YA 5CF5A 3PZHA 3NRMA 1WBVA 2QR7A 3NZ0A 1O9UA 3O8UA 4FT5A 5IUHA 2QVSE 3NIZA 2C30A 3W8QA 3C4FA 1PMNA 4ZZOA 5AUUA 4DFUA 2QHNA 4E4MA 5M09A 3CR0A 2CGVA 2C6IA 5LVOA 4OBPA 3C4WA 4U3YA 5DEYA 4UXQA 3MTFA 4KWPA 4F0FA 3MY0A 2BALA 4O0SA 2XBJA 4O4CA 2CNUA 2BPMA 2OIBA 2ZM3A 3I60A 5EK7A 2ONLC 4EKKA 5AA9A 4R3CA 1YW2A 2OFUA 4G3FA 3UO4A 4JR7A 2Z02A 4CZUA 2R3IA 1M7NA 3NUXA 3TL8A 3JYAA 1YI3A 4IWDA 2X7FA 4R3RA 1YDSE 2OSCA 2X4FA 4C8BA 3AD4A 3MPTA 4PP7A 2W4KA 5J79A 5JQ5A 3JY0A 4QP3A 2OZOA 3LM5A 4ALWA 4AZTA 2SRCA 4CFFA 1WVWA 4EC9A 1PXIA 1GIJA 2W1EA 4CKIA 5JKGA 4NYEA 1YXVA 1ZMWA 3EWHA 4K8AA 4MVFA 3ZLXA 4BTFA 1XMLA 5A9UA 4WBOA 1IRKA 3FC2A 3G9NA 4Q5HA 2R3PA 3LMGA 4I5MA 5DT3A 2ERZE 3QKKA 3H0ZA 2W96B 4EK3A 3TUCA 3Q9WA 1FGIA 1ZYJA 1GNGA 3KB7A 4GK3A 4BFMA 4O7YA 2C3IB 4P4CA 3ZUTA 5GIOE 4GFOA 3ZYAA 4DLJA 3RPYA 5CAQA 4BN1A 4GVJA 2YA9A 5FEDA 3A99A 2AQXA 3EHAA 3UP2A 1CKIA 2OIDA 4YR8A 4LMNA 2VGPA 4V04A 3JUHA 1NW1A 4XLIA 4YHFA 2C3JA 3BV3A 1Q4LA 1Q8WA 3SG8A 1BKXA 2WMSA 3RWPA 1ZRZA 3KIOC 4FTLA 1AD5A 1ZMUA 4YJOA 2CKEA 3HKOA 5JGBA 1VYWA 2BFYA 1H1SA 4NFMA 1YHSA 2W1FA 2Q83A 3OWJA 3FLWA 4XBRA 1BI8A 1IG1A 2ITPA 4CCBA 4YPSA 5HNGA 4GVAA 4LL5A 5IZFA 2HWOA 3DLZA 4U97A 3ZRKA 3GOKA 2J51A 2OBJA 2KULA 4TKSA 4BB4A 4CYIA 4ANNA 2GSFA 4UYAA 2VTNA 4OUCA 4U8ZA 1SVEA 5DFPA 5HG9A 1REKA 3MH0A 5ACBC 3FI3A 4RVKA 4XV9A 4HNFA 3MH3A 4NIFA 4KKHA 2VWBA 3F5GA 3WZEA 3GU8A 2BR1A 3KVWA 4X6RA 5J95A 3E7OA 4PMMA 2ZV7A 4ANSA 2XNNA 5HIDA 4FSYA 2G9XA 3R7IA 5B2MA 3BLHA 1OPKA 2R5TA 4D9TA 4BDEA 5IH6A 3UNKA 4CT2A 4JR3A 3C50A 3OOMA 4XOZA 2YLEA 4RQVA 1K3AA 3OC1A 5HBHA 1OPJA 2ZVAA 3NNVA 3WOWA 1Q3DA 2C6TA 5CSHA 3HAVA 4EEVA 4QMQA 3ZM4A 2RF9A 4EQUA 2ZDTA 4JDKA 2ITQA 4DGOA 3TM0A 2JFLA 3Q4CA 3COIA 3Q53A 2GU8A 4BKYA 3VUKA 2XNMA 4ANQA 4RA5A 2P33A 4FOCA 1H0WA 4YHJA 4EOQA 2VNYA 4G9RA 3I4BA 3OG7A 4JS8A 2RFDA 3CPCA 5CZIA 3O7LD 2PZYA 3D5XA 5AV4A 1M14A 4UMUA 4AN2A 1JNKA 1Q62A 2FB8A 2ZDUA 4QYHA 3VS5A 2P2IA 3UOHA 4MX9A 5CEMA 3CC6A 1OL6A 3QXOA 4JBPA 3KULB 3P5JC 4NFNA 3LPBA 1MP8A 4E6QA 5TOZA 3EQHA 4KUJA 4O83A 4OTHA 4RT7A 2J4ZA 1CMKE 4HCVA 4G3CA 4WOVA 3AKLA 1Q99A 5IPJA 3DFAA 4DBXA 3LCDA 3R8ZA 4S33A 3W55A 4QP8A 3LZBA 5HBJA 5L2WA 5AIKA 4GT5A 4AXFA 3DY7A 4U42A 4FV3A 4MEDA 3PIXA 5DR9A 3U6JA 1IEPA 1SNXA 2X0GA 4L3JA 5CU6A 2OF2A 4L6QA 4Y73A 3EKNA 3G6GA 2B53A 4IWQA 4MBIA 2QG5A 3QQJA 4E4LA 5HICA 1QPJA 3R7VA 4TXCA 2QODA 4X2JA 5CSVA 2NRUA 3ATSA 3L9MA 3G51A 4OTIA 4X2NA 4DH5A 1H1WA 3POZA 1JVPP 3A61A 4ASDA 3R30A 3IDPA 2JAMA 2GNIA 4R7IA 4M66A 4ZK5A 4WRSA 5GZ8A 5BVDA 3MDYA 3GOPA 5EKNA 1FPUA 3AGMA 2OXYA 3S00A 3BBWA 3POOA 2WHBA 3ORXA 3OWLA 4W9WA 2OJJA 1OGYA 4YZBA 1G8SA 2Y4PA 2F57A 2UZLA 3JR1A 4YZ9A 4XYFA 3PJCA 3RZBA 3KCFA 1B6CB 1WVXA 3UP7A 4AA4A 5TKDA 4S2ZA 1SMHA 5BVWA 2A1AB 3ZDUA 5FP6A 4NH1A 1QL6A 4AGUA 4EJ7A 4GKHA 3SQQA 5CTPA 3R04A 4FGBA 4F0IA 3SA0A 2EXEA 3LFFA 5IQGA 4K6ZA 3B2WA 4FTIA 3B8RA 3F5PA 4I21A 4G34A 4WA9A 5A4CA 4MCVA 2YWVA 4MHAA 3H10A 4EZ5A 3MA3A 4OTQA 3SHEA 1X8BA 2ITOA 4JBQA 4DHJA 3EL7A 2DUVA 4HVDA 3S95A 3OFMA 3PXFA 4CG8A 3OXIA 5HO7A 2IVTA 4OTFA 4BCNA 2YAAA 3GU5A 4O7LA 2R7BA 5L8KA 2J9MA 4AOJA 2WTVA 2IN6A 3AMAA 2X2MA 3QA0A 5CLPA 2IW8A 3WI6A 1R78A 4AA5A 4OR5A 4OBQA 3R9OA 3KN5A 2H6DA 4TTHB 2VWIA 1U54B 5AUYA 4IADA 5AX3A 4CFVA 5LMKA 4YC8A 3R2YA 1LEZA 4QYEA 3FUPA 3BI6A 4FKSA 5D11A 2XK4A 4ERWA 2VO6A 3PSDA 3GXLA 5DRBA 4C4GA 4EORA 5AAEA 5HX6A 3PP1A 5CZHA 3RHKA 2GNHA 5E8XA 4KBAA 5AUVA 2WMQA 3RWQA 3GB2A 4CT1A 3LFSA 3COHA 4DFXE 4USEA 3UOJA 3LQ8A 3W32A 4DG0E 4FEXA 3A62A 3NUSA 4M69B 4YP8A 4I6HA 4RSSA 4XX9A 3TACA 4BBFA 4CZTA 5C4LA 5C26A 3ORKA 4GG5A 5JGDA 1PKGA 2AC5A 2RL5A 5GJGA 3PPZA 3PTGA 4JT3A 3NUAA 2Y0AA 4IAYA 4AGCA 4C35A 5L2TA 3UOKA 3VRYA 5JZJA 3TMOA 2IVUA 2ZFYA 3FAAA 2A19B 3BLAA 4NTTA 2GQSA 3NVKI 1WBWA 2OJFE 4LGGA 3SVVA 2EWAA 1YDRE 3TTJA 2PUPA 2JIIA 3FSKA 5GZ9A 4ZJIA 4ZSAA 4LQMA 3KREA 1G5SA 5EM5A 2ITTA 5BVKA 2GMXA 4BRXA 5JGAA 2P3GX 1JWHA 2YHVA 3OP5A 5DGZA 3R7OA 3V6SA 1PXJA 2WTCA 2CJMA 3IGOA 3R28A 5CNOA 3ZFMA 3NNUA 4IX6A 3D0EA 4AF3A 4O7ZA 4DG3E 5EI8A 2R3OA 3OEFX 4X3FC 5EYKA 4F7SA 2ITUA 4DGGA 2XJ2A 3HV6A 4LM5A 5LVNA 4CLIA 1OKWA 4BKZA 4E73A 4KA3A 4L3PA 4BCKA 2YJSA 5AUXA 5M57A 4FV2A 1XH9A 4H36A 5AP4A 3BWJA 3ROYA 5H8GA 4KBCA 4PMSA 2HAKA 4FT9A 1H01A 3FLSA 4M0ZA 3UMXA 5M4IA 5IQEA 2WU6A 5ANJA 4N6ZA 2EB2A 2ZAZA 3GCVA 4JI9A 3VJOA 5BNJA 4CLJA 4AQCA 4FEUA 2PMIA 5G6VA 3VNTA 5CF6A 4FUYA 4IH8A 3BHUA 2BTRA 5DWRA 3N4VA 2XEZA 4O96A 2VAGA 5AAFA 3RKBA 4EH9A 4KNBA 4O0TA 1Y6BA 2GNLA 4DDGA 3P78A 4KKEA 3MB6A 4BR3A 4O4EA 3SOCA 2R3HA 4G17A 3PA4A 4XV3A 2JGZA 4X3FB 3HDNA 4YJRA 3FZOA 4AA0A 2FA2A 3GCPA 2DYLA 3QRIA 5EI6A 3RK9A 1XO2B 3G2FA 3W33A 2FSTX 2P55A 2WMAA 4I1ZA 4RJ7A 1KSWA 3OY3A 3WF5A 4FVPA 2HW6A 3AT3A 2CLQA 2RKUA 3DPKA 4TPTA 4A4LA 3Q4TA 4FYNA 4IB3A 4TT7A 3RAWA 3W8LA 4DTAA 2Q0BA 3L9LA 5I9YA 2WOUA 4HGLA 1OECA 1SVHA 4E4NA 2YDJA 3BGPA 3KK9A 1SYKA 2YFXA 5HG8A 3R9DA 3ZUUA 4UV0A 4IACA 3VS7A 2H9VA 4ACHA 2R3JA 1QPDA 3PY3A 4JDHA 2PVRA 4O1OA 5FBNC 4NKSA 5H2UA 3ROCA 1LEWA 4YMJA 4O4FA 4OTGA 4GEOA 3IKAA 1UWHA 4KIPA 5J8IA 3OD6X 5EYDA 2QOOA 4M84A 3UC3A 4DEGA 3UTOA 1YDTE 3GU7A 2BRBA 4CXAA 1FVTA 3DOGA 1KE8A 3Q6WA 4R7BA 4W4XA 3VS3A 4FIGA 5ANDA 4AFJA 3T3VA 1H00A 2CPKE 3I6WA 3REPA 3LJ2A 3Q4UA 4BZOA 4CRLA 4RWIA 4O86A 4DAWA 2ZJWA 1PYEA 4JG7A 2J0IA 3RPRA 3HX4A 4BCHA 2PVHA 3NX8A 4FV8A 2Y4IC 3OWKA 3S4QA 4ZTHA 5FG8A 4IQ6A 2X2KA 3KCKA 4KS7A 3FC1X 5IDNA 3BYUA 3F5UA 4FTMA 5AMNA 2C6MA 2RIOA 2JIUA 3OXTA 3IS5A 2UW6A 5M4CA 3UNZA 1SM2A 3S1HA 5M06A 3SDJA 3KXZA 4DLIA 3FI2A 4FV6A 2I6LA 2C5XA 3SX9A 1PY5A 3EYHA 1HCLA 1RE8A 2VTIA 4XNEA 4L3LA 4F4PA 5CENA 2PE2A 3TEIA 3O50A 1OZ1A 3L1SA 3AMYA 4F1OA 2ZV8A 2XRUA 3KU2A 3HV5A 4QMMA 5ANOA 4AXDA 4LYNA 4PTGA 3Q2JA 4CQGA 5JZNA 2V22A 4FEVA 3QU0A 2FGIA 4QNYA 2IW9A 3SC1A 3WIKA 1Q3WA 2HZIA 4FV4A 4RX8A 5C8NA 3QCSA 3D5VA 4S34A 4ZLOA 1XQZA 1OL7A 3L9PA 3DKCA 3NUNA 5ETAA 4BDAA 4GKIA 3SW7A 3AC4A 3KFAA 4FL3A 1ZWSA 2WOTA 2BROA 4LRJA 3KXXA 5EW8A 4EHGA 2WTDA 4CZYB 4I4FA 5EQPA 3PG1A 4MBJA 5CVGA 2VZ6A 3ID6C 2REIA 3LXKA 2BRMA 2HYYA 4L8MA 1I09A 4PL5A 5JRSA 5FXQA 4JAIA 2J6MA 4QTEA 3NEWA 4F6SA 3OZ6A 4GT4A 1SNUA 3LXLA 5HE2A 3TDWA 5DRDA 5D7VA 3IW8A 4HPUE 3KF4A 3A4OX 3ZRMA 5B0XA 3FLZA 2O5KA 3K3JA 4C4HA 2Y8OA 3W2RA 1YHWA 2XNEA 3NUPA 4FT3A 2X8DA 3PE2A 3UNJA 4Z7HA 4BI2A 2IVVA 3PY0A 4U43A 4UZDA 5HO6A 3A7IA 5JN2A 3HMOA 4DGNA 3SRVA 3MFRA 4RIXB 2XYUA 3QQUA 4ZJVA 4AN3A 4E26A 1GZOA 5KMLA 5AIRA 3OTVA 3I7BA 2ETRA 2ETMA 2X4ZA 3BE2A 5LXMA 4F9BA 4IX5A 3UMWA 2J0LA 3MVHA 3R9NA 4FZAB 5C8KA 5B7VA 2YM4A 5CF4A 1EH4A 3QLGA 3DJ7A 1U59A 2Y6OA 2YERA 3GT8A 4J1RA 2Z7SA 1YWVA 3R1SA 2CLXA 3EH9A 3OW3A 2XKFA 4PUZA 4BL1A 5IUIA 4Z3VA 3CQWA 2WMTA 3CY2A 3IK3A 3ORLA 2JDSA 1WFCA 3TNHA 2BDFA 3ZBFA 2PVKA 3HMNA 4AT5A 3QUPA 4JDIA 2BTSA 5K4IA 3LFNA 2JEDA 3RP9A 1S9IA 2XNPA 4RIWB 3E3PA 3LHJA 4CTBA 4YO4A 2XK3A 4ORKA 2CSNA 3G0FA 4QMZA 1W84A 3KKVA 2QCSA 2UZNA 4QP6A 3VBWA 1PF8A 4O84A 1XH4A 4BHZA 1F3MC 4L7SA 2OJGA 4ANMA 4ZZMA 3DBDA 4J7BA 5EKOA 3UG1A 5E92A 5M44A 1UWJA 2WGJA 3KMUA 3FMNA 5JFWA 4JRVA 4DITA 3S3IA 4A06A 2OH0E 2W9ZB 3A7FA 1JSTA 4IC7A 4ENYA 5L8LA 2PVLA 4U80A 4D2TA 2CGXA 5J9YA 4D58A 3FE3A 2QKWB 2P2HA 2W1GA 1M52A 3COMA 3EN4A 3FMKA 3CKXA 3PJ2A 1VJYA 5HG5A 5AR3A 3THBA 3GBZA 4QPMA 5A4QA 3V5JA 5I3RA 1ZOHA 2VWUA 4CFXA 4G6OA 5CVFA 4CNHA 1W8CA 4O22A 5HOAA 3RPSA 3FZTA 2VX3A 4O81A 1H27A 4YTHA 1G8KA 4DH8A 4GUEA 3UIBA 1JAMA 3VC4A 3WZJA 2XAMA 4UMRA 3H0YA 4BTMA 1CKPA 3DAKA 2VV9A 2WMXA 3NIEA 4KIKB 4U0IA 5CANA 1LPUA 3RMFA 4KSQA 3GP0A 2VWVA 4E1ZA 3PJ3A 3Q32A 2CCHA 1YVJA 3LFBA 3WILA 2AC3A