4CKRA

Crystal structure of the human ddr1 kinase domain in complex with ddr1-in-1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
314
structure length
295
Chain Sequence
MPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Discovery of a Potent and Selective Ddr1 Receptor Tyrosine Kinase Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 295
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ckrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ckrA01
2OGVA 1JOWB 2ITZA 5AV3A 4G3FA 4YHTA 5A4QA 3FL5A 3UNZA 3FKNA 3UIUA 2E9PA 4ANQA 3BYSA 3FMLA 4ORKA 4NKSA 3KC3A 3TWJA 3P0MA 4A4OA 3GI3A 4QTBA 5J5SA 3Q6WA 2CKEA 4RIOA 2QR7A 4IAZA 1UNGA 4DEGA 3C5IA 1TVOA 5BPYA 3KN5A 5EHOA 3WZDA 2IW8A 5LWMA 2XMYA 4ANSA 1GZKA 3G9NA 2YCSA 4KSPA 4XV2A 1CDKA 4Z7GA 3HKOA 3DLSA 4ENXA 4I0TA 4RVTA 4M15A 3RNYA 2YACA 3HL7A 3OY1A 4WG5A 5EW9A 2RL5A 3I0OA 3MBLA 2CN5A 2W5HA 2VWBA 3AQVA 2YAAA 4KUJA 4RGJA 5M06A 2OW3A 4NT4A 4GYGA 1Q41A 2PTKA 3FMMA 4YZBA 3MV5A 5D41A 2BIKB 3SD0A 2GSFA 2X2KA 5LMAA 2P33A 4O22A 1ZYDA 3RPYA 1FGKA 3P7AA 3JR1A 1OKZA 4ZZMA 5DMZA 2YZAA 1QCFA 2QONA 1B38A 2J0JA 4RC2A 3LQ8A 1K3AA 3ORZA 2QHNA 3QQKA 4HGEA 5KHXA 2YZLA 4HZSA 1QPJA 2W96B 1V0PA 1NXKA 3LFNA 4LUEA 3MTLA 4FYOA 4O0SA 5BMMA 3RZBA 4FVRA 2WEIA 4BIEA 4I0SA 5T3QA 3TG1A 2A1AB 5M53A 4YBJA 3SVVA 2R3GA 3U8WA 4J1RA 4GJ3A 1S9JA 3HMIA 2C6DA 1T45A 4RIXA 4XOYA 3UTOA 4ARKA 4EHEA 3FLZA 5A4CA 4GW8A 2O64A 4DBXA 4Y8DA 2FSTX 1V0BA 2PVJA 2PZYA 3VAPA 3W10A 2BDWA 4IFCA 5CEPA 5JH6A 5EH0A 4I3ZA 4ZJIA 2VAGA 3FPMA 4LGHA 1R1WA 2ZM3A 4ZZOA 2WMWA 2Y7JA 3EN7A 5HQ0A 3ZHPC 2PULA 2JIIA 3GGFA 4GMYA 3LXLA 3F88A 5K4IA 4U42A 3NUSA 4R5YA 2JAVA 1V1KA 2R3RA 3FZTA 5LMKC 4QP8A 3CTHA 4XV3A 2F4JA 2RFEA 2V0DA 3DDQA 3HYHA 4ACGA 4KS7A 4RLKA 4QQ5A 3FXWA 3PIYA 3UC4A 3QUPA 3M42A 5HESA 4YU2A 2OSCA 4HNFA 4ZTNA 4DGGA 4D1SA 3HVCA 3Q4TA 4N6ZA 3HV3A 4QMMA 3V5LA 4F9WA 1PMNA 3OROA 3W18A 2QR8A 3C0HA 1PRYA 2YM3A 4DTAA 1H0VA 3U6IA 5AP1A 4UWYA 3TDWA 3MGYA 4D1XA 2G2IA 5IUGA 4GSBA 4F63A 2X9FA 5CF8A 2P3GX 3OFMA 2WU6A 3REPA 3WF8A 1O6YA 3D7ZA 3UZRA 2XZSA 2BROA 5LVLA 1BL6A 3DNDA 3FY0A 3GCSA 2F7EE 5DE2A 3G6HA 3PSDA 3LPBA 2QCSA 2QOIA 3R2BA 3E3BX 4Y46A 4AT4A 5CU0A 2XNPA 4O1PA 2WMBA 5EW3A 4QP4A 3TNPC 3D2KA 3QQLA 5DT4A 4H1JA 2VTTA 4AX8A 1MRYA 1FGIA 4V0GA 2CGUA 5DIAA 5GZ9A 4QMQA 3F82A 1ZLTA 2JIVA 2ZV9A 5LVPA 2XF0A 2XK3A 4JXFA 4AA4A 2XJ1A 3NAXA 1YWNA 5CU6A 1JKLA 4BTFA 2GMXA 3QQJA 3D9VA 4XG6A 5EDPA 4PDSA 3OEZA 2AYPA 3PUPA 4D4RA 2O3PA 3QFVA 4WOVA 4AT5A 4ACDA 3ROYA 4KIKB 2X81A 3U9CA 4YZNA 4C4IA 4NM5A 4A07A 5HVKA 4UX9A 4DE4A 4Q5HA 3UIMA 4JIKA 3VS4A 4Y5QA 4LGGA 3ZC6A 2PUUA 1U46A 5HICA 1FMKA 3PJ8A 1PW2A 2EWAA 2G2HA 4HYUA 3PVBA 5CU3A 3OOMA 4C33A 3Q52A 1ZOHA 2XB7A 2CKQA 3DBEA 4U0IA 4R3PA 1OITA 4DTKA 3ZBXA 5GINE 2H8HA 4NW6A 2C4GA 3KFAA 4GYIA 4KRDA 5A4EA 5FM3A 2I7QA 3V6RA 2ONLC 4EHVA 3SDJA 3Q4ZA 4FT9A 3MY0A 2FYSA 3A7FA 4QMTA 3KKVA 3HAMA 3MVMA 2GQSA 5DNRA 2RIOA 4B8LA 1Y91A 3EQRA 2GS2A 3ZO1A 4H39A 4O86A 4GL9A 4UMPA 1URWA 3E5AA 3GU5A 4ZMEA 1YOJA 4XG3A 3CTQA 3RVGA 3U4UA 4CMTA 1YW2A 3QTRA 4ZTSA 3PG1A 3CQEA 3A8XA 2IZRA 2UW8A 4YBKA 3HP5A 1J7LA 5GHVA 1ZY4A 2HZ0A 4K1BA 4ANLA 4C4EA 5CVFA 2X6DA 4O7NA 4G6LA 4D2RA 2JDTA 3NCGA 2P2HA 4JR7A 4KKGA 3JYAA 4OTIA 3EFKA 2IW9A 3DAKA 3E3PA 3QU0A 4EK5A 4I4EA 4HYHA 3EQIA 2W05A 2DYLA 4J71A 1H01A 2UW5A 1XBCA 4KD1A 5CAOA 4F6WA 2CSNA 2VTPA 1G3NA 3MSSA 2WTDA 4G9RA 5HX6A 5DRBA 4GU9A 1W84A 5FLFA 1SMHA 3OD6X 3L8XA 3PIXA 5C8KA 5HE0A 2A27A 3ZO4A 1Z9XA 3KF4A 2WTIA 4DLIA 4B8MA 1YDTE 5DR6A 3GCUA 3DQXA 3FI4A 4G17A 4MD9E 4YJRA 4EH2A 2CGWA 3IW4A 4X3FC 1X8BA 3CGFA 1ZZ2A 3S1HA 3MWUA 3ZDUA 2VWXA 3QQHA 4LUDA 2IVUA 4Y72A 3SW4A 4BGHA 4D0XA 5F94A 5KUPA 3R1SA 3TDVA 3QL8A 1GZ8A 3KF7A 5IH6A 2J0KA 2YN8A 2I0VA 2X4FA 4FSZA 5AUTA 3IKAA 5L2SA 3G6GA 3IW8A 1GIJA 2X39A 4DFYA 3AC8A 3ZUVA 3Q60A 3QRIA 4U8ZA 3KN6A 4GS6A 4NCTA 3F3WA 4ZK5A 4CFMA 1NA7A 2YM8A 2VNWA 4G1WA 3PJ2A 5CANA 5K5XA 3MDYA 4DH3A 3TV6A 2W9ZB 3MVJA 2HW7A 2VTQA 4G2FA 3QTUA 4DEEA 2W1DA 4MCVA 3R9DA 5E7RA 5HKMA 4CFFA 1XR1A 2XK8A 5HG5A 2IW6A 5KZIA 3BYVA 3ZEWA 4FTJA 4PP7A 2A2AA 3Q3BA 4IXPA 4H58A 4EYMA 4IVAA 4EOSA 1E9HA 4X6RA 2F9GA 4WBBB 1VYZA 2PMLX 5GJGA 4A4LA 3UQFA 3QWKA 5AP5A 4HW7A 2H6DA 3KXZA 4TN6A 2YA9A 4ZSEA 4C4JA 3KB7A 4DH7A 4GFGA 1U5QA 3W16A 3C9WA 4H3PA 3QXOA 2GHLA 3BWFA 3E88A 2UZEA 3GOPA 3THBA 5L8KA 5AR8A 5ANGA 4WUAA 3VC4A 5FXSA 5CAPA 2DUVA 3JXWA 4FF8A 4EYJA 4CGAA 3ZEPA 5E1SA 3W8QA 4YNEA 3OP5A 4C36A 1PXLA 1ZY5A 2VWIA 2VTOA 3GCQA 2UZVA 1H26A 5M57A 4I1ZA 1P4OA 4RJ3A 5IEVA 4U45A 1HCLA 2Y6MA 3EIDA 3F3TA 1BI8A 3TNWA 3V8TA 4KIKA 2J4ZA 4UN0C 4APPA 3JS2A 3QXPA 5AWMA 4JAJA 4QMWA 1I09A 4FKLA 3BV2A 4FKQA 4XV1A 5JQ5A 5CVHA 4DGNA 3DK7A 5L6PA 1NVRA 3GQIA 3FLNC 4MWIA 3DV3A 4AACA 4YJOA 2IN6A 2W1IA 4F6SA 5LCJA 1SZMA 2UZUE 3FLSA 3ATSA 4L8MA 2W1FA 5E8TA 2WNTA 4FNXA 1YHVA 4AF3A 1G5SA 4BCOA 2VTSA 4G3DA 4IDTA 3PXYA 3EYGA 4JJRA 4E4XA 1TQIA 3NYXA 1GZOA 3N9XA 4MQ2A 4NIFA 4QYEA 5I9UA 3V04A 3MA3A 1TQPA 4E5WA 3R2YA 1OIQA 3O50A 5IPJA 3VULA 4EH8A 4ZSGA 4JAIA 5C9CA 2PHKA 3OW4A 4X2JA 3LM0A 4P5ZA 4BCJA 3PPKA 1OPKA 2FO0A 4BZNA 3LZBA 5TF9A 3VJNA 3L9MA 4A7CA 5IMEA 2ITUA 2GFSA 3QRTA 3SRVB 4ITJA 4BCPA 4FICA 3GC7A 5FQDC 4FGRA 2OIQA 5HTCA 3R8VA 3U9NA 2GTMA 2IVSA 4O7RA 3V5WA 1NW1A 3DKGA 5CEIA 3ORLA 4WG4A 3S4QA 4BHZA 3K3IA 4AZVA 1WVYA 4ZMFA 3AD4A 2WEVA 3DY7A 4YTHA 5T6KA 3EKNA 5E8XA 2V7AA 3IW7A 4FV3A 4JDIA 3V8SA 2YJRA 5FRIA 3VRZA 4IZ5A 4JG7A 5FBNC 3ULIA 2XVDA 3CC6A 4RWKA 3FZPA 3L9PA 3MH3A 5CT0A 2R3JA 2QI8A 4CTBA 1W98A 4D9TA 1RJBA 4JQEA 2G01A 3OBGA 3DKCA 4YTIA 4C8BA 1W83A 4RJ7A 4J8NA 4X21A 2UZBA 5M51A 1J91A 2WPAA 1LEWA 5DG5A 2C6KA 3VNTA 4BI2A 4FV2A 5BX0A 1JKKA 3MVLA 4RJ8A 3GBZA 1YXXA 2G2FA 5K0KA 2QOLA 4QQCA 1JAMA 2OJFE 2W1EA 1MP8A 5IQDA 3Q9YA 4MWHA 2B9JA 3IDBA 3LIJA 4EJNA 3OWLA 5DR2A 1YXVA 2C5YA 1PMUA 4GH2A 4TNDA 3ZC5A 3OT8A 1BLXA 4EC8A 4IZYA 2NPQA 3ZFYA 1YXTA 4XHKB 4IANA 4U5JA 2A4LA 3KREA 2BHEA 3NDMA 2YCRA 3R7OA 2X2LA 3F5UA 4DG3E 5GZ8A 2PYWA 5M08A 2OXYA 3Q4UA 5I9XA 4RWIA 5I9YA 5DVRA 4AN3A 1WBNA 4ANNA 5M09A 4YTCA 2WQNA 2CKOA 3PA5A 4P4CA 5HLPA 2B4SB 3DQWA 3RP9A 4QRCA 4CXAA 4U44A 4EOIA 3QX2A 1H4LA 4AN9A 3O8TA 5AV0A 3TT0A 5IA0A 5BVKA 3UQCA 2XA4A 4KKHA 4PRJA 3LJ0A 4XG8A 3LCSA 4QTEA 2HK5A 3ENHA 4M12A 3O96A 4FC0A 5A6OA 4QPAA 2Z7RA 4AA5A 3OWKA 3SC1A 1J7IA 1CKPA 3HX4A 5M55A 4MNFA 4AOTA 3ORTA 4RX9A 2P55A 2VO6A 3D7TB 1Q8TA 4LL0A 2R0IA 4OTRA 2OK1A 4KIPA 4O0TA 1DM2A 3W33A 5KNJA 3ZLWA 1CKJA 5I9WA 4MBJA 4F7LA 1H07A 2C6LA 2GNHA 2O63A 2YJSA 2QURA 3W32A 3DTCA 3IK3A 3UPXA 5J9YA 3VIDA 5KMJA 3PSBA 5KMOA 2J9MA 3ZSHA 3MB7A 4X7QA 3FHIA 2WGJA 3BLRA 3SHEA 2DWBA 2P2IA 2C3KA 4W9XA 4N0SA 2XK6A 4IX5A 3E62A 2R4BA 2GHMA 3E8DA 4X6QC 5DI1A 4TYJA 1VYWA 3DBDA 1PXKA 4MXOA 5CSWA 3LFQA 4OBPA 4ZY6A 2BRNA 3R7YA 4FSQA 4FZ7A 4QMYA 3DGKA 3R1YA 4FL3A 4GVJA 4JT3A 5L8LA 4OR5A 2VGOA 1BUHA 3EMGA 3VQUA 4AN2A 2CKPA 1Q8WA 4K2RA 2B54A 2OZAA 3CXWA 3AXWA 3OZ6A 2OH0E 4AAAA 5LVOA 3DAEA 3VJOA 4D5HA 3BV3A 2PVKA 3F5GA 3L8VA 1YI6A 5AUVA 3Q2JA 3O23A 2BIYA 4EK8A 4F9YA 2WKMA 2X8IA 4IWDA 4E4NA 2OFVA 3DS6A 3QC4A 1H00A 5GZAA 3NUPA 2B0QA 4U3YA 1JVPP 3W2OA 1Q3WA 3HMOA 2HXQA 5CSPA 2VO7A 2VTRA 3PWYA 1PKDA 3SG9A 3FXXA 3QHWA 5A54A 3U4WA 3UC3A 3EOCA 4K33A 1KWPA 2O5KA 3QX4A 5D7AA 1OPLA 3COHA 2JFLA 4RPVA 4B6LA 1OL2A 3KL8A 1YOMA 4JBQA 3V6SA 3VF8A 4D4SA 5ACBC 5IKWA 4AFJA 4NTTA 3QZIA 4IJ9A 4BDHA 4DEBA 4R1VA 3W1FA 5HIEA 4PX6A 3IOPA 4TWNA 1MRVA 4EBVA 3PRIA 3BI6A 1JSUA 3GB2A 3JVRA 2R3HA 3EQPA 3MS9A 1W0XC 3NYVA 5HU9A 3H9FA 3POZA 4FIFA 4L01A 4W4YA 5AUZA 3RCJA 5LOHA 2CDZA 2F7ZE 3TXOA 5CI6A 4BCGA 4UXQA 3RZFA 3DZOA 4KINA 3OCSA 3PY0A 4FK6A 4C59A 2QOKA 5T68A 3QD4A 4QP6A 3EKKA 1GIIA 3PDTA 3ZYAA 1ZWSA 3MN3A 3FZ1A 2Y6OA 4GFOA 2OXXA 3OXZA 4GG5A 3FKLA 4NW5A 4RIXB 2B9IA 3OCTA 1AGWA 4IIRA 4C57A 4L7FA 5HZNA 4YLJA 3C7QA 1OKVA 3P86A 4GJ2A 5AP0A 1SVHA 3NGAA 3VRYA 4F1MA 5BYYA 4A9SA 5ICPA 3S00A 2WO6A 4YMJA 2PWLA 1F3MC 2XJ0A 3ZSGA 4BRXA 1Q61A 2B55A 2WTJA 2XKEA 4K0YA 2R0UA 1B39A 3G2FA 4RJ4A 3BKBA 2SRCA 4LMUA 5H8EA 4HYSA 5EYDA 3T8OA 4I6HA 5E1EA 5E92A 5EM7A 2VTJA 4J52A 5CEKA 1F5QA 4I6QA 5ETIA 4RFZA 4RC4A 3HAVA 2JGZA 4DITA 5CXZA 3EN4A 4O27B 2QLUA 3LW0A 2W7XA 2Q83A 2FA2A 3WYXA 3ZDIA 2WAJA 1CSNA 1WCCA 3LE6A 4L43A 5FDPA 2VX0A 3SKCA 5FTGA 5C4LA 2I40A 4CFVA 2J90A 3HDNA 2LAVA 4U41A 4APCA 4DGOA 2RG6A 5LARA 4MYGA 4FR4A 5CSXA 3RWPA 3SLSA 4F08A 5L3AA 5HIBA 1YVJA 2QU6A 4FV9A 4USFA 2BVAA 4JOAA 3FSFA 3QKKA 5H8GA 3RPVA 1PXPA 1XKKA 4MXCA 3IGOA 1JKTA 1GIHA 4FSNA 2WTCA 4D4YA 4K9YA 4CKRA 3S95A 3F2NA 1G8SA 5I3OA 4EK6A 4HVGA 5CEOA 2YCQA 3E7VA 4N70A 1FMOE 2VX1A 4QD6A 3PZEA 4WO5A 4IX4A 5EKOA 3BX5A 2EB3A 1ZZLA 4E6DA 2QQ7A 3DLZA 4GKIA 4U97A 3FKOA 4EOMA 5LMKA 4AOJA 4BDAA 1MQ4A 1JWHA 2GNIA 1OI9A 4BB4A 3VUGA 1UWHA 3ZO2A 3UDBA 3TKHA 3R28A 1OMWA 4ZY5A 1M7NA 4HGLA 2YM6A 4UZDA 4ZY4A 4MF1A 5DH3A 4FZAB 4AGUA 4V0GB 2W06A 3CP9A 3R21A 4YUQA 3JY0A 1E1VA 3BPRA 3EQGA 2EVAA 3CKXA 3R02A 3ENMA 1XH9A 2G15A 1YWRA 2B53A 2FSMX 5HCXA 2E9UA 4AGCA 1AD5A 4WIHA 4FBXA 2XIKA 2C68A 2ZV7A 5F9EA 5E8UA 2YEXA 5DA3A 5JFWA 1JKSA 2ETKA 4EL9A 4O2PA 3IPHA 2O2UA 3BU5A 4BGQA 3L8SA 3FY2A 4OTHA 4YHJA 4XG7A 4O7LA 4TYHB 1CKIA 4BGGA 5AP4A 2GFCA 5A3XA 3VQHA 4G16A 2UVZA 4O6EA 4C58A 2JKQA 2HYYA 3C4WA 3KXMA 1U4DA 1OZ1A 3NPCA 4CFUA 2Y9QA 3GENA 5BNJA 1OBDA 4FIJA 4IM2A 4B99A 3NS9A 3HUBA 4IH8A 4LRKA 4FV6A 5M07A 2X7OA 3T3VA 2BKKA 2PVRA 2RF9A 1O9UA 2YM5A 4UALA 2UZNA 3D5XA 3I4BA 2XNNA 5KKRB 5D7VA 4I5MA 3K3JA 5A6NA 3VS2A 4G3CA 1RQQA 3DKOA 2E9NA 2X2MA 3VN9A 1CMKE 1XQZA 2R2PA 4FL2A 4M0YA 4Y95A 4ZJJA 3HV7A 3ZUTA 2ZYBA 3BGPA 3NAYA 4NWMA 1YWVA 4ZTHA 3TTIA 2BDJA 2PMIA 5AA9A 4WG3A 4J53A 5HLNA 4FKVA 2YM4A 5HIDA 3LFAA 4DGLC 3FMJA 5AEPA 2EXMA 4S33A 3WE4A 2CJMA 1JNKA 4DFNA 4YJUA 3DFCB 5HG7A 2UW4A 4OTWA 5E8SA 5AV4A 3WF9A 3GC8A 2W0JA 2WTWA 4O7YA 5IF1A 2KULA 4QMZA 3RKBA 2J6MA 2JBPA 3EJ1A 1H27A 3COKA 4R5SA 5BYZA 3F6XA 3ODYX 3NWWA 1OGUA 3W2RA 3UNKA 4F64A 4NM3A 3DAJA 2OIBA 4U80A 4YC3A 3UGCA 3NMUF 4M66A 5F20A 3FWQA 3F9NA 4BTKA 4CKIA 4O81A 1WZYA 5JFSA 5F95A 2Y4IC 4OAVB 2YIRA 4JDKA 5EM8A 3FQSA 2WU7A 4FZDB 2CNVA 4IFGA 4ASEA 4C61A 3R9RA 2ZM4A 4MXYA 2WMRA 3PY1A 3ETAA 3QF9A 4YJTA 5J9LA 4IVDA 2XNGA 1REKA 5K9IA 2YIXA 3BU6A 1IAJA 2XRUA 4GCJA 3KA0A 5IDNA 3CD8A 5EOBA 2VX3A 1BYGA 1U54A 3QCQA 4L44A 3NVMB 4ZXTA 4CQGA 2Z2WA 4AA0A 2CMWA 4HPTE 5JGBA 1H0WA 2BZJA 4FTIA 1H28A 2HCKA 5LXMA 5AJQA 1L8TA 2HZ4A 3HV6A 5GIOE 4FG8A 4IWPA 3QKLA 3MYGA 2UW7A 3E64A 4I5HA 4FKSA 3VF9A 3PVGA 3V5QA 3PPZA 4L45A 4X3FA 4CLJA 4PNIA 3OT3A 4L00A 3E63A 4LRMA 4RBLA 4GKHA 3CCNA 4MXAA 3EWHA 3RPSA 2QG5A 2BHHA 1KE7A 4ERWA 2ITQA 4BCQA 3AMAA 4WBOA 3AC4A 5IQHA 4Z9LA 4RZVA 1F0QA 4DTBA 4KAOA 2JDSA 4DEAA 2A19B 4XUFA 2Q0BA 3P4KA 5I9ZA 1DI9A 5JFXA 3CJFA 2E9VA 1NT2A 2NO3A 3UOLA 1UV5A 3FV8A 4HPUE 4AZFA 4EK3A 3NW5A 5BQ0A 3C50A 4DG2E 1UU3A 3DJ6A 3F5PA 4FZ6A 4IAKA 4C2WA 5AR5A 4FEVA 2GNGA 5CEMA 4IWOA 4GU6A 2QOOA 4C3RA 3RK7A 3ORMA 3QC9A 3UOKA 4F65A 4D2VA 1WBSA 4FVQA 5GJDA 4UMRA 2JDVA 3P5KA 3ZUUA 5EYMA 3QWJA 2E2BA 5BUIA 2FSLX 3CBLA 2BDFA 3QA8A 4PDPA 4IZ7A 2W1CA 2Z7LA 5H8BA 3TN8A 5HO7A 5L2QA 4BN1A 2ESMA 4MBIA 2YAKA 3TJDA 3AG9A 4DHFA 1ZYJA 4QYGA 5CF6A 4QQTA 4FTRA 4AXAA 1V0OA 3SX9A 3WYYA 4N57A 4FVPA 3UO6A 4TYHA 4YJPA 3KCFA 1DI8A 4BKJA 5C8NA 2R3OA 3EN6A 3ZLXA 3GFEA 4TWPA 1GAGA 2O65A 2PZ5A 3B2TA 3ORXA 4P5QA 2CHLA 5IU2A 2GNLA 4GRBA 5J79A 3BU3A 2Z7SA 5KCVA 3FEGA 5E91A 2HWPA 4Q9SA 2UW9A 2V5QA 4EKKA 3R9NA 1Y6AA 2R9SA 3DA6A 1PXIA 1KOAA 5IMXA 1B6CB 2J0IA 5EHYA 2WTKB 4R7HA 3OS3A 5ANJA 4QPMA 4DLJA 5IZFA 3M1SA 3ZZEA 4GVAA 2X0GA 3TZ7A 3UVQA 4NIFB 4EUTA 3QRKA 4JRVA 3ZTXA 3R8UA 2OIDA 2JDOA 3MPAA 4AE9A 4FTOA 4ZTRA 3DXPA 4NM0A 3U6JA 4BKZA 5BUJA 3DOGA 3CY3A 3QQUA 2QODA 3MJ1A 4AOIA 3ANQA 2FUMA 3R7VA 4Y83A 4D2SA 3TKIA 5IA2A 3VS1A 2V7OA 2OJIA 4E7WA 3HMNA 4GT4A 4L7SA 4RZWA 4D55A 3LKMA 4EH9A 4O6LA 3R7IA 3AT3A 3OHTA 2KTYA 1XHAA 4MQ1A 5CY3A 5B7VA 5M4UA 5AMNA 1XH8A 4NYEA 2O8YA 4QQJA 4BCFA 3BHUA 3NNUA 2DQ7X 1KE6A 2PMNX 2XNOA 1WVXA 2OF2A 5C03A 1M52A 3O2MA 4XJ0A 2J5FA 4PUZA 2Z60A 4FT5A 1R0EA 4RRVA 4A06A 3HV5A 3QQFA 4AP7A 1ND4A 3IOKA 4GT5A 2ZB1A 1PMEA 2VTHA 2YLFA 1REJA 1APME 3HRBA 3PXRA 3EH9A 1YDSE 4U40A 3WILA 1WAKA 3A99A 3ET7A 2VO0A 4MF0A 4MD7E 4YZCA 5DT0A 1Y8YA 2HOGA 3WF7A 2WXVA 3LCKA 4O0XA 4UWCA 4QNAA 4I23A 5CVGA 3ORPA 4TKSA 4YGAA 2C0IA 4WRSA 3JUHA 4EQCA 3LQ5A 4PY1A 4DH8A 4NL0A 3W8LA 4BWXA 5CXHA 3TTJA 1H25A 1SYKA 3EQDA 2BZKB 2WMTA 2UVYA 4ZLYA 5E9EA 5DPVA 1STCE 5HD7A 2J50A 4L9IA 2J2IB 4NFMA 4L3PA 3K2LA 4OTDA 4DBNA 2JITA 4UZHA 4EWHA 4WKQA 5HTIA 3EZVA 4FE2A 1CTPE 4NEUA 3MI9A 3NZ0A 5HE2A 4R3CA 2IWIA 1WBWA 5CENA 4GIHA 2OFUA 5KMLA 3LMHA 4DT9A 4M13A 4D0WA 4OLIA 3ZMMA 3IO7A 1IA9A 3UMWA 5GIPE 4LRJA 1BL7A 4I5PA 4BDKA 3P79A 2BPMA 4XX9A 2HW6A 2HZNA 4F4PA 3A62A 2JKKA 4CZTA 3O7LB 3R71A 3WE8A 2JBOA 4O0WA 2QU5A 3H30A 4IE9A 4BF2A 2C69A 5DBXA 3BQRA 4CV9A 2F7XE 5AM6A 1Q4LA 2WMUA 3R83A 4IADA 4XP3A 2GQRA 2OF4A 4E6CA 2XEYA 1JQHA 5AP3A 3TM0A 4LV5A 4HVHA 4FSTA 5CX9A 4RFYA 3QCYA 3ZXZA 1IEPA 4CRSA 3CPCA 4LGDA 3C1XA 3E87A 2IPXA 4O7SA 4O0YA 3PXKA 2BILB 3BWJA 3O17A 1UU9A 5A14A 4O7TA 2XM9A 1XWSA 4JX3A 3FMNA 3TEIA 3TI1A 2X8DA 2X6EA 5HORA 3W2SA 2UUEA 2HAKA 3OBJA 3U6HA 1H8FA 2UZDA 4IC7A 5CI7A 4DT8A 4FG9A 4U81A 1FVVA 2HENA 3R6XA 4TTHB 3I6UA 4ASXA 3IONA 1H24A 4J98A 1ZAOA 1VEBA 1IRKA 1ZYSA 4ZP5A 3TZ8A 3GEQA 4KRCA 2VNYA 4I6BA 3V5JA 1XBBA 1UWJA 2VTAA 4MH7A 4F09A 3DJ7A 3DBCA 2BFYA 5CLPA 2OZOA 2IVVA 5J5TA 5CZIA 5TE0A 3TV4A 3ZONA 4J96A 3C4EA 3ALOA 3FQEA 1IR3A 2OZAB 3UO4A 1URCA 4CG8A 4CSVA 2PK9A 4O7ZA 2C6OA 2XKDA 3IW6A 5DEYA 4UMQA 2XYUA 5HTBA 3WI6A 4B7TA 5F1ZA 3R7UA 2WQMA 2JLDA 3DTWA 4JI9A 5BVDA 3E8CA 3QYWA 4QMSA 3R7EA 4D1ZA 4J95A 3U87A 4AZTA 3UJGA 3I1AA 4C3FA 4O0UA 5BUEA 2X7GA 1FOTA 4FIIA 4CD0A 3BZ3A 3SGCA 2R3LA 3Q4CA 4EOLA 3NEWA 5KE0A 1A48A 4BBEA 1OL1A 1YXSA 3PSCA 3CD3A 2RKUA 2XIXA 4XNEA 1G8AA 4W9WA 3NVKI 4XG9A 2QD9A 1OVEA 4S32A 2I1MA 3BIZA 4IM3A 2YDJA 4BDCA 1S9IA 3LJ2A 3ZFXA 4RX7A 4RA4A 1M2QA 4DFXE 3V3VA 3GUBA 5AUYA 4QTAA 2VWZA 4KABA 3RM7A 4FIGA 2CNQA 1XH4A 4YC8A 3W2CA 3GCPA 3EQFA 2ITYA 3BHTA 2G9XA 3EHAA 4FTUA 4QMPA 2LGCA 4QMLA 4RIYB 3R8LA 4EHGA 4FEUA 5I5ZA 4EK4A 5HNIX 1ZOEA 4BCHA 2G1TA 4GUBA 4BWPA 5C27A 3VUTA 4D2WA 4D9UA 5EYCA 2QOFA 4O96A 3R8ZA 3CPBA 1VR2A 3EQCA 1IA8A 4O0VA 5FXQA 3WF6A 1YHWA 5EQEA 4MTAA 4XV9A 4PNKA 3F69A 2FB8A 4IAAA 4BIDA 2ITWA 2Z8CA 4S30A 4CKJA 5BYLA 4ZJVA 3KMWA 4EZ7A 3F3UA 3O8PA 4ANBA 2PUIA 4X2NA 3EQBA 3G9LX 2IZTA 4E1ZA 1XBAA 2QO7A 3AGLA 4DN5A 1I44A 3LFFA 4CNHA 3ZO3A 2PU8A 2RSVA 3FMDA 4FUXA 3NW6A 3NYNA 1OIUA 2GTNA 4FV8A 3Q04A 5DFPA 5JKGA 2PUPA 5IQGA 2VN9A 3CS9A 3OC1A 2F2UA 4CCUA 5CAVA 4KA3A 3OTUA 3VHKA 4C34A 4KKEA 2C3IB 3RBWA 3L9NA 1IAHA 4AW1A 4HJOA 3VWAA 3R0TA 3LFCA 5E8VA 3W55A 4I41A 4YHFA 4BDIA 4FOBA 1XH7A 1H1QA 4WUNA 3UOJA 3DXQA 3IECA 3E8NA 3HLLA 2XK9A 2C3LA 1OBGA 4ZTQA 4G9CA 3MESA 3CEKA 3NUYA 1AQ1A 1OUYA 1ZRZA 2W1GA 4IVCA 5C1QB 3FI8A 3N4TA 2YITA 5L6WL 4RG0A 4MXZA 3ZRLA 2YERA 3MIYA 2YLEA 4TYEA 2QKWB 4QYYA 3UZPA 5AAEA 5CZHA 5FM2A 3PLAE 3HUCA 3BHHA 3UZTA 5CAQA 2WZJA 1OL7A 4XMOA 2CCIA 3KY2A 4PMMA 2EUFB 4YJSA 3TZ9A 4UYNA 4E4MA 1Q5KA 2PVHA 3NUNA 5HO8A 1IG1A 4TNBA 4XBUA 2PMOX 1H08A 4FL1A 4H36A 4FEWA 4JNWA 1GOLA 4M84A 3RALA 1WBVA 3RAWA 4TXCA 1H1PA 3PA3A 1P5EA 4BCKA 3KMMA 4IJPA 5HO6A 3H10A 1FVTA 3MY5A 4FSRA 1O6KA 4EH4A 4WSYA 3IQ7A 2HY81 2XP2A 5B0XA 5EDRA 4CT1A 3ERKA 4FKOA 3G33A 4AFEA 4H05A 2PVNA 2V22A 5HCYA 2RFNA 2X4ZA 4V05A 3TNIA 3ZM9A 4IHPA 3F3ZA 4FEXA 3OUKA 5L2TA 3LLAA 4JDHA 4R6VA 4QMOA 2QOQA 1ZOGA 3Q5ZA 1UNHA 2VU3A 4FKWA 4I20A 4RVKA 3F61A 3UG2A 4AW2A 4LM5A 4TYIA 3N4UA 3I79A 4LYNA 4U7ZA 5AIRA 2XIZA 2ITVA 4R7IA 4XG4A 1TKIA 4G6OA 3MH2A 4Q2AA 3G0FA 3EB0A 3VS3A 1OIRA 1P14A 2FH9A 4TWOA 4CTCA 4FTNA 3NNXA 3S3IA 5CF5A 3A7HA 3MY1A 4O83A 4OTQA 3OY3A 4FIEA 3F66A 4HVDA 3VBWA 2W4OA 2GPHA 3MJ2A 3LQ3A 5DWRA 2VV9A 3H9RA 3D5VA 3CE3A 4NSTA 3NR9A 4DEIA 4PTEA 3CY2A 2GNJA 1ZMWA 2XK4A 4EOKA 3KGAA 2B1PA 5HNBA 3VBXA 4J7BA 4TW9A 3D5UA 4TRLA 3MPMA 1Z5MA 3CTJA 4C3PA 4ZAUA 2A0CX 1SVGA 3BCEA 3HP2A 3G5DA 3QAME 5JGAA 1KV1A 2EB2A 4CFWA 4D5KA 3FYKX 3ZRMA 1FBNA 3DKFA 5GNKA 4XLIA 5TKDA 4FV4A 2YDKA 4AZWA 3PWDA 5AP6A 4S34A 4FX3A 3CQWA 3MTFA 1QPEA 2FSOX 3HV4A 1KUTA 3FZSA 4ZOGA 4G34A 1FVRA 3ZRKA 2OLCA 4XS2A 4XOZA 4F0IA 2BTSA 1ATPE 1K2PA 3UIBA 5BVEA 5FUTA 3GU8A 4L67A 2GS6A 2V55A 3NSZA 4TY1A 3FXZA 4BCNA 5ACKA 3RGFA 5HCZA 3TUCA 1HOWA 2XKCA 4RIYA 3QZHA 4F9CA 1BMKA 3IDCA 5E8ZA 4L42A 5C8MA 3NCZA 3DCVA 2PE1A 3HECA 4NK9A 1GNGA 5AUWA 2IO6A 3C4ZA 4HCUA 3E7OA 4MNEA 4IEBA 3FLQA 4PV0A 4YNOA 1IASA 1YRPA 3TL8A 2DS1A 2HXLA 1BKXA 4U43A 3M2WA 2OJJA 4FUYA 5M4IA 4AGDA 4ONAA 3IS5A 3LXPA 3RTPA 3KRWA 4I93A 1ZARA 3HA6A 4YURA 4C62A 3PP1A 2IJMA 3A60A 3QTXA 2XIYA 3LJ1A 4K77A 4H3BA 4B0GA 3COIA 3QRJA 4PQNA 3F7ZA 5HVJA 3KXHA 1P4FA 2CCHA 3FPQA 3Q2MA 4BI0A 2R7BA 1M17A 5HEZA 3EL8A 4QYFA 3PA4A 3AOXA 4IB1A 3FYJX 4BWKA 4R8QA 3Q9XA 4RFMA 4IC8A 3GU4A 3MPTA 2GQGA 2CN8A 1Q8ZA 4XEYA 5IA5A 4KIOA 4ALVA 2CGXA 2I6LA 3FAAA 3MW1A 4WRGA 3PJ1A 1U54B 1DS5A 4YLLA 2I0EA 5E8YA 4ZIMA 5FEDA 5EI8A 4G6NA 2C5VA 4WNMA 2XNEA 3OVVA 4CYIA 4AE6A 5CNNA 3ULZA 1GY3A 4U79A 2PZRA 3GQLA 4IACA 4O38A 5BVNA 3UO5A 3A7JA 4HCVA 4RWJA 4ZTMA 2B52A 4ERKA 3G15A 4ZLOA 2C47A 2FGIA 4LG4A 4N6YA 4PMSA 5JK3A 2BAJA 4UB7A 3W2PA 4CZUA 4NUSA 4NKAA 3BHVA 4L68A 4X3FB 4GIIA 5CU2A 5KMMA 2VRXA 3NIZA 4ZSLA 5TT7A 4E6QA 2ZM1A 5IH5A 2J5EA 2YHVA 3AC2A 3CJGA 4QP2A 3UPZA 1WBPA 5BVOA 4FODA 2JAMA 3BEAA 4Z3VA 3RHKA 3ALNA 4OTPA 4BTMA 4UMUA 2CLQA 1PHKA 3MIAA 2JKOA 4E4LA 1Y6BA 4FKJA 2R3IA 2UW0A 2WOUA 3AD6A 4PL5A 4RVLA 2B9FA 1A9UA 3KRXA 4TPTA 3VS5A 1UA2A 2Y4PA 4HGSA 1OECA 5ANEA 4E5BA 2XBJA 4HYIA 4YPDA 3BYUA 2ETMA 4S31A 1KE8A 5JSMA 3PE2A 4WNPA 5ETCA 4X0MA 4R3RA 3ATTA 4AS0A 3WZJA 5KMIA 3EQHA 1ZYCA 3COMA 4II5A 5AAGA 4BICA 3RJCA 5K5NA 4L53A 4PWNA 3QLGA 1WMKA 4QPSA 3OXTA 4O0RA 4ZLZA 4BHNA 3DZQA 2WIHA 3FI3A 3NX8A 3TNQB 1FQ1B 1M2PA 3QD2B 3Q9WA 3AMYA 5JEBA 4MK0A 3NNVA 2WMXA 2GCDA 4GG7A 3R63A 3DDPA 4EUUA 1UKHA 4BBMA 3PZHA 5EKNA 4OW8A 5HHWA 2WELA 3G0EA 2XH5A 2XS0A 4ID7A 4PPBA 5L2IA 3KK8A 4MX9A 2C5NA 2ETRA 3KULB 3UP2A 5HD4A 3MFRA 3QHRA 5KBQA 2JKMA 3H4JA 1XH5A 4L3LA 5H2UA 4H3QA 2ITTA 4O7VA 3UBDA 5M44A 4M97A 2H34A 5JMSA 3AT2A 5ITAA 2EXCX 4F7JA 1U59A 1SVEA 3KVWA 4DFZE 3C5UA 3GCVA 2UZOA 3PTGA 4PL4A 3LXKA 4JS8A 4DINA 4L52A 3ZFMA 4C4HA 3R7GA 5FP6A 3FZRA 4EH6A 4DF3A 5CSVA 3K54A 3QTSA 4FTQA 3S2PA 4OT6A 4AZEA 4A9TA 4AQCA 1ZMUA 3SXRA 4JX7A 4P90A 3JPVA 3FSKA 5IG1A 5M56A 2OO8X 1XH6A 1OKYA 2P4IA 4YTFA 4U9AA 4O82A 4A9UA 3KCKA 3RAIA 2C6EA 5D11A 3HNGA 4CCBA 1UNLA 3RNIA 3SG8A 3QTZA 4JBVA 4OAUC 1RDQE 5EG3A 4I21A 3ID6C 4QTCA 2ONLA 3QA0A 3AMBA 3L1SA 4RA5A 1BI7A 3RM6A 5FG8A 3P7CA 4QMXA 4BDEA 5AR2A 1SNXA 4I0RA 4L46A 2UW3A 2UW6A 3F5XA 2OJGA 5CS6A 3SQQA 3P23A 3AT4A 4N4SA 5FWKK 3RPRA 4Z7HA 1MRUA 3PG3A 2R7IA 4FV1A 4R1YA 3WARA 3FC2A 3MFSA 4XBRA 4F9AA 4QP1A 3ORNA 4F7NA 3PFQA 3DPKA 4WNKA 5IEXA 3R9OA 4BDFA 4LV8A 2OI4X 1YI3A 1W8CA 3N4VA 3BHYA 3QALE 4YZMA 5JZNA 4FV0A 2PSQA 2ITPA 3UP7A 4DYMA 2F57A 2VO3A 3CQUA 2ZVAA 3POOA 3B2WA 4TL0A 2AUHA 2R3QA 4TYGA 4BI1A 4F0FA 5M4CA 4IB3A 5TOZA 4BVUA 5J1VA 1PF8A 1QMZA 3SW7A 4JQ7A 4LOPA 3A4OX 4J8MA 1QL6A 2P0CA 3LCOA 4QP7A 4PMTA 4EOPA 1KV2A 3B8QA 3DK3A 4W4XA 2WQOA 4QMVA 4XCUA 3OTVA 2HELA 4I22A 2QHMA 5JT2A 2EXEA 3LMGA 5C26A 4FI1A 5FTOA 1FINA 5IUHA 4IMYA 3LFDA 5BMSA 4M67A 1ERKA 4A4XA 1OPJA 5IQEA 5HI2A 3IG7A 2Y0AA 3SOAA 4ANOA 4F1TA 2Z02A 3H0ZA 2BUJA 3A61A 3ODZX 3GXLA 3P7BA 5FEQA 2R3MA 2C0TA 3IW5A 3UE4A 4IB5A 5AP2A 2WTVA 3I5ZA 3I5NA 3PRFA 4FT0A 4BDJA 4YZDA 4ACCA 2O0UA 4IAIA 5LMBA 1OL6A 3GOKA 3PVUA 4DA5A 3RAHA 2W17A 2C5OA 3TNHA 1JSVA 4NTSA 5AADA 2IVTA 2JIUA 5CU4A 5CYIA 4E3CA 4EKLA 4IB0A 4O2ZA 4YSMA 4FV7A 1YXUA 3FUPA 5AA8A 1OM1A 2VGPA 3P08A 3CKWA 3DXNA 1HCKA 3I6WA 1ZMVA 2HZIA 3OWJA 3D5WA 3MB6A 3CR0A 5AM7A 5FTQA 4S2ZA 3QTQA 1Q3DA 2Z7QA 4MBLA 2W99B 1JSTA 3WZKA 4FV5A 4JBOA 3VUKA 4DAWA 2W4KA 2BMCA 3EZRA 4QP9A 3QZFA 5EFQA 3C51A 3UODA 5B2KA 4FKTA 3UOHA 4ZZNA 2PVMA 3AGMA 3GFWA 4AG8A 4J97A 5IA4A 3L9LA 3F3VA 4FKIA 4ZTLA 4EOQA 5H9BA 4FTKA 4AUAA 4JQ8A 5LCKA 4RVMA 2ITXA 2UVXA 3OG7A 4UEUA 3VUDA 2JDRA 3R22A 2BRGA 4Q9ZA 2WB8A 1PYXA 3D0EA 2QOHA 2R5TA 2IZUA 4TZRA 5C01A 3E8EA 3KULA 3RMFA 2BTRA 4LI5A 3C0IA 3Q53A 5DN3A 1QPDA 2VWVA 2ZV2A 5I0BA 4LQMA 3QD0A 4YPSA 5KBRA 2XKFA 4OBOA 5B2MA 1GJOA 1PXJA 4FG7A 5TO8A 5AV2A 4X3JA 5ANIA 5HE3A 5GJFA 5FBOA 3ACKA 3D15A 3ORKA 3MFUA 3H9OA 5HNGA 2YIQA 3C4CA 1K9AA 3DK6A 2VZ6A 3HA8A 3QD3A 2GHGA 1JLUE 2BZIB 3H3CA 4BCMA 2VTIA 4H1MA 4JG8A 2QG7A 1LUFA 5L2WA 3T3UA 2JFMA 4NJDA 3F7WA 1UU7A 4JDJA 2XEZA 4O91A 3ZM4A 5FD2A 1NVSA 2ZMCA 2W5AA 4NJ3A 5D10A 3E92A 5AUXA 2B9HA 4CV8A 5L6OA 2W4JA 5L8JA 4BTJA 5J95A 3A7GA 1PJKA 4PTCA 4YJQA 4FMQA 4RX5A 4BYJA 4EHZA 3TV7A 4DCAA 2VD5A 3D83A 2GDOA 2VTMA 4RMZA 3GC9A 3B8RA 3QRUA 4YJNA 1UVRA 3A8WA 3VHEA 5LJJA 3TCPA 3HMPA 3TKUA 1J1CA 3FL4A 2PVLA 3TIZA 5I9VA 3KEXA 3NUXA 5EDQA 4EH7A 2VWWA 5JRQA 5EYKA 5LWNA 1J1BA 4G5PA 4QO9A 3I60A 3OMVA 4YR8A 3BYMA 3LM5A 5AR4A 1Q8UA 3QKMA 3I0QA 4JBPA 4V04A 5AAFA 2PY3A 3NRMA 2PL0A 2ITOA 4AZSA 4K11A 3QZGA 5ETAA 5HLWA 2R3NA 2QKRA 3KQ7A 1H1RA 2IG7A 3PJCA 3V5PA 3FC1X 2XJ2A 3D94A 3MA6A 3WOWA 2RG5A 3HDMA 5BVFA 4FTTA 3G90X 4XYFA 5JN2A 5JZJA 2X9EA 1VJYA 3QTIA 5K0XA 2GNFA 3RCDA 2WFYA 2R3PA 5CT7A 1JBPE 3V51A 5CF4A 5DR9A 3HZTA 3VUIA 4EONA 3ZH8A 5G1XA 3Q32A 1UU8A 4D58A 4B9DA 4GUEA 3PLSA 5IISA 5KHWA 4HGTA 4RLLA 3UVRA 3LHJA 4ZEGA 4YLKA 4PPAA 3OUNB 2BRMA 4X2FA 3P1AA 4E26A 3BE9A 5D1JA 3LOKA 4GK2A 4RC3A 3S0OA 3WZUA 4GK3A 4ITHA 5EW8A 3GNIB 4AW5A 2AC5A 1YHSA 4FGBA 4FSMA 4EJ7A 3QCSA 3MH0A 4CYJA 2NP8A 4YZ9A 5BVWA 2H96A 3UQGA 1MUOA 3BRBA 3C13A 2J51A 4AGWA 5LQFA 3BE2A 3OXIA 3SXFA 4C2VA 1KE5A 5FDXA 4O84A 3I81A 5TR6A 1XO2B 4MEDA 3CIKA 4XG2A 5C4KA 4EORA 3D2IA 3FQHA 2ACXA 3ZLYA 5FXRA 4ITIA 2RFDA 3HRCA 2YIWA 4ALWA 4JIAA 4E73A 2X1NA 2OBJA 4D2PA 1QPCA 3KXGA 1XJDA 3OW3A 3ACJA 2WMAA 3KXXA 3V8WA 5LVNA 2ERKA 3Q6UA 1W82A 5M4FA 3R1QA 4MVFA 4YO4A 3DBFA 3EN5A 3LVPA 3R73A 4IM0A 4F70A 5HBEA 2HWOA 4RQVA 3C4XA 4PPCA 2HY0A 5IDPA 3I7CA 4IWQA 2QO9A 1H1SA 3FI2A 1RE8A 5EI6A 4ACMA 3GU6A 4X2KA 3TUDA 4MAOA 2VWYA 3M11A 4ASDA 4EC9A 4KSQA 4M3QA 1RW8A 2PE2A 3UNJA 3BGZA 4PL3A 3HEGA 4EWQA 3ZXTA 4FTAA 4UXLA 3ZSIA 2YDIA 3MVHA 4C4GA 4IX3A 4KBCA 5FEEA 4PMPA 2BRBA 3UIXA 2XK7A 3HGKA 4DG0E 3ZU7A 4IW0A 4LOQA 4QMNA 5IUIA 4JRNA 4FT3A 3VVHA 3TUBA 4PTGA 3MFTA 5KMNA 2WMQA 4DEDA 3PJ3A 4IVBA 1L3RE 4TT7A 3K5UA 4YJVA 5A46A 4KS8A 4NU1A 2WIPA 3KK9A 2C5XA 2PZPA 1W7HA 2YIYA 3KU2A 4MXXA 3Q96A 5AX9A 3NNWA 4BR3A 2H9VA 5ANKA 2VUWA 5KKRC 2W1ZA 4MHAA 5DT3A 2OG8A 4IAYA 3GC0A 3AD5A 4I24A 4DH1A 4EOJA 4NH1A 3DU8A 4USEA 1R3CA 3BQCA 3FE3A 4NZWB 3PXFA 4U6RA 5HE1A 3D4QA 2QLQA 4O1OA 4CMOA 5KX8A 1J7UA 3CSVA 1OB3A 3SV0A 3SXSA 3QTWA 4PDOA 2C6TA 3ELJA 2FVDA 4RX8A 5CTPA 2JEDA 3R30A 4I5CA 4M69B 3QLFA 4NFNA 3PXZA 3HRFA 4P7EA 5J9ZA 3MH1A 4EH5A 1OKWA 4G5JA 1KOBA 2ERZE 2YISA 4C37A 2WQBA 2IZSA 4CT2A 4FT7A 4XLVA 3QCXA 5EM6A 3TJCA 4CFXA 4RQKA 3BBWA 3WZEA 4O7WA 3QUEA 2JC6A 4G3EA 3VS6A 1PMVA 4IZAA 4KBKA 2XRWA 4MNEB 2PVFA 4M14A 4KBAA 2BALA 3BGQA 4K6ZA 2BAQA 1LEZA 3PVWA 3UG1A 1VZOA 4M0ZA 4FIHA 2C1AA 2EU9A 3VBQA 3NUUA 1YKRA 4RSSA 3OWPA 3OCGA 4LMNA 4GEOA 3FLWA 4I92A 2BRHA 4V01A 3I7BA 5FP5A 4QP3A 2VTNA 1LR4A 4E8AA 2OU7A 3P9JA 4BCIA 4GV1A 4AT3A 3O71A 3PPJA 2F2CB 3RWQA 1OL5A 3A7IA 3EFJA 4M7IA 5B2LA 4OUCA 2BKZA 4RIWB 2CPKE 4L6QA 4J99A 3RK9A 1Q62A 2OH4A 2Y8OA 1JPAA 3R9HA 1A06A 4C35A 1NY3A 4NCTC 3G51A 4UYAA 3NIEA 2QOBA 4UMTA 2AC3A 3AC1A 4XP2A 3RHXA 5ANDA 3WBLA 2QC6A 5HBJA 4PDYA 1DAYA 2VTLA 4Q5EA 4D28A 3WIGA 3BLQA 4FTMA 4D4VA 5L4QA 3Q5IA 4M8TA 5CWZA 3R1NA 4ZS0A 5AR3A 1PXNA 1SNUA 3R8PA 5JGDA 3PE1A 2XUUA 4ANMA 1PXMA 3ANRA 2ZOQA 1H1WA 3FDNA 2GS7A 3KRLA 4IQ6A 4KB8A 4KIQA 2WD1A 1NVQA 3KVXA 3A2CA 3LLTA 3ZBFA 3LMIA 3FJQE 3FBVA 4GFMA 2XIRA 2UZLA 4PF4A 3QBNA 3VW8A 4A9YA 4JG6A 2WMVA 2Y4IB 1KE9A 2PZIA 3OEFX 4FKUA 2XYNA 5AP7A 3R8MA 5EHLA 2I0YA 3C0GA 5IA3A 1BX6A 2PPQA 3NYOA 4FKRA 4BDGA 4K8AA 2C1BA 5IQAA 5JFVA 4DEHA 4GK4A 2ZV8A 4WSQA 3DNEA 3N51A 5DOSA 3FZOA 4B4LA 4Y85A 5IA1A 4NM7A 2PVYA 3ZS5A 5EQPA 4BZDA 3LAUA 5I4NA 4FNZA 4E20A 3T9IA 2C6IA 5HBHA 4FA2A 2YWPA 4OBQA 4BIBA 4D2TA 3RINA 4USDA 5J87A 3U55A 4TWCA 3PIZA 1O6LA 3ZCLA 3QGYA 1M14A 5HOAA 4G3GA 3L8PA 2C6MA 4ALUA 5IQIA 5AFVA 5DEWA 2WQEA 3CLYA 3KRRA 4YP8A 4DFLA 5KZ0A 5CSHA 3EL7A 3K5VA 4ENYA 2I0HA 4PP9A 4E6AA 5KO1A 1YOLA 5CNOA 2CGVA 4ASZA 3CGOA 1U5RA 2VWUA 2ZB0A 4CZYB 4FSUA 2V62A 5EI2A 5ETFA 4ACHA 1KSWA 4UWBA 1UKIA 4DGMA 4MD8E 3PP0A 3TIYA 2WTKC 4UV0A 2OWBA 3VBTA 5FGKA 4YC6A 3VS0A 1Y8GA 3VS7A 2NNWB 5JRSA 2F49A 1YDRE 4FSYA 2WOTA 2PE0A 4KNBA 1Q8YA 1T46A 2J0LA 3BLHA 4FZFB 3Q9ZA 3DB6A 3JY9A 4FOCA 4QMUA 5J7HA 2NRUA 2E9OA 4ZS4A 4I6FA 3VO3A 2QVSE 4JVGA 3ORIA 4HZRA 5AV1A 4EBWA 5A4TA 4BY9E 4XP0A 2W5BA 5HU3A 3DB8A 3T9TA 3QQGA 5DYJA 3O8UA 5E8WA 2NRYA 5CEQA 3FMEA 3LFEA 4HCTA 1LPUA 2W9FB 4HNIA 2QOCA 3C4FA 1Y57A 1MQBA 2XM8A 1FPUA 1LP4A 4HOKA 5DRDA 4C38A 4R7BA 4OTGA 5HVYA 3GVUA 4DFBA 4XH6A 3RAKA 3FHRA 4M69A 2XCKA 2XCHA 3O51A 3RPOA 3D14A 2XNBA 2Q0NA 4E5AX 4ZSAA 1OIYA 3BEGA 4AU8A 3SA0A 2JD5A 4FEQA 2BCJA 5EQYA 2OKRA 2ZDTA 3A4PA 3LFSA 2UV2A 3UMXA 1E1XA 4Z16A 4FSWA 3DJ5A 3EFLA 3KMUA 4FK3A 3AC5A 5D12A 1PYEA 3RI1A 4HVSA 4WHZA 4XRLA 3ZZWA 1ZYLA 2WHBA 2CLXA 4FNYA 5DGZA 2RFSA 4DH5A 3IGGA 4I4FA 4L3JA 4W8EA 4Y73A 1R0PA 3QYZA 3PYYA 1ZXEA 4CFNA 2XBAA 1WBOA 3P78A 3SRVA 3OOGA 4QT1A 3SAYA 3W2QA 5CASA 4F99A 4X2GA 4EH3A 3NW7A 4F7SA 4JR3A 4OGRA 3EFWA 3E93A 5K3YA 1CM8A 5CALA 4QNYA 2UZWE 3EYHA 5EM5A 4XRJA 1EH4A 3F2AA 4F6UA 2C3JA 4C02A 4CEGA 3AC3A 4RIWA 4EEVA 4P2KA 4W8DA 3UYTA 4Z55A 4R77A 4JLCA 4R78A 4YO6A 4F1OA 3VUMA 4LL5A 4EOOA 3PY3A 4A9RA 2W1HA 2QNJA 5EK7A 4RWLA 1DAWA 5AR7A 4CMUA 4ZSJA 4CVAA 5DLSA 5HGIA 4BBFA 4G31A 4C7TA 4CG9A 4IDVA 4IAFA 4OT5A 1WFCA 4Y5HA 5HG8A 5CQUA 3WIKA 3PXQA 4FYNA 2BFXA 5A4LA 5KMKA 4HVIA 3VBYA 4O21A 4BL1A 4QYHA 4E93A 2YWVA 3V01A 2GU8A 3R04A 4C4FA 1WBTA 5D9HA 5IQBA 2OXDA 1YQJA 3R01A 4LOOA 4DCEA 3JVSA 4RJ5A 4BDBA 4C0TA 3U54A 3EN9A 3DFAA 5I3RA 1PXOA 2R3KA 4CQEA 3BELA 5G6VA 5IQCA 2QO2A 2YCFA 4KWPA 5A9UA 4MKCA 3TACA 2YFXA 5EOLA 2YM7A 4FTLA 4FTCA 1TQMA 1PY5A 5AUUA 2BZHB 3LXNA 5LVMA 4AW0A 1SM2A 3GU7A 4JL9A 1PKGA 3UVPA 3NLBA 3OCBA 4BKYA 3RK5A 3GP0A 3ITZA 4WNOA 2ZJWA 4FNWA 3WF5A 2UZTA 2YABA 2CNUA 5HG9A 5JQ8A 4RJ6A 3SOCA 4CRLA 3FMKA 3HMMA 3LCTA 3BBTB 2C30A 4QOXA 2J0MB 2J7TA 2ZDUA 4WD5A 4BDDA 4DFUA 4K18A 3DBQA 3F2RA 5J7BA 5H3QA 3BYOA 3U51A 4W4WA 4BZOA 4IX6A 4YSJA 5E4HA 1P2AA 1Q24A 4WA9A 1Z57A 1Q99A 3O0GA 5J8IA 4RT7A 3OF0A 2C0OA 3KXNA 2OICA 4GT3A 4FKGA 5DHJA 3TZMA 3ZLSA 4UY9A 4LFIA 3VW6A 4F9BA 5CQWA 4DC2A 4UBAA 4EQMA 4QTDA 1J3HA 5IH4A 2ITNA 2XNMA 3QUDA 3VUHA 5HX8A 2R64A 5K4JA 3KRJA 3V5TA 3LFBA 5AIKA 4BFMA 3NUAA 3ROCA 1GZNA 4M68A 4EZ5A 1R78A 1M2RA 3O7LD 3UYSA 4WT6A 4EZ3A 2B7AA 5E90A 3DT1A 1Q97A 2RGPA 4BC6A 3ZOSA 4OTFA 2ZMDA 2X7FA 3D7TA 4FKPA 3VBVA 2BR1A 2R3FA 3II5A 3FMHA 1YI4A 5CAUA 5F4NA 4IBMA 2PUNA 4W4VA 3GT8A 4CLIA 4BYIA 1M7QA 4I94A 3FLYA 2X8EA 4F0GA 3H0YA 3QGWA 3R00A 2BAKA 4U3ZA 3IDPA 5ANOA 2REIA 1WVWA 5AX3A 2ZAZA 2WMSA 1OUKA 1R39A 2HIWA 4EI4A 4EQUA 5IEYA 4AWIA 5J1WA 5IQFA 3LCDA 2OJ9A
chains in the Genus database with same CATH superfamily
2OGVA 1JOWB 2ITZA 5AV3A 4G3FA 4YHTA 5A4QA 3FL5A 3UNZA 3FKNA 3UIUA 2E9PA 4ANQA 3BYSA 3FMLA 4ORKA 4NKSA 3KC3A 3TWJA 3P0MA 4A4OA 3GI3A 4QTBA 5J5SA 3Q6WA 2CKEA 4RIOA 2QR7A 4IAZA 1UNGA 4DEGA 3C5IA 1TVOA 5BPYA 3KN5A 5EHOA 3WZDA 2IW8A 5LWMA 2XMYA 4ANSA 1GZKA 3G9NA 2YCSA 4KSPA 4XV2A 1CDKA 4Z7GA 3HKOA 3DLSA 4ENXA 4I0TA 4RVTA 4M15A 3RNYA 2YACA 3HL7A 3OY1A 4WG5A 5EW9A 2RL5A 3I0OA 3MBLA 2CN5A 2W5HA 2VWBA 3BLAA 3AQVA 2YAAA 4KUJA 4RGJA 5M06A 2OW3A 4NT4A 4GYGA 1Q41A 2PTKA 3FMMA 4YZBA 3MV5A 5D41A 2BIKB 3SD0A 2GSFA 2X2KA 5LMAA 2P33A 4O22A 1ZYDA 3RPYA 1FGKA 3P7AA 3JR1A 1OKZA 4ZZMA 5DMZA 2YZAA 1QCFA 2QONA 1B38A 2J0JA 4RC2A 3LQ8A 1K3AA 3ORZA 2QHNA 3QQKA 4HGEA 5KHXA 2YZLA 4HZSA 1QPJA 2W96B 1V0PA 1NXKA 3LFNA 4LUEA 3MTLA 4FYOA 4O0SA 5BMMA 3RZBA 4FVRA 2WEIA 4BIEA 4I0SA 5T3QA 3TG1A 2A1AB 5M53A 4YBJA 3SVVA 2R3GA 3U8WA 4J1RA 4GJ3A 1S9JA 3HMIA 2C6DA 1T45A 4RIXA 4XOYA 3UTOA 4ARKA 4EHEA 3FLZA 5A4CA 4GW8A 2O64A 4DBXA 4Y8DA 2FSTX 1V0BA 2PVJA 3W0MA 2PZYA 3VAPA 3W10A 2BDWA 4IFCA 5CEPA 5JH6A 5EH0A 4I3ZA 4ZJIA 2VAGA 3FPMA 4LGHA 1R1WA 2ZM3A 4ZZOA 2WMWA 2Y7JA 3EN7A 5HQ0A 3ZHPC 2PULA 2JIIA 3GGFA 4GMYA 3LXLA 3F88A 5K4IA 4U42A 3NUSA 2XAMA 4R5YA 2JAVA 1V1KA 2R3RA 3FZTA 5LMKC 4QP8A 3CTHA 4XV3A 2F4JA 2RFEA 2V0DA 3DDQA 3HYHA 4ACGA 4KS7A 4RLKA 4QQ5A 3FXWA 3PIYA 3UC4A 3QUPA 3M42A 5HESA 4YU2A 2OSCA 4HNFA 4ZTNA 4DGGA 4D1SA 3HVCA 3Q4TA 2AQXA 4N6ZA 3HV3A 4QMMA 3V5LA 4F9WA 1PMNA 3OROA 3W18A 2QR8A 3C0HA 1PRYA 2YM3A 4DTAA 1H0VA 3U6IA 5AP1A 4UWYA 3TDWA 3MGYA 4D1XA 2G2IA 5IUGA 4GSBA 4F63A 2X9FA 5CF8A 2P3GX 3OFMA 2WU6A 3REPA 3WF8A 1O6YA 3D7ZA 3UZRA 2XZSA 2BROA 2X0OA 5LVLA 1BL6A 3DNDA 3FY0A 3GCSA 2F7EE 5DE2A 3G6HA 3PSDA 3LPBA 2QCSA 2QOIA 3R2BA 3E3BX 4Y46A 4AT4A 5CU0A 2XNPA 4O1PA 2WMBA 5EW3A 4QP4A 3TNPC 3D2KA 3QQLA 3BL9A 5DT4A 4H1JA 2VTTA 4AX8A 1MRYA 1FGIA 4V0GA 2CGUA 5DIAA 5GZ9A 4QMQA 3F82A 1ZLTA 2JIVA 2ZV9A 5LVPA 2XF0A 2XK3A 4JXFA 4AA4A 2XJ1A 3NAXA 1YWNA 5CU6A 1JKLA 4BTFA 2GMXA 3QQJA 3D9VA 4XG6A 5EDPA 4PDSA 3OEZA 2AYPA 3PUPA 4D4RA 2O3PA 3QFVA 4WOVA 4AT5A 4ACDA 3ROYA 4KIKB 2X81A 3U9CA 4YZNA 4C4IA 4NM5A 4A07A 5HVKA 4UX9A 4DE4A 4Q5HA 3UIMA 4JIKA 3VS4A 4Y5QA 4LGGA 3ZC6A 2PUUA 1U46A 5HICA 1FMKA 3PJ8A 1PW2A 2EWAA 2G2HA 4HYUA 3PVBA 5CU3A 3OOMA 4C33A 3Q52A 1ZOHA 2XB7A 2CKQA 3DBEA 4U0IA 4R3PA 1OITA 4DTKA 3ZBXA 5GINE 2H8HA 4NW6A 2C4GA 3KFAA 4GYIA 4KRDA 5A4EA 5FM3A 2I7QA 3V6RA 2ONLC 4EHVA 3SDJA 3Q4ZA 4FT9A 4I6LA 3MY0A 2FYSA 3A7FA 4QMTA 3KKVA 3HAMA 3MVMA 2GQSA 5DNRA 2RIOA 4B8LA 1Y91A 3EQRA 2GS2A 3ZO1A 4H39A 4O86A 4GL9A 4UMPA 1URWA 3E5AA 3GU5A 4ZMEA 1YOJA 4XG3A 3CTQA 3RVGA 3U4UA 4CMTA 1YW2A 3QTRA 4ZTSA 3PG1A 3CQEA 4AXEA 3A8XA 2IZRA 2UW8A 4YBKA 3HP5A 1J7LA 5GHVA 1ZY4A 2HZ0A 4K1BA 4ANLA 4C4EA 5CVFA 2X6DA 4O7NA 4G6LA 4D2RA 2JDTA 3NCGA 2P2HA 4JR7A 4KKGA 3JYAA 4OTIA 3EFKA 2IW9A 3DAKA 3E3PA 3QU0A 4EK5A 4I4EA 4HYHA 3EQIA 2W05A 2DYLA 4J71A 1H01A 2UW5A 1XBCA 4KD1A 5CAOA 4F6WA 2CSNA 2VTPA 1G3NA 3MSSA 2WTDA 4G9RA 5HX6A 5DRBA 4GU9A 1W84A 5FLFA 1SMHA 3OD6X 3W0RA 3L8XA 3PIXA 5C8KA 5HE0A 2A27A 3ZO4A 1Z9XA 3KF4A 2WTIA 4DLIA 4B8MA 1YDTE 5DR6A 3GCUA 3DQXA 3FI4A 4G17A 4MD9E 4YJRA 4EH2A 2CGWA 3IW4A 4X3FC 1X8BA 3CGFA 1ZZ2A 3S1HA 3MWUA 3ZDUA 2VWXA 3QQHA 4LUDA 2IVUA 4Y72A 3SW4A 4BGHA 4D0XA 5F94A 5KUPA 3R1SA 3TDVA 3QL8A 1GZ8A 3KF7A 5IH6A 2J0KA 2YN8A 2I0VA 2X4FA 4FSZA 5AUTA 3IKAA 5L2SA 3G6GA 3IW8A 1GIJA 3NFFB 2X39A 4DFYA 3AC8A 3ZUVA 3Q60A 3QRIA 4U8ZA 2NYAA 3KN6A 4GS6A 4NCTA 3F3WA 4ZK5A 4CFMA 1NA7A 2YM8A 2VNWA 4G1WA 3PJ2A 5CANA 5K5XA 3MDYA 4DH3A 3TV6A 2W9ZB 3MVJA 2HW7A 2VTQA 4G2FA 3QTUA 4DEEA 2W1DA 4MCVA 3R9DA 5E7RA 5HKMA 4CFFA 1XR1A 2XK8A 5HG5A 1W2FA 2IW6A 5KZIA 3BYVA 3ZEWA 4FTJA 4PP7A 2A2AA 3Q3BA 4IXPA 4H58A 4EYMA 4IVAA 4EOSA 1E9HA 4X6RA 2F9GA 4WBBB 1VYZA 2PMLX 5GJGA 4A4LA 3UQFA 3QWKA 5AP5A 4HW7A 2H6DA 3KXZA 4TN6A 2YA9A 4ZSEA 4C4JA 4LV7A 3KB7A 4DH7A 4GFGA 1U5QA 3W16A 3C9WA 4H3PA 3QXOA 2GHLA 3BWFA 1XMMA 3E88A 2UZEA 3GOPA 3THBA 5L8KA 5AR8A 5ANGA 4WUAA 3VC4A 5FXSA 5CAPA 2DUVA 3JXWA 4FF8A 4EYJA 4CGAA 3ZEPA 5E1SA 3W8QA 4YNEA 3OP5A 4C36A 1PXLA 1ZY5A 2VWIA 2VTOA 3GCQA 2UZVA 3BL7A 1H26A 5M57A 4I1ZA 1P4OA 4RJ3A 5IEVA 4U45A 1HCLA 2Y6MA 3EIDA 3F3TA 1BI8A 3TNWA 3V8TA 4KIKA 2J4ZA 4UN0C 4APPA 3JS2A 3QXPA 5AWMA 4JAJA 4QMWA 1I09A 4FKLA 3BV2A 4FKQA 4XV1A 5JQ5A 5CVHA 4DGNA 3DK7A 5L6PA 1NVRA 3GQIA 3FLNC 4MWIA 3DV3A 4AACA 4YJOA 2IN6A 2W1IA 4F6SA 5LCJA 1SZMA 2UZUE 3FLSA 3ATSA 4L8MA 2W1FA 5E8TA 2WNTA 4FNXA 1YHVA 4AF3A 1G5SA 4BCOA 1XMLA 2VTSA 4G3DA 4IDTA 3PXYA 3EYGA 4JJRA 4E4XA 1TQIA 3NYXA 1GZOA 3N9XA 4MQ2A 4NIFA 4QYEA 5I9UA 3V04A 3MA3A 1TQPA 4E5WA 3R2YA 1OIQA 3O50A 5IPJA 3VULA 4EH8A 4ZSGA 4JAIA 5C9CA 2PHKA 3OW4A 4X2JA 3LM0A 4P5ZA 4BCJA 3PPKA 1OPKA 3P5JC 2FO0A 4BZNA 3LZBA 5TF9A 3VJNA 3L9MA 4A7CA 5IMEA 4O4DA 2ITUA 2GFSA 3QRTA 3SRVB 4ITJA 4BCPA 4FICA 3GC7A 5FQDC 4FGRA 2OIQA 5HTCA 3R8VA 3U9NA 4DDGA 2GTMA 2IVSA 4O7RA 3V5WA 1NW1A 3DKGA 5CEIA 3ORLA 4WG4A 3S4QA 4BHZA 3K3IA 4AZVA 1WVYA 4ZMFA 3AD4A 2WEVA 3DY7A 4YTHA 5T6KA 3EKNA 5E8XA 2V7AA 3IW7A 4FV3A 4JDIA 3V8SA 2YJRA 5FRIA 3VRZA 4IZ5A 4JG7A 5FBNC 3ULIA 2XVDA 3CC6A 4RWKA 3FZPA 3L9PA 3MH3A 5CT0A 2R3JA 2QI8A 4CTBA 1W98A 4D9TA 1RJBA 4JQEA 2G01A 3OBGA 3DKCA 4YTIA 4C8BA 1W83A 4RJ7A 4J8NA 4X21A 2UZBA 5M51A 1J91A 2WPAA 1LEWA 5DG5A 2C6KA 3VNTA 4BI2A 4FV2A 5BX0A 1JKKA 3MVLA 4RJ8A 3GBZA 1YXXA 2G2FA 5K0KA 2QOLA 4QQCA 1JAMA 2OJFE 2W1EA 1MP8A 5IQDA 3Q9YA 4MWHA 2B9JA 3IDBA 3LIJA 4EJNA 3OWLA 5DR2A 1YXVA 2C5YA 1PMUA 4GH2A 4TNDA 3ZC5A 3OT8A 1BLXA 4EC8A 4IZYA 2NPQA 3ZFYA 1YXTA 4XHKB 4IANA 4U5JA 2A4LA 3KREA 2BHEA 3NDMA 2YCRA 3R7OA 2X2LA 3F5UA 4DG3E 5GZ8A 2PYWA 5M08A 2OXYA 3Q4UA 5I9XA 4RWIA 5I9YA 5DVRA 4AN3A 1WBNA 4ANNA 5M09A 4YTCA 2WQNA 2CKOA 3PA5A 4P4CA 5HLPA 2B4SB 3DQWA 3RP9A 4QRCA 4CXAA 4U44A 4EOIA 3QX2A 1H4LA 4AN9A 3O8TA 5AV0A 3TT0A 5IA0A 5BVKA 3UQCA 2XA4A 2XANA 4KKHA 4PRJA 3LJ0A 4XG8A 3LCSA 4QTEA 2HK5A 3ENHA 4M12A 3O96A 4FC0A 5A6OA 4QPAA 2Z7RA 4AA5A 3OWKA 3SC1A 1J7IA 1CKPA 3HX4A 5M55A 4MNFA 4AOTA 3ORTA 4RX9A 2P55A 2VO6A 3D7TB 1Q8TA 4LL0A 2R0IA 4OTRA 2OK1A 4KIPA 4O0TA 1DM2A 3W33A 5KNJA 3ZLWA 1CKJA 5I9WA 4MBJA 4F7LA 1H07A 2C6LA 2GNHA 2O63A 2YJSA 2QURA 3W32A 3DTCA 3IK3A 3UPXA 5J9YA 3VIDA 5KMJA 3PSBA 5KMOA 2J9MA 3ZSHA 3MB7A 4X7QA 3FHIA 2WGJA 3BLRA 3SHEA 2DWBA 2P2IA 2C3KA 4W9XA 4N0SA 2XK6A 4IX5A 3E62A 2R4BA 2GHMA 3E8DA 4X6QC 5DI1A 4TYJA 1VYWA 3DBDA 1PXKA 4MXOA 5CSWA 3LFQA 4OBPA 4ZY6A 2BRNA 3R7YA 4FSQA 4FZ7A 4QMYA 3DGKA 3R1YA 4FL3A 4GVJA 4JT3A 5L8LA 4OR5A 2VGOA 1BUHA 3EMGA 3VQUA 4AN2A 2CKPA 1Q8WA 4K2RA 2B54A 2OZAA 3CXWA 3AXWA 3OZ6A 2OH0E 4AAAA 5LVOA 3DAEA 3VJOA 4D5HA 3BV3A 2PVKA 3F5GA 3L8VA 1YI6A 5AUVA 3Q2JA 3O23A 2BIYA 4EK8A 4F9YA 2WKMA 2X8IA 4IWDA 4E4NA 2OFVA 3DS6A 3QC4A 1H00A 5GZAA 3NUPA 2B0QA 4U3YA 1JVPP 3W2OA 1Q3WA 3HMOA 2HXQA 5CSPA 2VO7A 2VTRA 3PWYA 1PKDA 3SG9A 3FXXA 3QHWA 3AKJA 5A54A 3U4WA 3UC3A 3EOCA 4K33A 2XARA 1KWPA 2O5KA 3QX4A 5D7AA 1OPLA 3COHA 2JFLA 4RPVA 4B6LA 1OL2A 3KL8A 4DHZA 1YOMA 4JBQA 3V6SA 3VF8A 4D4SA 5ACBC 5IKWA 4AFJA 4NTTA 3QZIA 4IJ9A 4BDHA 4DEBA 4R1VA 3W1FA 5HIEA 4PX6A 3IOPA 4TWNA 1MRVA 4EBVA 3PRIA 3BI6A 1JSUA 3GB2A 3JVRA 2R3HA 3EQPA 3MS9A 1W0XC 3NYVA 5HU9A 3H9FA 3POZA 4FIFA 4L01A 4W4YA 5AUZA 3RCJA 5LOHA 2CDZA 2F7ZE 3TXOA 5CI6A 4BCGA 4UXQA 3RZFA 3DZOA 4KINA 3OCSA 3PY0A 4FK6A 4C59A 2QOKA 5T68A 3QD4A 4AXDA 4QP6A 3EKKA 1GIIA 3PDTA 3ZYAA 1ZWSA 3MN3A 3FZ1A 2Y6OA 4GFOA 2OXXA 3OXZA 4GG5A 3FKLA 4NW5A 4RIXB 2B9IA 3OCTA 1AGWA 4IIRA 4C57A 4L7FA 5HZNA 1ST0A 4YLJA 3C7QA 1OKVA 3P86A 4GJ2A 5AP0A 1SVHA 3NGAA 3VRYA 4F1MA 5BYYA 4A9SA 5ICPA 3S00A 2WO6A 4YMJA 2PWLA 1F3MC 2XJ0A 3ZSGA 4BRXA 1Q61A 2B55A 2WTJA 2XKEA 4K0YA 2R0UA 1B39A 3G2FA 4RJ4A 3BKBA 2SRCA 4LMUA 5H8EA 4HYSA 5EYDA 3T8OA 4I6HA 5E1EA 5E92A 5EM7A 2VTJA 4J52A 5CEKA 1F5QA 4I6QA 5ETIA 4RFZA 4RC4A 3TYKA 3HAVA 2JGZA 4DITA 5CXZA 3EN4A 4O27B 2QLUA 3LW0A 2W7XA 2Q83A 2FA2A 3WYXA 3ZDIA 2WAJA 1CSNA 1WCCA 3LE6A 4L43A 5FDPA 2VX0A 3SKCA 5FTGA 5C4LA 2I40A 4CFVA 2J90A 3HDNA 2LAVA 4U41A 4APCA 4DGOA 2RG6A 5LARA 4MYGA 4FR4A 5CSXA 3RWPA 3SLSA 4F08A 5L3AA 5HIBA 1YVJA 2QU6A 4FV9A 4USFA 2BVAA 4JOAA 3FSFA 3QKKA 5H8GA 3RPVA 1PXPA 1XKKA 4MXCA 3IGOA 1JKTA 1GIHA 4FSNA 2WTCA 4D4YA 4K9YA 4CKRA 3S95A 3F2NA 1G8SA 5I3OA 4EK6A 4HVGA 5CEOA 2YCQA 3E7VA 4N70A 1FMOE 2VX1A 4QD6A 3PZEA 4WO5A 4IX4A 5EKOA 3BX5A 2EB3A 1ZZLA 4E6DA 2QQ7A 3DLZA 4GKIA 4U97A 3FKOA 4EOMA 5LMKA 4AOJA 4BDAA 1MQ4A 1JWHA 2GNIA 1OI9A 4BB4A 3VUGA 1UWHA 3ZO2A 3UDBA 3TKHA 3R28A 1OMWA 4ZY5A 1M7NA 4HGLA 2YM6A 4UZDA 4ZY4A 4MF1A 5DH3A 4FZAB 4AGUA 4V0GB 2W06A 3CP9A 3R21A 4YUQA 3JY0A 1E1VA 3BPRA 3EQGA 2EVAA 3CKXA 3R02A 3ENMA 1XH9A 2G15A 1YWRA 2B53A 2FSMX 5HCXA 2E9UA 4AGCA 1AD5A 4WIHA 4FBXA 2XIKA 2C68A 2ZV7A 5F9EA 5E8UA 2YEXA 5DA3A 5JFWA 1JKSA 2ETKA 4EL9A 4O2PA 3IPHA 2O2UA 3BU5A 4BGQA 3L8SA 3FY2A 4OTHA 4YHJA 4XG7A 4O7LA 4TYHB 1CKIA 4BGGA 5AP4A 4LDTA 2GFCA 5A3XA 3VQHA 4G16A 2UVZA 4O6EA 4C58A 2JKQA 2HYYA 3C4WA 3KXMA 1U4DA 1OZ1A 3NPCA 4CFUA 2Y9QA 3GENA 5BNJA 1OBDA 4FIJA 4IM2A 4B99A 3NS9A 3HUBA 4IH8A 4LRKA 4FV6A 5M07A 2X7OA 3T3VA 2BKKA 2PVRA 2RF9A 1O9UA 2YM5A 4UALA 2UZNA 3D5XA 3I4BA 2XNNA 5KKRB 5D7VA 4I5MA 3K3JA 5A6NA 3VS2A 4G3CA 1RQQA 3DKOA 2E9NA 2X2MA 3VN9A 1CMKE 1XQZA 2R2PA 4FL2A 4M0YA 4Y95A 4ZJJA 3HV7A 3ZUTA 2ZYBA 3BGPA 3NAYA 4NWMA 1YWVA 4ZTHA 3TTIA 2BDJA 2PMIA 5AA9A 3PUFC 4WG3A 4J53A 5HLNA 4FKVA 2YM4A 5HIDA 3LFAA 4DGLC 3FMJA 5AEPA 2EXMA 4S33A 3WE4A 2CJMA 1JNKA 4DFNA 4YJUA 3DFCB 5HG7A 2UW4A 4OTWA 5E8SA 5AV4A 3WF9A 3GC8A 2W0JA 2WTWA 4O7YA 5IF1A 2KULA 4QMZA 3RKBA 2J6MA 2JBPA 3EJ1A 1H27A 3COKA 4R5SA 5BYZA 3F6XA 1TFFA 3ODYX 3NWWA 1OGUA 3W2RA 3UNKA 4F64A 4NM3A 3DAJA 2OIBA 4U80A 4YC3A 3UGCA 3NMUF 4M66A 5F20A 3FWQA 3F9NA 4BTKA 4CKIA 4O81A 1WZYA 5JFSA 5F95A 2Y4IC 4OAVB 2YIRA 4JDKA 5EM8A 3FQSA 2WU7A 4FZDB 2CNVA 4IFGA 4ASEA 4C61A 3R9RA 4O4FA 2ZM4A 4MXYA 2WMRA 3PY1A 3ETAA 3QF9A 4YJTA 5J9LA 4IVDA 2XNGA 1REKA 5K9IA 2YIXA 3BU6A 1IAJA 2XRUA 4GCJA 3KA0A 5IDNA 3CD8A 5EOBA 2VX3A 1BYGA 1U54A 3QCQA 4L44A 3NVMB 4ZXTA 4CQGA 2Z2WA 4AA0A 2CMWA 4HPTE 4O4CA 5JGBA 1H0WA 2BZJA 4FTIA 1H28A 2HCKA 5LXMA 5AJQA 1L8TA 2HZ4A 3HV6A 5GIOE 4FG8A 4IWPA 3QKLA 3MYGA 2UW7A 3E64A 4I5HA 4FKSA 3VF9A 3PVGA 3V5QA 3PPZA 4L45A 4X3FA 4CLJA 4PNIA 3OT3A 4L00A 3E63A 4LRMA 4RBLA 4GKHA 3CCNA 4MXAA 3EWHA 3RPSA 2QG5A 2BHHA 1KE7A 4ERWA 2ITQA 4BCQA 3AMAA 4WBOA 3AC4A 5IQHA 4Z9LA 4RZVA 1F0QA 4DTBA 4KAOA 2JDSA 4DEAA 2A19B 4XUFA 2Q0BA 3P4KA 5I9ZA 1DI9A 5JFXA 3CJFA 2E9VA 1NT2A 2NO3A 3UOLA 1UV5A 3FV8A 4HPUE 4AZFA 4EK3A 3NW5A 5BQ0A 3C50A 4DG2E 1UU3A 3DJ6A 3F5PA 4FZ6A 4IAKA 4C2WA 5AR5A 4FEVA 1W2CA 2GNGA 5CEMA 4IWOA 4GU6A 2QOOA 4C3RA 3RK7A 3ORMA 3QC9A 3UOKA 4F65A 4D2VA 1WBSA 4FVQA 5GJDA 4UMRA 2JDVA 3P5KA 3ZUUA 5EYMA 3QWJA 2E2BA 5BUIA 2FSLX 3CBLA 4DHIB 2BDFA 3QA8A 4PDPA 4IZ7A 2W1CA 2Z7LA 5H8BA 3TN8A 5HO7A 2XALA 5L2QA 4BN1A 2ESMA 4MBIA 2YAKA 3TJDA 3AG9A 4DHFA 1ZYJA 4QYGA 5CF6A 4QQTA 4FTRA 4AXAA 1V0OA 3SX9A 3WYYA 4N57A 4FVPA 3UO6A 4TYHA 4YJPA 3KCFA 1DI8A 4BKJA 5C8NA 2R3OA 3EN6A 3ZLXA 3GFEA 4TWPA 1GAGA 2O65A 2PZ5A 3B2TA 3ORXA 4P5QA 2CHLA 5IU2A 2GNLA 4GRBA 5J79A 3BU3A 2Z7SA 5KCVA 3FEGA 5E91A 2HWPA 4Q9SA 2UW9A 2V5QA 4EKKA 3R9NA 1Y6AA 2R9SA 3DA6A 1PXIA 1KOAA 5IMXA 1B6CB 2J0IA 5EHYA 2WTKB 4R7HA 3OS3A 5ANJA 4QPMA 4DLJA 5IZFA 3M1SA 3ZZEA 4GVAA 2X0GA 3TZ7A 3UVQA 4NIFB 4EUTA 3QRKA 4JRVA 3ZTXA 2AEGA 3R8UA 2OIDA 2JDOA 3MPAA 4AE9A 4FTOA 4ZTRA 3DXPA 4NM0A 3U6JA 4BKZA 5BUJA 3DOGA 3CY3A 3QQUA 2QODA 3MJ1A 4AOIA 3ANQA 2FUMA 3R7VA 4Y83A 4D2SA 3TKIA 5IA2A 3VS1A 2V7OA 2OJIA 4E7WA 3HMNA 4GT4A 4L7SA 4RZWA 4D55A 3LKMA 4EH9A 4O6LA 3R7IA 3AT3A 3OHTA 2KTYA 1XHAA 4MQ1A 5CY3A 5B7VA 5M4UA 5AMNA 1XH8A 4NYEA 2O8YA 4QQJA 4BCFA 3BHUA 3NNUA 2DQ7X 1KE6A 2PMNX 2XNOA 1WVXA 2OF2A 5C03A 1M52A 3O2MA 4XJ0A 2J5FA 4PUZA 2Z60A 4FT5A 1R0EA 4RRVA 4A06A 3HV5A 3QQFA 4AP7A 1ND4A 3IOKA 4GT5A 2ZB1A 1PMEA 2VTHA 2YLFA 1REJA 1APME 3HRBA 3PXRA 3EH9A 1YDSE 4U40A 3WILA 1WAKA 3A99A 3ET7A 2VO0A 4MF0A 4MD7E 4YZCA 5DT0A 1Y8YA 2HOGA 3WF7A 2WXVA 3LCKA 4O0XA 4UWCA 4QNAA 4I23A 5CVGA 3ORPA 4TKSA 4YGAA 2C0IA 4WRSA 3JUHA 4EQCA 3LQ5A 4PY1A 4DH8A 4NL0A 3W8LA 4BWXA 5CXHA 3TTJA 1H25A 1SYKA 3EQDA 2BZKB 2WMTA 2UVYA 4ZLYA 5E9EA 5DPVA 1STCE 5HD7A 2J50A 4L9IA 2J2IB 4NFMA 4L3PA 3ML1A 3K2LA 4OTDA 4DBNA 2JITA 4UZHA 4EWHA 4WKQA 5HTIA 3EZVA 4FE2A 1CTPE 4NEUA 3MI9A 3NZ0A 5HE2A 4R3CA 2IWIA 1WBWA 5CENA 4GIHA 2OFUA 5KMLA 3LMHA 4DT9A 4M13A 4D0WA 4OLIA 3ZMMA 3IO7A 1IA9A 3UMWA 5GIPE 4LRJA 1BL7A 5BV3A 2A98A 4I5PA 4BDKA 3P79A 2BPMA 4XX9A 2HW6A 2HZNA 4F4PA 3A62A 2JKKA 4CZTA 3O7LB 3R71A 3WE8A 2JBOA 4O0WA 2QU5A 3H30A 4IE9A 4BF2A 2C69A 5DBXA 3BQRA 4CV9A 2F7XE 5AM6A 1Q4LA 2WMUA 3R83A 4IADA 4XP3A 2GQRA 2OF4A 4E6CA 4FRFA 2XEYA 1JQHA 5AP3A 3TM0A 4LV5A 4HVHA 4FSTA 5CX9A 4RFYA 3QCYA 3ZXZA 1IEPA 4CRSA 3CPCA 4LGDA 3C1XA 3E87A 2IPXA 4O7SA 4O0YA 3PXKA 2BILB 3BWJA 3O17A 1UU9A 5A14A 4O7TA 2XM9A 1XWSA 4JX3A 3FMNA 3TEIA 3TI1A 2X8DA 2X6EA 5HORA 3W2SA 2UUEA 2HAKA 3OBJA 3U6HA 1H8FA 2UZDA 4IC7A 5CI7A 4DT8A 4FG9A 4U81A 1FVVA 2HENA 3R6XA 4TTHB 3I6UA 4ASXA 3IONA 1H24A 4J98A 1ZAOA 1VEBA 1IRKA 1ZYSA 4ZP5A 3TZ8A 3GEQA 4KRCA 2VNYA 4I6BA 3V5JA 1XBBA 1UWJA 2VTAA 4MH7A 4F09A 3DJ7A 3DBCA 2BFYA 5CLPA 2OZOA 2IVVA 5J5TA 5CZIA 5TE0A 3TV4A 3ZONA 4J96A 3C4EA 3ALOA 3FQEA 1IR3A 2OZAB 3UO4A 1URCA 4CG8A 4CSVA 2PK9A 4O7ZA 2C6OA 2XKDA 3IW6A 5DEYA 3PFYA 4UMQA 2XYUA 5HTBA 3WI6A 4B7TA 5F1ZA 3R7UA 2WQMA 2JLDA 3DTWA 4JI9A 5BVDA 3E8CA 3QYWA 4QMSA 3R7EA 4D1ZA 4J95A 3U87A 4AZTA 3UJGA 3I1AA 4C3FA 4O0UA 5BUEA 2X7GA 1FOTA 4FIIA 4CD0A 3BZ3A 3NFGB 3SGCA 2R3LA 3Q4CA 4EOLA 3NEWA 5KE0A 1A48A 4BBEA 1OL1A 1YXSA 3PSCA 3CD3A 2RKUA 2XIXA 4XNEA 1G8AA 4W9WA 3NVKI 4XG9A 2QD9A 1OVEA 4S32A 2I1MA 3BIZA 4IM3A 2YDJA 4BDCA 1S9IA 3LJ2A 3ZFXA 4RX7A 4RA4A 1M2QA 4DFXE 3V3VA 3GUBA 5AUYA 4QTAA 2VWZA 4KABA 3RM7A 4FIGA 2CNQA 4AAYA 1XH4A 4YC8A 3W2CA 3GCPA 3EQFA 2ITYA 3BHTA 2G9XA 3EHAA 4FTUA 4QMPA 2LGCA 4QMLA 4RIYB 3R8LA 4EHGA 4FEUA 5I5ZA