1REKA

Crystal structure of camp-dependent protein kinase complexed with balanol analog 8
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Balanol analogues probe specificity determinants and the conformational malleability of the cyclic 3',5'-adenosine monophosphate-dependent protein kinase catalytic subunit
pubmed rcsb
source organism Mus musculus
total genus 97
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1rekA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1rekA02
3FSKA 2JKKA 3F5GA 3ORKA 4I21A 3OCTA 3PG3A 4I41A 1P2AA 4PMMA 4YTIA 5AR2A 1WMKA 2PMIA 1UNLA 5IDPA 3GU7A 3NAYA 3DQXA 5K5NA 4JG7A 5EQYA 4X2KA 4BHZA 3HL7A 3P5KA 4IACA 5GIPE 3QYZA 5BVDA 5KMOA 4DGGA 3PDTA 4NSTA 3ZHPC 4AUAA 3BKBA 5EK7A 5EW3A 1H01A 4BCHA 2VTSA 2R9SA 1YXVA 3C7QA 4GU6A 3SX9A 5E4HA 4KSPA 3PZHA 4EH6A 4XV3A 4EH3A 5FEEA 5KHWA 4U44A 1H1SA 3F5XA 4DC2A 5ANDA 5BVOA 4QP8A 4QQCA 2ZV9A 4WG5A 4I4FA 3C5UA 4DF3A 3NCGA 4WO5A 4OLIA 2UZTA 1IG1A 4RX7A 5AUVA 3DAJA 2QKRA 4FEXA 4FK3A 3HMNA 4RIOA 3LW0A 4DFNA 4E26A 4DEAA 4MCVA 3GCQA 4FOCA 5LWMA 3TV7A 3M11A 4GSBA 3PVUA 3W55A 3DK3A 2R3LA 4IVCA 3ODYX 2C3JA 4TNBA 2QI8A 2RG5A 3F66A 3R7VA 2O3PA 3W2PA 2UUEA 5HESA 3AC3A 5L8KA 4C59A 3MSSA 4PDYA 2QOQA 3ZM9A 3BEGA 3R1SA 2UZNA 3CC6A 3U87A 2X6EA 2R4BA 5CVGA 4QMLA 3BPRA 4I0RA 2ITQA 5JEBA 1ZYJA 2IO6A 5IMXA 1A48A 1B39A 5AAGA 4RVMA 4QYYA 1CDKA 3IW8A 3NW6A 2J0KA 4U81A 5CU4A 3TIYA 2OO8X 4TYHA 4HZRA 2JKMA 3R7YA 4IJPA 5C03A 4J8NA 4TXCA 1U4DA 3KC3A 4QMVA 4ALVA 4E8AA 4R5YA 3VQUA 4LMUA 2OLCA 5EM7A 5HE0A 2FH9A 4MNEB 5B2KA 2A2AA 4DHFA 2ZV7A 4F1OA 3QD0A 4I24A 1R0EA 4G3DA 4U80A 3OBJA 3FC1X 4YGAA 5H8EA 1URCA 3HNGA 4DH5A 1PXKA 1QPDA 3CSVA 4DTKA 4YBJA 3CXWA 3QQFA 4N4SA 4FIJA 2YA9A 4IADA 3GCVA 4ZY6A 2GQRA 3VS0A 4EC8A 4EWQA 5HG8A 4FI1A 3CR0A 5BVNA 4FTJA 2I6LA 4IFGA 4HVHA 4OW8A 4KABA 1PJKA 4IBMA 5JFSA 4U6RA 5AR3A 3QZHA 2FGIA 5DT0A 5A6OA 4IHPA 4RWKA 4RVTA 1SZMA 4DH7A 3QHRA 4IVBA 1H08A 4CYJA 5K4JA 2VNYA 3W18A 1ZAOA 1Q62A 4MBLA 4BRXA 4IEBA 3BYUA 3PSBA 4LQMA 3I7CA 3NUAA 4FYOA 5LCKA 3CKWA 3R7IA 5LARA 4RVKA 5AFVA 2G2FA 4QMQA 4KS8A 3LMHA 1BYGA 3BLQA 3QKMA 3ULZA 1MP8A 4J8MA 4D4YA 5FXSA 5L8JA 3A62A 1E1XA 2G01A 3HECA 4ONAA 1H00A 4DYMA 3ALOA 3R21A 4UV0A 2UZVA 3VBWA 4U3ZA 2BDWA 3LFAA 3MB6A 4G9CA 4F1MA 3QKKA 2J51A 3EL8A 3FMDA 3L8SA 4YURA 5B7VA 5HO7A 5JRQA 4X3JA 5A46A 4DBNA 1V0BA 4BF2A 5CU3A 3P86A 3S3IA 3S2PA 3QU0A 4L46A 4AZEA 3QTSA 3C4FA 2A4LA 2OWBA 4TKSA 2QODA 4IX5A 4FT3A 4F7JA 3OW4A 4FKWA 2UZDA 3QD2B 3R0TA 2YIRA 1KV2A 4ZP5A 3FXWA 3D5VA 1XWSA 2BALA 3PPJA 3W8QA 3OD6X 3E8EA 3H4JA 3BU6A 2QNJA 3PXYA 4M66A 3NDMA 5EKOA 5EYMA 4C4EA 4M3QA 5E90A 2YDJA 4UMQA 4N70A 4O0XA 4AZSA 4C2WA 3DPKA 3L9MA 1PXPA 3R04A 2QOKA 5AP3A 2P3GX 4MNFA 1JLUE 5CF8A 2RKUA 4D9UA 2PZRA 3BQCA 2HXLA 3IW5A 3LIJA 4FTTA 4YJOA 5AADA 2HZIA 1QL6A 2OIDA 3IO7A 1F0QA 1CKJA 4CXAA 4L6QA 1ZMUA 2FYSA 4RIWB 4UXQA 5DH3A 4KD1A 1UA2A 5DR6A 1UKHA 4XYFA 4DLIA 2A1AB 4LV5A 3SW4A 1M2PA 3T9IA 4EOQA 2GPHA 2YHVA 4K18A 3D5XA 4R3RA 5CSWA 2ERZE 4JT3A 4DFLA 4LM5A 3GT8A 5ETIA 3EB0A 3R8LA 1IA8A 2GCDA 4FIHA 4GG7A 4BIBA 2YFXA 3MFRA 4UMRA 1PF8A 2WD1A 2XK8A 4GVJA 3A8XA 3R02A 4BCQA 2ZMDA 3JS2A 4ACDA 2BRMA 4XG3A 3E93A 3ZRMA 3S1HA 2Q83A 3IGOA 3L9PA 4Y72A 1XBAA 5KNJA 3A7JA 3OVVA 2UW5A 3EYGA 4CV9A 1ZXEA 3KRWA 2C30A 2JIUA 5CAUA 1B6CB 2J0MB 5CSXA 3QX4A 3PLAE 2JDTA 2O0UA 3TNHA 4Q9ZA 4OAVB 2ONLC 4RZWA 5C8KA 3UDBA 4ARKA 5J1VA 2OF2A 2R3MA 1LP4A 4JG8A 2YWVA 1UU7A 5C8MA 5M09A 3MH0A 3NVMB 5IQAA 2HWPA 4QRCA 4O7LA 4BIDA 4AGCA 3PY3A 4BDHA 2GNHA 1KSWA 2O65A 4L3PA 5K5XA 4XBRA 5LVLA 5I9VA 4HYUA 5CF6A 4FSNA 3ET7A 2XZSA 3GFWA 3SQQA 4OBQA 2W96B 4CLIA 1R1WA 4QMTA 4TWCA 4U3YA 2XNBA 3ORMA 3Q6WA 3Q3BA 2BKZA 3PP1A 3R1QA 3S0OA 3OW3A 3QZGA 4ACMA 2X1NA 4DGOA 1WVYA 2BHEA 2BRHA 3RAWA 1LEWA 3UVPA 3NUUA 2VNWA 4A4XA 1O6LA 5EM6A 5A4TA 5FUTA 4BGGA 3EN6A 4QMMA 4QMOA 5HCXA 2O2UA 5B0XA 5AAFA 3TG1A 3ZO4A 4F9WA 4O82A 2OW3A 4GK2A 2BIYA 3C13A 2XK6A 4AZTA 1PXJA 4I92A 3KB7A 4CMTA 2IZUA 3QL8A 2XIYA 5KMIA 4O7YA 2GNGA 4CKJA 1OPKA 4ZTLA 3KQ7A 3O7LB 2PE0A 3FQEA 3KN5A 5AMNA 4I93A 4XG6A 3RPOA 2QLQA 4DEDA 3Q2JA 4QT1A 3GNIB 3HDNA 4K2RA 1Q4LA 4BZNA 4MD7E 4F63A 4Z16A 4O6LA 2C6DA 4WRSA 4H3BA 2JDSA 3ORPA 2ETMA 3KEXA 3TACA 1ZWSA 5I3RA 4YZBA 3MPMA 1YXTA 2GQSA 3MVLA 2YACA 3Q60A 1NVQA 1O6KA 1IEPA 4I20A 4PP9A 5BUIA 3VAPA 5IA4A 3UOKA 4G9RA 4BTFA 4QTCA 4HW7A 1J7LA 2YCFA 4YJNA 5AUWA 4FIFA 3ULIA 4FF8A 2B0QA 1EH4A 1Z9XA 3WZDA 4IB5A 4YP8A 4FV9A 3UNJA 3CTQA 3RNYA 3VN9A 2W9ZB 4J1RA 3IECA 1JSVA 2XM9A 3FJQE 3GC8A 5A3XA 4O6EA 4CVAA 3NNVA 2W1CA 5J8IA 4FMQA 2EUFB 2WMUA 3CY3A 4R3PA 2IVVA 3OY3A 3NPCA 4HYIA 4JBVA 4CEGA 2F49A 5FXQA 3RHXA 5FDXA 4TL0A 5LVPA 3DU8A 1CMKE 1SYKA 2REIA 2XYUA 2IZRA 4LRMA 4QMUA 3FPMA 2FSLX 3KN6A 2CGVA 4IH8A 4XJ0A 2W1DA 2F4JA 2OH4A 3W33A 4AN2A 4AWIA 4WNMA 4O84A 3G15A 3FMLA 3QD4A 3MPAA 3W2SA 4QQTA 1ZYCA 1H25A 3QUPA 4EK8A 3VQHA 1M2QA 3U9CA 4ENXA 2XKFA 3DV3A 3FZTA 5AA8A 3FHIA 5E8YA 3ERKA 3C0GA 3QBNA 4LGDA 2R2PA 3ODZX 2JEDA 3PRIA 4G16A 4RFMA 4AX8A 4BTJA 5DR9A 4MXAA 2C0OA 4OT6A 3WF8A 3ZFXA 5I0BA 3GEQA 5L2IA 4TW9A 2CGUA 3W8LA 5IEXA 4U79A 2XRWA 5FBNC 1OL2A 1OI9A 2DQ7X 4EH7A 4USEA 4NUSA 2PMLX 4ZMFA 4L3JA 3QQGA 4IDVA 1JWHA 2PVFA 3B8RA 3RP9A 4APPA 5HD4A 1M2RA 3AMAA 2QLUA 3ITZA 5F94A 2HYYA 4BBEA 4HVGA 4BGQA 4WRGA 2B9FA 3MYGA 3PXQA 4G6NA 1OITA 4KS7A 3HGKA 4E4LA 2YJRA 1FGKA 3PXFA 3R7UA 1R3CA 1KWPA 5E8UA 5CF4A 5ITAA 2ZV2A 3BYOA 3FKOA 4HGEA 4C3PA 3BWFA 4OTPA 2WFYA 3BYVA 1KE9A 3GC7A 4DEGA 4X0MA 5D1JA 4Z3VA 1WFCA 5C8NA 2QQ7A 4CD0A 3RZFA 5LOHA 2PVRA 4QYGA 4BI1A 3LPBA 3R6XA 4C0TA 5CAOA 4NH1A 4RFZA 3NLBA 5DVRA 2W5BA 5BMSA 3MESA 2Z60A 3UOHA 4DE4A 3U6HA 1Y57A 4ZEGA 3O7LD 4RC4A 1MQ4A 3ZO3A 3U8WA 2P33A 4IZ7A 5IA1A 1REJA 3QWJA 4ANBA 2WTDA 2CLXA 3GOPA 3SDJA 2R3NA 5IISA 3TWJA 2X81A 5F95A 4ZLZA 2BAJA 5JFXA 4OAUC 2WMTA 4HGSA 5DRDA 3G6HA 3ZFYA 5DA3A 1P5EA 4H1JA 4AQCA 4J53A 1UNHA 2HZNA 4RC2A 3FHRA 5M51A 3Q04A 5EDRA 1XQZA 4BCNA 4X2GA 3DDPA 4XBUA 5HORA 2X8DA 5HBEA 3G51A 4CKIA 2C5XA 3MVMA 2R3OA 4QTDA 4W8DA 3MDYA 3VRZA 5TF9A 5CAQA 2VWXA 4RIWA 5J9LA 3MFSA 5AP0A 5AA9A 3A8WA 3LZBA 2HW7A 4FKOA 4EKKA 3UNKA 3C1XA 3KXGA 2XK9A 4HNFA 3POZA 3W2CA 4C38A 3C0IA 3KVXA 3QZFA 3VULA 4DH3A 4C3RA 1L3RE 3ZFMA 2PWLA 4APCA 4J7BA 1Q61A 4U9AA 3C5IA 4AFEA 3PIZA 5ANEA 3ZCLA 5BYYA 2A27A 5EDPA 4AZWA 3EMGA 4ANMA 1ZY4A 4FKUA 2EB2A 4JQ7A 3NUYA 4D5HA 1JSTA 3KFAA 4PF4A 3BWJA 3WF6A 4M14A 3QQJA 4Z9LA 4EK3A 4PUZA 2PUUA 1HCLA 4FV0A 4FEWA 4CCUA 2Y0AA 5HLPA 4NW6A 1ZYDA 3G6GA 3KXMA 3MIAA 2PVKA 3N4TA 2UZBA 2V62A 4I0TA 4FV4A 2LAVA 4GH2A 3PVGA 1VJYA 4EHVA 3QTZA 4EH9A 4RJ7A 3UE4A 3F7ZA 3BIZA 4RIYA 3ZZWA 4PTCA 2KULA 3LCSA 1PMVA 1OKZA 3QLGA 3CTJA 1S9IA 3THBA 4PV0A 2O8YA 2Y9QA 4JXFA 3PA4A 4DEHA 4ACCA 4CYIA 4O7RA 3I6UA 4QYHA 5ANGA 5KX8A 4FV6A 3W1FA 4Q5HA 4BYJA 4R7HA 3ACJA 1Z57A 3ZLXA 4C58A 5IZFA 4C61A 5B2LA 2VAGA 1KUTA 2ITZA 4L53A 5EFQA 3O96A 3Q4UA 4UZHA 4DT9A 4BDGA 3S4QA 2A19B 1XBBA 4CSVA 4D0XA 3DXPA 3EQRA 2XK3A 3U55A 2JC6A 3OOMA 1U59A 2PVNA 3CD3A 3Q4TA 3WARA 3FI8A 5IUGA 4QD6A 4RWJA 3PG1A 4HVSA 3UPZA 2R3RA 3ETAA 5E92A 3IK3A 2QU6A 4F70A 1KE7A 5A4QA 2GHLA 1H1WA 4EHZA 3EFWA 3QC4A 3Q9ZA 2PU8A 4L7FA 4W9WA 4PNKA 4RJ5A 5EHYA 5AIKA 1MRVA 3VRYA 1PW2A 4MD8E 3S95A 4BIEA 3UC3A 4PDSA 1V0OA 4IAZA 5I9YA 4UWYA 4F08A 3LQ5A 1WVWA 4H58A 2JKOA 2EXEA 3SLSA 4H3PA 5CSVA 4G2FA 5DG5A 3MJ2A 3EH9A 4FIGA 4C8BA 4PTGA 2OFUA 3MH3A 4M84A 1H0VA 5AIRA 1GZNA 5E8WA 3BHHA 3QCYA 5ETFA 2YWPA 3RBWA 3MB7A 3DKCA 1KE5A 2WAJA 1YOLA 4O1PA 4JJRA 4U7ZA 5CVHA 5CU2A 4ZLOA 1RQQA 2X7GA 2VUWA 3COMA 3DBDA 4I6HA 4RX9A 4D1SA 4KIQA 5HVYA 2XKDA 5KMLA 2X9EA 2VO6A 2X8IA 4KBAA 3VS7A 3O17A 5KMMA 5K3YA 2VO0A 4X2NA 1Q24A 4PNIA 3QQLA 4YUQA 3KMUA 1MQBA 2XNOA 2QKWB 3MY0A 4KB8A 3E3BX 4RSSA 4TWPA 3RGFA 3SXSA 4BC6A 2J2IB 4ALWA 4B99A 5CEPA 2XA4A 2X7FA 4CLJA 1JBPE 5F1ZA 4EEVA 2VGOA 4S34A 3NNXA 4ZK5A 1U54B 3WF5A 2I7QA 2FO0A 4CZTA 4NFNA 2WMXA 3QRKA 4MQ2A 2QO9A 5FTQA 5JFVA 2B53A 4UZDA 2I0HA 4NKAA 4G1WA 2VTAA 3H9FA 2JBOA 5IH6A 2JKQA 3MVJA 4MXXA 5IKWA 2O63A 3BCEA 2DUVA 3FI3A 2YM5A 4LYNA 3D94A 2HWOA 3OWJA 3V6RA 4BCOA 5KKRB 2QC6A 5JGDA 2B55A 4GUEA 1YXUA 4EOPA 4O0VA 2ITUA 2PPQA 4DTBA 3DQWA 2P55A 4ZZOA 4AZFA 4XRJA 2PUNA 1YDSE 1BLXA 3MH1A 5AR7A 3BBWA 5H3QA 1FMOE 3V5QA 4ANSA 3IDBA 1XR1A 3R1NA 2W9FB 3AT4A 3FY0A 3HMPA 1LUFA 1GZ8A 4ZS0A 4NK9A 2QONA 3D83A 3UZRA 1JVPP 5AR8A 3LFCA 2QG7A 4X6QC 4KRCA 4RLLA 3DB8A 4BB4A 2W5AA 4HYHA 3ZZEA 4EUTA 2XNNA 5L6PA 3C4WA 5AUTA 4KAOA 3V5WA 3F3WA 3NUXA 3H3CA 4FICA 4CFVA 4EYMA 2NO3A 2V22A 2PMOX 4YHTA 3V04A 4CFNA 2WHBA 4FSUA 3DA6A 3AD4A 4KSQA 1JKSA 2GFCA 3HVCA 3WZUA 3FSFA 4FTNA 4XNEA 4E6DA 4W4WA 4YJSA 4FGBA 5BMMA 4D2VA 5TT7A 2BAQA 2ZOQA 3ZXZA 2OXXA 1ERKA 3HZTA 3LMGA 3ZEWA 4L01A 3LCKA 3KRXA 4IFCA 3LJ0A 1BKXA 4JDJA 3QTXA 4JI9A 1J7IA 3KK8A 2OF4A 3OMVA 5KMJA 2P2IA 1BL6A 3BHTA 4M7IA 4QPMA 2R3QA 5EYDA 3I4BA 4CCBA 1FQ1B 2GS6A 5M4FA 4GL9A 3C4XA 5HTIA 5FLFA 2CMWA 3EN5A 3ORIA 4GJ3A 5A4CA 4AN3A 3CGOA 1PYXA 2Y7JA 4XEYA 3HMOA 3RAHA 5K9IA 5H8GA 4TT7A 5HCZA 3LFNA 3C4ZA 5GINE 4G6OA 4USDA 4I5PA 4AE6A 4KRDA 1W0XC 3MY1A 3PXKA 2IW6A 5H2UA 3TV6A 3BE2A 5FP6A 2IJMA 4F6WA 3FZOA 4F6SA 4JBPA 4NWMA 3OF0A 3GU6A 3Q52A 4II5A 4BWPA 4YU2A 4RIXB 4E5WA 3A4OX 3GXLA 2HZ0A 3NSZA 2OZAB 4K0YA 4NEUA 2G2IA 4Y8DA 4YLKA 5HG7A 3I6WA 3R8PA 1GNGA 3DAKA 3E8DA 4FZ7A 3I81A 4XH6A 3UODA 4L3LA 3GFEA 3NUPA 3RI1A 3BZ3A 2PHKA 3LCTA 3RCJA 2JAVA 4BVUA 3D9VA 3MWUA 2C1AA 2GNFA 5M08A 2B9IA 3SGCA 3A2CA 2W1IA 3H0ZA 4U42A 5FBOA 4O7SA 5AX9A 3FQSA 5FWKK 4XRLA 3TJDA 1U5QA 2H6DA 2CKQA 4JR3A 2ITXA 2XYNA 3RKBA 4EOSA 4M68A 4RRVA 2JIVA 3E7VA 2DYLA 3EFJA 3IG7A 2F7EE 2XS0A 4QTEA 4LGHA 1ZOEA 2I0EA 3PP0A 3H9RA 4GIHA 4OTHA 5LVOA 1Z5MA 4GJ2A 4IB0A 4FODA 4HCVA 4MEDA 3O50A 3SAYA 3WOWA 3GI3A 3OWKA 2NNWB 5AP6A 2W4OA 2YEXA 4LRJA 5DWRA 3MV5A 2C3LA 3FL4A 4XP0A 3IOKA 4D58A 4QPAA 2G1TA 4HJOA 4QMWA 4G3EA 3QCSA 5DEYA 4ZIMA 2G15A 3V8TA 4X21A 5M56A 2VX1A 4L45A 4F9YA 1K9AA 2WTWA 4LI5A 3W2QA 2YZAA 1VYWA 2QR7A 3VUMA 5JFWA 2WXVA 4XV2A 4EOLA 1GIHA 2XNMA 3PE1A 2ETRA 5DN3A 2GTMA 4KKGA 4ZSEA 4GFMA 4YTCA 2XKCA 3NW5A 4GMYA 3G5DA 2W1GA 4D5KA 4E93A 3L1SA 4TZRA 4ZJJA 3ORLA 5LJJA 3QCXA 3CTHA 1OIYA 2QURA 3I1AA 3L8PA 4OTRA 3A7GA 3NUSA 4D2SA 4FSMA 4YJPA 1Q8WA 4Y5QA 4EKLA 4FV7A 4M13A 2FVDA 5HKMA 2ITYA 3PJ3A 3ZU7A 5AP5A 5ETCA 3LM5A 3V5TA 2CNQA 5A4EA 5HICA 3PXZA 3MGYA 3RALA 4AXAA 1G3NA 1H0WA 1UWHA 5AR5A 4BFMA 2BTRA 1FMKA 3FLNC 4JRVA 1NA7A 4WSYA 1H07A 4O7ZA 3GU4A 3RZBA 2Y4IB 2PTKA 3D5UA 3FV8A 4WG4A 5M4CA 4RX5A 4DG3E 3MA6A 4G3CA 1J1BA 3BHYA 4ANLA 5J79A 3ZC6A 2WIHA 4IE9A 3VUHA 5E7RA 3AMYA 4CZUA 4FSTA 2GSFA 5HX6A 4K33A 3IS5A 1MRUA 4IWOA 4M0YA 2XK7A 3H0YA 5AEPA 4XG2A 4AT5A 4C33A 3GC0A 2C1BA 2IG7A 1OIUA 4C4GA 4K8AA 5TKDA 4PL4A 3W32A 3W16A 5E8ZA 4H05A 3G90X 3KGAA 2WTCA 4FKJA 5DOSA 2R3HA 4FKPA 4QMPA 3AGMA 4UMPA 3GU5A 4FIEA 1CKIA 4MX9A 2QOLA 4A7CA 5FEQA 4CRLA 1WCCA 4BDKA 3OCSA 2PL0A 3HA8A 3NVKI 4ERKA 4DFYA 4CV8A 5D7VA 4IJ9A 2C3KA 1YXXA 3G0EA 3HV4A 5J95A 4U40A 4FV2A 5LMBA 1JNKA 3FMMA 3OC1A 4QNYA 2YAKA 5DRBA 1TKIA 1ZLTA 2WMRA 3P7CA 2C6MA 3IPHA 2FB8A 2Q0NA 3QXPA 3OBGA 3P4KA 2YM3A 1Q8UA 1Q97A 1Q8TA 3ANQA 4ZSLA 2W0JA 1YI6A 5D7AA 4YSJA 4BDEA 2WKMA 2XUUA 3TZ7A 4EH2A 4AT3A 2YAAA 4IZ5A 3C50A 4LOQA 4IAAA 3TUCA 4W8EA 3IONA 3DK7A 2W05A 3ORTA 5IA5A 4Z7HA 3QA8A 3TNPC 2CKEA 1S9JA 3PJ2A 4PRJA 4QP9A 5DFPA 4NM0A 3UJGA 4J96A 1ND4A 2R3GA 4FSWA 3VS1A 2RF9A 4IDTA 4ZZMA 5I9ZA 5D41A 1KE6A 1H1PA 1M7QA 2BFXA 3HMMA 4FV5A 5JQ5A 3UOJA 5M57A 2X7OA 1O6YA 1XH7A 2GTNA 5EW8A 4MBIA 4KWPA 5CEMA 2I0VA 3PLSA 4ZXTA 3R28A 3RMFA 3TV4A 3KL8A 4OBOA 2E9VA 4P2KA 2WTKC 3CE3A 2ZM4A 5L2TA 2KTYA 3H30A 3DTCA 5IUIA 3BV3A 3VC4A 1PXMA 4BDAA 4F09A 3SRVB 3F7WA 2RG6A 4NZWB 1TQIA 3MJ1A 4KIKB 1J1CA 4FTMA 4M69A 4N0SA 3RAIA 3DB6A 3R73A 4Y46A 3BYSA 3SXFA 5CI6A 4BDIA 4FZDB 3O2MA 4ZOGA 4O7TA 2FUMA 5FTOA 3I79A 2FSOX 4YJUA 4BKJA 3LFSA 5AP4A 4EONA 1E9HA 4NIFA 4EQCA 3MS9A 3D14A 5C26A 3ZOSA 1LPUA 3MBLA 3K5VA 4L9IA 3IQ7A 4GUBA 4JX7A 4BDCA 3UG2A 3NRMA 2PMNX 2PVHA 4X3FC 2BIKB 2X6DA 2GNLA 5DI1A 4JOAA 1GY3A 2C6KA 1VR2A 5BYZA 4EHEA 2IZSA 4I5MA 3OG7A 2HK5A 2QD9A 4G5JA 4FG9A 3GC9A 2WOTA 3NZ0A 2GHGA 4O22A 5EYCA 2B54A 4XG8A 2CKPA 4CG8A 3CP9A 4YPSA 2R7IA 3BELA 1YHVA 3FMJA 3FLSA 3MPTA 4E4MA 3TN8A 1OECA 5IF1A 5L6OA 3KREA 4UEUA 2GQGA 4OTFA 3ZEPA 2OBJA 5I9UA 2YLEA 5DYJA 4RIXA 3PFQA 1IA9A 4F99A 5HIEA 3UMXA 2HCKA 4IX6A 3OXIA 4YZMA 3QX2A 3P9JA 4RZVA 5EI8A 4A9SA 4EZ7A 3NR9A 1MRYA 2J5EA 1RW8A 2W06A 3DLSA 3P23A 3PXRA 4EOMA 5J7HA 3OWLA 4V0GA 5CQUA 1JKKA 2W17A 4NM5A 4K6ZA 2X2LA 2DWBA 4RJ8A 3SOCA 3UO4A 5HG5A 3B2WA 5ACKA 2J0JA 5BQ0A 2EU9A 1XKKA 5BYLA 3GQIA 2UW4A 3VJOA 4E20A 4GG5A 4FTQA 3TDVA 1XH6A 3E3PA 5T6KA 3BGPA 4KBCA 5HI2A 4RJ6A 3O51A 2ZM3A 2X2MA 4BCKA 4C2VA 4ACGA 3OS3A 4CKRA 3QWKA 2EWAA 1T45A 3C9WA 2PVJA 3R71A 5AX3A 4CFUA 2XIKA 2W4JA 3DY7A 3OUNB 3A7HA 2AUHA 4HCUA 5TO8A 5AV4A 3VS4A 3KULB 3OY1A 4M0ZA 4PPAA 4BCMA 2XEYA 2R3FA 2Z7LA 5EDQA 2XRUA 2CKOA 5AUYA 3EJ1A 1OL1A 1H27A 1PXNA 2RFNA 4OTIA 3R8ZA 4ZTSA 3FZSA 1NW1A 1PYEA 3TDWA 3WE8A 2F2CB 3BHUA 3QTWA 4B0GA 2YIWA 2ZMCA 3DFCB 2CGXA 2JDRA 2UV2A 4C34A 4EZ5A 4NTSA 3CEKA 2J0LA 2UZWE 3C4CA 4GFOA 3ORNA 3UVQA 4L00A 3HAMA 4HOKA 3ELJA 4U97A 1O9UA 5HNGA 4IMYA 2Z02A 1ATPE 4RGJA 3FE3A 3Q5IA 3IW7A 2C0TA 3E63A 2B4SB 4P90A 4EK4A 4N57A 4KA3A 4FKLA 2ITVA 3LQ3A 2IPXA 2P0CA 4AOJA 5K0XA 3IGGA 2W5HA 2IW9A 4D1ZA 3ZLSA 2E9PA 3AC5A 4TWNA 3OHTA 5FTGA 1P14A 3QHWA 4XHKB 3FPQA 4C7TA 4ZZNA 2W1FA 3DOGA 4MH7A 2QHMA 3LCDA 4YZ9A 3FXXA 3PJ1A 5IUHA 3Q32A 1WBWA 2VWZA 2C0IA 2WMBA 4EUUA 4YHFA 4CMUA 3N51A 1ZYLA 5AV2A 4ASEA 2QOCA 3NAXA 4R3CA 3MW1A 4DAWA 4A9TA 3NX8A 5E9EA 5FQDC 3OZ6A 3ENHA 4L52A 4MBJA 3G2FA 4M97A 3ROCA 3RVGA 1JKTA 2OJIA 3F2AA 4MNEA 2BDFA 3EQDA 2IVUA 5KZ0A 4AFJA 3WI6A 5IMEA 4IWDA 2X4ZA 3CQWA 2F2UA 2GU8A 2QOBA 1NY3A 3CS9A 3D2KA 3FZRA 3KRJA 3Q5ZA 4LV8A 3HRFA 5EI2A 4BTKA 4BWKA 4CFWA 2WU7A 1QPJA 1W82A 4BL1A 4EBWA 5IU2A 3BU5A 4PWNA 2C5OA 4AACA 4LOOA 5D10A 2HXQA 5FM3A 3V6SA 1WBTA 2XM8A 4ANQA 2YM6A 2HW6A 4X7QA 2W1EA 1URWA 2ZAZA 2ZDTA 4F0GA 5HOAA 1OM1A 3D0EA 3R30A 2YLFA 2H96A 4GK3A 3COKA 4L7SA 3TZ9A 2J0IA 5J87A 1QCFA 3RJCA 4A4OA 2J7TA 5D9HA 3U54A 1H4LA 2C6TA 3EWHA 4I23A 2E9OA 4JAJA 5HHWA 4B6LA 3HV3A 3CQEA 3L8VA 4DH1A 3RNIA 1UV5A 1PMNA 2VRXA 4TWOA 2OXDA 3NMUF 1BX6A 1XH4A 1WBOA 5AV3A 4G6LA 5D11A 4PP7A 4WBBB 4W4YA 3POOA 4TYEA 4JIAA 3GCSA 2BZIB 4EWHA 3OTVA 4GVAA 5E1SA 3DTWA 2B9HA 4LMNA 3PE2A 1W7HA 4JAIA 3RPRA 1APME 2VX0A 2JITA 3DGKA 3NW7A 3NYNA 4AOIA 1GAGA 1M7NA 4KIOA 5TR6A 5JSMA 4LRKA 3CLYA 1REKA 4IX4A 2ACXA 1A06A 3ENMA 2QHNA 4FVPA 3GOKA 2Y6MA 4QMYA 5DPVA 3RAKA 4FTCA 5IQCA 2X39A 4OR5A 4G3GA 3OTUA 4AOTA 3N4UA 3PA5A 3GBZA 2H8HA 4FNXA 4AGUA 4BDBA 5BVKA 4A4LA 5JT2A 2YIXA 3OXZA 4KIKA 3UC4A 3GGFA 1OL6A 2VTRA 3IOPA 2CNVA 5C9CA 3W10A 2Y8OA 4JBQA 2E2BA 3JVRA 3EN9A 4JS8A 4WSQA 2R3JA 3R1YA 3V5LA 2PZ5A 4JX3A 3KF4A 4Y85A 2IVSA 2WIPA 3O8UA 2JGZA 4NCTA 3UQCA 3MA3A 4F9BA 2FA2A 3DZQA 1W98A 5BUEA 5KBQA 2JFMA 4ASDA 3WZKA 2BZHB 2VN9A 4I22A 2WMWA 2V7AA 4E4XA 4F0FA 1KOAA 2P2HA 4HZSA 3UOLA 4J52A 3VUTA 5KCVA 1ZZ2A 3TKHA 4FVQA 1K2PA 2F7XE 4BZOA 4DITA 1NXKA 2VWIA 3ZLYA 4QMXA 2B52A 4ZMEA 5AUZA 1ZARA 2UW8A 3ZSHA 2BRBA 4QOXA 3ZO2A 2JAMA 3Q53A 1YWRA 4EHGA 4Z7GA 3AXWA 3WE4A 3TTJA 2WO6A 2YABA 3NYOA 4TRLA 3P79A 4CFMA 2QO2A 4GYGA 2VWWA 4IVAA 4BDFA 4OTGA 3GCUA 5GJFA 1GIJA 3FY2A 4L42A 1OZ1A 1VYZA 4O2PA 5GZAA 1TVOA 3Q2MA 4IAFA 3OWPA 5FGKA 3ZLWA 3NCZA 5IQFA 4O96A 4EJ7A 4K9YA 5CAVA 4NYEA 2J90A 3FL5A 1YHSA 5ANJA 2OH0E 2B9JA 5IEVA 1YWVA 3EYHA 3QA0A 4FUXA 3P78A 3TKIA 4YJTA 1WBPA 1WVXA 5EKNA 3UMWA 2C5YA 2P4IA 5G6VA 1W84A 3DZOA 2R0UA 3I7BA 3M1SA 3HRBA 3VBTA 5JZJA 3BHVA 4CZYB 5I5ZA 3C0HA 3RWPA 4AF3A 3HKOA 3QAME 2F7ZE 3LVPA 3TZMA 5AAEA 3LJ2A 4AW0A 2BFYA 4F7NA 5CTPA 3KF7A 4NU1A 5HIDA 3QXOA 2J9MA 2VO7A 5ANIA 3FC2A 4O0TA 4FL2A 4XMOA 2YZLA 3QTUA 3UQGA 1F5QA 4CQEA 5M07A 2ZM1A 4YR8A 4IVDA 5DNRA 5L8LA 3UIUA 5BVWA 3JR1A 3D7TB 4O0YA 4GW8A 4D4RA 4TTHB 2VX3A 4ZTMA 5LCJA 2WMVA 3R9NA 3CJGA 1PY5A 3I60A 4C02A 1UU9A 1VZOA 3OUKA 1WBVA 2BUJA 4UALA 3II5A 3EQFA 5L2SA 2HAKA 5JN2A 3C51A 4UMTA 2WEIA 3TNIA 3U9NA 4A9YA 4I6QA 4NW5A 1FVTA 1TQMA 3LLAA 3U51A 4AA0A 1CKPA 4JDKA 5L4QA 2AC5A 3TT0A 3EKNA 3TXOA 3OT3A 3EHAA 4U5JA 4CG9A 4XV1A 5LVMA 3LHJA 3PWDA 3KK9A 3R9HA 3SKCA 5HNBA 3SA0A 3R01A 5AR4A 5CZHA 4HYSA 5AUXA 4JDHA 4CGAA 3KY2A 3DBFA 5L6WL 2V7OA 3DBCA 3FUPA 2O64A 3R2YA 3ALNA 3IW6A 3MIYA 3UIBA 4FSYA 3PPZA 5AJQA 1OBDA 5LMKA 3E8CA 4EOJA 3CIKA 3AQVA 4FL3A 5CNOA 3HMIA 3VVHA 5KMNA 1OMWA 2PUIA 3EQGA 3OEZA 3FKLA 4MVFA 1AQ1A 3AC4A 3EN7A 3E64A 4AW5A 5AV1A 3UZTA 4DCEA 1U5RA 3DNDA 5F9EA 4WNPA 4QP7A 3VHKA 4CFXA 5J9YA 4FE2A 4JG6A 4E4NA 4I6BA 3UIXA 1DS5A 3JVSA 3VW6A 1XBCA 4IM2A 5AP7A 4DINA 1R78A 3R8VA 1FOTA 4UN0C 4YO4A 3BQRA 1GZOA 2IWIA 3O23A 4QYEA 2VTLA 2BRGA 4NT4A 1HOWA 3SG8A 1YVJA 1XH5A 4XG9A 4GKHA 4ZSAA 4ZSJA 4HPTE 3LM0A 4MHAA 5L2WA 1Y6AA 3WIKA 1KV1A 3PIXA 5LQFA 1M17A 3CKXA 3LE6A 4CQGA 5BUJA 3EL7A 2XCHA 3O8TA 2W7XA 4EJNA 3VF9A 2LGCA 2NP8A 3PTGA 5L2QA 3NIEA 4FTRA 2GFSA 4ZSGA 4XUFA 4BBMA 4F64A 2W99B 3EQIA 4UYNA 3LOKA 5D12A 1IAHA 2HENA 3E92A 4FV8A 4DTAA 3FKNA 4O91A 4IC8A 3FMKA 3Q4ZA 3TEIA 4D2WA 4S2ZA 3AD6A 2W1ZA 2GNJA 4M8TA 3KVWA 4D2RA 3JY0A 4YNOA 5ETAA 3NGAA 1G5SA 2XJ2A 4KINA 4ASXA 3JXWA 5IQDA 4XG4A 2YN8A 5IQBA 4BTMA 5M4IA 3PJCA 5HIBA 3DKGA 1PKGA 5IQIA 3UO5A 5TOZA 2WMAA 5DE2A 3WYYA 3FZ1A 5JKGA 2UW9A 2VTOA 2C5VA 1U46A 2Z7QA 3KCFA 3LFBA 4DFBA 4EORA 4WA9A 4EYJA 4DBXA 4OGRA 4XLVA 3QRIA 5IA2A 3R9RA 1H1QA 3QUDA 3DKFA 1FVVA 4RMZA 3RCDA 4KIPA 4BICA 3UNZA 4QMZA 1OIQA 1QMZA 3SC1A 2BROA 4EBVA 1PMUA 2WU6A 3VUGA 4DEEA 2UW6A 5FDPA 2PK9A 4OTWA 2C6LA 2BHHA 2JD5A 3FYJX 2I0YA 3QKLA 4H36A 3LAUA 4TN6A 4W9XA 2BDJA 5HTCA 1UNGA 3F9NA 4O83A 2VTPA 3A61A 3ZUTA 4MXOA 2Z7RA 1YWNA 3F69A 1MUOA 3FMHA 3KXXA 5CLPA 4IC7A 3VBQA 1PHKA 4QTBA 4BZDA 4PMTA 2IVTA 3JYAA 5ANKA 3KMMA 2VTIA 4L44A 4X2FA 3FAAA 5CNNA 2BPMA 2UZEA 4QYFA 1CSNA 3R7EA 4QPSA 5IH5A 2OXYA 4FSQA 5AP1A 3D7ZA 4J95A 3HV5A 2V5QA 3MTFA 3ZBXA 3VUIA 4S32A 3V51A 2CNUA 4BCPA 4ERWA 3ZM4A 2JIIA 4FL1A 3Q96A 3UGCA 3DJ6A 3PZEA 4LG4A 5DT3A 3HRCA 4Z55A 5CXZA 3D5WA 4O0RA 3R8MA 3K3JA 4A06A 4W4VA 4PL5A 4I4EA 4FX3A 4D28A 3U4WA 2QG5A 4GV1A 5CU6A 4FTAA 2XJ1A 5EHLA 4AT4A 2YDIA 3F3UA 2FSTX 2ITTA 3LFQA 2WMSA 4IANA 1QPEA 5E1EA 3RHKA 4ACHA 2ZB0A 1GZKA 1UWJA 4FNZA 5HGIA 5B2MA 3EZVA 5GIOE 4F9CA 1OKYA 3ID6C 4ORKA 4G17A 2RFSA 3ZUUA 3L9NA 1XH9A 4IM3A 5CWZA 3L8XA 2B1PA 3P1AA 4DGLC 4PTEA 1V1KA 2UZOA 2YISA 3LQ8A 4FTIA 4RT7A 2XNEA 4BDDA 4DGNA 2W1HA 5F20A 5CX9A 3H9OA 2QVSE 3RM6A 4GYIA 3DLZA 4XX9A 4D2PA 1J91A 1PKDA 4EH8A 3WF9A 4MTAA 1G8SA 4R7BA 1IAJA 1SNUA 4MYGA 4O27B 3F3ZA 3K54A 1RJBA 1CM8A 4FEVA 1OKWA 1SMHA 3G9LX 4BKZA 4WHZA 4C62A 2R5TA 3PUPA 1PXLA 2EVAA 4FZAB 3KCKA 4NCTC 4FA2A 1E1VA 4LFIA 4X2JA 3QUEA 5KHXA 3PWYA 4JDIA 3P0MA 3OT8A 1DM2A 3K2LA 1Q8YA 1ZRZA 3DXNA 2RGPA 3EKKA 4LUDA 2BKKA 2XH5A 2CCHA 1XH8A 4I5HA 5F4NA 5CU0A 3KXHA 4RPVA 5E8XA 5L3AA 2HZ4A 4GT4A 2WTIA 4V05A 3A7IA 3V8WA 3AD5A 2VO3A 4Y73A 4MWHA 4MWIA 1OPJA 3IDPA 4UMUA 3SHEA 3DXQA 5FG8A 3VJNA 4IM0A 4OUCA 2WPAA 1LEZA 2R3IA 4ZTNA 3RINA 5IQGA 2XCKA 3D15A 3LFFA 5T3QA 1IRKA 2QOHA 2OSCA 4BBFA 3TUBA 2AC3A 3D7TA 3DAEA 4KBKA 3U6JA 4U45A 4D55A 4GFGA 2UW7A 4D4SA 2C47A 3W2OA 1Q41A 4OTDA 2JDVA 3GP0A 3TUDA 4BY9E 2XIXA 5HO6A 2XF0A 5J5SA 4FK6A 4FG7A 1J3HA 2ITOA 1GJOA 3VS6A 3F5UA 3ORZA 4HGTA 4HGLA 4C35A 4AU8A 5ICPA 1YOMA 1YRPA 4RA5A 4YMJA 2ZVAA 5H8BA 4F0IA 5E8VA 4WUNA 1R0PA 4RJ3A 5CT7A 2BZKB 4ENYA 2RIOA 3QC9A 3BEAA 4EZ3A 4MD9E 4E73A 2UW3A 1T46A 4K11A 2GS7A 4YZNA 2C4GA 4HNIA 4YTFA 4DT8A 3ZDIA 3EQBA 1SNXA 4FR4A 1TQPA 2ZB1A 3W2RA 3EQPA 4R1YA 3NNWA 4FUYA 3VWAA 4I94A 3ZONA 3OFMA 2UVYA 3A4PA 2VV9A 2QR8A 1U54A 2PE2A 3KRLA 5C4KA 4WOVA 3WILA 4V04A 3QCQA 4ITJA 3UPXA 2C6OA 1XO2B 2OFVA 4A9RA 2YM8A 5HEZA 4Q2AA 4YBKA 5HO8A 4CTCA 5HE3A 4F9AA 3VO3A 3COIA 4ITIA 4R7IA 5GJGA 1IR3A 2BVAA 5DR2A 3ZBFA 4Q5EA 3OROA 2XNPA 3CGFA 3MFTA 4FYNA 1FINA 4TYJA 4IAYA 2UVXA 4E3CA 5FP5A 5GNKA 3EFLA 3R7GA 3V8SA 5HQ0A 1ZZLA 3KRRA 2Z2WA 4I1ZA 2WQMA 3SOAA 4B4LA 4E6CA 3SV0A 5BVEA 4XCUA 2HOGA 3KXNA 4UYAA 2X4FA 4UY9A 4F65A 2VTHA 5JH6A 4B8MA 2BILB 4ANOA 2EB3A 2NPQA 4G3FA 4GCJA 5A6NA 4WD5A 1AD5A 1Y91A 2F9GA 3E87A 4TYGA 4C37A 4QP3A 3NYVA 3KA0A 4OTQA 3MH2A 4FT0A 5DBXA 5KMKA 1JOWB 4O7VA 3COHA 3RK9A 5AM7A 3BU3A 2OIBA 2CHLA 3MVHA 4O7WA 2BMCA 2ZJWA 3R22A 4EI4A 2CJMA 3LXLA 1FPUA 2OIQA 3O8PA 4QP4A 3F61A 5EQEA 3AC8A 1H26A 3GVUA 5HVJA 3RPYA 5CAPA 1Y8GA 3BX5A 3MN3A 3LJ1A 2R0IA 4B9DA 3ZSIA 3DJ5A 3PJ8A 3RK7A 3ZXTA 4AS0A 4FGRA 3KKVA 1FGIA 4S33A 2YJSA 3R8UA 4IXPA 4GS6A 4ZLYA 2J5FA 3LFEA 3QTQA 3CBLA 5E8TA 3FEGA 5LMKC 3VIDA 4XV9A 4PX6A 5IPJA 3K3IA 5EQPA 1H8FA 3GENA 4NM3A 3BRBA 3Q9XA 2R7BA 3C4EA 1PMEA 4G31A 5A14A 2WTJA 5I4NA 1BI7A 3RK5A 2G9XA 2WQBA 3ZRLA 4IW0A 3DCVA 4RWIA 5EW9A 3BE9A 4ANNA 5J1WA 2CPKE 3NUNA 4JNWA 2QOIA 1GOLA 5IQEA 2Q0BA 2C5NA 5CENA 3FQHA 3T9TA 2OK1A 2GDOA 2OZAA 2YCSA 5EOBA 2JBPA 4P7EA 1W8CA 4NFMA 3OEFX 3ZUVA 2OU7A 3IDCA 4RC3A 4MF0A 4Y5HA 4YLLA 4JLCA 3NWWA 1V0PA 4KKEA 3VBYA 3ZDUA 5FXRA 2W4KA 2WNTA 3LMIA 4NM7A 3O0GA 1YQJA 4RIYB 4MQ1A 3ZC5A 4BWXA 2C69A 4GT3A 3TCPA 5IA0A 3ATSA 1UU3A 1ZMWA 5C27A 4Y83A 4E7WA 1XJDA 4FZ6A 4UWCA 3FLZA 5BNJA 1Q5KA 1WBNA 4WUAA 4M12A 4FKRA 2CLQA 4AE9A 3BI6A 3QQHA 4BDJA 5ACBC 4JRNA 2OJGA 4P5ZA 4CTBA 5HU9A 4FIIA 2OG8A 4MXCA 5CVFA 4UXLA 3ZYAA 2XP2A 4YC3A 2XVDA 2B7AA 2GHMA 4FTOA 4ZJVA 2PZYA 1UKIA 2BCJA 2CDZA 1OBGA 2I40A 3FDNA 3RWQA 3F2RA 4LUEA 2YERA 3KMWA 4WT6A 3U6IA 5DT4A 3AGLA 3F2NA 3UYTA 3ORXA 3FZPA 4PDPA 4ZS4A 1IASA 4O7NA 4UWBA 3CPCA 5HZNA 1XHAA 2OJFE 3G0FA 3GCPA 1OB3A 5HU3A 4RQVA 3Q4CA 2IW8A 4FTUA 5IH4A 4LOPA 4K1BA 4Q9SA 5CEKA 3V5JA 5A9UA 2Z8CA 3JY9A 5HE1A 3WIGA 4OBPA 4U0IA 2XKEA 4D2TA 2DS1A 5G1XA 1SVHA 3UVRA 2ERKA 4HPUE 3TM0A 3BLHA 3DK6A 4WNKA 4DGMA 3PSDA 2QOOA 4K77A 2PVLA 2XNGA 3UP7A 4YTHA 3VBVA 4AW1A 4BHNA 4YZDA 3PA3A 4WG3A 3PRFA 5HTBA 3UIMA 3QGWA 3ATTA 2VTJA 2AYPA 5EOLA 2GNIA 2WTKB 5DLSA 3QQUA 1DI8A 2E9NA 4YHJA 4RQKA 4FKGA 3V5PA 5ANOA 4LL5A 2CCIA 3FMEA 4DFXE 4USFA 3HUBA 3Q9WA 3UYSA 2H34A 3MY5A 1PXOA 1PXIA 3CQUA 5AP2A 4O0SA 4XS2A 4A9UA 4QQJA 4AA5A 2H9VA 5AWMA 1LR4A 4MKCA 1YHWA 4TNDA 3TI1A 4MAOA 2PVMA 2OKRA 2YCQA 1Y6BA 1YDTE 4U8ZA 3EZRA 5BVFA 3ZSGA 2RL5A 2VWYA 4XOZA 2Y6OA 4L43A 4C3FA 1H28A 3OXTA 1JSUA 4M67A 1YI3A 3UP2A 4ALUA 3UO6A 2BR1A 5JRSA 3SG9A 4EQUA 3VW8A 3DT1A 3GQLA 3MTLA 4X3FB 4QMNA 3GUBA 3HEGA 5GZ8A 4GIIA 4ZJIA 4R78A 1I44A 4FT7A 4FKQA 4ITHA 1P4OA 1R39A 3LXKA 3NYXA 3UZPA 1NT2A 3GB2A 4FG8A 1DI9A 5M53A 2XB7A 1YKRA 3E8NA 4EH5A 5CANA 3LLTA 4D1XA 2VU3A 2ITPA 3HDMA 1YDRE 2BZJA 5M06A 4YJVA 2X2KA 1UU8A 5BX0A 2X8EA 5CSPA 4F6UA 2XIRA 2YDKA 4YLJA 4IWPA 4S31A 5HVKA 2BAKA 2R64A 4IAKA 5E91A 3VUKA 3B8QA 3FYKX 5J9ZA 2BTSA 2V0DA 4PDOA 5A54A 5EYKA 1A9UA 3ZTXA 2OGVA 4B7TA 3VS5A 3PY0A 1WAKA 4G34A 4L68A 5KBRA 1JKLA 1YOJA 4GK4A 4OT5A 2I1MA 3P08A 5HCYA 3WZJA 2HY81 4DLJA 3NNUA 5A4LA 1M52A 4IB1A 4PMSA 2J4ZA 4D9TA 2GS2A 2YM7A 3AC1A 4P4CA 4ZY5A 5IDNA 2UVZA 3T8OA 4IB3A 2RSVA 4RWLA 4FT5A 1G8AA 3ACKA 3F6XA 4Y95A 5KUPA 4IWQA 3BV2A 4FNYA 3ZMMA 4O86A 2NRYA 1JQHA 5AUUA 5CEIA 1BMKA 2CSNA 2YCRA 1YI4A 2XK4A 3R7OA 3EQHA 5IQHA 4RA4A 3ZH8A 4JIKA 5TE0A 4DFZE 4YJQA 2R3KA 4FEUA 4KKHA 3QGYA 1YXSA 3QRUA 5M44A 3AC2A 5HX8A 3PVWA 4YNEA 3AT2A 2WELA 3FI2A 4ZTHA 4AGWA 4E1ZA 3SRVA 3SD0A 4E5AX 2G2HA 3OP5A 3QZIA 4BCFA 4NL0A 1ZMVA 1H24A 2GMXA 5CEOA 3R9OA 4F7LA 1L8TA 4H3QA 4S30A 4PY1A 4C4IA 2J6MA 2WTVA 3F5PA 5HG9A 1CTPE 5IEYA 5HLWA 1WBSA 3F82A 3QRJA 2V55A 1PRYA 4CFFA 5HLNA 5C01A 2VWUA 2J50A 5AM6A 4WIHA 5K0KA 3ANRA 4QNAA 4ZAUA 4GU9A 2EXMA 2WQOA 4RFYA 4FT9A 4M15A 5EH0A 2VD5A 4IIRA 3PYYA 4TY1A 3D4QA 4YPDA 2IN6A 3HA6A 4FKTA 3CJFA 4FSRA 5AV0A 5I3OA 3RM7A 5J7BA 1SM2A 3UTOA 4DN5A 1ZOGA 4DA5A 3LCOA 5CYIA 4QO9A 4MXZA 4HVIA 2ZV8A 3L9LA 4C4JA 4BCGA 2NRUA 3S00A 4D4VA 3M2WA 4FSZA 3I5ZA 2WQEA 5KKRC 1DAWA 3OCBA 5CS6A 4B8LA 5CQWA 4BKYA 4JVGA 2YITA 2C6IA 1WZYA 4H1MA 5DMZA 4EC9A 5LVNA 1OGUA 3R83A 4DEIA 4BCJA 5CXHA 4QTAA 2CN8A 2YM4A 2WEVA 4ZTQA 1YW2A 2VTTA 3PIYA 4C4HA 4I5CA 4P5QA 3HV7A 2Y4PA 4YJRA 5HE2A 3MI9A 3REPA 4ZY4A 1OL7A 3DS6A 3P7BA 1ZY5A 2ZYBA 5CZIA 4D0WA 3FXZA 5I9WA 3PSCA 4O0UA 4MXYA 5H9BA 2VTMA 3HP2A 3R2BA 2YIQA 3KXZA 4U41A 4E5BA 3QALE 3K5UA 4FKIA 4EOIA 1I09A 2R3PA 4FV1A 4J98A 3VHEA 2PYWA 4GKIA 2JDOA 4I0SA 2VTQA 3VBXA 4DH8A 5CALA 4R6VA 3DKOA 4WBOA 2IZTA 2XIZA 4ID7A 3FLYA 3M42A 3ZS5A 3T3VA 3JUHA 3UBDA 1X8BA 4GEOA 3Q6UA 2JLDA 1OVEA 1ZYSA 3SXRA 3V01A 3LFDA 3F3TA 4DCAA 1OIRA 3G33A 1Q8ZA 3DBQA 3KULA 3CPBA 4EK5A 1B38A 5GZ9A 1H1RA 2C6EA 3VNTA 4DG2E 4E6QA 3LXNA 2PZIA 3I0OA 4R8QA 4O1OA 3TIZA 2OZOA 4FKVA 5DEWA 4JL9A 4O21A 5M55A 3DDQA 4J99A 4YC6A 2XBAA 5CASA 5HNIX 4HCTA 5I9XA 3QLFA 4BR3A 3QD3A 2CGWA 2WOUA 2WQNA 3HYHA 5DGZA 4ASZA 5K4IA 2PUPA 3HV6A 4O2ZA 3N4VA 4BCIA 4PMPA 4IQ6A 1P4FA 3HP5A 4C36A 4FKSA 3DBEA 4I6FA 4RG0A 4JR7A 4MF1A 2PE1A 4WKQA 3LXPA 4YO6A 3LKMA 4F4PA 2WZJA 3OOGA 2X9FA 1VEBA 3O71A 2OJJA 3B2TA 3DNEA 4TYHB 3AG9A 4XOYA 5DHJA 4C57A 4EL9A 5HBHA 2PZPA 3BLRA 4FC0A 4NJ3A 1AGWA 2WMQA 3TNWA 3VUDA 3WBLA 4A07A 3WF7A 1BL7A 4F7SA 3BBTB 4JBOA 2F57A 4MK0A 4X6RA 3RPVA 5GHVA 2EXCX 3FWQA 3TNQB 1Q99A 2RFDA 3H10A 4EQMA 3KU2A 3FMNA 5EG3A 5CI7A 5CSHA 4KNBA 5CT0A 4C4FA 3I5NA 4FV3A 4QP1A 1J7UA 2XJ0A 2ZDUA 4NKSA 5CEQA 3V3VA 4QP6A 3ZO1A 4N6YA 2SRCA 3WYXA 4AN9A 2OICA 5JGAA 4GRBA 4O81A 2PULA 4TYIA 3E7OA 4UB7A 3A99A 4ZTRA 4BGHA 5JMSA 3A60A 4XP2A 5CF5A 5IG1A 3PVBA 3R00A 3MFUA 1BUHA 4HVDA 2VZ6A 5HD7A 4XG7A 3EOCA 1STCE 4DEBA 4YZCA 4YSMA 5E8SA 2Z7SA 4IZAA 5FRIA 2ITWA 2XMYA 4RJ4A 4RVLA 5EI6A 4EK6A 4FOBA 3BYMA 4CNHA 3HAVA 1NVSA 1HCKA 3Q9YA 4GT5A 4DG0E 4JQEA 3CCNA 1SVGA 3FI4A 3IW4A 4WNOA 4F1TA 3TZ8A 3CY2A 3I0QA 5FEDA 4NJDA 2XBJA 2QOFA 4LGGA 4AAAA 2VTNA 4AA4A 5EM5A 3TJCA 3VF8A 1FBNA 4DFUA 4AZVA 2UZUE 4PQNA 4FTLA 5M4UA 1Y8YA 4X3FA 2ITNA 3ROYA 3DFAA 3AMBA 3T3UA 3TL8A 4AW2A 5J5TA 4NTTA 4RBLA 3F3VA 4PPCA 2QCSA 4E6AA 1OPLA 2JFLA 4CT2A 3FLWA 3F88A 3QFVA 2VWBA 5C1QB 4BI0A 3IKAA 3HUCA 4PPBA 1OKVA 3E5AA 5JGBA 3AT3A 4PL3A 4O38A 3UG1A 4XLIA 4BI2A 1JPAA 5CY3A 4CMOA 2VGPA 3NS9A 2PVYA 3E62A 1SVEA 3AOXA 3E88A 1Q3DA 3EFKA 2ESMA 3QTIA 2ONLA 1Q3WA 3JPVA 3QYWA 3BGQA 4H39A 3R9DA 4CRSA 4N6ZA 2O5KA 3PPKA 5LWNA 1DAYA 2Y4IC 3EN4A 3QQKA 4YC8A 2QU5A 2HY0A 2VWVA 3WZEA 4O0WA 3N9XA 1ZOHA 2X0GA 4L67A 3FBVA 4RLKA 4U43A 1OUYA 5T68A 3TKUA 5JQ8A 4R77A 4QMSA 2E9UA 5LMAA 4AGDA 4AP7A 4FTKA 4M69B 3QRTA 3EIDA 4J97A 3QF9A 1OL5A 4FEQA 3R63A 3U4UA 2RFEA 4QP2A 1RDQE 5FD2A 3NEWA 4FBXA 2UW0A 2OJ9A 1BI8A 4R5SA 3SVVA 4I3ZA 3HX4A 4NIFB 5EHOA 2C68A 3RPSA 5HBJA 1NVRA 2HELA 2BRNA 3QTRA 4FNWA 5KO1A 4FVRA 4FZFB 3VS2A 4EOKA 4XP3A 3HLLA 3PY1A 1KE8A 4RX8A 3DJ7A 4EOOA 2YIYA 5DIAA 4IZYA 3CD8A 3UQFA 4EH4A 2PY3A 2WGJA 3A7FA 5EM8A 2QO7A 4QQ5A 2ETKA 3RTPA 1UVRA 3G9NA 5LXMA 4R1VA 3FLQA 3GU8A 4UBAA 5IA3A 1KOBA 4JQ8A 1W83A 4LL0A 1K3AA 5JZNA 1QPCA 4AG8A 1OUKA 4BYIA 4J71A 5KE0A 5BPYA 2WB8A 2HIWA 4UX9A 2A0CX 4TPTA 2FSMX 3BGZA 4L8MA 2XEZA 4IAIA 3P7AA 4W4XA 2C3IB 1JAMA 3D2IA 4G5PA 1F3MC 5FM2A 5JK3A 4IX3A 1RE8A 4CT1A 1GIIA 2PSQA 3EQCA 3ZRKA 5GJDA 3VS3A 1M14A 2OI4X 4V01A 4V0GB 3TTIA 2CN5A 4KUJA 3SW7A 3OCGA 3NIZA 5C4LA 1FVRA 5KZIA 2UZLA 4BN1A
chains in the Genus database with same CATH superfamily
3FSKA 2JKKA 3F5GA 3ORKA 4I21A 3OCTA 3PG3A 4I41A 1P2AA 4PMMA 4YTIA 5AR2A 1WMKA 2PMIA 1UNLA 5IDPA 3GU7A 3NAYA 3DQXA 5K5NA 4JG7A 5EQYA 4X2KA 4BHZA 3HL7A 3P5KA 4IACA 5GIPE 3QYZA 5BVDA 5KMOA 4DGGA 3PDTA 4NSTA 3ZHPC 4AUAA 3BKBA 5EK7A 5EW3A 1H01A 4BCHA 2VTSA 2R9SA 1YXVA 3C7QA 4GU6A 3SX9A 5E4HA 4KSPA 3PZHA 4EH6A 4XV3A 4EH3A 5FEEA 5KHWA 4U44A 1H1SA 3F5XA 4DC2A 5ANDA 5BVOA 4QP8A 4QQCA 2ZV9A 4WG5A 4I4FA 3C5UA 4DF3A 2XALA 3NCGA 4WO5A 4OLIA 2UZTA 1IG1A 4RX7A 5AUVA 3DAJA 2QKRA 4FEXA 4FK3A 3HMNA 4RIOA 3LW0A 4DFNA 4E26A 4DEAA 4MCVA 3GCQA 4FOCA 5LWMA 3TV7A 3M11A 4GSBA 3PVUA 3W55A 3DK3A 2R3LA 4IVCA 3ODYX 2C3JA 4TNBA 2QI8A 2RG5A 3F66A 3R7VA 2O3PA 3W2PA 2UUEA 5HESA 3AC3A 5L8KA 4C59A 3MSSA 4PDYA 2QOQA 3ZM9A 3BEGA 3R1SA 2UZNA 3CC6A 3U87A 2X6EA 2R4BA 5CVGA 4QMLA 3BPRA 4I0RA 2ITQA 5JEBA 1ZYJA 2IO6A 5IMXA 1A48A 1B39A 5AAGA 4RVMA 4QYYA 1CDKA 3IW8A 3NW6A 2J0KA 4U81A 5CU4A 3TIYA 2OO8X 4TYHA 4HZRA 2JKMA 3R7YA 4IJPA 5C03A 4J8NA 1W2DA 4TXCA 1U4DA 3KC3A 4QMVA 4ALVA 4E8AA 4R5YA 3VQUA 4LMUA 2OLCA 5EM7A 5HE0A 2FH9A 4MNEB 5B2KA 2A2AA 4DHFA 2ZV7A 4F1OA 3QD0A 4I24A 1R0EA 4G3DA 4U80A 3OBJA 3FC1X 4YGAA 5H8EA 1URCA 3HNGA 4DH5A 1PXKA 1QPDA 3CSVA 4DTKA 4YBJA 3CXWA 3QQFA 4N4SA 4FIJA 2YA9A 4IADA 3GCVA 4ZY6A 2GQRA 3VS0A 4EC8A 4EWQA 5HG8A 4FI1A 3CR0A 5BVNA 4FTJA 2I6LA 4IFGA 4HVHA 4OW8A 4KABA 1PJKA 4IBMA 5JFSA 4U6RA 5AR3A 3QZHA 2FGIA 5DT0A 1TZDA 5A6OA 4IHPA 4MUQA 4RWKA 4RVTA 1SZMA 4DH7A 3QHRA 4IVBA 1H08A 4CYJA 5K4JA 2VNYA 3W18A 1ZAOA 1Q62A 4MBLA 4BRXA 4IEBA 3BYUA 3PSBA 4LQMA 3I7CA 3NUAA 4FYOA 5LCKA 3CKWA 3R7IA 5LARA 4RVKA 5AFVA 2G2FA 4QMQA 4KS8A 3LMHA 1BYGA 3BLQA 3QKMA 3ULZA 1MP8A 4J8MA 4D4YA 5FXSA 5L8JA 3A62A 1E1XA 2G01A 3HECA 4ONAA 1H00A 4DYMA 3ALOA 3R21A 4UV0A 2UZVA 2IF8A 3VBWA 4U3ZA 2BDWA 3LFAA 3MB6A 4G9CA 4F1MA 3QKKA 2J51A 3EL8A 3FMDA 3L8SA 4YURA 5B7VA 5HO7A 5JRQA 4X3JA 5A46A 4DBNA 1V0BA 4BF2A 5CU3A 3P86A 3S3IA 3S2PA 3QU0A 4L46A 4AZEA 3QTSA 3C4FA 2A4LA 2OWBA 4TKSA 2QODA 4IX5A 4FT3A 4F7JA 3OW4A 4FKWA 2UZDA 3QD2B 3R0TA 2YIRA 1KV2A 4ZP5A 3FXWA 3D5VA 1XWSA 2BALA 3PPJA 3W8QA 3OD6X 3E8EA 3H4JA 3BU6A 2QNJA 3PXYA 4M66A 3NDMA 5EKOA 5EYMA 4C4EA 4M3QA 5E90A 2YDJA 4UMQA 4N70A 4O0XA 4AZSA 4C2WA 3DPKA 3L9MA 1PXPA 3R04A 2QOKA 5AP3A 2P3GX 4MNFA 1JLUE 5CF8A 2RKUA 4D9UA 2PZRA 3BQCA 2HXLA 3IW5A 3LIJA 4FTTA 4YJOA 5AADA 2HZIA 1QL6A 2OIDA 3IO7A 1F0QA 1CKJA 4CXAA 4L6QA 1ZMUA 2FYSA 4RIWB 4UXQA 5DH3A 4KD1A 1UA2A 5DR6A 1UKHA 4XYFA 4DLIA 2A1AB 4LV5A 3SW4A 1M2PA 3T9IA 4EOQA 2GPHA 2YHVA 4K18A 3D5XA 4R3RA 5CSWA 2ERZE 4JT3A 4DFLA 4LM5A 3GT8A 5ETIA 3EB0A 3R8LA 1IA8A 2GCDA 4FIHA 4GG7A 4BIBA 2YFXA 3MFRA 4UMRA 1PF8A 2WD1A 2XK8A 4GVJA 3A8XA 3R02A 4BCQA 2ZMDA 3JS2A 4ACDA 2BRMA 4XG3A 3E93A 3ZRMA 2A98A 3S1HA 2Q83A 3IGOA 3L9PA 4Y72A 1XBAA 5KNJA 3A7JA 3OVVA 2UW5A 3EYGA 4CV9A 1ZXEA 3KRWA 2C30A 2JIUA 5CAUA 1B6CB 2J0MB 5CSXA 3QX4A 3PLAE 2JDTA 2O0UA 3TNHA 4Q9ZA 4OAVB 2ONLC 4RZWA 5C8KA 3UDBA 4ARKA 5J1VA 2OF2A 2R3MA 1LP4A 4JG8A 2YWVA 1UU7A 5C8MA 5M09A 3MH0A 3NVMB 4FJVA 5IQAA 2HWPA 4QRCA 4O7LA 4BIDA 4AGCA 3PY3A 4BDHA 2GNHA 1KSWA 2O65A 2X0OA 4L3PA 5K5XA 4XBRA 5LVLA 5I9VA 4HYUA 5CF6A 4FSNA 3ET7A 2XZSA 3GFWA 3SQQA 4OBQA 2W96B 4CLIA 1R1WA 4QMTA 4TWCA 4U3YA 2XNBA 3ORMA 3Q6WA 3Q3BA 2BKZA 3PP1A 3R1QA 3S0OA 3OW3A 3QZGA 4ACMA 2X1NA 4DGOA 1WVYA 2BHEA 2BRHA 3RAWA 1LEWA 3UVPA 3NUUA 2VNWA 4A4XA 1O6LA 5EM6A 5A4TA 5FUTA 4BGGA 3EN6A 4QMMA 4QMOA 5HCXA 2O2UA 5B0XA 5AAFA 3TG1A 3ZO4A 4F9WA 4O82A 2OW3A 4GK2A 2BIYA 3C13A 2XK6A 4AZTA 1PXJA 4I92A 3KB7A 4CMTA 2IZUA 3QL8A 2XIYA 5KMIA 4O7YA 2GNGA 4CKJA 1OPKA 4ZTLA 3KQ7A 3PFYA 3O7LB 2PE0A 3FQEA 3KN5A 5AMNA 4I93A 4XG6A 3RPOA 2QLQA 4DEDA 3Q2JA 4QT1A 3GNIB 3HDNA 4K2RA 1Q4LA 4BZNA 4MD7E 4F63A 4Z16A 4LV7A 4O6LA 2C6DA 4WRSA 4H3BA 2JDSA 3ORPA 2ETMA 3KEXA 3TACA 1ZWSA 5I3RA 4YZBA 3MPMA 1YXTA 2GQSA 3MVLA 2YACA 3Q60A 1NVQA 1O6KA 1IEPA 4I20A 4PP9A 5BUIA 3VAPA 5IA4A 3UOKA 4G9RA 4BTFA 4QTCA 4HW7A 1J7LA 2YCFA 4YJNA 5AUWA 4FIFA 3ULIA 4FF8A 2B0QA 1EH4A 1Z9XA 3WZDA 4IB5A 4YP8A 4FV9A 3UNJA 3CTQA 3RNYA 3VN9A 2XAOA 2W9ZB 4J1RA 3IECA 1JSVA 2XM9A 3FJQE 3GC8A 5A3XA 4O6EA 4CVAA 3NNVA 2W1CA 5J8IA 4FMQA 2EUFB 2WMUA 3CY3A 4R3PA 2IVVA 3OY3A 3NPCA 4HYIA 4JBVA 4CEGA 2F49A 5FXQA 3RHXA 5FDXA 4TL0A 5LVPA 3DU8A 1CMKE 1SYKA 2REIA 2XYUA 2IZRA 4LRMA 4QMUA 3FPMA 2FSLX 3KN6A 2CGVA 4IH8A 4XJ0A 2W1DA 2F4JA 2OH4A 3W33A 4AN2A 4AWIA 4WNMA 4O84A 3G15A 3FMLA 3QD4A 3MPAA 3W2SA 4QQTA 1ZYCA 1H25A 3QUPA 4EK8A 3VQHA 1M2QA 3U9CA 4ENXA 2XKFA 3DV3A 3FZTA 5AA8A 3FHIA 5E8YA 3ERKA 3C0GA 3QBNA 4LGDA 2R2PA 3ODZX 2JEDA 3PRIA 4G16A 4RFMA 4AX8A 4BTJA 5DR9A 4MXAA 2C0OA 4OT6A 3WF8A 3ZFXA 5I0BA 3GEQA 5L2IA 4TW9A 2CGUA 3W8LA 5IEXA 4U79A 2XRWA 5FBNC 1OL2A 1OI9A 2DQ7X 4EH7A 4USEA 4NUSA 2PMLX 4ZMFA 4L3JA 3QQGA 4IDVA 1JWHA 2PVFA 3B8RA 3RP9A 4APPA 5HD4A 1M2RA 3AMAA 2QLUA 3ITZA 5F94A 2HYYA 4BBEA 4HVGA 4BGQA 4WRGA 2B9FA 3MYGA 3PXQA 4G6NA 1OITA 4KS7A 3HGKA 4E4LA 2YJRA 1FGKA 3PXFA 3R7UA 1R3CA 1KWPA 5E8UA 5CF4A 5ITAA 1XMLA 2ZV2A 3BYOA 3FKOA 4HGEA 4C3PA 2IEWA 3BWFA 4OTPA 2WFYA 3BYVA 1KE9A 3GC7A 4DEGA 4X0MA 5D1JA 4Z3VA 1WFCA 5C8NA 2QQ7A 4CD0A 3RZFA 5LOHA 2PVRA 4QYGA 4BI1A 3LPBA 3R6XA 4C0TA 5CAOA 4NH1A 4RFZA 3NLBA 5DVRA 2W5BA 5BMSA 3MESA 2Z60A 3UOHA 4DE4A 3U6HA 1Y57A 4ZEGA 3O7LD 4RC4A 1MQ4A 3ZO3A 3U8WA 2P33A 4IZ7A 5IA1A 1REJA 3QWJA 4ANBA 2WTDA 2CLXA 3GOPA 3SDJA 2R3NA 5IISA 3TWJA 2X81A 5F95A 4ZLZA 2BAJA 5JFXA 4OAUC 2WMTA 4HGSA 5DRDA 3G6HA 3ZFYA 5DA3A 1P5EA 4H1JA 4AQCA 4J53A 1UNHA 2HZNA 4RC2A 3FHRA 5M51A 3Q04A 5EDRA 1XQZA 4BCNA 4X2GA 3DDPA 4XBUA 5HORA 2X8DA 5HBEA 3G51A 4CKIA 2C5XA 3MVMA 2R3OA 4QTDA 4W8DA 3MDYA 3VRZA 5TF9A 5CAQA 2VWXA 4RIWA 5J9LA 3MFSA 5AP0A 5AA9A 3A8WA 3LZBA 2HW7A 4FKOA 4EKKA 3UNKA 3C1XA 3KXGA 2XK9A 4HNFA 3POZA 3W2CA 4C38A 3C0IA 3KVXA 3QZFA 3VULA 4DH3A 4C3RA 1L3RE 3ZFMA 2PWLA 4APCA 4J7BA 1Q61A 4U9AA 3C5IA 4AFEA 3PIZA 5ANEA 3ZCLA 5BYYA 2A27A 5EDPA 4AZWA 3EMGA 4ANMA 1ZY4A 4FKUA 2EB2A 4JQ7A 3NUYA 4D5HA 1JSTA 3KFAA 4PF4A 3BWJA 3WF6A 4M14A 3QQJA 4Z9LA 4EK3A 4PUZA 2PUUA 1HCLA 4FV0A 4FEWA 4CCUA 2Y0AA 5HLPA 4NW6A 1ZYDA 3G6GA 3KXMA 3MIAA 2PVKA 3N4TA 2UZBA 2V62A 4I0TA 4FV4A 2LAVA 4GH2A 2XANA 3PVGA 1VJYA 4EHVA 3QTZA 4EH9A 4RJ7A 3UE4A 3F7ZA 3BIZA 4RIYA 3ZZWA 4PTCA 2KULA 3LCSA 1PMVA 1OKZA 3QLGA 3CTJA 1S9IA 3THBA 4PV0A 2O8YA 2Y9QA 4JXFA 3PA4A 4DEHA 4ACCA 4CYIA 4O7RA 3I6UA 4QYHA 5ANGA 5KX8A 4FV6A 3W1FA 4Q5HA 4BYJA 4R7HA 3ACJA 1Z57A 3ZLXA 4C58A 5IZFA 4C61A 5B2LA 2VAGA 1KUTA 2ITZA 4L53A 5EFQA 2ZFYA 3O96A 3Q4UA 4UZHA 4DT9A 4BDGA 3S4QA 2A19B 1XBBA 4CSVA 4D0XA 3DXPA 3EQRA 2XK3A 3U55A 3NFFB 2JC6A 3OOMA 1U59A 2PVNA 3CD3A 3Q4TA 3WARA 3FI8A 5IUGA 4QD6A 4RWJA 3PG1A 4HVSA 3UPZA 2R3RA 3ETAA 5E92A 3IK3A 2QU6A 4F70A 1KE7A 5A4QA 2GHLA 1H1WA 4EHZA 4BJJB 3EFWA 3QC4A 3Q9ZA 2PU8A 4L7FA 4W9WA 4PNKA 4RJ5A 5EHYA 5AIKA 1MRVA 3VRYA 1PW2A 4MD8E 3S95A 4BIEA 3UC3A 4PDSA 1V0OA 4IAZA 5I9YA 1VLRA 4UWYA 4F08A 3LQ5A 1WVWA 4H58A 2JKOA 2EXEA 3SLSA 4H3PA 5CSVA 4G2FA 5DG5A 3MJ2A 3EH9A 4FIGA 4C8BA 4PTGA 2OFUA 3MH3A 4M84A 1H0VA 5AIRA 1GZNA 5E8WA 3BHHA 3QCYA 5ETFA 2YWPA 3RBWA 3MB7A 3DKCA 1KE5A 2WAJA 1YOLA 4O1PA 4JJRA 4U7ZA 5CVHA 5CU2A 4ZLOA 1RQQA 2X7GA 2VUWA 3COMA 3DBDA 4I6HA 4RX9A 4D1SA 4KIQA 5HVYA 2XKDA 5KMLA 2X9EA 2VO6A 2X8IA 4KBAA 3VS7A 3O17A 5KMMA 5K3YA 2VO0A 4X2NA 1Q24A 4PNIA 3QQLA 4YUQA 3KMUA 1MQBA 2XNOA 2QKWB 3MY0A 4KB8A 3E3BX 2X0QA 4RSSA 4TWPA 3RGFA 3SXSA 2J2IB 4ALWA 4B99A 4BC6A 5CEPA 2XA4A 2X7FA 4CLJA 1JBPE 5F1ZA 4EEVA 2VGOA 4S34A 3NNXA 4ZK5A 1U54B 3WF5A 2I7QA 4O4EA 2FO0A 4CZTA 4NFNA 2WMXA 3QRKA 4MQ2A 2QO9A 5FTQA 5JFVA 2B53A 4UZDA 2I0HA 4NKAA 4G1WA 2VTAA 3H9FA 2JBOA 5IH6A 2JKQA 3MVJA 4MXXA 5IKWA 2O63A 3BCEA 2DUVA 3FI3A 2YM5A 4LYNA 3D94A 2HWOA 3OWJA 3V6RA 4BCOA 5KKRB 2QC6A 5JGDA 2B55A 4GUEA 1YXUA 4EOPA 4O0VA 2ITUA 2PPQA 4DTBA 3DQWA 2P55A 4ZZOA 4AZFA 4XRJA 2PUNA 1YDSE 1BLXA 3MH1A 5AR7A 3BBWA 5H3QA 1FMOE 3V5QA 4ANSA 3IDBA 1XR1A 3R1NA 2W9FB 3AT4A 3FY0A 3HMPA 1LUFA 1GZ8A 4ZS0A 4NK9A 2QONA 3D83A 3UZRA 1JVPP 5AR8A 3LFCA 2QG7A 4X6QC 4KRCA 4RLLA 3DB8A 4BB4A 2W5AA 4HYHA 3ZZEA 4DHIB 4EUTA 2XNNA 5L6PA 3C4WA 5AUTA 4KAOA 3V5WA 3F3WA 3NUXA 3H3CA 4FICA 4CFVA 4EYMA 2NO3A 2V22A 2PMOX 4YHTA 3V04A 4CFNA 2WHBA 4FSUA 3DA6A 3AD4A 4KSQA 1JKSA 2GFCA 3HVCA 3WZUA 3FSFA 4FTNA 4XNEA 4E6DA 4W4WA 4YJSA 4FGBA 5BMMA 4D2VA 5TT7A 2BAQA 2ZOQA 3ZXZA 2OXXA 1ERKA 3HZTA 3LMGA 3ZEWA 4L01A 3LCKA 3KRXA 4IFCA 3LJ0A 1BKXA 4JDJA 3QTXA 4JI9A 1J7IA 3KK8A 2OF4A 3OMVA 5KMJA 2P2IA 1BL6A 3BHTA 4M7IA 4QPMA 2R3QA 5EYDA 3I4BA 4CCBA 1FQ1B 2GS6A 5M4FA 1W2CA 4GL9A 3C4XA 5HTIA 5FLFA 2CMWA 3EN5A 3ORIA 4GJ3A 5A4CA 4AN3A 3CGOA 1PYXA 2Y7JA 4XEYA 3HMOA 3RAHA 5K9IA 5H8GA 4TT7A 5HCZA 3LFNA 3C4ZA 5GINE 4G6OA 4USDA 4I5PA 4AE6A 4KRDA 1W0XC 3MY1A 3PXKA 2IW6A 5H2UA 3TV6A 3BE2A 5FP6A 2IJMA 4F6WA 3FZOA 4F6SA 4JBPA 4NWMA 3OF0A 3GU6A 3Q52A 4II5A 4BWPA 4YU2A 3W0SA 4RIXB 4E5WA 3A4OX 3GXLA 2HZ0A 3NSZA 2OZAB 4K0YA 4NEUA 2G2IA 4Y8DA 4YLKA 5HG7A 3I6WA 3R8PA 1GNGA 3DAKA 3E8DA 4FZ7A 3I81A 4FRFA 4XH6A 3UODA 4L3LA 3GFEA 3NUPA 3RI1A 3BZ3A 2PHKA 3LCTA 3RCJA 2JAVA 4BVUA 3D9VA 3MWUA 2C1AA 2GNFA 5M08A 2B9IA 3SGCA 3A2CA 2W1IA 3H0ZA 4U42A 5FBOA 4O7SA 5AX9A 3FQSA 5FWKK 4XRLA 3TJDA 1U5QA 4I6LA 2H6DA 2CKQA 4JR3A 2ITXA 2XYNA 3RKBA 4EOSA 4M68A 4RRVA 2JIVA 3E7VA 2DYLA 3EFJA 3IG7A 2F7EE 2XS0A 4QTEA 4LGHA 1ZOEA 2I0EA 3PP0A 3H9RA 4GIHA 4OTHA 5LVOA 1Z5MA 4GJ2A 4IB0A 4FODA 4HCVA 4MEDA 3O50A 3SAYA 3WOWA 3GI3A 3OWKA 2NNWB 5AP6A 2W4OA 2YEXA 4LRJA 5DWRA 3MV5A 2C3LA 3FL4A 4XP0A 3IOKA 4D58A 4QPAA 2G1TA 4HJOA 4QMWA 4G3EA 3QCSA 5DEYA 4ZIMA 2G15A 3V8TA 4X21A 5M56A 2VX1A 4L45A 4F9YA 1K9AA 2WTWA 4LI5A 3W2QA 2YZAA 1VYWA 2QR7A 3VUMA 5JFWA 2WXVA 4XV2A 4EOLA 1GIHA 2XNMA 3PE1A 2ETRA 5DN3A 2GTMA 4KKGA 4ZSEA 4GFMA 4YTCA 2XKCA 3NW5A 4GMYA 3G5DA 2W1GA 4D5KA 4E93A 3L1SA 4TZRA 4ZJJA 3ORLA 5LJJA 3QCXA 3CTHA 1OIYA 2QURA 3I1AA 3L8PA 4OTRA 3A7GA 3NUSA 4D2SA 4FSMA 4YJPA 1Q8WA 4Y5QA 4EKLA 4FV7A 4M13A 2FVDA 5HKMA 2ITYA 3PJ3A 3ZU7A 5AP5A 5ETCA 3LM5A 3V5TA 2CNQA 5A4EA 5HICA 3PXZA 3MGYA 3RALA 4AXAA 1G3NA 1H0WA 1UWHA 5AR5A 4BFMA 2BTRA 1FMKA 3PUFC 3FLNC 4JRVA 1NA7A 4WSYA 1H07A 4O7ZA 3GU4A 3RZBA 2Y4IB 2PTKA 3D5UA 3FV8A 4WG4A 5M4CA 4RX5A 4DG3E 3MA6A 4G3CA 1J1BA 3BHYA 4ANLA 5J79A 3ZC6A 2WIHA 4IE9A 3VUHA 5E7RA 3AMYA 4CZUA 4FSTA 2GSFA 5HX6A 4K33A 3IS5A 1MRUA 4IWOA 4M0YA 2XK7A 3H0YA 5AEPA 4XG2A 4AT5A 4C33A 3W0RA 4QEBA 3GC0A 2C1BA 2IG7A 1OIUA 4C4GA 4K8AA 5TKDA 4PL4A 3W32A 3W16A 5E8ZA 4H05A 3G90X 3KGAA 2WTCA 4FKJA 5DOSA 2R3HA 4FKPA 4QMPA 3AGMA 4UMPA 3GU5A 3AKKA 4FIEA 1CKIA 4MX9A 2QOLA 4A7CA 5FEQA 4CRLA 1WCCA 4BDKA 3OCSA 2PL0A 3HA8A 3NVKI 4ERKA 4DFYA 4CV8A 5D7VA 4IJ9A 2C3KA 1YXXA 3G0EA 3HV4A 5J95A 4U40A 4FV2A 5LMBA 1JNKA 3FMMA 3OC1A 4QNYA 2YAKA 5DRBA 1TKIA 1ZLTA 2WMRA 3P7CA 2C6MA 3IPHA 4DHJA 2FB8A 2Q0NA 3QXPA 3OBGA 3P4KA 2YM3A 1Q8UA 1Q97A 1Q8TA 3ANQA 4ZSLA 2W0JA 1YI6A 5D7AA 4YSJA 4BDEA 2WKMA 2XUUA 3TZ7A 4EH2A 4AT3A 2YAAA 4IZ5A 3C50A 4LOQA 4IAAA 3TUCA 4W8EA 3IONA 3DK7A 2W05A 3ORTA 5IA5A 4Z7HA 3TMOA 3QA8A 3TNPC 2CKEA 1S9JA 3PJ2A 4PRJA 4QP9A 5DFPA 4NM0A 3UJGA 4J96A 1ND4A 2R3GA 4FSWA 4AQKA 3UDSA 3VS1A 2RF9A 4IDTA 4ZZMA 5I9ZA 5D41A 1KE6A 1H1PA 1M7QA 2BFXA 3HMMA 4FV5A 5JQ5A 3UOJA 5M57A 2X7OA 1O6YA 1XH7A 2GTNA 5EW8A 4MBIA 4KWPA 5CEMA 2I0VA 3PLSA 4ZXTA 3R28A 3RMFA 3TV4A 3KL8A 4OBOA 2E9VA 4P2KA 2WTKC 3CE3A 2ZM4A 3W0NA 5L2TA 2KTYA 3H30A 3DTCA 5IUIA 3BV3A 3VC4A 1PXMA 4BDAA 4F09A 3SRVB 3F7WA 2RG6A 4NZWB 1TQIA 3MJ1A 4KIKB 1J1CA 4FTMA 4M69A 4N0SA 3RAIA 3DB6A 3R73A 4Y46A 3BYSA 3SXFA 5CI6A 4BDIA 4FZDB 3O2MA 4ZOGA 4O7TA 2FUMA 5FTOA 3I79A 2FSOX 4YJUA 4BKJA 3LFSA 5AP4A 4EONA 3BL9A 1E9HA 4NIFA 4EQCA 3MS9A 3D14A 5C26A 3ZOSA 1LPUA 3MBLA 3K5VA 4L9IA 3IQ7A 4GUBA 4JX7A 4BDCA 3UG2A 3NRMA 2PMNX 2PVHA 4X3FC 2BIKB 2X6DA 2GNLA 5DI1A 4JOAA 1GY3A 2C6KA 1VR2A 5BYZA 4EHEA 2IZSA 4I5MA 2X0PA 3OG7A 2HK5A 2QD9A 4G5JA 4FG9A 3GC9A 2WOTA 3NZ0A 2GHGA 4O22A 5EYCA 2B54A 4XG8A 2CKPA 4CG8A 3CP9A 4YPSA 2R7IA 3BELA 1YHVA 3FMJA 3FLSA 3MPTA 4E4MA 3TN8A 1OECA 5IF1A 5L6OA 3KREA 4UEUA 2GQGA 4OTFA 3ZEPA 2OBJA 5I9UA 2YLEA 5DYJA 4RIXA 3PFQA 1IA9A 4F99A 5HIEA 3UMXA 2HCKA 4IX6A 3OXIA 4YZMA 3QX2A 3P9JA 4RZVA 5EI8A 2XARA 4A9SA 4EZ7A 3NR9A 1MRYA 2J5EA 1RW8A 2W06A 3DLSA 3P23A 3PXRA 4EOMA 5J7HA 3OWLA 4V0GA 5CQUA 1JKKA 2W17A 4NM5A 4K6ZA 2X2LA 2DWBA 4RJ8A 3SOCA 3UO4A 5HG5A 3B2WA 5ACKA 2J0JA 5BQ0A 2EU9A 1XKKA 5BYLA 3GQIA 2UW4A 3VJOA 4E20A 4GG5A 4DDIA 4FTQA 3TDVA 1XH6A 3E3PA 5T6KA 3BGPA 4KBCA 5HI2A 4RJ6A 3O51A 2ZM3A 2X2MA 4BCKA 4C2VA 4ACGA 3OS3A 4CKRA 3QWKA 2EWAA 1T45A 3C9WA 2PVJA 3R71A 5AX3A 4CFUA 2XIKA 2W4JA 3DY7A 3OUNB 3A7HA 2AUHA 4HCUA 5TO8A 5AV4A 3VS4A 3KULB 3OY1A 4M0ZA 4PPAA 4BCMA 2XEYA 2R3FA 2Z7LA 5EDQA 2XRUA 2CKOA 5AUYA 3EJ1A 1OL1A 1H27A 1PXNA 2RFNA 4OTIA 3R8ZA 4ZTSA 3FZSA 1NW1A 1PYEA 3TDWA 3WE8A 2F2CB 3BHUA 3QTWA 4B0GA 2YIWA 2ZMCA 3DFCB 2CGXA 2JDRA 2UV2A 4C34A 4EZ5A 4NTSA 3CEKA 2J0LA 2UZWE 3C4CA 4GFOA 3ORNA 3UVQA 4L00A 3HAMA 4HOKA 3ELJA 4U97A 1O9UA 5HNGA 4IMYA 2Z02A 1ATPE 4RGJA 3FE3A 3Q5IA 3IW7A 2C0TA 3E63A 2B4SB 4P90A 4EK4A 4N57A 4KA3A 4FKLA 2ITVA 3LQ3A 2IPXA 2P0CA 4AOJA 5K0XA 3IGGA 2W5HA 2IW9A 4D1ZA 3ZLSA 2E9PA 3AC5A 4TWNA 3OHTA 5FTGA 1P14A 3QHWA 4XHKB 3FPQA 4C7TA 4ZZNA 1XMMA 2W1FA 3DOGA 4MH7A 2QHMA 3LCDA 4YZ9A 3FXXA 3PJ1A 5IUHA 3Q32A 1WBWA 2VWZA 2C0IA 2WMBA 4EUUA 4YHFA 4CMUA 3N51A 1ZYLA 5AV2A 4ASEA 2QOCA 3NAXA 4R3CA 3MW1A 1W2FA 4DAWA 4A9TA 3NX8A 5E9EA 5FQDC 3OZ6A 3ENHA 4L52A 4MBJA 3G2FA 4M97A 3ROCA 3RVGA 1JKTA 2OJIA 3F2AA 4MNEA 2BDFA 3EQDA 2IVUA 5KZ0A 4AFJA 3WI6A 5IMEA 4IWDA 2X4ZA 3CQWA 2F2UA 2GU8A 2QOBA 1NY3A 3CS9A 3D2KA 3FZRA 3KRJA 3Q5ZA 4LV8A 3HRFA 5EI2A 4BTKA 4BWKA 4CFWA 3ML1A 2WU7A 1QPJA 1W82A 4BL1A 4EBWA 5IU2A 3BU5A 4PWNA 2C5OA 4AACA 4LOOA 5D10A 2HXQA 5FM3A 3V6SA 1WBTA 2XM8A 4ANQA 2YM6A 2HW6A 4X7QA 2W1EA 1URWA 2ZAZA 2ZDTA 4F0GA 5HOAA 1OM1A 3D0EA 3R30A 2YLFA 2H96A 4GK3A 3COKA