1REKA

Crystal structure of camp-dependent protein kinase complexed with balanol analog 8
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Balanol analogues probe specificity determinants and the conformational malleability of the cyclic 3',5'-adenosine monophosphate-dependent protein kinase catalytic subunit
pubmed rcsb
source organism Mus musculus
molecule tags Transferase
total genus 97
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1rekA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1rekA02
5JN2A 2B1PA 3GOKA 1CKJA 3QHWA 2R3MA 2W05A 2C6EA 4FV8A 4HGLA 4QMTA 5HIDA 1GZKA 1TVOA 1XBCA 4C4HA 4QQCA 2UW9A 4PPCA 3MI9A 5CI6A 3VHKA 3A7JA 2Y7JA 1UV5A 5JZNA 2ZV8A 2WIHA 3LLTA 3PJ3A 3COIA 4YLJA 4QD6A 3WILA 3RI1A 5EQYA 3HRBA 1YXSA 4CSVA 4UXLA 4ZTLA 4FVQA 5HICA 5ETAA 3O7LD 1IRKA 3ZFXA 4YZBA 2PZIA 2R3GA 4U80A 1Y8GA 4FYOA 2YJRA 3UQFA 4CLIA 2GQSA 2ITWA 4IJPA 3PA4A 5FG8A 4FEVA 1XBBA 2UZWE 3SQQA 5JQ5A 3ZO3A 3MJ1A 3P4KA 4H39A 4F9WA 5C4KA 4DEAA 3C1XA 2C6DA 3FJQE 1A06A 3FPQA 4NSTA 1ZZ2A 2OIQA 2J9MA 1H1SA 2PVYA 3D9VA 4AN9A 4F7SA 4HOKA 5A4TA 3S2PA 5GZ8A 3PVBA 4GEOA 2I0YA 3D94A 3IECA 5AUYA 4FT7A 5DEYA 3UDBA 4EYJA 5BYYA 3CD3A 5BVWA 3OBJA 5BMSA 1PXMA 3LHJA 3ZFMA 5EYMA 3CLYA 1UWJA 3V01A 1H1QA 5IQIA 5JGAA 4GUBA 3OZ6A 3QTRA 4KIQA 3E3BX 4U7ZA 5BUIA 4I5HA 4LOOA 2NNWB 2BPMA 3DXPA 3KK8A 1NT2A 3DY7A 5CVGA 4EK4A 4C3FA 5AP4A 2XNEA 2BFYA 4NZWB 1JPAA 4X2NA 3HMIA 3F5GA 3ORPA 3VF9A 3W2QA 2XH5A 3ZBFA 4BCJA 4C4JA 2W1DA 4F4PA 2X7GA 3GC7A 4GJ2A 3QQFA 3ZEWA 2CGVA 5L2WA 3BBTB 2X4ZA 5M4CA 1FINA 3BE2A 5CQWA 4HYUA 4EH4A 3RAHA 1UNHA 3ZLSA 3W16A 4AG8A 2PE0A 2CNUA 4FSZA 1EH4A 3FLZA 2CCHA 4RWLA 4ZSLA 3AGMA 4AT4A 3BQCA 2VUWA 3W2RA 5CNOA 2CN5A 3GFEA 3Q52A 3GOPA 3R8PA 1ZYJA 4WKQA 4FZ6A 4M15A 4EK5A 1YRPA 2ITYA 2XIYA 2JFMA 2VWXA 3I0OA 4F09A 1Q3DA 3NYNA 1OKVA 5CVFA 2G2IA 3EN5A 4PPAA 1WCCA 3TN8A 4G17A 4X21A 4XV3A 3FMMA 5IMEA 5EKOA 4FKTA 5EW8A 5CXZA 2XK4A 3A7IA 3PP0A 2PVFA 2VX3A 3QZIA 4RZVA 3VS4A 4FIFA 2RF9A 4A4LA 5K3YA 3OROA 3QHRA 4I0SA 1XH4A 2BRMA 4MVFA 4O6EA 3UIBA 3PYYA 2X2KA 3UMXA 3Q2JA 3MW1A 3OBGA 2FSLX 2XP2A 2GNJA 2BRHA 3NUPA 2WTJA 2YM4A 4BZOA 5T3QA 4HGSA 2OXYA 4CYJA 4WIHA 4GK2A 3R22A 4RJ4A 3DBQA 2B52A 2PUPA 4G16A 3REPA 1FMOE 3QZGA 5KUPA 2GCDA 1G8AA 1H25A 2B55A 4JX3A 2XK9A 1J1CA 3B8QA 4GG5A 3SW4A 3PWDA 1H0WA 3F5UA 4KWPA 4ZXTA 1OIUA 4KD1A 2BDFA 3DJ5A 3RGFA 5C27A 3QXPA 1XH6A 3ZRLA 3KVWA 3OWKA 4OTQA 3DQWA 2O2UA 3FMKA 1GZNA 4E6AA 5J7BA 1WZYA 4FKQA 2WB8A 1Z57A 4PWNA 3DNEA 3ZFYA 4DEHA 4NUSA 5HLWA 3DTCA 4AGWA 1WBOA 3R9RA 3C0IA 3QBNA 1LP4A 1YXVA 4DCEA 3QUDA 4FF8A 1ZMVA 2YIQA 4I4FA 4D4YA 4F9YA 5M57A 5FEQA 1L8TA 3QTSA 3KMMA 4R78A 2FSMX 3TIZA 4WOVA 2FSOX 5LOHA 3R7UA 4D5KA 4YTHA 5I9XA 4YMJA 3UO5A 3FKLA 3U4WA 4C58A 4NTSA 3BHUA 4ZS4A 3R2YA 4MNEA 2ONLC 1YHWA 2PZPA 2WQMA 4IAFA 5M4FA 4G1WA 3SX9A 2V5QA 2C3JA 3G0FA 2OZAA 5EI2A 4BTFA 2EWAA 5EHYA 3PY3A 1UNGA 3FLQA 2O0UA 4R8QA 4O2ZA 3ENMA 4FG9A 4BY9E 4AA5A 4TZRA 4CD0A 3B2TA 1W7HA 3SKCA 5KHXA 5M06A 3D5VA 5IUIA 4ZSAA 1APME 4GT3A 2W4OA 4Y72A 4RJ5A 1Q8ZA 3IDCA 4EZ3A 5DI1A 3ZDUA 2FUMA 2XKCA 3NAYA 5D9HA 3RP9A 3A99A 5C8KA 5M55A 4G6NA 3A7HA 5T6KA 4UN0C 3RTPA 5I3RA 4S32A 4BIEA 4BCGA 1OKYA 3M42A 4QP9A 5HE2A 1IEPA 3HP5A 5HIEA 2W5BA 1CMKE 3R9DA 4M3QA 3IDBA 1VR2A 1GAGA 3ODYX 3DGKA 4USEA 3H3CA 3PJ2A 4R3PA 3QGWA 3MWUA 1Q3WA 4YJTA 4RIXB 4I41A 3H9RA 2ZYBA 2VTSA 2J5EA 1H1WA 4PL5A 2DQ7X 2X2MA 3BLRA 5E8WA 2IO6A 1OBDA 4MBJA 1CSNA 2HAKA 4ANOA 3I4BA 4XP2A 2VWYA 3ORKA 4KKGA 3ALNA 4AGCA 4DFUA 3QCXA 3VW8A 3PG3A 4RX8A 2YIYA 4FTRA 2VGOA 4G5JA 3KRXA 2IVUA 4L7SA 5M4UA 3NZ0A 3MY0A 3AMAA 5DLSA 4CZYB 3V6RA 4B6LA 5C4LA 5EH0A 4FT9A 4E1ZA 3PRIA 1XH9A 4GT4A 3ODZX 5L8LA 3CQUA 2GTNA 4LMNA 2PVJA 3O50A 3II5A 3VN9A 4A9RA 3VF8A 1W83A 2BDJA 4RSSA 4BIDA 4EQUA 3H30A 4FIIA 2H6DA 4BHZA 5A46A 4GW8A 4X6QC 4DN5A 2VTLA 4USDA 5DIAA 4O38A 4YLLA 4NFMA 4LMUA 2ITZA 5HD4A 4RFZA 1NVRA 1BI7A 3DOGA 3UIUA 3WE8A 1XBAA 4A4XA 1KUTA 2X39A 4L44A 2OK1A 4W9XA 5CT0A 4R1VA 3GQIA 4ERWA 4O83A 3R1QA 4RX9A 2O5KA 5JT2A 3MH0A 1FQ1B 4MCVA 2Q83A 2VWIA 3HMMA 5EI8A 3CEKA 2CKEA 4BCHA 4IM3A 2R3FA 3TNPC 3VJNA 4F7JA 1KE8A 3I7CA 3PY0A 3QA0A 2JKOA 2QKRA 3QD4A 3VS6A 3P7CA 4OBOA 4C33A 3EWHA 3BHTA 4HVIA 4O81A 2E9OA 4YP8A 5K4IA 3EIDA 1F0QA 2NRUA 3AD5A 2HCKA 4ZLZA 1YOLA 4I23A 2QO2A 3UOHA 3DKGA 4FTCA 5GZ9A 1FMKA 2BCJA 3DZOA 3LQ5A 4QNYA 4CKJA 1XH5A 4IZ7A 3HGKA 3I6UA 3CE3A 5FLFA 2J0JA 5E8SA 5JFVA 1KE5A 5CAUA 1PMUA 3FZTA 1TQPA 3IW7A 4YC3A 3I60A 3GGFA 1OPKA 4R6VA 3GU7A 2RSVA 4XCUA 4ZEGA 4BCNA 5ETIA 4FE2A 1URCA 4NW6A 3H9FA 3QD2B 4L53A 1NVSA 3D15A 4FTQA 5HBHA 3PVUA 4F6WA 3VBTA 5HNGA 4Z7GA 4OTIA 5AR7A 2IZSA 4DFZE 3TCPA 3LMIA 4O7SA 3L9LA 3LMHA 4LG4A 4OTFA 4R77A 4RVMA 5DYJA 3F88A 3I6WA 3PWYA 2VO6A 2WXVA 3T3VA 1QPDA 2BZKB 2YZAA 4BDKA 4D0XA 3VUIA 4GU9A 4U43A 5FXQA 4AE9A 1XHAA 2VO0A 3AC5A 3BZ3A 4J53A 2V7AA 2B54A 4XV9A 2AYPA 3QC9A 4IX5A 3CD8A 2C4GA 5IQDA 4E5WA 4IDVA 4RJ6A 4DTAA 2WMQA 3MV5A 2QONA 2J4ZA 2QOHA 4O21A 5CU6A 4C2VA 3R8ZA 2ETKA 1DAYA 3I7BA 5G6VA 2QOQA 5IF1A 4WNMA 3VBXA 1TKIA 4RA5A 2GTMA 3FDNA 3S4QA 4O7ZA 5C03A 2GDOA 3C4ZA 3Q9ZA 5IA1A 3PY1A 2C0OA 4ZY6A 5GINE 4XOYA 5CXHA 4NIFB 2BZJA 2F7XE 1PYXA 5CAQA 4O7NA 2NRYA 3Q9XA 5JQ8A 1MP8A 4MF0A 4USFA 3ORZA 4FC0A 5M56A 4TW9A 3ULZA 4KABA 4FTNA 4BDAA 4EHVA 2UW5A 5J5TA 1UKIA 2JGZA 4UYNA 4X3FC 3E92A 4C59A 5F9EA 4BGGA 5JK3A 2RG6A 5AR3A 3Q4ZA 4JOAA 3IOKA 2P55A 2W5AA 5CWZA 4FTAA 3PJ1A 5L6OA 4C02A 5A6NA 3I0QA 5JRSA 3MH2A 4E7WA 4HVGA 4G3CA 4QOXA 2WMTA 2HENA 3D0EA 4BRXA 4QP1A 1LR4A 4DAWA 2W1EA 3G6GA 3WF5A 1OL2A 5A4LA 3QRJA 4O7LA 4BBEA 4KAOA 4NK9A 5EK7A 2PZYA 2W1GA 3RAIA 3UQGA 5TR6A 5IA2A 3O2MA 4QTDA 4NM3A 3PTGA 4FV4A 4ANSA 3JPVA 1VZOA 3E8NA 4EH9A 3UVPA 3EQPA 4HGEA 4CFNA 2JC6A 5AP7A 4AW1A 4EOPA 5LJJA 4IB5A 1H4LA 3RZFA 2PK9A 3FQEA 4RIYA 4PDOA 3KEXA 1M2QA 1KV2A 2YDJA 4KKHA 4C57A 3AG9A 4P7EA 4BI1A 4N6ZA 3NIEA 3GCSA 3LFFA 2XIKA 4OTHA 4ZY4A 4YHJA 5I0BA 2WMSA 3D4QA 2W1CA 2XKFA 4KIPA 4RIWA 1IR3A 1V1KA 3RWQA 3ZO1A 4A9UA 2UZNA 1M7QA 2PUIA 2EB3A 3IPHA 3DJ6A 3TNQB 3RK5A 4FGBA 4FZFB 4K11A 4W4VA 5GJGA 1DI9A 2ZM3A 3FUPA 3QD0A 3COMA 5LMBA 5LWMA 4XYFA 4F7NA 4FKGA 5LMKA 3QZFA 4M0ZA 3FI3A 5E91A 3M11A 3MH3A 5DR9A 3MY1A 2QKWB 3ACJA 4IE9A 3R7IA 3BWFA 3RWPA 3WZDA 4Q9ZA 5J9YA 4EH5A 5EW9A 3E8CA 5CY3A 2O65A 3DBDA 4TYIA 5JFWA 5EQEA 4QYFA 2I7QA 4RA4A 2VZ6A 4PMSA 3CQWA 4M12A 3GENA 4O6LA 3R00A 1SNUA 1J1BA 1JOWB 2UUEA 3I1AA 3EFLA 3PJ8A 1LUFA 4O1OA 2X7FA 4W9WA 3PDTA 3UPXA 3FXZA 3QQUA 3FI4A 5ANEA 3W2PA 2G01A 4IQ6A 3BIZA 1KE9A 3NYVA 4ZY5A 2XCHA 3MFTA 4TWNA 3CP9A 3FC2A 5DR6A 4YNOA 2YM8A 4HCTA 4LQMA 3NCGA 4D58A 2YDIA 5AUXA 1YDSE 1H24A 2QI8A 4QMPA 3BQRA 3SRVA 3CCNA 4NL0A 3CGFA 3DU8A 2C1AA 3O0GA 4L3JA 5KBQA 4LI5A 4C4IA 4HVSA 3O23A 4JX7A 5K5NA 5GJDA 2XK3A 2HZNA 3PVWA 4FG8A 2WU7A 4IAKA 4RJ7A 4AZWA 5IA3A 3AT2A 3KXHA 5HG9A 2J0LA 3D83A 5IUGA 2WOUA 3OCTA 1VYZA 1GY3A 1J7IA 4BCIA 3A4OX 5CSWA 4M8TA 4BTJA 5D41A 5DH3A 4NJDA 4DC2A 2BTSA 3Q2MA 2YAAA 3NVMB 3FZ1A 3SOAA 4WO5A 3JVRA 3R7YA 5CALA 4NT4A 3MESA 4LGHA 4PPBA 4BZNA 2GQRA 3QX4A 3FYJX 4IX4A 4U0IA 1ZYLA 2QHMA 3DXQA 3MTLA 5KHWA 5I5ZA 1YW2A 2AC3A 1WVXA 2F57A 1SYKA 2VTTA 3HRFA 4DTBA 4PMTA 2JFLA 3VUDA 3THBA 3VW6A 3QAME 4JBQA 5H3QA 3C4WA 2Z2WA 2UZBA 5BVKA 2PE1A 5M09A 2B53A 2X9EA 3LIJA 5IQBA 4QYEA 3K3IA 5BVFA 4QP8A 4O0UA 3VJOA 3WARA 3QQLA 3TT0A 5LVPA 1K2PA 5DT0A 3LW0A 4U97A 5TKDA 3UC4A 4AW0A 3BHHA 4DLIA 4PDYA 3ZUVA 4G3FA 3BHYA 3OFMA 4BFMA 2NP8A 3UYTA 3R8UA 3OD6X 1LPUA 2OZOA 3S0OA 5BUJA 2REIA 2PULA 2YLFA 4O96A 3ZMMA 4AZSA 3ZONA 4JJRA 4TYEA 4M0YA 1SVGA 5E8VA 2C6TA 1QPJA 3R1SA 4C7TA 3FEGA 2XZSA 3A4PA 3B8RA 4GMYA 2JIIA 4G9RA 3NYOA 4IAZA 4NJ3A 1WMKA 1GIJA 5E92A 1OIQA 1IG1A 4AAAA 4YTCA 2R4BA 4QYHA 4ALVA 3BI6A 3EQCA 4J96A 4BDEA 4C3RA 5KNJA 4G9CA 5L6WL 4WRSA 2HIWA 4R5YA 4QYYA 4YNEA 3UC3A 3M1SA 5EYDA 3CSVA 5HIBA 5ANIA 1XH8A 3DK6A 4TYHB 4LRMA 5AR8A 1OECA 5HVYA 4U6RA 2X0GA 4MXCA 3IQ7A 5DEWA 1U54B 3LXLA 4IWOA 4YJOA 1XO2B 1OB3A 5HBJA 2ZB1A 5IA5A 1OL1A 3VNTA 2C6OA 2PSQA 3N4VA 1CDKA 3HV6A 3E7OA 1YWRA 4MXYA 5AV4A 2F4JA 3DT1A 3O51A 4BDBA 4YJNA 3GVUA 3Q9YA 3F66A 3HV4A 4I5MA 4D5HA 3Q60A 3R63A 5HNBA 4EOJA 3POOA 4QMYA 4TYJA 1DS5A 2X9FA 3I81A 1VEBA 1UU8A 3OW4A 5AP1A 3RPOA 5AM7A 1W98A 3OWLA 3K5UA 4GL9A 4FOCA 3KXNA 2IPXA 4M66A 2XBAA 4RFMA 4YU2A 5DG5A 4Q5HA 3FZRA 1JSTA 5HGIA 4CFMA 4EHZA 5EKNA 3OWPA 4QP7A 1Z9XA 5IEXA 5EQPA 3EOCA 5DNRA 2QCSA 2C3KA 4BCOA 4RQKA 2HZ4A 2OJ9A 2Z7RA 5HVJA 3FV8A 5EW3A 5AX9A 4DYMA 2YHVA 3AD4A 2IN6A 3VS7A 1PXOA 3VUTA 2J0KA 3E8EA 3QD3A 3D7ZA 4QQ5A 2IW6A 4PF4A 2CKQA 1LEWA 2WTDA 5HORA 2IG7A 4QP3A 4Y95A 4EYMA 4XNEA 4CFVA 1JSUA 3KGAA 4ONAA 5IZFA 3BPRA 2X1NA 4U41A 5HX6A 3ORNA 4XLVA 2JIVA 2GS6A 3OCSA 3RPRA 3QKKA 4V0GB 2WTKC 2VTJA 2NPQA 4IADA 3TZ8A 4JDHA 2ETMA 3FLYA 4ASEA 2YCRA 2R0IA 3CXWA 3G5DA 3LFAA 2YA9A 3V5JA 4BWXA 4F9BA 5CAOA 3LQ3A 3OT8A 4JDJA 1YHVA 2I0HA 2XK7A 4O0YA 2HELA 2R3PA 3ZC6A 4O0XA 3EHAA 3NUXA 3UO6A 4G6OA 4CV8A 3OT3A 3P0MA 4I22A 2VAGA 2BIKB 1HCLA 5DR2A 4AGUA 3VUGA 3HAVA 5GHVA 5H2UA 1ZMUA 4GYGA 4MWHA 4D2PA 4YUQA 5J79A 3KK9A 3MYGA 4KKEA 2OFUA 3P5KA 4RVLA 2W17A 4W4XA 3P86A 4YJUA 3ULIA 4FKVA 2VGPA 3EQRA 4EZ5A 4I6HA 3IGOA 3JY9A 3QTZA 3UODA 3QF9A 4XG2A 4BWKA 4IFCA 1AD5A 1ZWSA 4TY1A 3NDMA 3L9PA 3LFDA 2QC6A 3EFJA 3OS3A 5E9EA 2VWWA 1FVRA 1ND4A 3V04A 1Y8YA 1W8CA 3O8TA 3HKOA 1JKSA 4FV0A 4BCPA 3DA6A 4TWOA 3OHTA 3A61A 3Q96A 1FBNA 5IG1A 2YIXA 4EH8A 3QLFA 4V04A 1G8SA 5F94A 3ANRA 2QR8A 4KINA 4WBBB 3SD0A 1OIYA 4UWCA 4A4OA 4YC6A 4OW8A 4CFFA 5FBOA 1XR1A 2H34A 4NU1A 1URWA 3W1FA 3R1NA 4FTMA 3V5LA 5K4JA 4F0FA 2CMWA 4ERKA 1CTPE 3KN5A 4GUEA 2OSCA 4TXCA 5AWMA 2C5OA 5L2QA 5LARA 3ZC5A 4U79A 4UB7A 3T3UA 4Y5HA 5B2KA 3SHEA 1OITA 2Z7LA 3NNXA 1OGUA 3V6SA 2UW8A 3BYVA 4H3QA 2I40A 4L01A 4B8LA 4D2TA 4EKLA 2JDRA 3AC2A 4QTCA 3PG1A 4KS7A 2O63A 5J1WA 1YKRA 4IACA 2UVXA 4JAJA 1YXUA 3UNZA 3W2OA 1H1PA 4J8MA 3V8WA 4JIAA 4EI4A 3A8XA 2R5TA 1CKPA 4BDCA 1PXNA 2GS7A 4ANBA 5CSXA 4C4EA 5AAEA 3OOGA 4JQ8A 1ZLTA 5J9ZA 1A48A 3LLAA 4MD7E 3LVPA 4G34A 2OWBA 3EN4A 2XYUA 3Q9WA 3KULB 4JG8A 2JKKA 4P90A 3UIXA 4AE6A 2HXQA 3ZO2A 3PPJA 4BZDA 1FPUA 3BKBA 4JI9A 1W82A 2UVYA 4AZTA 3D14A 3A62A 5FBNC 3MPTA 2I0EA 3QRKA 1S9JA 2HYYA 4M69B 4D4VA 4FKSA 4MX9A 5I9VA 4ZTNA 4GK4A 4AW5A 4C8BA 3QQKA 4FEUA 3E63A 5CEQA 5AV1A 3VRYA 3QGYA 4XX9A 4W8DA 3H0ZA 1OI9A 3D5WA 4R5SA 3VVHA 4E5AX 3A7FA 4TPTA 5CYIA 2G9XA 5KZIA 4FOBA 4UMQA 1WBSA 2WD1A 5E1SA 4LL5A 4FZAB 4A9SA 2GNLA 5J1VA 2BAJA 4FNYA 4LV5A 3LM0A 3MB7A 4RIXA 4A7CA 4ACCA 4O86A 3GC8A 4GVAA 4WG4A 3LJ1A 4XRJA 3PXQA 4BKJA 2CGXA 3MVLA 3BEGA 3ZH8A 1H00A 3ACKA 3DBFA 2XNNA 5HNIX 4UMTA 1PMEA 1LEZA 3POZA 2JDTA 2XVDA 4FSUA 4C35A 3F2RA 2C6LA 3FXXA 3N4TA 5BVDA 2DUVA 3PVGA 3S95A 3CBLA 3DAKA 4KBAA 5HI2A 1ZOEA 2J5FA 1IAJA 4ZSGA 1W84A 4EOSA 3BLHA 4WSQA 2A1AB 3LFSA 4HPUE 4YZCA 2HWPA 2ZMCA 3Q32A 4MBLA 2GFCA 3VS2A 4QMOA 2WTWA 3ZYAA 1Q4LA 4NM0A 3TZ7A 3TKIA 3IG7A 3KF4A 3BLQA 2OXDA 3OY3A 3FMEA 4YJPA 4D9TA 4ZZNA 1Q8TA 4EHGA 1Y6BA 3FZPA 2PUNA 3TJDA 4ARKA 1Q62A 2QOBA 3FMNA 1JWHA 4E4LA 1H01A 1UVRA 3ELJA 3BU6A 4F1MA 3KREA 3PZHA 2VV9A 1PW2A 1ZOHA 3UTOA 4K8AA 2IZRA 3C9WA 3OY1A 4JS8A 4RZWA 4K2RA 4Y8DA 3SC1A 4N70A 3EZVA 4W4WA 2X8EA 2AC5A 3ANQA 4WD5A 4FV5A 2RGPA 2HW6A 3ZTXA 2R2PA 4APCA 4ITJA 4LM5A 4YZ9A 5C9CA 5D7VA 4OTDA 4NEUA 4BF2A 3Q04A 2ZDUA 3RCDA 1KWPA 4PTGA 5AJQA 5FXRA 5HE0A 4U9AA 3HUBA 4FIGA 1J7LA 3PPKA 2ITUA 4C4FA 5LMKC 4X2KA 3RK7A 3GCVA 4DGOA 3F61A 3R9NA 1BL6A 3RKBA 4XS2A 5EFQA 4DGLC 4J8NA 5F1ZA 5AIRA 1KOAA 3KC3A 4LYNA 4DFYA 4R3RA 3C0GA 3WF6A 2XNPA 1CKIA 4A9TA 3WF9A 4BB4A 4BGHA 3LCDA 4FGRA 5H8GA 3WF8A 2UVZA 3A2CA 2BUJA 3E3PA 4FSNA 5CT7A 4HYIA 3QYWA 4XOZA 4BICA 3CR0A 2ZOQA 4GFGA 4WG3A 2YIRA 4MD8E 5AP2A 3GT8A 5BNJA 3H9OA 2UW0A 4RLLA 1PKDA 3OC1A 2QQ7A 4UMUA 3S1HA 4B7TA 3QX2A 5EM6A 5DRDA 3Q4CA 4F9CA 2XKDA 4J98A 1KSWA 4B9DA 5KO1A 2UZUE 4IAYA 3P7BA 5LMAA 4DH3A 2ERKA 3NPCA 5CAPA 2GMXA 4D2SA 2PVNA 2WO6A 5E8YA 4OGRA 4N4SA 3O17A 3NUAA 2PVMA 4XJ0A 4L43A 5DHJA 2W9ZB 5E7RA 4GKIA 5C1QB 4YJVA 4L8MA 1I09A 4JLCA 1B38A 1PMNA 3DFCB 5FWKK 4I93A 5B2LA 3TUBA 2B0QA 3U55A 4FZDB 2XCKA 4ZSEA 3OCGA 2QO7A 5DE2A 2QOFA 4QPAA 3FKOA 1Q41A 4HVHA 4DGGA 3R7GA 3NWWA 3UQCA 3CJFA 2ESMA 4UBAA 2CLXA 4FT0A 1PXIA 3U6HA 3QL8A 4CG8A 1OL7A 3AOXA 1OL5A 4TT7A 4CRLA 4JAIA 4EK3A 2QO9A 1OZ1A 4KB8A 1OL6A 3E5AA 2O8YA 3C4FA 1MRYA 3GU8A 4DLJA 4YR8A 3F82A 4CV9A 3IGGA 4NIFA 3SA0A 2CKOA 4QMLA 3HA6A 4KUJA 4OBQA 5HHWA 4D1ZA 4IM2A 4FR4A 2WU6A 3FLSA 5AR5A 4F6SA 5I3OA 5A14A 4FICA 3JS2A 4J99A 4MD9E 5CSVA 4PDPA 4ZOGA 2GNGA 4HGTA 1WFCA 3DCVA 5EI6A 4ZTHA 4MH7A 5KBRA 3MGYA 5IDPA 3OMVA 4HZSA 4NTTA 4TWPA 4E6DA 2GPHA 3PRFA 2A19B 4LGDA 5CI7A 3COKA 2IJMA 1A9UA 1P4FA 5HO6A 1SZMA 2Y4IC 4ZZMA 4DG3E 5IMXA 3GXLA 4CTCA 1Q8UA 3DS6A 2PU8A 3A8WA 4XG6A 4MYGA 2KULA 2QVSE 4Q2AA 4H1JA 2VX1A 3BRBA 4B4LA 5IQAA 5IQEA 4EZ7A 1AGWA 3WE4A 3P7AA 2IW8A 3FI2A 4U42A 3PJCA 3BV3A 4FA2A 3WZKA 3V5QA 1UA2A 2B9IA 3OUNB 4AW2A 3FZOA 2BIYA 4J71A 5DN3A 3HZTA 3LFBA 3QQGA 5HTBA 3KN6A 5E90A 1T45A 3ZM4A 5K9IA 4XG3A 5BYLA 4S33A 4D1SA 3HUCA 5D10A 3V8TA 2XIXA 1DM2A 4JQEA 3UJGA 3V5TA 1JQHA 4WSYA 2HY81 3GB2A 5HQ0A 4O7RA 2BAKA 1M7NA 5CEPA 4ZTMA 3G6HA 4JXFA 4Z55A 4U45A 3LQ8A 4WUNA 2FB8A 3NVKI 5LXMA 3TEIA 4QYGA 3NEWA 3SXRA 3VS3A 3CIKA 4DFNA 3KXXA 3LAUA 3V8SA 1VJYA 2P3GX 5AUUA 2R7IA 2ZV9A 4OTPA 5ANGA 3W10A 5HLNA 2UZEA 3FQSA 1XKKA 3DKFA 3NW6A 4FVPA 3MDYA 2BMCA 2ITVA 5CU4A 1BX6A 2RIOA 3VUKA 2ETRA 3A7GA 1Y91A 2V55A 1JVPP 4QMUA 4O0WA 4JL9A 1MQ4A 4BCQA 4FK3A 3V5WA 5IU2A 1O9UA 4KIOA 1QMZA 2W4JA 4WUAA 2C68A 4DINA 2I0VA 3DB8A 3DKCA 4O0VA 3ZUUA 2G1TA 1QPEA 5M07A 4CMOA 2PVHA 4QPSA 3P78A 5F20A 3TNHA 1W0XC 3TWJA 4TRLA 5DVRA 1SVEA 5EM5A 3GU6A 3PSDA 5GZAA 4IX6A 4FNZA 3D2IA 3FHRA 3ZXTA 4CGAA 3WYXA 2C3LA 3IW8A 4DTKA 4NM7A 3R83A 5A4EA 5HO8A 3OVVA 2C0IA 3EQGA 3ERKA 4D2WA 2J50A 5D7AA 2Z7SA 4XEYA 4OTWA 4ALWA 2W7XA 3N51A 2W5HA 4HJOA 2QURA 2BILB 5FTQA 4NW5A 3PXYA 2OJGA 2PMNX 5A9UA 3MSSA 1K9AA 3OXTA 5FEEA 2RFNA 3ZLWA 2J7TA 4NCTA 4QMZA 2DYLA 3H10A 2PMIA 2YM7A 5AM6A 5JGBA 2PMLX 3LFNA 1J3HA 2IZTA 2OI4X 2E2BA 2WOTA 3AT3A 3F3VA 3OEFX 4G6LA 2Z7QA 3CJGA 4IZ5A 4WA9A 3ZU7A 4I92A 4YO6A 4E4XA 2R3QA 5HE3A 3ZUTA 2HWOA 2ZAZA 3ZZEA 2Y6OA 4DH7A 3C51A 4WNPA 4KRDA 2UW7A 4C36A 1HCKA 3ZRKA 4FTUA 3ZS5A 1ZYSA 3QRIA 4AS0A 1WBVA 3UIMA 4S34A 2O64A 3ZCLA 5AUZA 3JR1A 3TDWA 3DZQA 4RJ8A 1IASA 4L42A 5EDQA 5H8BA 3NSZA 4JQ7A 4RFYA 3QQHA 2PYWA 3KB7A 5LQFA 1U5RA 2R3JA 4FV9A 1M2PA 4EH7A 3VUMA 1QPCA 2WGJA 3ETAA 5IQHA 1YVJA 3TKHA 5FEDA 2YFXA 3F6XA 3HNGA 5AP5A 5FM2A 4HVDA 4FKPA 1NVQA 4BDFA 4EOQA 3GCQA 5AMNA 1Y6AA 3WF7A 4PL4A 3KCKA 4MKCA 2H8HA 4RVKA 4C0TA 3QLGA 4FKRA 5HD7A 3ZHPC 2I1MA 4PTEA 3R9OA 3KU2A 3WYYA 4Q5EA 4DCAA 2VD5A 1YDTE 3VWAA 5BVNA 3TACA 4TKSA 2R3LA 4AFEA 1ZMWA 3E62A 1U4DA 4LGGA 5EOLA 4BVUA 4EOKA 2RKUA 3FC1X 4W4YA 1FVVA 3CPBA 4FL2A 5CEIA 3SDJA 5E8XA 2OKRA 4I3ZA 3LXPA 1DAWA 4ZMEA 3EFKA 4TYHA 3FWQA 3UG1A 4U3YA 5LVNA 5KKRC 3QWJA 3C13A 4EOLA 1PXJA 2YCSA 3SXFA 4AOJA 2PPQA 1U54A 1M14A 4DITA 5HX8A 4FSQA 3OUKA 4BDJA 5C26A 5HCXA 2PVLA 4YSMA 1PJKA 2Y8OA 4RJ3A 4BDDA 3DBEA 1Q97A 2C5VA 5BYZA 3Q5IA 5KMKA 5DT3A 5KMIA 2QR7A 3ZOSA 3B2WA 4EK6A 4PL3A 1PYEA 4YPDA 4GU6A 3KL8A 4I4EA 2W1HA 3HLLA 2HOGA 2GNIA 4ACMA 5F95A 2BVAA 2EB2A 3GI3A 2PVRA 3R0TA 2ITOA 4GT5A 4TWCA 1R1WA 3TNWA 4ASDA 1OUKA 3K5VA 3VAPA 4XH6A 4Y5QA 1M2RA 3T9IA 4CKIA 3ZLXA 4AX8A 3BCEA 3VIDA 3DLSA 2Z02A 2ZB0A 5ANOA 4ZAUA 2ACXA 4XMOA 5AR4A 3CC6A 3F5XA 4EHEA 4TTHB 5HVKA 2E9PA 3TTIA 3EJ1A 5KMLA 3DXNA 4ZLOA 3KRRA 3UG2A 4MEDA 3Q6UA 4Y83A 1Q61A 4F6UA 3W32A 5ANDA 4IW0A 2ITQA 3EQIA 3TJCA 5IA4A 2ONLA 2C5YA 3F2NA 4BKZA 1JKKA 3UNKA 4G3GA 4EOOA 3AMBA 3GBZA 3UGCA 3AMYA 4D2VA 3LKMA 2VX0A 3F69A 5B0XA 4ANNA 5IQCA 4CMUA 5AP3A 4GFOA 5HEZA 1PF8A 1GIIA 5KE0A 4K18A 4V0GA 1CM8A 4QP6A 1GJOA 2PTKA 3GUBA 2VTHA 3DK3A 3UOLA 2WMBA 1NXKA 2WELA 3W18A 5EDPA 5HG8A 1AQ1A 3LM5A 4EL9A 2WQNA 2XEYA 3JUHA 4XP0A 3MTFA 4FKLA 4L3LA 5K0XA 4DFXE 4O2PA 4UZHA 2ITTA 2OLCA 2NO3A 5CLPA 5GIOE 4K9YA 4D4SA 4G2FA 2YISA 3BYUA 3EL8A 5KMNA 3NUSA 5EHLA 2VTAA 1H07A 2J51A 3KMWA 1BYGA 5TT7A 2ZV7A 4QRCA 2I6LA 5JRQA 3SW7A 4FEXA 2GQGA 2QD9A 3OXZA 1XJDA 2YCFA 4C62A 2QG7A 4FIEA 4N0SA 4ORKA 4QQTA 3R7OA 2VWZA 4KBCA 4C37A 4D55A 5HBEA 3BV2A 1JKTA 3ET7A 3MY5A 2F7ZE 3E88A 4D9UA 3QRUA 3ORLA 4U5JA 4MXOA 4FTTA 4J1RA 4IAAA 3P9JA 3QA8A 5CS6A 4R7BA 3HRCA 4O84A 5D1JA 4EJNA 3G0EA 4L00A 4AT3A 3G15A 3R02A 4W8EA 3UNJA 2CLQA 5AA9A 3IW5A 2VNYA 3DBCA 5A4QA 2J0IA 4CFWA 3KA0A 4HNIA 4KA3A 5L2IA 3G90X 2YWPA 3HA8A 4BL1A 2QOKA 1TQMA 1YWVA 5AA8A 4AOIA 3OOMA 4PNKA 1H1RA 3R2BA 4GYIA 4CQEA 4PMPA 3MIAA 5AP6A 2QU5A 2Y4PA 2R7BA 4I6FA 4EQMA 4F1OA 4F9AA 4Z9LA 3DDQA 4YJRA 4H05A 4QQJA 2FSTX 3FY0A 4U8ZA 5G1XA 3UBDA 4DEEA 3RK9A 1VYWA 4GIHA 4GFMA 1Q8WA 4C3PA 1YHSA 3D5XA 4DBNA 5HU3A 3TV6A 5FTOA 4C38A 4R1YA 4O0TA 4RVTA 2XK8A 4CEGA 4ZZOA 4AFJA 4C34A 4HCVA 5IH6A 4AP7A 2BROA 4FNXA 4IBMA 1FOTA 5CENA 4PMMA 4PP9A 4IVCA 5ACKA 3LCTA 3OF0A 4M97A 3HDMA 4YBJA 1PRYA 4N6YA 4F64A 3UZPA 2F7EE 4UY9A 5EYKA 2JBPA 4QP2A 5DWRA 2XEZA 3F9NA 4QP4A 5EM8A 1X8BA 3W55A 5CU2A 2B9HA 5CF6A 2ZDTA 4MXZA 4WRGA 2C30A 3BWJA 3KULA 2J90A 2JDVA 3DTWA 4WNOA 3Q3BA 4X3JA 5IUHA 4I6QA 5J5SA 1STCE 5M44A 3NUYA 4DEGA 2X6DA 2V62A 3HV3A 5M51A 1PMVA 3C0HA 3FMDA 4IIRA 3R8VA 4DHFA 4OAVB 3PXZA 2CGUA 4OTRA 5H8EA 4CKRA 1GNGA 4M69A 2VU3A 4JR3A 2JBOA 3R9HA 3ITZA 4N57A 4IM0A 3C4EA 3F3WA 4MXXA 2JKMA 3WZJA 4UMRA 2IVVA 4B99A 2WFYA 3U54A 3QTXA 4L68A 4XV2A 3KXMA 3PSCA 2YM3A 5L8KA 3EQBA 4ID7A 2Y9QA 3IO7A 2RFSA 2YM6A 4PQNA 2C3IB 4BC6A 2FYSA 1U59A 4HYSA 3BGPA 3N9XA 2UZLA 4BBMA 3TUCA 2ERZE 2VO3A 5LVOA 2WAJA 1WBWA 4X0MA 3FL5A 5L8JA 3BU3A 1JKLA 3NR9A 3UZTA 3HDNA 4BCFA 2YITA 4FNWA 2CJMA 2A4LA 3QYZA 4ZK5A 2YLEA 2WIPA 4E93A 5L2TA 1PXPA 1MRVA 3ZXZA 3KRLA 2XB7A 4II5A 1IA8A 5AUVA 4WBOA 2PZRA 2R3HA 2UZDA 4ITIA 4MQ1A 4PUZA 3VQHA 3QCQA 2E9UA 5JKGA 4HCUA 2YERA 4GCJA 3KQ7A 3CY2A 3OG7A 3PE2A 4EH2A 3PA5A 3KXGA 4AZVA 3NGAA 3L9NA 1ZYCA 1WBTA 5AUWA 4PRJA 3QU0A 3LXKA 5FM3A 1Q99A 5I9YA 2BAQA 4XP3A 2IWIA 3UE4A 2G2HA 1KE6A 2BHEA 4H3PA 1GOLA 1M52A 3BBWA 1MQBA 3NIZA 3NS9A 2W96B 3E93A 4IVDA 5BUEA 3TM0A 4X6RA 3HV5A 4FKOA 1OMWA 3JXWA 4JR7A 2C6IA 5EM7A 3WZEA 4FKUA 4XUFA 4E73A 5BVOA 5LCJA 5CX9A 2B4SB 3FI8A 4JBOA 3MIYA 2PE2A 2ITPA 4U40A 4QTEA 4CMTA 4IAIA 3S00A 4UXQA 2QOLA 2ZVAA 4CCUA 5JSMA 4NM5A 1ZZLA 3KVXA 3QFVA 4D2RA 3BELA 2OH0E 3MVMA 3EL7A 1UKHA 4ANMA 4AZEA 4IB1A 4UV0A 1JBPE 4EQCA 2PVKA 2XIRA 3VC4A 2PL0A 2YDKA 3KFAA 4RWIA 5CEOA 3FPMA 2EU9A 2WNTA 4MNFA 5AV3A 3FKNA 1R3CA 4EC8A 3MVJA 4Y85A 3KXZA 4FI1A 4YZNA 2FH9A 3ID6C 1V0OA 3L9MA 1PY5A 3BYMA 1YI6A 4RX5A 2OGVA 2VTOA 4AN2A 1T46A 1ZY4A 3FMJA 4GK3A 1Y57A 2YJSA 4DT8A 4CNHA 3P1AA 3RPYA 5M4IA 3QKMA 5ETCA 1H8FA 5IH5A 1WBNA 3NNWA 3ORXA 1PKGA 3PZEA 1H26A 2XUUA 2FA2A 2XM9A 4NKSA 3DPKA 4XG9A 1QL6A 4V05A 2WMAA 5GNKA 1R39A 1OPLA 3FMHA 5E1EA 3WI6A 4G3EA 5AADA 1O6LA 3O71A 2JLDA 1BMKA 2XA4A 2VWBA 3RNYA 2YN8A 2GHGA 2ZJWA 3H4JA 4FSRA 4UZDA 5DT4A 3UMWA 5EHOA 3U6JA 4Q9SA 2OIBA 5HCZA 3G9LX 4WNKA 3RCJA 2VRXA 4RWJA 3FXWA 2GS2A 4DEIA 5FP5A 4IDTA 2XK6A 2BRGA 3R21A 5AV2A 5DMZA 5FQDC 1OM1A 4NCTC 2OO8X 3E64A 2W0JA 3MS9A 4KBKA 4A9YA 2P2HA 3MBLA 3GCUA 5CU3A 5TF9A 4DEDA 3NW5A 5HCYA 3WOWA 5B2MA 4BN1A 3MA6A 3R7EA 3L8VA 4EOIA 3G33A 2OW3A 4QO9A 4KSPA 4JRNA 4UX9A 5FGKA 3Q5ZA 5I9ZA 5CZHA 3CPCA 4DG0E 3GP0A 4G3DA 3R30A 5J87A 3PFQA 2OIDA 2IVSA 3HECA 3NUUA 2FVDA 2E9NA 3R1YA 1WVYA 4QMVA 4OLIA 5FP6A 4K33A 2VO7A 4AZFA 1UU7A 2FO0A 5ETFA 3DKOA 4IFGA 2C5XA 5JFSA 2XJ0A 3RM6A 1PXKA 2EVAA 2YIWA 4EKKA 3P79A 4BHNA 4FODA 4AA4A 2B7AA 2CKPA 5DA3A 3FMLA 3K54A 5EYCA 1RW8A 5CANA 2PZ5A 4KS8A 3PXKA 3D2KA 4M67A 4FTOA 4XHKB 3D7TB 4CFUA 3VS0A 3W8LA 2VWVA 4U81A 4KIKB 4Y46A 3QZHA 3UYSA 4BWPA 4MBIA 1V0BA 4C4GA 3FHIA 4DH5A 3NLBA 3U9NA 4FSTA 1G3NA 5AX3A 4AU8A 4M14A 3AC8A 3CTHA 4YTIA 5BX0A 3CKXA 3TTJA 2VTRA 4CRSA 3SGCA 1M17A 4ENXA 3QTWA 2UW3A 4P2KA 4O7YA 3V51A 3KRJA 1U46A 3EQFA 3RAWA 3VS5A 3VS1A 3I79A 2G2FA 2RL5A 3GC0A 4NH1A 1MRUA 2R3KA 3G9NA 3UP2A 2YZLA 2BKKA 4X3FB 2W1IA 3EKNA 4H1MA 4ANLA 2GSFA 3FYKX 3R01A 4RQVA 5DRBA 4EWHA 4GS6A 5KCVA 1IAHA 3U87A 5J8IA 3OXIA 4A06A 2P33A 2OF4A 4IC7A 4PP7A 4MTAA 2QG5A 3ZEPA 4FV2A 3ZSGA 2PY3A 2ITXA 1R0PA 4UYAA 1O6YA 4GJ3A 3JYAA 4LRKA 4EJ7A 3U6IA 4OUCA 1YWNA 3QUPA 4ZMFA 3LMGA 2QOIA 4JVGA 4RX7A 5HTIA 4YJSA 2OH4A 4O7VA 2XJ2A 3WIGA 3BYSA 1KV1A 1UU9A 3CY3A 4DGNA 3PA3A 2YM5A 4IVBA 2VWUA 4E8AA 4F0GA 3P23A 4WT6A 3GCPA 3HYHA 4AACA 3QQJA 2YCQA 3KKVA 1J91A 2BFXA 5CVHA 4BTKA 4TL0A 3CTJA 4MHAA 4BR3A 2C1BA 3ATTA 5KX8A 4PNIA 4BTMA 5H9BA 3EYGA 3VULA 4APPA 5F4NA 3ZRMA 3Q53A 4EONA 4I6BA 2WQOA 1YXTA 3IW6A 5KKRB 3WZUA 4CG9A 3NRMA 3F3TA 3EB0A 3BX5A 3ZM9A 4OT5A 3AT4A 4L67A 3GFWA 1R0EA 5ACBC 4B8MA 2WTCA 2GU8A 4O0SA 5EG3A 5L2SA 2W9FB 1NW1A 1YXXA 2CNVA 2Y6MA 2BR1A 3FLNC 3I5ZA 3R73A 4K0YA 4ZTSA 4QMQA 4YSJA 5HZNA 2WQEA 3R8MA 2XYNA 3FAAA 4FTIA 4IB3A 4UWYA 3TIYA 3T9TA 2UZTA 3EYHA 4K6ZA 4DF3A 3P08A 1GIHA 4TYGA 2OJIA 2RG5A 3TZMA 3HAMA 2VTNA 2QLQA 2CPKE 2XNMA 3SXSA 1JSVA 1XH7A 4ASZA 3Q4TA 4UMPA 1IA9A 2XNOA 3QCYA 1FGKA 4I0TA 4JG7A 5AV0A 2LAVA 3W8QA 4F99A 3HEGA 5CF5A 4MK0A 5E8UA 5JEBA 2WMRA 3ZBXA 3BHVA 4QT1A 4ZTQA 4FUXA 3JY0A 3TI1A 4O7TA 3UP7A 3FY2A 3CKWA 1E9HA 5CAVA 4BI2A 4E20A 5D12A 4DA5A 3BU5A 4YPSA 2HK5A 1BL7A 4IH8A 3IKAA 3TUDA 2A27A 1SMHA 2ZV2A 3GQLA 3HMNA 2GNFA 2EXMA 4FL1A 4IXPA 4LOQA 1DI8A 3QALE 4YGAA 3RVGA 5D11A 5DPVA 3MFRA 4CT2A 3HMOA 2IVTA 4GVJA 2OG8A 4O82A 3IOPA 5KMMA 3IDPA 4E6QA 2B9JA 4FK6A 5LWNA 1F5QA 4OR5A 4L9IA 4FIHA 3EZRA 3HL7A 5GIPE 3DAJA 4MQ2A 2XJ1A 2R3RA 4EOMA 1RJBA 1ZXEA 2Y0AA 3RAKA 1Q8YA 3AC3A 4QMMA 4QMSA 5FDPA 5DBXA 2YEXA 3RHXA 1YI3A 3BE9A 3R71A 1O6KA 4BIBA 4IJ9A 2JEDA 4FIJA 5T68A 3TV4A 2BDWA 4WG5A 1H08A 3C5UA 4JRVA 3FLWA 3NUNA 3OP5A 4OBPA 3AQVA 5FD2A 5A3XA 1OKZA 4EBWA 2WTVA 1HOWA 4U3ZA 2Z60A 4QMWA 4BYJA 4RIOA 4C2WA 3V5PA 4BCKA 1YDRE 3QUEA 2EXCX 3FSKA 4FV6A 4J97A 4EORA 4Z16A 5HE1A 4QTBA 3L1SA 5FRIA 4X2FA 3W33A 3U8WA 2G15A 3U51A 2PWLA 4OT6A 1YQJA 1OKWA 4YTFA 5I9UA 5KZ0A 4D0WA 4F7LA 2A2AA 4LUEA 5AUTA 1MUOA 5TOZA 3F7WA 4DH8A 3KCFA 4GRBA 4KSQA 4MXAA 3UZRA 1YI4A 4HPTE 1RQQA 3QKLA 3F5PA 4M7IA 2V22A 1F3MC 5C01A 2VTPA 5LVMA 5M53A 5JFXA 4CVAA 3RPVA 2YWVA 4BDHA 3MPMA 3FZSA 4KRCA 4YC8A 4IZAA 3FBVA 2H96A 4MNEB 2OXXA 2XKEA 4ZSJA 2HZ0A 3DJ7A 3KY2A 1ATPE 1R78A 4XG8A 4F0IA 3LFCA 3LCSA 4X2JA 2OZAB 4GIIA 2V7OA 4O7WA 4FT3A 4EWQA 3GEQA 4L6QA 4BBFA 2UW6A 5AP0A 3QTIA 2JKQA 4YBKA 5CZIA 5K5XA 3TDVA 3TV7A 4DH1A 4JIKA 4XLIA 3OTVA 4FMQA 4AN3A 3O96A 4B0GA 4I21A 4EUTA 3PXRA 3HV7A 2X4FA 4LL0A 4E3CA 2W99B 3SG9A 3F3UA 3KMUA 4DT9A 1PXLA 3MJ2A 3QTQA 4GV1A 3NMUF 2P0CA 2GFSA 3NNVA 3RPSA 2W4KA 3QC4A 4I94A 1BI8A 4FV7A 4CT1A 5CU0A 2BRBA 3GU4A 4BYIA 5CQUA 4TN6A 3ZZWA 4CCBA 4NKAA 4J95A 5AIKA 3N4UA 5C8MA 3R28A 4JT3A 3NW7A 3LJ0A 2QNJA 2XS0A 4FEQA 4KNBA 2C47A 2WMXA 3UVRA 2BKZA 3RNIA 2F2CB 4EBVA 4FKJA 4EH3A 3MA3A 2XBJA 4IWQA 5FTGA 4ZP5A 2CDZA 3VRZA 4F70A 2OBJA 1S9IA 1P14A 2AUHA 2QHNA 2VN9A 3UVQA 3ZSHA 1Q24A 4XG7A 4QNAA 3PLSA 2IZUA 4L45A 4O1PA 1ZARA 1V0PA 4JBVA 3OWJA 3EN6A 4F1TA 3PLAE 3FE3A 4ACGA 2WTKB 3W2CA 4L46A 3DB6A 1XWSA 2JDSA 2YACA 2VTIA 3QXOA 3RALA 1WBPA 4IANA 2C6KA 4OTGA 2W1FA 2WPAA 4JNWA 4XBRA 4DFBA 1SM2A 5FUTA 4G31A 2YAKA 2C6MA 5HOAA 3RZBA 4M13A 4MAOA 4YZDA 2J0MB 5IKWA 3PXFA 4AF3A 5HTCA 1FGIA 2R64A 4DEBA 2W1ZA 4YHTA 2XM8A 3EKKA 4MF1A 5IQFA 2HXLA 4FG7A 2XNGA 3CQEA 3FQHA 2W06A 4IC8A 4NFNA 5AFVA 3VBYA 2HY0A 5HESA 2BHHA 1ZAOA 4TNDA 3BEAA 1OUYA 5A4CA 4CLJA 5J9LA 5CTPA 4AUAA 5E8TA 1E1VA 4AQCA 2C5NA 2GHLA 3CTQA 3F7ZA 4FX3A 5B7VA 2CNQA 4LFIA 2DWBA 3C50A 4E4NA 4EUUA 2QOOA 4O27B 1FVTA 3FSFA 5L3AA 3M2WA 4S31A 2VNWA 4V01A 2C0TA 2Q0NA 1Z5MA 2X6EA 3PPZA 4FT5A 5EDRA 4FTKA 5BMMA 4EK8A 5IEVA 5IEYA 5DOSA 3DDPA 1L3RE 2JIUA 3EQDA 4X2GA 2OJJA 2GNHA 4BKYA 1XQZA 2J2IB 5ITAA 2ZMDA 3V3VA 1UU3A 2BRNA 4AA0A 5DFPA 3F2AA 4FKIA 1JAMA 4PTCA 2X81A 4DBXA 4R3CA 2XMYA 4YLKA 5EOBA 3ATSA 4RC4A 3DQXA 2BZHB 3LFEA 5FXSA 2BZIB 2QOCA 3EN9A 5BVEA 1ZYDA 4PY1A 3MFUA 5IA0A 5C8NA 4BCMA 3LFQA 2WEIA 4X7QA 4PDSA 4XG4A 1BKXA 3KF7A 5TE0A 3W2SA 3A60A 4BDGA 4CYIA 3MFSA 4F65A 3TG1A 2JDOA 3AC1A 3AGLA 4R7IA 3VQUA 4JBPA 3AC4A 4FKWA 3DLZA 4S30A 3DK7A 3RINA 4AOTA 2R9SA 3SAYA 5HG5A 1B39A 3PIZA 1BUHA 4HNFA 4LUDA 5HG7A 4A07A 3E7VA 4ENYA 4Z7HA 3O8PA 4K77A 5CEKA 4FUYA 4FYNA 2RFEA 4JDKA 3NYXA 5AAFA 3PUPA 4ZJJA 1OVEA 2WQBA 3GC9A 3SLSA 2CHLA 2F2UA 2P2IA 3C4CA 4LOPA 5E4HA 2XRWA 4L52A 2JAMA 2LGCA 2ITNA 4H3BA 4IMYA 4FV3A 1E1XA 2ZM4A 4S2ZA 1UNLA 2SRCA 5IQGA 3C7QA 4UWBA 3C4XA 4ZJVA 5LVLA 2OF2A 1I44A 4IWPA 2HZIA 2OFVA 3COHA 2PMOX 3R6XA 4PX6A 4ACHA 1NY3A 4L3PA 3TKUA 3QCSA 4QMNA 2H9VA 4GG7A 4QMXA 3R04A 3S3IA 3TL8A 3VUHA 1H28A 2V0DA 3LCOA 4EH6A 4FEWA 2OICA 4FSMA 4F63A 3VO3A 5KMOA 4GKHA 4J52A 3NNUA 5HKMA 4I24A 5J95A 3HP2A 3L8SA 5TO8A 3SOCA 2A0CX 2X8IA 2WMWA 4RWKA 3VBQA 1ERKA 5HU9A 1GZOA 2OJFE 3L8PA 4EC9A 3AD6A 4RT7A 3L8XA 3D5UA 4D4RA 2EUFB 4IZYA 4J7BA 2EXEA 4FSYA 2F9GA 4D1XA 4DFLA 4G5PA 1TQIA 2P4IA 2DS1A 3FL4A 4TNBA 4RGJA 2GHMA 2QODA 4H58A 4O91A 5GJFA 2KTYA 2WZJA 3LCKA 2Z8CA 3IW4A 5I9WA 4E6CA 3BYOA 3IK3A 3C5IA 3K2LA 4CXAA 5CEMA 3PIXA 5M08A 3PSBA 1Q5KA 2JAVA 3CGOA 4NYEA 1YOJA 1SNXA 2PHKA 4YJQA 1P5EA 5DGZA 1GZ8A 3T8OA 3ENHA 5AAGA 2CSNA 5CNNA 2X8DA 2E9VA 3EH9A 4JDIA 3U9CA 2R3IA 3SV0A 4O22A 4CFXA 5K0KA 1QCFA 2QLUA 4LV8A 4ZTRA 5KMJA 3Q4UA 4RIYB 5LCKA 4I20A 4I5PA 3TNIA 4RPVA 4EEVA 4O0RA 2VTQA 3NX8A 4P5QA 4FV1A 1B6CB 1PHKA 4CZTA 1J7UA 3NCZA 1OBGA 2JITA 3E87A 3DFAA 4RRVA 4XRLA 5BPYA 4UEUA 5HO7A 4XV1A 3MH1A 2BTRA 4L7FA 4RIWB 4ALUA 5IPJA 5IDNA 4IX3A 3R7VA 3VBVA 4ACDA 4ITHA 1P2AA 4BDIA 3EFWA 4IEBA 3ROYA 2X2LA 3JVSA 4RLKA 4E4MA 1NA7A 3ZDIA 3RMFA 3EQHA 5IH4A 3TZ9A 4ZS0A 4YO4A 2F49A 1OIRA 4UALA 5IISA 5CF4A 4QTAA 5AR2A 2BALA 3LOKA 5FDXA 2Q0BA 3PE1A 4HW7A 4I0RA 3H0YA 2WEVA 4LRJA 1OPJA 4H36A 4FZ7A 3BGQA 4PV0A 4WHZA 2WHBA 4YZMA 4IB0A 4ZLYA 3HVCA 5ICPA 2XRUA 3MPAA 4DG2E 4DE4A 4U44A 1U5QA 5I4NA 2B9FA 3ORIA 4P5ZA 2J6MA 3SVVA 2VTMA 2FGIA 1ZRZA 4IHPA 2C69A 3OW3A 4HZRA 4R7HA 5BQ0A 5CF8A 1RDQE 1REKA 4FTJA 1P4OA 2UZOA 3ZO4A 3Q6WA 5CSHA 3R8LA 4XBUA 4P4CA 4FVRA 3LE6A 3K3JA 2ZM1A 3LXNA 4AXAA 2UZVA 1SVHA 4BGQA 4QPMA 3O7LB 5JH6A 1G5SA 3EN7A 3VHEA 3DNDA 3SRVB 4DGMA 4RBLA 4FTLA 4HYHA 3G51A 5E8ZA 4ZIMA 3UOKA 3HX4A 1REJA 2XF0A 2YABA 4E5BA 1KOBA 3PP1A 3GNIB 4E26A 3IS5A 3LJ2A 3MN3A 1RE8A 3QTUA 4JG6A 4RG0A 4I1ZA 4Y73A 5ANJA 3WIKA 5CSPA 3DAEA 1YOMA 4FL3A 3ZSIA 2IW9A 4CTBA 1BLXA 3OCBA 5JZJA 5CASA 2CN8A 3CS9A 3KRWA 3I5NA 3G2FA 4I5CA 1ZOGA 4M84A 5AEPA 5JGDA 4YURA 2UV2A 5L4QA 3UOJA 3GU5A 3LPBA 3MVHA 2OU7A 3D7TA 3UPZA 2R3OA 4BI0A 4RC3A 1KE7A 1ZY5A 4ANQA 1K3AA 5A6OA 1H27A 4KIKA 3RBWA 3DV3A 4K1BA 3HMPA 3RJCA 4YHFA 2CGWA 3ORTA 4M68A 2X7OA 5L6PA 4F08A 3BGZA 2RFDA 3IONA 1WVWA 4FBXA 5JMSA 4CZUA 3LZBA 4IVAA 3ROCA 4GH2A 3MB6A 3SG8A 2WMUA 3AXWA 2R3NA 3QRTA 3QWKA 2JD5A 3U4UA 5J7HA 3F3ZA 2PUUA 4MWIA 4C61A 3OEZA 3EMGA 4ZJIA 2HW7A 4X3FA 3ZLYA 2QU6A 4AWIA 4CQGA 4ASXA 1JLUE 3OTUA 3UO4A 4GSBA 5ANKA 4Z3VA 2XIZA 2UW4A 3RHKA 4RC2A 3RM7A 4AT5A 2WMVA 4D28A 4OAUC 2Y4IB 4RMZA 3ALOA 1JNKA 1UWHA 2R0UA 2WKMA 2XNBA 3NAXA 4NWMA 4FSWA 4AGDA 3ORMA 3VBWA 3E8DA 2O3PA 1H0VA 3TXOA 3O8UA 3WBLA 1WAKA 5A54A 5HLPA 3PIYA 2CCIA 2WTIA 4IWDA
chains in the Genus database with same CATH superfamily
5JN2A 2B1PA 3GOKA 1CKJA 3QHWA 2R3MA 2W05A 2C6EA 4FV8A 4HGLA 4QMTA 5HIDA 1GZKA 1TVOA 1XBCA 4C4HA 4QQCA 2UW9A 4PPCA 3MI9A 5CI6A 3VHKA 3A7JA 2Y7JA 1UV5A 5JZNA 2ZV8A 2WIHA 3LLTA 3PJ3A 3COIA 4YLJA 4QD6A 3WILA 3RI1A 5EQYA 3HRBA 1YXSA 4CSVA 4UXLA 4ZTLA 1OGYA 4FVQA 5HICA 5ETAA 3O7LD 1IRKA 3ZFXA 4YZBA 2PZIA 2R3GA 4U80A 1Y8GA 4FYOA 2YJRA 3UQFA 3W0MA 4CLIA 2GQSA 2ITWA 4IJPA 3PA4A 5FG8A 4FEVA 1XBBA 2UZWE 3SQQA 5JQ5A 3ZO3A 3MJ1A 3P4KA 4H39A 4F9WA 5C4KA 4DEAA 3C1XA 2C6DA 3FJQE 1A06A 3FPQA 4NSTA 1ZZ2A 2OIQA 2J9MA 1H1SA 2PVYA 3D9VA 4AN9A 4F7SA 4HOKA 5A4TA 3S2PA 5GZ8A 3PVBA 4GEOA 2I0YA 3D94A 3IECA 5AUYA 4FT7A 5DEYA 3UDBA 4EYJA 5BYYA 3CD3A 5BVWA 3OBJA 4O4BB 5BMSA 1PXMA 3LHJA 3ZFMA 4AXFA 5EYMA 3CLYA 1UWJA 3V01A 1H1QA 5IQIA 5JGAA 4GUBA 3OZ6A 3QTRA 4KIQA 3E3BX 4U7ZA 5BUIA 4I5HA 4LOOA 2NNWB 2BPMA 3DXPA 3KK8A 1NT2A 4MUQA 3DY7A 5CVGA 4EK4A 4C3FA 5AP4A 2XNEA 2BFYA 4NZWB 1JPAA 4X2NA 3HMIA 3F5GA 3ORPA 3VF9A 3W2QA 2XH5A 3ZBFA 4BCJA 4C4JA 2W1DA 4F4PA 2X7GA 3GC7A 4GJ2A 3QQFA 3ZEWA 2CGVA 5L2WA 3BBTB 2X4ZA 5M4CA 1FINA 3BE2A 5CQWA 4HYUA 4EH4A 3RAHA 1UNHA 3ZLSA 3W16A 4AG8A 2PE0A 2CNUA 4FSZA 1EH4A 3FLZA 2CCHA 4RWLA 4ZSLA 3AGMA 4AT4A 3BQCA 2VUWA 3W2RA 5CNOA 2CN5A 3GFEA 3Q52A 3GOPA 3R8PA 2A98A 1ZYJA 4WKQA 4FZ6A 4M15A 4EK5A 1YRPA 2ITYA 2XIYA 2JFMA 2VWXA 3I0OA 4F09A 1Q3DA 3NYNA 1OKVA 5CVFA 2G2IA 3EN5A 4PPAA 1WCCA 3TN8A 4G17A 4X21A 4XV3A 3FMMA 5IMEA 5EKOA 4FKTA 5EW8A 5CXZA 2XK4A 3A7IA 3PP0A 2PVFA 2VX3A 3QZIA 4RZVA 3VS4A 4FIFA 2RF9A 4A4LA 5K3YA 3OROA 3QHRA 4I0SA 1XH4A 2BRMA 4MVFA 4O6EA 3UIBA 3PYYA 2X2KA 3UMXA 3Q2JA 3MW1A 3OBGA 2FSLX 2XP2A 2GNJA 2BRHA 3NUPA 2WTJA 2YM4A 4BZOA 5T3QA 4HGSA 2OXYA 4CYJA 4WIHA 4GK2A 3R22A 4RJ4A 3DBQA 2B52A 2PUPA 4G16A 3REPA 1FMOE 3QZGA 5KUPA 2GCDA 1G8AA 1H25A 2B55A 4JX3A 2XK9A 1J1CA 3B8QA 4GG5A 3SW4A 3PWDA 1H0WA 3F5UA 4KWPA 4ZXTA 1OIUA 4KD1A 2BDFA 3DJ5A 3RGFA 5C27A 3QXPA 1XH6A 3ZRLA 3KVWA 3OWKA 4OTQA 3DQWA 2O2UA 3FMKA 1GZNA 4E6AA 5J7BA 1WZYA 4FKQA 2WB8A 1Z57A 4PWNA 3DNEA 3ZFYA 4DEHA 4NUSA 5HLWA 3DTCA 4AGWA 1WBOA 3R9RA 3C0IA 3QBNA 1LP4A 1YXVA 4DCEA 3QUDA 4FF8A 1ZMVA 2YIQA 4I4FA 4D4YA 4F9YA 5M57A 5FEQA 1L8TA 3QTSA 3KMMA 4R78A 2FSMX 3TIZA 4WOVA 2FSOX 5LOHA 3R7UA 4D5KA 4YTHA 5I9XA 4YMJA 3UO5A 3FKLA 3U4WA 4C58A 3W0PA 4NTSA 3BHUA 4ZS4A 3R2YA 4MNEA 2ONLC 1YHWA 2PZPA 2WQMA 4IAFA 5M4FA 4G1WA 3SX9A 2V5QA 2C3JA 3G0FA 2OZAA 5EI2A 4BTFA 2EWAA 5EHYA 3PY3A 1UNGA 3FLQA 2O0UA 4R8QA 4O2ZA 3NFGB 3ENMA 4FG9A 4BY9E 4AA5A 4TZRA 4CD0A 3B2TA 1W7HA 3SKCA 5KHXA 5M06A 3D5VA 5IUIA 4ZSAA 1APME 4GT3A 2W4OA 4Y72A 4RJ5A 1Q8ZA 3IDCA 4EZ3A 5DI1A 3ZDUA 2FUMA 2XKCA 3NAYA 5D9HA 3RP9A 3A99A 5C8KA 4AAYA 5M55A 4G6NA 3A7HA 5T6KA 4UN0C 3RTPA 5I3RA 4S32A 4BIEA 4BCGA 1OKYA 3M42A 4QP9A 5HE2A 1IEPA 3HP5A 5HIEA 2W5BA 1CMKE 3R9DA 4M3QA 3IDBA 1VR2A 1GAGA 3ODYX 3DGKA 4USEA 3H3CA 3PJ2A 4R3PA 3QGWA 3MWUA 1Q3WA 4YJTA 4RIXB 4I41A 3H9RA 2ZYBA 2VTSA 2J5EA 1H1WA 4PL5A 2DQ7X 2X2MA 3BLRA 5E8WA 2IO6A 1OBDA 4MBJA 1CSNA 2HAKA 4ANOA 3I4BA 4XP2A 2VWYA 3ORKA 4KKGA 3ALNA 4AGCA 4DFUA 3QCXA 3VW8A 3PG3A 4RX8A 2YIYA 4FTRA 2VGOA 4G5JA 3KRXA 2IVUA 4L7SA 5M4UA 3NZ0A 3MY0A 3AMAA 5DLSA 4CZYB 3V6RA 4B6LA 5C4LA 5EH0A 4FT9A 4E1ZA 3W0OA 3PRIA 1XH9A 4GT4A 3ODZX 5L8LA 3CQUA 2GTNA 4LMNA 2PVJA 3O50A 3II5A 3VN9A 4A9RA 3VF8A 1W83A 2BDJA 4RSSA 4BIDA 4EQUA 3AKJA 3H30A 4FIIA 2H6DA 4BHZA 5A46A 4GW8A 4X6QC 4DN5A 2VTLA 4USDA 5DIAA 4O38A 4YLLA 4NFMA 4LMUA 2ITZA 5HD4A 4RFZA 1NVRA 1BI7A 3DOGA 3UIUA 3WE8A 1XBAA 4A4XA 1KUTA 2X39A 4L44A 2OK1A 4W9XA 5CT0A 4R1VA 3GQIA 4ERWA 4O83A 3R1QA 4RX9A 2O5KA 5JT2A 3MH0A 1FQ1B 4MCVA 2Q83A 2VWIA 3HMMA 5EI8A 3CEKA 2CKEA 4BCHA 4IM3A 2R3FA 3TNPC 3VJNA 4F7JA 1KE8A 3I7CA 3PY0A 3QA0A 2JKOA 2QKRA 3QD4A 3VS6A 3VONA 3P7CA 4OBOA 4C33A 3EWHA 3BHTA 4HVIA 4O81A 2E9OA 4YP8A 5K4IA 3EIDA 1F0QA 2NRUA 3AD5A 2HCKA 4ZLZA 1YOLA 4I23A 2QO2A 3UOHA 3DKGA 4FTCA 5GZ9A 1FMKA 2BCJA 3DZOA 3LQ5A 4QNYA 4CKJA 1XH5A 4IZ7A 3HGKA 3I6UA 3CE3A 5FLFA 2J0JA 5E8SA 5JFVA 1KE5A 5CAUA 1PMUA 3FZTA 1TQPA 3IW7A 4YC3A 3I60A 3GGFA 1OPKA 4R6VA 3GU7A 2RSVA 4XCUA 4ZEGA 4BCNA 5ETIA 4FE2A 4DDGA 1URCA 4NW6A 3H9FA 3QD2B 4L53A 1NVSA 3D15A 4FTQA 5HBHA 3PVUA 4F6WA 3VBTA 5HNGA 4Z7GA 4OTIA 5AR7A 2IZSA 4DFZE 3TCPA 3LMIA 4O7SA 3L9LA 3LMHA 4LG4A 4OTFA 4R77A 4RVMA 5DYJA 3F88A 3I6WA 3PWYA 2VO6A 2WXVA 3T3VA 1QPDA 2BZKB 2YZAA 4BDKA 4D0XA 3VUIA 4GU9A 4U43A 5FXQA 4AE9A 1XHAA 2VO0A 3AC5A 3BZ3A 4J53A 2V7AA 2B54A 4XV9A 2AYPA 3QC9A 4IX5A 3CD8A 2C4GA 5IQDA 4E5WA 4IDVA 4RJ6A 4DTAA 2WMQA 3MV5A 2QONA 2J4ZA 2QOHA 4O21A 5CU6A 4C2VA 3R8ZA 2ETKA 1DAYA 3I7BA 5G6VA 2QOQA 5IF1A 4WNMA 3VBXA 1TKIA 4RA5A 2GTMA 3FDNA 3S4QA 4O7ZA 5C03A 2GDOA 3C4ZA 3Q9ZA 5IA1A 3PY1A 2C0OA 4ZY6A 5GINE 4XOYA 5CXHA 4NIFB 2BZJA 2F7XE 1PYXA 5CAQA 3BL9A 4O7NA 2NRYA 3Q9XA 5JQ8A 1MP8A 4MF0A 4USFA 3ORZA 4FC0A 5M56A 4TW9A 3ULZA 4KABA 4FTNA 4BDAA 4EHVA 2UW5A 5J5TA 1UKIA 2JGZA 4UYNA 4X3FC 3E92A 4C59A 5F9EA 4BGGA 5JK3A 2RG6A 5AR3A 3Q4ZA 4JOAA 3IOKA 2P55A 2W5AA 5CWZA 4FTAA 3AKLA 3PJ1A 5L6OA 4C02A 5A6NA 3I0QA 5JRSA 3MH2A 4E7WA 4HVGA 4G3CA 4QOXA 2WMTA 2HENA 3D0EA 4BRXA 4QP1A 1LR4A 4DAWA 2W1EA 3G6GA 3WF5A 1OL2A 5A4LA 3QRJA 4O7LA 4BBEA 4KAOA 4NK9A 5EK7A 2PZYA 2W1GA 3RAIA 3UQGA 5TR6A 5IA2A 3O2MA 4QTDA 4NM3A 3PTGA 4FV4A 4ANSA 4AXCA 3JPVA 1VZOA 3E8NA 4EH9A 3UVPA 3EQPA 4HGEA 4CFNA 2JC6A 5AP7A 4AW1A 4EOPA 5LJJA 4IB5A 1H4LA 3RZFA 2PK9A 3FQEA 4RIYA 4PDOA 3KEXA 1M2QA 1KV2A 2YDJA 4KKHA 4C57A 3AG9A 4P7EA 4BI1A 4N6ZA 3NIEA 3GCSA 3LFFA 2XIKA 4OTHA 4ZY4A 4YHJA 5I0BA 2WMSA 3D4QA 2W1CA 2XKFA 4KIPA 4RIWA 1IR3A 1V1KA 3RWQA 3ZO1A 4A9UA 2UZNA 1M7QA 2PUIA 2EB3A 3IPHA 3DJ6A 3TNQB 3RK5A 4FGBA 4FZFB 4K11A 4W4VA 5GJGA 1DI9A 2ZM3A 3FUPA 3QD0A 3COMA 5LMBA 5LWMA 4XYFA 4F7NA 4FKGA 5LMKA 3QZFA 4M0ZA 3FI3A 5E91A 3M11A 3MH3A 5DR9A 3MY1A 2QKWB 3ACJA 4IE9A 3R7IA 3BWFA 3RWPA 3WZDA 4Q9ZA 5J9YA 4EH5A 2XAOA 5EW9A 3E8CA 5CY3A 2O65A 3DBDA 4TYIA 5JFWA 5EQEA 4QYFA 2I7QA 4RA4A 2VZ6A 4PMSA 3CQWA 4M12A 3GENA 4O6LA 3R00A 1SNUA 1J1BA 1JOWB 2UUEA 3I1AA 3EFLA 3PJ8A 1LUFA 4O1OA 2X7FA 4W9WA 3PDTA 3UPXA 3FXZA 3QQUA 3FI4A 5ANEA 3W2PA 2G01A 4IQ6A 3BIZA 1KE9A 3NYVA 4ZY5A 2XCHA 3MFTA 4TWNA 3CP9A 3FC2A 5DR6A 4YNOA 2YM8A 4HCTA 4LQMA 3NCGA 4D58A 2YDIA 5AUXA 1YDSE 1H24A 2QI8A 4QMPA 3BQRA 3SRVA 3CCNA 4NL0A 3CGFA 3DU8A 2C1AA 1ST0A 3O0GA 4L3JA 5KBQA 4LI5A 4C4IA 4HVSA 3O23A 4JX7A 5K5NA 5GJDA 2XK3A 2HZNA 3PVWA 4FG8A 2WU7A 4IAKA 4RJ7A 4AZWA 5IA3A 3AT2A 3KXHA 5HG9A 2J0LA 3D83A 5IUGA 2WOUA 3OCTA 1VYZA 1GY3A 1J7IA 4BCIA 3A4OX 5CSWA 4M8TA 4BTJA 5D41A 5DH3A 4NJDA 4DC2A 2BTSA 3Q2MA 2YAAA 3NVMB 3FZ1A 3SOAA 4WO5A 3JVRA 3R7YA 5CALA 4NT4A 3MESA 4LGHA 4PPBA 4BZNA 2GQRA 3QX4A 3FYJX 4IX4A 4U0IA 1ZYLA 2QHMA 3DXQA 3MTLA 5KHWA 5I5ZA 1YW2A 2AC3A 1WVXA 2F57A 1SYKA 2VTTA 3HRFA 4DTBA 4PMTA 2JFLA 3VUDA 3THBA 3VW6A 3QAME 4JBQA 5H3QA 3C4WA 2Z2WA 2UZBA 5BVKA 2PE1A 5M09A 2B53A 2X9EA 3LIJA 5IQBA 4QYEA 3K3IA 5BVFA 4QP8A 4O0UA 3VJOA 3WARA 3QQLA 3TT0A 5LVPA 1K2PA 5DT0A 3LW0A 4U97A 5TKDA 3UC4A 4AW0A 3BHHA 4DLIA 4PDYA 3ZUVA 4G3FA 3BHYA 3OFMA 4BFMA 2NP8A 3UYTA 3R8UA 3OD6X 1LPUA 2OZOA 3S0OA 5BUJA 2REIA 2PULA 2YLFA 4O96A 3ZMMA 4AZSA 3ZONA 4JJRA 4TYEA 4M0YA 1SVGA 5E8VA 2C6TA 1QPJA 3R1SA 4C7TA 3FEGA 2XZSA 3A4PA 3B8RA 4GMYA 2JIIA 4G9RA 3NYOA 4IAZA 4NJ3A 1WMKA 1GIJA 5E92A 1OIQA 1IG1A 4AAAA 3BL7A 4YTCA 2R4BA 4QYHA 4ALVA 3BI6A 3EQCA 4J96A 4BDEA 4C3RA 5KNJA 4G9CA 5L6WL 4WRSA 2HIWA 4R5YA 4QYYA 4YNEA 3UC3A 3M1SA 5EYDA 3CSVA 5HIBA 5ANIA 1XH8A 3DK6A 4TYHB 4LRMA 5AR8A 1OECA 5HVYA 4U6RA 2X0GA 4MXCA 3IQ7A 5DEWA 1U54B 3LXLA 4IWOA 4YJOA 1TZDA 1XO2B 1OB3A 5HBJA 2ZB1A 5IA5A 1OL1A 3VNTA 2C6OA 2PSQA 3N4VA 1CDKA 3HV6A 3E7OA 1YWRA 4MXYA 5AV4A 2F4JA 3DT1A 3O51A 4BDBA 4YJNA 3GVUA 3Q9YA 3F66A 3HV4A 4I5MA 4D5HA 3Q60A 3R63A 5HNBA 4EOJA 3POOA 4QMYA 4TYJA 1DS5A 2X9FA 3I81A 1VEBA 1UU8A 3OW4A 5AP1A 3RPOA 5AM7A 1W98A 3OWLA 3K5UA 4GL9A 4FOCA 3KXNA 2IPXA 4M66A 2XBAA 4RFMA 4YU2A 5DG5A 4Q5HA 3FZRA 1JSTA 5HGIA 4CFMA 4EHZA 5EKNA 3OWPA 4QP7A 1Z9XA 5IEXA 5EQPA 3EOCA 5DNRA 2QCSA 2C3KA 4BCOA 4RQKA 2HZ4A 2OJ9A 2Z7RA 5HVJA 3FV8A 5EW3A 5AX9A 4DYMA 2YHVA 3AD4A 2IN6A 3VS7A 1PXOA 3VUTA 2J0KA 3E8EA 3QD3A 3D7ZA 4QQ5A 2IW6A 4PF4A 2CKQA 1LEWA 2WTDA 5HORA 2IG7A 4QP3A 4Y95A 4EYMA 4XNEA 4CFVA 1JSUA 3KGAA 4ONAA 5IZFA 3BPRA 2X1NA 4U41A 5HX6A 3ORNA 4XLVA 2JIVA 2GS6A 3OCSA 3RPRA 3QKKA 4V0GB 2WTKC 2VTJA 2NPQA 4IADA 3TZ8A 4JDHA 2ETMA 3FLYA 4ASEA 2YCRA 2R0IA 3CXWA 3G5DA 3LFAA 2YA9A 3V5JA 4BWXA 4F9BA 5CAOA 3LQ3A 3OT8A 4JDJA 1YHVA 2I0HA 2XK7A 4O0YA 2HELA 2R3PA 3ZC6A 4O0XA 3EHAA 3NUXA 3UO6A 4G6OA 4CV8A 3OT3A 3P0MA 4I22A 2VAGA 2BIKB 1HCLA 5DR2A 4AGUA 3PUFC 3VUGA 2XANA 3HAVA 5GHVA 5H2UA 1ZMUA 4GYGA 4MWHA 4D2PA 4YUQA 5J79A 3KK9A 3MYGA 4KKEA 2OFUA 3P5KA 4RVLA 2W17A 4W4XA 3P86A 4YJUA 3ULIA 4FKVA 2VGPA 3EQRA 4EZ5A 4I6HA 3IGOA 4DHIB 3JY9A 3QTZA 3UODA 3QF9A 4XG2A 4BWKA 4IFCA 1AD5A 1ZWSA 4TY1A 3NDMA 3L9PA 3LFDA 2QC6A 3EFJA 3OS3A 5E9EA 2VWWA 1FVRA 1ND4A 3V04A 1Y8YA 1W8CA 3O8TA 3HKOA 1JKSA 4FV0A 4BCPA 3DA6A 4TWOA 3OHTA 3A61A 3Q96A 1FBNA 5IG1A 2YIXA 4EH8A 3QLFA 4V04A 1G8SA 5F94A 3ANRA 2QR8A 4KINA 4WBBB 3SD0A 1OIYA 4UWCA 4A4OA 4YC6A 4OW8A 4CFFA 5FBOA 1XR1A 2H34A 4NU1A 1URWA 3W1FA 3R1NA 4FTMA 3V5LA 5K4JA 4F0FA 2CMWA 4ERKA 1CTPE 3KN5A 4GUEA 2OSCA 4TXCA 5AWMA 2C5OA 5L2QA 5LARA 3ZC5A 4U79A 4UB7A 3T3UA 4Y5HA 5B2KA 3SHEA 1OITA 2Z7LA 3NNXA 1OGUA 3V6SA 2UW8A 3BYVA 4H3QA 2I40A 4L01A 4B8LA 4D2TA 4EKLA 2JDRA 3AC2A 4QTCA 3PG1A 4KS7A 2O63A 5J1WA 1YKRA 4IACA 2UVXA 4JAJA 1YXUA 3UNZA 3W2OA 1H1PA 4J8MA 3V8WA 4JIAA 4EI4A 3A8XA 2R5TA 1CKPA 4BDCA 1PXNA 2GS7A 4ANBA 5CSXA 4C4EA 5AAEA 3OOGA 4JQ8A 1ZLTA 5J9ZA 1A48A 3LLAA 4MD7E 3LVPA 3TYKA 4G34A 2OWBA 3EN4A 2XYUA 3Q9WA 3KULB 4JG8A 2JKKA 4P90A 3UIXA 4AE6A 2HXQA 3ZO2A 3PPJA 4BZDA 1FPUA 3BKBA 4JI9A 1W82A 2UVYA 4AZTA 3D14A 3A62A 5FBNC 3MPTA 2I0EA 3QRKA 1S9JA 2HYYA 4M69B 4D4VA 4FKSA 4MX9A 5I9VA 4ZTNA 4GK4A 4AW5A 4C8BA 3QQKA 4FEUA 3E63A 5CEQA 5AV1A 3VRYA 3QGYA 4XX9A 4W8DA 3H0ZA 1OI9A 3D5WA 4R5SA 3VVHA 4E5AX 3A7FA 4TPTA 5CYIA 2G9XA 5KZIA 4FOBA 4UMQA 1WBSA 2XAMA 2WD1A 5E1SA 4LL5A 4FZAB 4A9SA 2GNLA 5J1VA 2BAJA 4FNYA 4LV5A 3LM0A 3MB7A 4RIXA 4A7CA 4ACCA 4O86A 3GC8A 4GVAA 4WG4A 3LJ1A 4XRJA 3PXQA 4BKJA 2CGXA 3MVLA 3BEGA 3ZH8A 1H00A 3ACKA 3DBFA 2XNNA 5HNIX 4UMTA 1PMEA 1LEZA 3POZA 2JDTA 2XVDA 4FSUA 4C35A 3F2RA 2C6LA 3FXXA 3N4TA 5BVDA 2DUVA 3PVGA 3S95A 3CBLA 3DAKA 4KBAA 5HI2A 1ZOEA 2J5FA 1IAJA 4ZSGA 1W84A 4EOSA 3BLHA 4WSQA 2A1AB 3LFSA 4HPUE 4YZCA 2HWPA 2ZMCA 3Q32A 4MBLA 2GFCA 3VS2A 4QMOA 2WTWA 3ZYAA 1Q4LA 4NM0A 3TZ7A 3TKIA 3IG7A 3KF4A 3BLQA 2OXDA 3OY3A 3FMEA 4YJPA 4D9TA 4ZZNA 1Q8TA 4EHGA 1Y6BA 3FZPA 2PUNA 3TJDA 4ARKA 1Q62A 2QOBA 3FMNA 1JWHA 4E4LA 1H01A 1UVRA 3ELJA 3BU6A 4F1MA 3KREA 3PZHA 2VV9A 1PW2A 1ZOHA 3UTOA 4K8AA 2IZRA 3C9WA 3OY1A 4JS8A 4RZWA 4K2RA 4Y8DA 3SC1A 4N70A 3EZVA 4W4WA 2X8EA 2AC5A 3ANQA 4WD5A 4FV5A 2RGPA 2HW6A 3ZTXA 2R2PA 4APCA 4ITJA 4LM5A 4YZ9A 5C9CA 5D7VA 4OTDA 4NEUA 4BF2A 3BLAA 3Q04A 2ZDUA 3RCDA 1KWPA 4PTGA 5AJQA 5FXRA 5HE0A 5BV3A 4U9AA 3HUBA 4FIGA 1J7LA 3PPKA 2ITUA 4C4FA 5LMKC 4X2KA 3RK7A 3GCVA 4DGOA 3F61A 3R9NA 1BL6A 3RKBA 4XS2A 5EFQA 4DGLC 4J8NA 5F1ZA 5AIRA 1KOAA 3KC3A 4LYNA 4DFYA 4R3RA 3C0GA 3WF6A 2XNPA 1CKIA 4A9TA 3WF9A 4BB4A 4BGHA 3LCDA 4FGRA 5H8GA 3WF8A 4FJVA 2UVZA 3A2CA 2BUJA 3E3PA 4FSNA 5CT7A 4HYIA 3QYWA 4XOZA 4BICA 2ZOQA 3CR0A 4GFGA 4WG3A 2YIRA 2IF8A 3UDTA 4MD8E 5AP2A 3GT8A 5BNJA 3H9OA 2UW0A 4RLLA 1PKDA 3OC1A 2QQ7A 4UMUA 3S1HA 4B7TA 3QX2A 5EM6A 3AKKA 5DRDA 3Q4CA 4F9CA 2XKDA 4J98A 1KSWA 4B9DA 5KO1A 2UZUE 4IAYA 4QDVA 3P7BA 5LMAA 4DH3A 2ERKA 3NPCA 5CAPA 2GMXA 4D2SA 2PVNA 2WO6A 5E8YA 4OGRA 4N4SA 3O17A 3NUAA 2PVMA 4XJ0A 4L43A 5DHJA 2W9ZB 5E7RA 4GKIA 5C1QB 4YJVA 4L8MA 1I09A 4JLCA 1B38A 1PMNA 3DFCB 5FWKK 4I93A 5B2LA 3TUBA 2B0QA 3U55A 4FZDB 2XCKA 4ZSEA 3OCGA 2QO7A 5DE2A 2QOFA 1W2CA 4QPAA 3FKOA 1Q41A 4HVHA 4DGGA 3R7GA 3NWWA 3UQCA 3CJFA 2ESMA 4UBAA 2CLXA 4FT0A 1PXIA 3U6HA 3QL8A 4CG8A 1OL7A 3AOXA 1OL5A 4TT7A 4CRLA 4JAIA 4EK3A 2QO9A 1OZ1A 4KB8A 1OL6A 3E5AA 2O8YA 3C4FA 1MRYA 3GU8A 4DLJA 4YR8A 3F82A 4CV9A 3IGGA 4NIFA 3SA0A 2CKOA 4QMLA 3HA6A 4KUJA 4OBQA 5HHWA 4D1ZA 4IM2A 4FR4A 2WU6A 3FLSA 5AR5A 4F6SA 5I3OA 5A14A 4FICA 3JS2A 4J99A 4MD9E 5CSVA 4PDPA 4ZOGA 2GNGA 4HGTA 1WFCA 3DCVA 5EI6A 4ZTHA 4MH7A 5KBRA 3MGYA 5IDPA 3OMVA 4HZSA 4NTTA 4TWPA 4E6DA 2GPHA 3PRFA 2A19B 4LGDA 5CI7A 3COKA 2IJMA 1A9UA 1P4FA 5HO6A 1SZMA 2Y4IC 4ZZMA 4DG3E 5IMXA 3GXLA 4CTCA 1Q8UA 3DS6A 2PU8A 1W2DA 3A8WA 4XG6A 4MYGA 2KULA 2QVSE 4Q2AA 4H1JA 2VX1A 3BRBA 4B4LA 5IQAA 5IQEA 4EZ7A 1AGWA 3WE4A 3P7AA 2IW8A 3FI2A 4U42A 3PJCA 3BV3A 4FA2A 3WZKA 3V5QA 1UA2A 2B9IA 3OUNB 4AW2A 3FZOA 2BIYA 4J71A 5DN3A 3HZTA 3LFBA 3QQGA 1G8KA 5HTBA 3KN6A 5E90A 1T45A 3ZM4A 5K9IA 4XG3A 5BYLA 4S33A 4D1SA 3HUCA 5D10A 3V8TA 2XIXA 1DM2A 4JQEA 3UJGA 3V5TA 1JQHA 4WSYA 2HY81 3GB2A 5HQ0A 4O7RA 2BAKA 1M7NA 5CEPA 4ZTMA 3G6HA 4JXFA 4Z55A 4U45A 3LQ8A 4WUNA 2FB8A 3NVKI 3O5AA 5LXMA 3TEIA 4QYGA 3NEWA 3SXRA 3VS3A 3CIKA 4DFNA 3KXXA 3LAUA 3V8SA 1VJYA 2P3GX 5AUUA 2R7IA 2ZV9A 4OTPA 5ANGA 3W10A 5HLNA 2UZEA 3FQSA 1XKKA 3DKFA 3NW6A 4FVPA 3MDYA 2BMCA 2ITVA 5CU4A 1BX6A 2RIOA 3VUKA 2ETRA 3A7GA 4DHJA 1Y91A 2V55A 1JVPP 4QMUA 4O0WA 4JL9A 1MQ4A 4BCQA 4FK3A 3V5WA 5IU2A 1O9UA 4KIOA 1QMZA 2W4JA 4WUAA 2C68A 4DINA 2I0VA 3DB8A 3DKCA 4O0VA 3ZUUA 2G1TA 1QPEA 5M07A 4CMOA 2PVHA 4QPSA 3P78A 5F20A 3TNHA 4AXEA 1W0XC 3TWJA 4TRLA 5DVRA 1SVEA 5EM5A 3GU6A 3PSDA 5GZAA 4IX6A 4FNZA 3D2IA 3FHRA 3ZXTA 4CGAA 3WYXA 2C3LA 3IW8A 4DTKA 4NM7A 3R83A 5A4EA 5HO8A 3OVVA 2C0IA 3EQGA 3ERKA 4D2WA 2J50A 5D7AA 4LV7A 2Z7SA 4XEYA 4OTWA 4ALWA 2W7XA 3N51A 2W5HA 4HJOA 2QURA 2BILB 5FTQA 1W2FA 4NW5A 3PXYA 2OJGA 2PMNX 5A9UA 3MSSA 1K9AA 3OXTA 5FEEA 2RFNA 3ZLWA 2J7TA 4NCTA 4QMZA 2DYLA 3H10A 2PMIA 2YM7A 5AM6A 5JGBA 2PMLX 3LFNA 1J3HA 2IZTA 2OI4X 2E2BA 2WOTA 3AT3A 3F3VA 3OEFX 4G6LA 2Z7QA 3CJGA 4IZ5A 4WA9A