5BUIA

Erk2 complexed with 2-pyridiyl tetrahydroazaindazole
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
338
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 111
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5buiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5buiA01
3EYHA 4O6LA 4GYGA 4AS0A 5HO8A 4BHZA 2F49A 5M51A 2C5OA 1JOWB 5T6KA 4TYEA 3LIJA 3R7UA 1JSTA 2AC5A 5CT7A 5HEZA 4FIHA 4K18A 4U0IA 1SVEA 1VZOA 4YMJA 2QOFA 5FBOA 2UZUE 2OK1A 1WBOA 2WMUA 4I20A 4I6FA 4UMPA 5FEDA 2ERKA 3OXTA 3TCPA 1BMKA 1F5QA 4JNWA 4G3CA 4FV6A 2QLQA 3P08A 4KIQA 5JGAA 4NM3A 2XIYA 3VJOA 2QONA 3FWQA 3HV6A 2HW6A 2Y8OA 5LQFA 3FMHA 3VUKA 5M57A 3Q3BA 3REPA 3HV7A 4I6HA 4FMQA 5DN3A 2W1GA 3RZBA 2JAVA 2HW7A 1VYZA 3FPQA 4D1ZA 4DF3A 4M84A 4RJ8A 5BPYA 3VS6A 5KMOA 1JSVA 3DQWA 1ZOEA 4WBBB 4BGHA 3OCBA 3D15A 4A07A 3MFSA 4J7BA 1XH9A 3L9MA 5C8MA 3O51A 5E8ZA 4ZJJA 1H24A 4L6QA 4LFIA 3C5UA 1A9UA 3PE2A 4QMVA 5AA8A 4I21A 2HOGA 3MTLA 4IC7A 4NK9A 2R3OA 4O84A 2UZDA 2XUUA 3PXYA 4RIOA 4X2KA 2YERA 4JRNA 1ND4A 3ZSIA 3NLBA 5CAPA 2O5KA 4RGJA 3ORXA 4U9AA 2W05A 3NUYA 1FBNA 4PTEA 4XG9A 1FVVA 2J4ZA 2A1AB 4IW0A 5EHYA 3LCOA 1I09A 3ZLXA 3FMDA 1Q4LA 3A7JA 3OC1A 3C5IA 2WTWA 2ZB1A 5E1SA 4LUDA 2CCHA 1WBNA 3EQCA 3R21A 3PPJA 4IX3A 4YLJA 5CX9A 4ZS0A 2OXYA 1OITA 4YTFA 3DV3A 2ITWA 2X2LA 3JYAA 1R39A 2ITXA 2A2AA 3I60A 3UIMA 2I40A 4D4YA 3NW7A 4IFGA 2YM5A 2BKZA 4XV9A 3F5GA 5D7AA 4RPVA 4E7WA 1STCE 2BZIB 3HVCA 5M4CA 3I0OA 2PMIA 4I24A 3DA6A 4YZCA 2C0IA 5CT0A 4ZSGA 3SDJA 3SHEA 4H3BA 4C36A 1ZMWA 4G2FA 4MF1A 5JMSA 5BX0A 4I6BA 4RBLA 4C37A 4ZLZA 5HIEA 4QMWA 2BRBA 2P33A 4F1OA 2R3LA 2QO9A 3DAKA 4O0VA 1YHSA 2BFYA 5AP0A 4ZTQA 3IW7A 3C4WA 4JBPA 3BELA 2HK5A 2VWUA 3TNPC 2XJ1A 4Z7GA 3PIYA 5BVFA 2X6EA 5LVOA 1GIIA 2GTNA 4JX7A 3R7OA 4FA2A 4DGGA 5IMXA 2QVSE 3KU2A 3NPCA 2OWBA 4RFYA 5B7VA 1UWHA 2RFDA 3AC1A 5AP5A 3I0QA 3OXIA 5AR4A 1K9AA 2OF4A 1ZYSA 2IZSA 4ZMFA 5BUIA 1OUYA 3HMNA 3NR9A 2Z60A 4EL9A 3P86A 4BCKA 4EH4A 4HVSA 4R7BA 4HGSA 4TWPA 5HX8A 3SVVA 2PU8A 2GS7A 3PLAE 4E20A 2I0EA 2WAJA 4XG2A 2ITUA 4C3RA 2VO6A 3UODA 4QP8A 3UVQA 5E1EA 4E6CA 3FUPA 3DFAA 3OWKA 4IMYA 5FEQA 5AX9A 4M7IA 2GNGA 4QP2A 5GHVA 3S2PA 5KCVA 2C6EA 2VN9A 4UBAA 4USDA 2VD5A 4IFCA 3TZMA 4U6RA 4W4VA 3MIAA 2WELA 4JDKA 4RA4A 5J5TA 4OTHA 3TM0A 5EM7A 1ZARA 3F69A 4I5PA 2Z2WA 5CF5A 3CKWA 4E1ZA 3AGLA 5J95A 5IH6A 2RKUA 4EWQA 2XKDA 4QMOA 2VTSA 5H9BA 4KB8A 4BDAA 4TKSA 4HGTA 4ZTMA 3MIYA 1H1RA 4FKWA 5LWMA 2R3HA 3BKBA 2UW3A 4YSJA 5GJDA 4BTMA 3VW8A 2WMVA 1KV1A 3NGAA 4LL0A 1GY3A 3OCTA 4NM7A 3FKLA 4RVKA 3W8QA 3WOWA 3ATTA 2PZPA 3ZM9A 4DTAA 3GGFA 1Y8GA 1ZAOA 1NW1A 3F7WA 4FGBA 4O82A 5IEVA 1TVOA 4B6LA 5A6NA 4YPSA 4EJ7A 4RIWA 1YWRA 2WTKC 4ZTSA 1H1PA 3UOJA 1NY3A 4CG9A 5C4KA 4ZTRA 5LXMA 1UU8A 4O6EA 2BMCA 2VNYA 3GCSA 4FSNA 4XH6A 4F9CA 4RZWA 2V7OA 3JY0A 4O38A 3E62A 5EDPA 3QZIA 5FP5A 5HLPA 4EZ3A 1H0VA 2IW8A 3UMXA 1CM8A 2WMXA 3PJ2A 5CU3A 3EYGA 3R9HA 3MPTA 2PE1A 3R7IA 4FT7A 4ACDA 2FH9A 2UZLA 2ERZE 3VULA 3MVLA 2BFXA 5HG7A 3P9JA 3IG7A 3TI1A 1HCKA 5DWRA 3TNWA 3VRZA 5IPJA 4L3JA 1GAGA 3L9LA 4J98A 5DNRA 5EI2A 2IZRA 4MXCA 1CKIA 2I6LA 3QKKA 4FT9A 4YC6A 4BRXA 2JDRA 3EFLA 3LLAA 5EKOA 1WVWA 3FHIA 3HNGA 5JGBA 3NVMB 2XIZA 4FICA 2A4LA 2JKQA 3ORIA 4GT4A 5M53A 3BBTB 4Q9SA 5ACKA 4R5YA 3PSDA 3BYUA 3C4FA 4FTRA 4BI2A 3OBGA 4BGQA 4C3FA 4IQ6A 2VUWA 1G3NA 1XQZA 3Q4ZA 4NWMA 4XRLA 5EYKA 4OTGA 4MQ2A 1K2PA 3R9DA 2FO0A 2W4KA 3GBZA 4QMQA 3UP2A 3MI9A 2QQ7A 4FV1A 3N4VA 1R1WA 3E88A 3OD6X 4BICA 1MRUA 4EHGA 3DXNA 3A60A 4Z55A 5ICPA 2H8HA 3QD2B 4BWKA 2C1AA 2VWXA 4EK6A 2OF2A 1YVJA 2WMSA 2WTCA 4DFLA 1UU3A 1XKKA 4M14A 2YIXA 3L9PA 4C4EA 3TV7A 5LMBA 4BFMA 2FSOX 5L8KA 5E90A 4DFXE 4LOQA 3RINA 4KAOA 3TKHA 2EB2A 5CI6A 4KSPA 2RSVA 1YKRA 4O7WA 4YP8A 5KBRA 4C3PA 5CSXA 4USFA 4K33A 1U54A 4U3YA 5CXHA 4NW5A 4AZEA 5JKGA 1S9IA 3Q60A 5DIAA 4EH2A 4FV0A 4IZYA 4RSSA 3D5UA 3WI6A 2EWAA 4I0TA 2C1BA 1AGWA 4A9TA 3DZOA 5J9YA 4FNWA 5DGZA 2PVFA 1BKXA 2PVHA 2VTAA 4IIRA 1KUTA 4JG8A 4HYHA 5TKDA 2XIRA 4D9TA 3DFCB 3IECA 4QMSA 1JKKA 3PXQA 3CSVA 3NNUA 4AZFA 3TWJA 3LJ2A 4IJ9A 4AZSA 4IVDA 4YJNA 4CRSA 4EWHA 3R7EA 2QG7A 5F94A 2R0IA 4IM0A 5FGKA 5JEBA 2AC3A 5HE3A 4PDYA 3EZRA 3L8XA 3R6XA 4ZOGA 5AP2A 3VO3A 2BAJA 2XJ0A 1W83A 4EBWA 3E64A 4AN3A 4J95A 2Y9QA 5CWZA 1ZZLA 4JI9A 4O2PA 4AN9A 4NKAA 2E9UA 3Q52A 4H36A 3LJ0A 5KZ0A 3RWPA 3P79A 3IDPA 4EOSA 4IACA 4YTCA 3GB2A 4IAYA 4EOPA 1MUOA 4AW5A 1OECA 2CCIA 4EEVA 4RWKA 2GNIA 5LWNA 4MXAA 4FZDB 5AAEA 2OLCA 4DH5A 2PVRA 2XCHA 4FL1A 3H30A 2PULA 4FTCA 3AC8A 4GFOA 4ASXA 3EZVA 3UVPA 3TTIA 3JXWA 5C27A 2OSCA 2R5TA 5M09A 4DT8A 2CGVA 4ZLYA 3SQQA 5AJQA 1UA2A 4L46A 2W1HA 4KRDA 4BDGA 4UXQA 4FV4A 2YAKA 2ZV2A 3AQVA 1RE8A 3PP1A 3QTQA 2RFEA 5JZJA 5L6PA 3LPBA 3SG9A 4IAIA 4DGOA 5A46A 3WZKA 2VTHA 1JKSA 5KMIA 3S95A 3CD8A 2CDZA 2R3FA 2WMAA 4BKZA 3OP5A 3PIZA 4BDFA 3GVUA 3UMWA 3ALNA 4C57A 4KWPA 3WYXA 4NJDA 3HMIA 3P0MA 3DU8A 5HBEA 3B8RA 3ZLSA 4Y5QA 1E1VA 5GIPE 4BVUA 4X2JA 5M44A 4WNMA 1FMOE 1BL7A 1PYXA 4DAWA 3PG3A 1T46A 3NEWA 4FI1A 2BUJA 3L8VA 2G2IA 4QMMA 1AD5A 3OW3A 3CD3A 5ANIA 4LGHA 3DBDA 2OJGA 4Y46A 2XP2A 3V04A 3IGGA 4JVGA 1H01A 3F61A 4D4SA 4NTSA 2VTIA 2VTMA 3GC7A 2XK8A 1OZ1A 2CHLA 5L2WA 4YHTA 2YCRA 2HZIA 3IOKA 3QQLA 5FLFA 4X3FB 2YEXA 3UGCA 1XH8A 2CKQA 3DT1A 4NM0A 2PE2A 2OH0E 4D0WA 2W1FA 3PXFA 4YHJA 2PSQA 3GOKA 4DYMA 2VTPA 2C3JA 3NRMA 5AUXA 2JIUA 4OTPA 4U5JA 5GJGA 4FL2A 4AUAA 1F3MC 4GW8A 2VRXA 4WT6A 4LL5A 3IKAA 5A3XA 1BI7A 4UZHA 2UZNA 5TR6A 1QL6A 2ITVA 5HD7A 3ROYA 4BCPA 2JBPA 3L1SA 3R02A 4ZEGA 4BDJA 4IB0A 2XNOA 3OTUA 3Q6UA 3BI6A 2IW6A 4L3LA 2QHNA 3DDQA 4QMTA 4HJOA 5IQFA 4RQKA 4V04A 3U9NA 2YM4A 4BB4A 4R6VA 4EKLA 4FSQA 3ZZWA 3MPMA 4F7JA 3D7TB 5IQIA 2JIVA 3U55A 3DBCA 3PXRA 3BWJA 5A14A 2HZ4A 3IW6A 4EQUA 5AFVA 3FQHA 4D2WA 4FG8A 4TYIA 4R7HA 4WD5A 4AWIA 3CLYA 4FKUA 4L68A 1F0QA 1H1WA 1ZWSA 5LOHA 4UWYA 2QO7A 2ITYA 3Q4CA 4UMQA 4BCOA 5AR2A 1YW2A 3MJ2A 3UZTA 1V1KA 3AGMA 2V5QA 4NCTC 2CKPA 5CALA 5JN2A 3W2SA 3DAEA 3PPKA 1KE5A 2UW8A 3TJCA 4CRLA 4NYEA 3SD0A 1YOJA 2QI8A 3ZS5A 4RQVA 5EQPA 3OEZA 1P4FA 4G9RA 3ZU7A 1OMWA 5EDQA 1GIJA 3OBJA 2B53A 3NIEA 5CF6A 2Z7QA 4JLCA 3CQEA 3K3IA 1PF8A 2I1MA 4CT2A 2YWPA 2YA9A 3ZSHA 4FTIA 4IZ5A 2J9MA 4IAKA 4OTFA 4DE4A 2QOKA 4H05A 1I44A 4FT3A 2W1CA 3PSBA 3ZXTA 4P5QA 2BVAA 4GCJA 3CPCA 2VU3A 3EFJA 2GDOA 5DOSA 4ZTLA 4BN1A 5C1QB 5HTIA 1CKJA 2VWWA 4YTHA 4WO5A 1H08A 5IQDA 2R7IA 4NM5A 4AXAA 4Q9ZA 2WMRA 4G5PA 5EH0A 4QP6A 2PUNA 1WBSA 4FYNA 4EK4A 2PZIA 2YCQA 1XBAA 3OROA 4CV9A 1BI8A 4AX8A 1EH4A 5KKRC 3QHRA 2ZMDA 3EN4A 1G5SA 2C6DA 3RK5A 3N4UA 1ZZ2A 3VQHA 3E92A 4O7ZA 3PRIA 3SXRA 3R8ZA 5B2MA 3OWJA 5T3QA 3E3PA 3DKGA 2WEVA 4O22A 2DYLA 2WD1A 4N70A 5EI8A 1LP4A 2ZJWA 4FTMA 2VWVA 2UVXA 2BRGA 1SYKA 3PJ8A 4ZMEA 5AADA 3DY7A 1YDRE 4JXFA 1ZMVA 5CU4A 1Q3WA 3EKKA 4CXAA 3BV2A 3W16A 3KY2A 4EC8A 5HORA 4R77A 1PXLA 2YITA 4QO9A 5DE2A 4ZXTA 5EQYA 4OT6A 3FLQA 3R1YA 2FSTX 5ACBC 3G9NA 4FX3A 2PE0A 4L44A 3V01A 4F0GA 1Q24A 1BX6A 3N9XA 2GSFA 2RL5A 4P5ZA 5LVMA 5K4JA 3HV5A 4ZSAA 4G16A 4A7CA 3ITZA 4QMXA 4C8BA 2OIQA 2Y6MA 1V0OA 5DR2A 5LJJA 4O7VA 4CKRA 5JH6A 1J7UA 4FTUA 2ONLA 2JKOA 4XV1A 1YXXA 1OM1A 3ZEWA 4CMUA 4L00A 3W33A 4O0XA 4QMNA 4J8NA 5JQ5A 3BHTA 4FK3A 4D2TA 2UZVA 3QALE 2XNPA 4K8AA 4HCVA 3ZXZA 3HRFA 3BWFA 3W1FA 3LMGA 3BE2A 4PX6A 3C4EA 2VWZA 2ITPA 3FAAA 5I3OA 3W2QA 5F9EA 2PMLX 3MFRA 3UQCA 4OTWA 2EVAA 5DA3A 4YJTA 2R3NA 3MPAA 5CLPA 2OICA 2J7TA 1DI8A 4EOOA 5KO1A 1JKTA 1YOLA 2BAKA 4EK8A 4CVAA 2C3LA 1REKA 3KRRA 3C0IA 5HI2A 4AE6A 2VTRA 3T8OA 4DTKA 4CG8A 3RP9A 3E7VA 3CTJA 4ORKA 2PZYA 4O0WA 3V5PA 5FP6A 1R0EA 3R7VA 3V3VA 2HELA 2WTDA 5HCYA 3F88A 3DLSA 4KBAA 5E8VA 5IQBA 3GU4A 3QD0A 2XBJA 2E2BA 5LVLA 2ESMA 4XJ0A 3I5ZA 4AW0A 3NNVA 3R9OA 3SRVB 5FD2A 1H0WA 3MB6A 4JS8A 2FYSA 2YACA 1SVGA 2XZSA 3QFVA 4DG3E 3D14A 4GEOA 3V6SA 3GC8A 3ID6C 4BTJA 2YM6A 3FMLA 5DG5A 2XKFA 1PMVA 5CZHA 2Y6OA 4UN0C 4FZAB 1JNKA 3KGAA 4YBKA 4JAJA 2I0VA 3V5JA 2C5NA 1Q61A 2AUHA 4F4PA 3Q96A 5K9IA 2YZLA 4OTIA 1XHAA 3CQWA 5KE0A 4TYHA 2GQRA 4RIYB 4X3FC 5KHWA 4G6LA 3RM7A 3AMBA 5IMEA 3POOA 2X7FA 4Y83A 2G2HA 2QU5A 3EQFA 4PWNA 4OAVB 4Z7HA 1M2PA 1P5EA 3OG7A 2XIKA 3KULB 3OVVA 4G5JA 2C0TA 3ZO1A 4ANMA 4R3PA 3WE8A 3OUKA 2V62A 4DEGA 4JR7A 4F08A 2I7QA 3A7FA 4OBQA 3G5DA 2LAVA 2I0YA 3BZ3A 2GCDA 4NJ3A 3UNJA 4GT3A 4V0GA 1JLUE 3ZO2A 3MH3A 2NPQA 4CZTA 2X7OA 3QTUA 1VEBA 4ZK5A 5L2IA 4O7YA 5LVNA 3JPVA 5KMLA 4IX5A 5IH5A 2WMWA 1HOWA 4FF8A 1WMKA 4EOJA 3E8NA 4GT5A 5E8XA 4HVDA 2XRWA 3V8TA 3F3ZA 3LHJA 3WYYA 1W98A 5BMMA 4YZNA 4D2RA 3Q6WA 4IB5A 4GIHA 3N4TA 1ATPE 4KBCA 3GFWA 1YDSE 3ORPA 3MGYA 4RFZA 5AP3A 4L7SA 1JQHA 3HV4A 2XK9A 3IPHA 2IVUA 4ASEA 1Q99A 3G9LX 3KF4A 4MWIA 4I92A 1VR2A 3NDMA 4P4CA 3BX5A 3W2CA 3GNIB 2BIKB 3R9RA 1PXIA 5M08A 4NW6A 2XEZA 3E5AA 2QLUA 3OTVA 2WTKB 2BHEA 3UPXA 3BCEA 3QUPA 4BYIA 4IEBA 4DEHA 1OPJA 3G0EA 4PNKA 1IASA 1ERKA 2IJMA 4JQEA 4JBQA 3RPVA 2B55A 4FSTA 3ZRKA 2FB8A 4HYSA 4PRJA 5CASA 4PL3A 4G6OA 3R04A 4KUJA 3WF9A 3NSZA 4IC8A 1OL1A 3A2CA 5CZIA 5FEEA 4QYYA 3WF5A 4E5WA 3DBFA 2B4SB 4NIFA 2Z7SA 2CKEA 2OZAB 3SGCA 1UVRA 4U97A 4ITJA 5IEYA 4QMLA 4RIXA 3D5XA 2CNQA 3HA6A 2G2FA 4RWIA 1J1BA 4ANSA 5BUJA 1FMKA 2VWYA 4HYIA 3U4WA 2X81A 5J1WA 1XH6A 5IQEA 4GFGA 4QYEA 4ANOA 2CLXA 4FOCA 3EIDA 4UMTA 2O2UA 3EQIA 4WOVA 1DS5A 3U87A 1FVRA 1CKPA 3T9IA 5DR9A 2PVKA 3C13A 4PY1A 1HCLA 2W96B 3DS6A 4D55A 2JFLA 2O63A 4RIWB 1ZYDA 3OMVA 4BBFA 4KA3A 4FZFB 1H1SA 4ZSLA 3FI2A 5ETFA 4BDDA 3IW5A 4YJPA 3PP0A 1QPDA 3HP5A 2R7BA 2JITA 3EQDA 2GS6A 3G6GA 1YXTA 3JUHA 4S34A 4IHPA 2WZJA 3EFWA 3KB7A 4H1MA 4MD7E 4PPCA 5J8IA 5LARA 3RVGA 3LKMA 3Q9YA 4BF2A 3V5QA 4D2PA 4OR5A 3U6IA 4DFBA 3G90X 3OY1A 5AUVA 4FEXA 1JAMA 1WAKA 4BIBA 4YJRA 5CY3A 2QHMA 3RK7A 5FTGA 5L2QA 2GNHA 5F1ZA 2KTYA 3BYOA 5C8NA 2XVDA 3LXPA 4L7FA 4EK5A 3QTXA 3NUUA 4KSQA 4FV8A 5I5ZA 4ZLOA 2C5YA 2OFUA 2UW4A 3E3BX 4ZP5A 5CEOA 2HIWA 4GUEA 4E4XA 1KE6A 3KN5A 1H28A 3VRYA 3VQUA 5IDNA 5EKNA 4AGCA 4TNBA 2Y7JA 2PTKA 2VX0A 5I0BA 4MCVA 1WCCA 4FUYA 2C6KA 1JBPE 2YIWA 5TT7A 3MESA 4F64A 2XB7A 4O0YA 5HVJA 4P7EA 2XJ2A 2FSMX 3P7CA 4ERKA 2EB3A 3A7IA 2BAQA 1W84A 4NKSA 2HZ0A 3D83A 3BQCA 3O23A 3P4KA 1PJKA 3QX4A 5FXQA 3QYZA 4EI4A 2C6IA 2WTVA 4FT5A 4YPDA 1X8BA 5DRBA 5ANDA 5JSMA 4GRBA 3AC2A 4WNPA 3TN8A 1YQJA 2HAKA 2UW7A 1SVHA 3D2IA 3HECA 4IXPA 1YI3A 3LFFA 4QTDA 4UYAA 2C5VA 5HOAA 4CQGA 5IQGA 4GVJA 3TZ7A 1PHKA 3FMMA 4J52A 4NZWB 3QTIA 5K5XA 2WQNA 5KUPA 1PXNA 4ZY4A 4QYHA 4CKJA 5M06A 4QMUA 4WUNA 2GHLA 2J0LA 2UUEA 4X3JA 3FXZA 3VUHA 5HVYA 5HU9A 4EOKA 4O86A 4QQJA 3UO6A 2C3IB 3DJ6A 1FQ1B 4CMTA 4C2WA 3TUCA 4K0YA 4RT7A 5HQ0A 3RPYA 1M7QA 3GQLA 3F5UA 3UIXA 4B0GA 4FSYA 3PJ3A 3PE1A 3ETAA 3IW8A 4K6ZA 4J97A 4CLIA 3CTHA 4EOQA 4ZZMA 3CQUA 5C4LA 1FGKA 3GCPA 3LFEA 3B2WA 4PF4A 4QT1A 3QRUA 4QQTA 2QOQA 4QP3A 2J90A 2GS2A 2J51A 4ASZA 4L42A 3QCQA 1OGUA 5KBQA 4GYIA 5BMSA 2VNWA 4MNEA 1B6CB 2ZOQA 3ORTA 4FKIA 4WG3A 4X0MA 1W8CA 4C4JA 5G1XA 3NS9A 2O8YA 3O8UA 3QTSA 5C9CA 3SXFA 1PXKA 4C0TA 3UYTA 4FIJA 2QOCA 5IQCA 4TPTA 5AX3A 3SXSA 1FGIA 3UNKA 2X2KA 2XCKA 2UV2A 4F1MA 4M69B 4ACGA 3LXKA 3QUDA 5CENA 4C34A 3ORMA 3P23A 4W4YA 3PSCA 4QMYA 2ITQA 4ARKA 3KVWA 5FXSA 3TL8A 2Z7RA 4JG7A 5DI1A 4IAFA 2WMTA 1AQ1A 2NRUA 3KXMA 4W4WA 4CLJA 3VS1A 3PY0A 3ERKA 4NUSA 4ZTHA 3VS2A 2A19B 4XG3A 4EH9A 2Y0AA 2ZB0A 3E7OA 4IANA 4QRCA 4QMZA 5CVHA 1XH7A 1WBTA 1M2QA 4EKKA 2IWIA 3SAYA 5GNKA 2OZOA 4OTDA 1QPEA 5AIKA 3FC2A 4EUTA 1TQIA 4F9YA 1YOMA 2QOLA 5GJFA 1E9HA 3KMWA 3POZA 5DT3A 3C7QA 3KRXA 3LMHA 4S32A 1E1XA 3VC4A 5M07A 2J6MA 3E8EA 3DK7A 4AA4A 3TT0A 2VTTA 1QPCA 2UW9A 3FHRA 3VW6A 3FY0A 2PVMA 2P4IA 4PTGA 3RCJA 5A9UA 4XLVA 5D12A 4RVLA 5A4CA 3TJDA 1KE8A 4EOMA 2YDKA 4APPA 5I9VA 3LFBA 4JAIA 4WSQA 2ZM1A 2W7XA 3ORLA 5L8JA 4AU8A 2R64A 4BDEA 1PXPA 3EOCA 2R3JA 3MFTA 5KMKA 2R2PA 3QC4A 4FSZA 4RJ7A 4E5AX 4LRJA 4YR8A 4IZ7A 2F2CB 4QTAA 1QPJA 4FVQA 1Z57A 1FOTA 4FT0A 1U4DA 4XG7A 4APCA 2ACXA 4AW2A 5M56A 3SW7A 3LM0A 5FUTA 4ITHA 3TKUA 3I7BA 2XK6A 3DKOA 4BCMA 5B0XA 2H34A 4PMTA 1XH4A 3KMMA 4CFFA 3HDNA 1B39A 1LPUA 3MA3A 3ZO4A 3KA0A 3DTWA 4PMSA 4CKIA 3KREA 4WHZA 2B9HA 2E9PA 5HE1A 5GZ8A 5HLWA 2HZNA 3BLQA 3AD6A 3VUTA 4R1VA 4YJSA 2PPQA 5IQHA 3THBA 3MFUA 5AA9A 3VUDA 2BRNA 4BDCA 1ZYLA 4XCUA 3WE4A 4MXZA 3D2KA 4U81A 1Q97A 3TXOA 2XNBA 3QCYA 4G3EA 1OB3A 2PWLA 4I4EA 4GSBA 4I5CA 3DK6A 1H1QA 1Y6BA 1L8TA 2ZM3A 4C35A 4YURA 4RLKA 5CEKA 4CYJA 1W7HA 4WUAA 3IDBA 4DGLC 2XYUA 2VO3A 2X9FA 4FKSA 1O9UA 3F6XA 2G01A 2GNFA 4KINA 1YI4A 4G6NA 3G0FA 1RW8A 2VGOA 4JBVA 4L53A 4FKQA 2YJRA 4TY1A 4ZSJA 5AV0A 5IEXA 4DN5A 3KXGA 3TZ8A 1CDKA 4FIIA 4IH8A 4R7IA 5EM5A 4ZAUA 5KKRB 5L3AA 3C50A 3L8PA 1Q8YA 2C6LA 4JQ7A 4C4IA 3VVHA 4ITIA 2GHMA 3S0OA 5HE0A 2DS1A 4DCAA 4JOAA 5J1VA 4ANQA 4PMPA 3DDPA 5BVWA 4D9UA 4G1WA 3TNQB 4D28A 2GQSA 2EU9A 4O0UA 4FKRA 4PDPA 4ANBA 4IVAA 1GZNA 3DBQA 5BQ0A 2R3MA 2HY0A 5HICA 4GKIA 4NFMA 4RVTA 3H10A 3KRJA 2PL0A 3EL7A 4ZS4A 4JX3A 4AOTA 5JFSA 2R3QA 4D1SA 1ZXEA 3WBLA 5I9YA 4D4VA 2UVYA 5I9ZA 3DB6A 1NA7A 4MVFA 3FXXA 3HMPA 3FZPA 4IDTA 4NU1A 2OXXA 1M14A 2QR7A 3C9WA 3MVHA 3F3VA 5GIOE 2YCSA 3ZBXA 3DCVA 1OUKA 5EHOA 2A27A 5DLSA 4J8MA 4LMNA 2CMWA 3IS5A 4F0FA 1J7LA 4V01A 4OAUC 4DBNA 3RPSA 3UZRA 4YZDA 1ZOHA 5H8BA 3BGQA 3RM6A 1QMZA 3VS4A 4BWPA 4FV7A 5M4UA 2JKMA 4QPMA 3O96A 3EMGA 4QPSA 3KN6A 2Q0NA 4UWBA 3L8SA 2WMQA 4YNEA 4B7TA 3EQHA 5EYCA 5D1JA 2YDJA 5I9UA 3LMIA 2E9OA 3ENMA 4O81A 4NTTA 4BI1A 4XBUA 3AD5A 2ZVAA 3R71A 4YZ9A 2BIYA 3R22A 4KIPA 2XRUA 3A61A 5ANJA 5HNIX 4I6QA 2PZ5A 5E7RA 5JK3A 3R2YA 4BZOA 3ROCA 3VIDA 2GPHA 3AMYA 3Q53A 3U6JA 3W2OA 4K11A 3HL7A 3CIKA 3EN9A 1M2RA 3BU6A 3UP7A 4MF0A 4ACCA 2OJ9A 3QTZA 5HG9A 3I1AA 3MA6A 5BVKA 4HOKA 5IA1A 2CPKE 4GIIA 4JDHA 3QA8A 3R8UA 4LGGA 3PWYA 3R7YA 5F20A 3LW0A 1PMUA 4ID7A 4TNDA 4Y85A 1A48A 2X39A 3KXZA 2LGCA 4UB7A 4A4OA 4FR4A 3MY0A 4DEIA 4HCUA 2C6OA 3ZRLA 4CFMA 5AMNA 4GU9A 3FL5A 2VO7A 3HAMA 3UO4A 4ERWA 4EZ5A 5JFWA 3DZQA 4O0SA 4EBVA 3ACJA 4I94A 4X2GA 4G34A 3KL8A 3QLGA 4WSYA 5I9XA 4C33A 2J2IB 4DITA 3Q9XA 4XOYA 4AT3A 1R0PA 3E93A 3BHVA 3IK3A 4E8AA 3ZFXA 4FE2A 4LYNA 4R5SA 4MEDA 4A4LA 1JKLA 3AC3A 1XBCA 2CGXA 3P7BA 3UYSA 4AGDA 4LUEA 4BIDA 4E93A 4O7SA 2B54A 3Q4UA 4OBOA 3FDNA 5HIDA 4FZ6A 3FSKA 4IM3A 4FSWA 3C0GA 3HAVA 4BBMA 3FLWA 3FZRA 3LCDA 4D4RA 4UWCA 3MBLA 2ZM4A 4Y8DA 3FLZA 4IWPA 1DAYA 3ZMMA 5IUHA 4NSTA 4P90A 3CPBA 3CR0A 3QQFA 2GU8A 2W4OA 3GU6A 3W2RA 2QKRA 2UZOA 1PXOA 1J7IA 3H0ZA 3MB7A 4FBXA 4KKGA 1K3AA 2BZJA 4C4HA 1OL5A 4DG0E 4KKEA 1WBWA 5K3YA 3H9RA 1CSNA 4WNKA 3RNIA 5JRQA 4MX9A 3RAHA 1M17A 1GZKA 1SM2A 1XJDA 4JBOA 4FTQA 3ZSGA 4AZVA 5K5NA 5C26A 2PHKA 4EJNA 1PMNA 3PXZA 5HD4A 3U54A 3BPRA 3FLNC 4U79A 1MQBA 4O91A 3LXLA 3E8CA 3MW1A 4YO4A 4O0RA 4L67A 4G17A 4PDOA 2I0HA 4HPUE 2PZRA 4JIKA 2QG5A 4BHNA 2JIIA 4KIKB 1Y6AA 4LQMA 2RGPA 4LV5A 5FTOA 4QP7A 2ZV7A 2YFXA 3FZTA 3M1SA 3W2PA 1OL2A 4QP1A 4QP4A 4J1RA 5F95A 3V5LA 3I6WA 4HGLA 3W8LA 3SG8A 1ZY5A 3D5VA 1WFCA 4S30A 5CQUA 4DH1A 3VAPA 2QNJA 3HUBA 2Q83A 2BILB 5TOZA 3QRKA 5M55A 2J0MB 1H8FA 2IPXA 1URCA 2X7GA 4WIHA 2V7AA 2WQMA 2J0JA 3R1SA 4ACMA 4BZNA 2X8IA 4QP9A 3LFSA 4EH6A 5AP7A 1BUHA 4II5A 4W4XA 4ACHA 4DBXA 1ZMUA 3HZTA 2W9FB 4YJVA 4BBEA 4TL0A 2UVZA 3NX8A 4JR3A 5B2LA 3I81A 4X7QA 4FEUA 2WIPA 3LZBA 3HUCA 3UZPA 3UG1A 4BL1A 3AC5A 3CS9A 4A9YA 2WPAA 3GFEA 5HCXA 2W5HA 4W8DA 3BBWA 4QD6A 3ODZX 4PPAA 2UZTA 3EQGA 3T3VA 3H0YA 3A62A 4TWNA 3F3TA 3QZFA 3GT8A 4K77A 3QQGA 3QYWA 4E4NA 2WQOA 5L8LA 5GZ9A 4EQMA 2PVJA 3ZTXA 2UZEA 1FPUA 3K5UA 4TWOA 4YBJA 2BDJA 5J9LA 1UKHA 2YIYA 3LJ1A 5AV1A 3UQGA 3V8WA 2JLDA 3VF8A 3PPZA 3U6HA 4TT7A 3V8SA 4FTNA 3FXWA 4HZSA 4RMZA 3WF7A 4BCQA 4UMRA 4RG0A 2YLEA 3NAXA 2ZDUA 4GL9A 5ANGA 5BYLA 4I23A 4IAAA 4MBJA 4RFMA 2Y4IC 3LAUA 5BVOA 3QGYA 4IWQA 4YUQA 4MNFA 1CMKE 4EONA 2B9IA 2PK9A 3RZFA 4Q5EA 3VF9A 3MYGA 5HZNA 2V22A 1XBBA 4BR3A 5CAVA 4RWLA 3VHEA 3QQKA 3ZYAA 3PG1A 1LEZA 5LMAA 3ZM4A 2EUFB 2GNLA 4U40A 1SNXA 2JBOA 3R63A 4O7TA 5AP6A 1W82A 3GUBA 3D94A 4Y73A 3BU3A 5L2SA 5CVGA 3EQRA 5FM3A 3UBDA 4BIEA 3LQ8A 3GU8A 3Q5IA 4DINA 3Q2JA 3WZJA 4B8MA 4Z3VA 4TYJA 3ODYX 4UYNA 1M7NA 4CFXA 3QXPA 2H9VA 2EXEA 3COMA 4LI5A 4DFZE 3CGFA 1OL7A 3F2NA 3FYKX 5AP1A 4JG6A 4F70A 2F9GA 3NYOA 1V0BA 3MH0A 3S1HA 5ANOA 5J79A 4RC3A 4F9WA 3AOXA 4CFNA 5L4QA 2P55A 4XX9A 3UOLA 5CYIA 4MQ1A 4EUUA 4KS8A 3HGKA 4I1ZA 5B2KA 3KEXA 5IDPA 3D4QA 5AAGA 3MV5A 4FOBA 4MXYA 4BCIA 3MVJA 2OJFE 2XS0A 4MBLA 4TZRA 4G3DA 3WZEA 3ZDIA 5LMKA 1FINA 3KK8A 4J99A 2CLQA 3BEGA 2XM8A 4KNBA 4C62A 3II5A 2B52A 3R8MA 2IVVA 1PXJA 3HMOA 3PRFA 3ZEPA 2ONLC 3CCNA 5E8UA 1ZYJA 4BTKA 4C4FA 2OBJA 5BNJA 5IF1A 1FVTA 5CSPA 2XKCA 4EHVA 5D9HA 3VHKA 2PVNA 1XO2B 2HXLA 3MY5A 3NUPA 4IJPA 5EHLA 3CY3A 4XP2A 3QZGA 3TNIA 4BZDA 4D2SA 5CQWA 3RI1A 2WTIA 4TWCA 3ZUUA 4TXCA 3JR1A 1MP8A 2OO8X 3W32A 3Q9ZA 3AXWA 4FEVA 3MJ1A 1BLXA 5BVNA 2X8DA 3R28A 4PP7A 4HVHA 3PDTA 3ZBFA 1OL6A 2YIQA 4CGAA 4D5HA 4PP9A 3RBWA 3VBQA 3FLSA 4CCUA 4AOIA 1YHVA 3L9NA 4YGAA 4FKJA 4PPBA 1OBDA 4XRJA 5FQDC 4M8TA 3RWQA 2YDIA 1OIUA 2F57A 2OFVA 1S9JA 1TQMA 2R3KA 3PVGA 3RPRA 3F66A 2XA4A 3D7TA 4IADA 4RX5A 4MKCA 1YI6A 3ZOSA 3R30A 4BWXA 4DFNA 3H9OA 3OT3A 3NCGA 3PTGA 4YLKA 3UE4A 4XYFA 5EOLA 2QC6A 1SNUA 5BVDA 3CJFA 4FVRA 4M66A 3V51A 4FNXA 3EB0A 4HPTE 4JIAA 5CU6A 3WF8A 3AD4A 5TO8A 4A9SA 3AG9A 3LFDA 4FV3A 4AA5A 3DJ5A 3RGFA 2RIOA 5IUGA 2GTMA 2W9ZB 2IVTA 3NZ0A 4B9DA 4F9AA 2B1PA 3C4ZA 4UALA 2FA2A 5HNGA 3DJ7A 3FSFA 3I79A 2WTJA 1ZLTA 5I4NA 2CGWA 4KABA 4WKQA 4IVCA 3FMEA 4YJQA 4GJ2A 3ZUTA 2IZUA 5DT0A 5CNOA 3RHKA 3QF9A 3FZOA 3PUPA 4FSMA 4H1JA 5AP4A 3SOAA 3VUGA 4O7LA 3QKLA 3BE9A 3ET7A 4KD1A 3R2BA 4TRLA 4FTTA 4ALUA 4L43A 3OF0A 2W5BA 1YXSA 1LUFA 3VBTA 3BHHA 3ORNA 1DM2A 5D11A 3KQ7A 4WBOA 4I0RA 2ZAZA 4NEUA 3BHYA 4R1YA 2JEDA 5CAUA 2BZKB 2R3PA 5AUWA 4DLJA 3A4OX 5CU0A 3PXKA 4AA0A 1Q8TA 4L01A 3RMFA 3A7HA 3U51A 3VNTA 3R0TA 4A4XA 4KRCA 2YABA 3ENHA 4I41A 4DEDA 3CE3A 3CTQA 4GKHA 5EW8A 2H6DA 3QQUA 3QWKA 3DKFA 5E4HA 4U42A 5EW9A 2ZV9A 4OTQA 3NW6A 4LGDA 1JVPP 2W4JA 3DQXA 4U7ZA 5HG5A 5A4LA 5I9WA 1UU9A 4XOZA 4AGWA 4ANLA 4ENXA 2FUMA 3HKOA 4F7LA 1GZ8A 5DPVA 2PUUA 2RF9A 3H9FA 5IZFA 3VS0A 2C5XA 4FV9A 3NYXA 1J91A 2WGJA 5HO7A 4DFYA 2RG5A 4TN6A 4N57A 5AV3A 3F9NA 3QRJA 2XM9A 3LFCA 2YAAA 4PV0A 4IB1A 4TYGA 4AAAA 3PWDA 1TQPA 4P2KA 4FIFA 2QOOA 4EOIA 2YIRA 3FJQE 3QHWA 4WG5A 4NL0A 2HWPA 5DMZA 2QOHA 3KVXA 5EM6A 2WEIA 3PJ1A 4FIEA 4FTOA 4HW7A 3EQBA 1Y8YA 3UJGA 4MBIA 1NT2A 2ETRA 2WQEA 4PL4A 3QKMA 3BYVA 2C4GA 4QQCA 4MH7A 4WNOA 2ITZA 4ZY6A 1B38A 4EHZA 4X21A 3F2AA 5K4IA 4I93A 2YLFA 1WVYA 4MD9E 2QD9A 4IDVA 3R83A 3E8DA 5CVFA 4PMMA 2UW6A 3M42A 5JGDA 3EN7A 2GFSA 3FI4A 4FKTA 4RC2A 4X2NA 3SLSA 4BGGA 5CSVA 5AR3A 3OXZA 4FSUA 3M11A 3R00A 4QNAA 4YJUA 4MK0A 5IA0A 4ZY5A 3VUMA 3FV8A 4QMPA 1IR3A 4W9XA 4FV2A 5H8EA 3C1XA 2R3GA 3K54A 1KV2A 1YWVA 3O50A 4JDIA 3MH2A 3G6HA 4LOPA 4S31A 5IUIA 3GI3A 3QCSA 2X9EA 3FI3A 4CSVA 3FE3A 3VBYA 4O7RA 4FNZA 1Q5KA 5AIRA 2XBAA 1P2AA 2OJJA 3KXHA 3QD3A 3ZONA 1PKGA 1ZYCA 5CF8A 3EHAA 2J0KA 1Q41A 2RFSA 3K2LA 4X6QC 3MS9A 4BCGA 3NYNA 3C51A 4FKPA 2P0CA 3GC0A 4DH7A 1RJBA 4H58A 4FV5A 5LCKA 4AOJA 5IG1A 2IVSA 4RX7A 3PA3A 3Q2MA 4L9IA 4QYGA 5HE2A 5K0XA 4BCJA 2NRYA 3GCVA 4G3FA 3UPZA 3QUEA 3UIUA 1CTPE 5HCZA 3IGOA 2BKKA 1U54B 5HG8A 3SRVA 4EORA 2VX3A 2UZWE 2JFMA 3ORKA 4BCHA 3NNXA 5EW3A 1RDQE 2VTQA 1PXMA 1Q3DA 5KZIA 3KFAA 3NUAA 4Z9LA 5AR5A 2WU6A 4YLLA 3VS7A 3GQIA 1TKIA 4FTAA 3ZHPC 4IB3A 5ITAA 1R78A 4JT3A 4GUBA 3ZC6A 3F5PA 4MYGA 3RPOA 1OIYA 3FZSA 1GIHA 1U5RA 2P3GX 4RVMA 5E92A 5A54A 4O27B 4O1OA 3UDBA 4F6SA 3FQSA 3RAKA 3V6RA 2ZV8A 3B8QA 4UEUA 1SMHA 4JL9A 3C4CA 4RIYA 5DT4A 3SOCA 4BI0A 4UX9A 5IKWA 3NCZA 1W0XC 2W1EA 2W1IA 3COIA 2C6MA 2VAGA 2XNGA 3FKOA 2YZAA 4QYFA 5ETCA 4XG8A 3VBWA 3KULA 4F7NA 4AFJA 4HVIA 2ITTA 3IO7A 4LRKA 3DTCA 2VV9A 4AT5A 3LOKA 3PVBA 4GVAA 4RX9A 3GU5A 4ZJIA 4W8EA 2SRCA 4XG4A 3KCKA 5AUYA 3EN5A 4MAOA 3WZUA 5ANKA 3UTOA 4C7TA 5KHXA 3TEIA 3WZDA 2XK3A 4JRVA 4YHFA 5L6WL 4B99A 1WVXA 2NO3A 4FL3A 3NVKI 4O96A 4M0ZA 4QTBA 2OU7A 3EFKA 3T9TA 3UOHA 3BGPA 2WOTA 2B9FA 3SX9A 3NMUF 4DH3A 3TZ9A 5AUTA 2VZ6A 4H39A 3DLZA 2OH4A 3FL4A 1Z5MA 5EOBA 5LVPA 2QODA 4XHKB 3NUXA 3EKNA 2CN8A 4LOOA 2OIBA 2WKMA 2X2MA 3BLRA 4HCTA 2QOBA 4PQNA 1SZMA 2BRMA 2C30A 2JDTA 3HEGA 4BCFA 1MRVA 1Q8ZA 4U8ZA 2CN5A 5E8TA 3UQFA 2OXDA 5EQEA 3NUSA 3QCXA 5C8KA 3HMMA 5DH3A 1H4LA 3F82A 2QOIA 1GNGA 5KMMA 5AR7A 2VO0A 2XNEA 4YTIA 3GOPA 3D0EA 4BCNA 4EK3A 2DQ7X 3FZ1A 3JVSA 3I4BA 2YCFA 3GU7A 2HY81 1KWPA 3QRIA 3F3WA 3OCGA 4IWDA 3ALOA 2O65A 4IWOA 2JAMA 3TG1A 3QD4A 5HTBA 4H3QA 2B9JA 2OZAA 3KC3A 4J53A 4XS2A 4UXLA 4XV2A 2QKWB 4U43A 4BC6A 4AFEA 3R7GA 3KMUA 4OBPA 1WZYA 2GQGA 2PMNX 3CP9A 2WB8A 3PVUA 2XEYA 2XIXA 1G8AA 2XYNA 4L3PA 2BHHA 4XBRA 2OKRA 4ZZOA 4EH3A 3OFMA 1Y57A 1JWHA 2YM3A 3HRBA 4OLIA 3WF6A 4B8LA 3DOGA 4YC3A 1WBPA 2G9XA 3EWHA 3MN3A 3VWAA 4NH1A 1PW2A 3MVMA 3TIYA 4V05A 4ZZNA 3CY2A 2PVLA 2C6TA 2J5FA 3FKNA 4FEQA 4Z16A 4F1TA 3G33A 3NUNA 3F2RA 5CEQA 3I7CA 3KRLA 4YSMA 5DR6A 4AZTA 5AR8A 3GC9A 5AV4A 5F4NA 3CGOA 1OVEA 1R3CA 1MQ4A 3AT4A 3GCQA 3WARA 4IX6A 4QPAA 3WILA 4WRGA 4O0TA 3WIGA 3QQJA 4FKVA 2QURA 4C2VA 3BLHA 3O17A 3G51A 2RFNA 3R1QA 3HRCA 2XK7A 4ALVA 1URWA 4GK2A 4ONAA 3VUIA 2JC6A 3PA5A 3EQPA 1IEPA 1RQQA 2X8EA 2EXCX 4FSRA 4XV3A 4EZ7A 3N51A 3FMNA 3DK3A 4M97A 3ZFMA 2WIHA 3ULIA 4FEWA 1WBVA 1U59A 2O64A 2WU7A 3NW5A 3DXPA 2E9NA 3AC4A 5T68A 5LCJA 3OZ6A 1UNLA 1GOLA 2FSLX 3CJGA 5C01A 5KMJA 3O8TA 2B7AA 4ZSEA 5CEPA 2W06A 3TDVA 1PYEA 4RLLA 1OKYA 5DRDA 3VBVA 5FBNC 5CSHA 1OI9A 2HWOA 3DNDA 5I3RA 3UC4A 3DKCA 5BVEA 3F5XA 5FDPA 2QO2A 3EH9A 2BROA 4YU2A 3QU0A 4XP0A 4GJ3A 1JSUA 5CI7A 4ZTNA 4I5MA 3DXQA 1KOBA 2R0UA 2Y4IB 4DEEA 4RC4A 4F99A 4DGNA 3QQHA 3FEGA 2VTOA 4HVGA 3FQEA 2C69A 2XMYA 3LFAA 1YDTE 2QU6A 2YISA 1PY5A 4LMUA 2FVDA 5DBXA 1H00A 4CNHA 5A6OA 3GENA 3P5KA 2WXVA 2WHBA 4XNEA 3PYYA 3TV4A 3GEQA 3LCTA 3TNHA 3QBNA 4O1PA 3MY1A 1NVSA 4JJRA 2HCKA 5IA2A 2FGIA 1BL6A 2HXQA 1Z9XA 4GK3A 3HYHA 2WO6A 3LLTA 2EXMA 3PFQA 3UNZA 3ANQA 4K1BA 1DAWA 5CAOA 4AF3A 4XG6A 4CFUA 5CNNA 4N4SA 4FKGA 4PL5A 3LM5A 4X2FA 4CFWA 3UO5A 2DUVA 5IISA 2WNTA 2KULA 3OT8A 4YC8A 4M12A 1OIQA 5D7VA 2Z02A 1L3RE 3RJCA 4DT9A 4QQ5A 3LXNA 3O7LD 1O6KA 4AE9A 2XK4A 2W17A 4IE9A 2PUIA 5G6VA 3LVPA 4DEBA 1O6YA 3A8XA 4KBKA 5HO6A 4EYJA 4YNOA 3CXWA 3R1NA 4XEYA 3OOMA 5EG3A 5HBHA 3PZEA 4M13A 4Y95A 5EK7A 5AWMA 3NAYA 3R8LA 1M52A 4HYUA 4GG5A 4YO6A 2F7XE 4F65A 4ZJVA 3HV3A 2RG6A 3Q5ZA 3MWUA 4FUXA 4BYJA 1REJA 2X4FA 2WQBA 3CKXA 2ETKA 2WMBA 1XWSA 3OY3A 4FKOA 4M69A 3RCDA 3ZC5A 2CNVA 5CF4A 3R8VA 3ULZA 1GZOA 2YHVA 4F09A 3RHXA 3ORZA 2BTSA 2F7ZE 2VTLA 4FK6A 4FODA 3HP2A 3ZUVA 4RX8A 5A4QA 3GCUA 3Q04A 4I3ZA 4QOXA 5J7BA 1T45A 1UNHA 3ZZEA 2VTJA 5TE0A 1P14A 1UV5A 3PJCA 5IQAA 2W0JA 2ZMCA 4J71A 5KNJA 4IM2A 2BDFA 5AV2A 3IW4A 4U45A 5EYDA 4DLIA 4MWHA 3DGKA 3H4JA 2UZBA 2BALA 4AN2A 3W18A 4MD8E 5HVKA 3C4XA 2JDVA 4FG9A 4DFUA 4MXOA 4GFMA 4N0SA 3OS3A 2XNNA 3W10A 1OIRA 1XR1A 4Q5HA 4RJ6A 3IONA 3VBXA 3VJNA 3R8PA 1OKZA 3M2WA 1H27A 4IBMA 2VGPA 4FIGA 3OCSA 4HNFA 4I4FA 4U41A 4X6RA 3TKIA 4GV1A 3ZFYA 5IU2A 2HYYA 2V55A 2F4JA 3O2MA 2R9SA 3RK9A 1NVQA 3O0GA 4BTFA 4FKLA 2VX1A 4IAZA 4M3QA 1KOAA 5JZNA 2O0UA 4DCEA 4G3GA 3FLYA 1PRYA 2YM7A 3MTFA 4MHAA 4Y5HA 3H3CA 4PTCA 5E8SA 2O3PA 5E8YA 5A4TA 5ANEA 3A7GA 3RALA 1U5QA 3S00A 1G8SA 3MSSA 5J87A 4FTJA 2YM8A 2G15A 2R3RA 1OKWA 5J7HA 5DEYA 2C0OA 4JQ8A 3V5TA 4S2ZA 4C38A 4MTAA 3U9CA 4AP7A 4E6AA 4RWJA 3G15A 5E91A 4C59A 3TUDA 2PY3A 4QTCA 3LE6A 4R3CA 4AG8A 5JT2A 4LM5A 4FC0A 4EH8A 1GJOA 2BPMA 4NCTA 5TF9A 4DA5A 3Q32A 5H2UA 4RA5A 2REIA 4O21A 3E87A 4DGMA 2UW5A 1DI9A 2OI4X 1ZY4A 5HESA 4D5KA 5JQ8A 3R73A 4OGRA 2PMOX 4TYHB 3NNWA 5A4EA 5BYZA 5M4IA 5H3QA 4L52A 1OKVA 4EYMA 3QXOA 4LG4A 2BZHB 4C02A 1U46A 3D7ZA 4YJOA 1VYWA 1XH5A 4L8MA 3ACKA 2HENA 4CZUA 3OWLA 5JFXA 4GK4A 4WA9A 2ETMA 3QL8A 4L45A 1Q8WA 4V0GB 2JDOA 4M67A 5FWKK 4DEAA 5KX8A 2NNWB 5IA5A 3R01A 1ZOGA 3RKBA 4ENYA 5J5SA 3BEAA 3CEKA 2NP8A 5HU3A 2WFYA 5HKMA 4O2ZA 3LFNA 1IRKA 5CSWA 1IAHA 1KE7A 3TV6A 3TIZA 1VJYA 3F7ZA 2IO6A 4E6DA 2W99B 1JPAA 4FVPA 3UIBA 5BUEA 4DHFA 2BR1A 3AMAA 3RAWA 3B2TA 3IQ7A 2Y4PA 4D0XA 4OW8A 2J0IA 4A9UA 3S3IA 2OG8A 5IH4A 1LEWA 3SA0A 5CTPA 1V0PA 2E9VA 2CSNA 2W1DA 3D5WA 1O6LA 3UG2A 1Q62A 4E3CA 1Y91A 4XMOA 3AT2A 3BRBA 3FPMA 3OWPA 3PVWA 4IVBA 4JDJA 5AEPA 4OT5A 2VWBA 3DB8A 4WRSA 2R4BA 3LQ3A 1UU7A 5AM6A 5HBJA 4H3PA 4G9CA 2ITOA 5FM2A 1KSWA 4F6WA 1LR4A 5EDRA 3I6UA 3AT3A 3LCSA 2H96A 3ZRMA 3MH1A 5CU2A 5GINE 4GH2A 4C61A 3ZH8A 3FMKA 4NIFB 4F7SA 4OUCA 3VS3A 1UWJA 3ANRA 4CT1A 5DEWA 4OTRA 1YXUA 5DFPA 1UKIA 4RIXB 2R3IA 5CEMA 3NIZA 5D41A 2VWIA 2YN8A 2ITNA 2QR8A 3F3UA 4B4LA 3BQRA 4HNIA 4AT4A 4BDKA 4D58A 4E5BA 4EHEA 4MXXA 3LQ5A 2BTRA 2Q0BA 3P7AA 4RJ3A 3QGWA 2B0QA 3KRWA 4I22A 2XNMA 3KXNA 3JY9A 4CYIA 3PY1A 2YWVA 3O7LB 4A9RA 3U4UA 4TW9A 1QCFA 4O7NA 2PUPA 2VTNA 3MDYA 5H8GA 4M68A 4FZ7A 3ATSA 2WOUA 2X6DA 3BIZA 3JVRA 3PIXA 2C47A 4WG4A 3OUNB 3HA8A 3HLLA 3EN6A 2C68A 4PUZA 2OJIA 5JRSA 1H26A 4BDIA 4CEGA 4U3ZA 5FRIA 3FYJX 1IG1A 4E73A 3TACA 1NXKA 4BKYA 4EC9A 5CANA 3PZHA 5CEIA 4ANNA 4AGUA 4AZWA 4N6YA 5GZAA 3TTJA 3QLFA 4FTKA 2OIDA 2OGVA 3C0HA 2JKKA 2W5AA 2GFCA 4M15A 4UV0A 3KK9A 5C03A 4BDBA 2A0CX 2J50A 2QCSA 4R8QA 5AUZA 3DBEA 4CFVA 3RTPA 4AQCA 1BYGA 4CZYB 3COKA 4O83A 3BGZA 1OPKA 3P1AA 2CJMA 4FG7A 5HHWA 5J9ZA 4LRMA 3I5NA 4U44A 2IW9A 1NVRA 1UNGA 1P4OA 1PKDA 5HNBA 4AACA 3GP0A 3RAIA 3DNEA 2P2IA 4TTHB 5EI6A 4ALWA 3IDCA 2JD5A 2X4ZA 2W1ZA 3FMJA 3NWWA 4BDHA 2X0GA 2JDSA 5FDXA 5JFVA 5IA4A 4EQCA 1ZRZA 5EM8A 3QRTA 1OBGA 3CC6A 5EFQA 3SV0A 4D1XA 5M4FA 4NT4A 5E8WA 4X3FA 4GMYA 4IZAA 5HX6A 3GXLA 5D10A 2DWBA 3BYSA 5AUUA 3BV3A 2GMXA 3FY2A 5HLNA 3QTRA 4XP3A 3UOKA 2XF0A 4EH7A 1YHWA 3A99A 3JS2A 3PLSA 5FTQA 4UMUA 2IN6A 2XKEA 5HGIA 4F9BA 4YZBA 4RJ4A 4RJ5A 4USEA 3KCFA 3K5VA 2F2UA 2X1NA 1H07A 3D9VA 4G31A 3KKVA 4CTBA 5E9EA 2ZDTA 4F0IA 4C58A 3COHA 4R3RA 3QWJA 4A06A 3O71A 4RZVA 5AM7A 3DPKA 3O8PA 5AAFA 5LMKC 3R9NA 2GNJA 4DG2E 2ZYBA 1YWNA 3VS5A 5HIBA 3EL8A 3E63A 3RNYA 3OOGA 5KMNA 1IAJA 3HX4A 2BRHA 3QZHA 4QNYA 1MRYA 3G2FA 4DTBA 1J3HA 3QTWA 3K3JA 4FYOA 4I0SA 5IA3A 2Z7LA 2CGUA 3SW4A 4KIOA 4KIKA 3QA0A 3U8WA 4F6UA 2PYWA 2AYPA 1OPLA 4DH8A 2J5EA 4FNYA 3SKCA 3BYMA 4GG7A 3BHUA 1A06A 5DYJA 3ZLWA 3TDWA 4PDSA 5BYYA 4U80A 4M0YA 1IA9A 3KF7A 4MNEB 3DAJA 4NFNA 2Z8CA 4E6QA 2XH5A 4BY9E 3A4PA 5HTCA 3QX2A 2BDWA 3HDMA 3LCKA 4N6ZA 3ZCLA 4HZRA 2BCJA 4YZMA 2PVYA 1KE9A 2UW0A 5CXZA 4DC2A 4HGEA 3OW4A 3QC9A 2P2HA 5CS6A 4E4MA 5FXRA 3OEFX 3OHTA 3BU5A 4S33A 3ZDUA 4K2RA 4ASDA 3P78A 2F7EE 3FI8A 4W9WA 3ZO3A 1J1CA 5ETAA 1YRPA 1APME 5CAQA 5L6OA 3LFQA 4FTLA 3UC3A 3PY3A 5DHJA 4QTEA 3CBLA 3EJ1A 2IG7A 4PNIA 4Q2AA 1PMEA 4GS6A 4C4GA 4K9YA 4AW1A 2C3KA 2V0DA 5EYMA 3Q9WA 3IOPA 2JGZA 5K0KA 3Q4TA 3NYVA 4RRVA 3PA4A 4CQEA 2G1TA 4F63A 1Q8UA 3S4QA 4R78A 4KS7A 4J96A 4Y72A 4CD0A 1IA8A 3W55A 3QAME 4CTCA 4GU6A 4IX4A 5DVRA 4E4LA 4I5HA 2OW3A 3V5WA 2IZTA 4EH5A 4BKJA 3FC1X 3UVRA 3TUBA 3ELJA 5ETIA 5L2TA 2CKOA 3KXXA 4D2VA 4EOLA 4LV8A 1YXVA 3WIKA 3FBVA 4KKHA 4CMOA 3A8WA 4FGRA 4XLIA 2GHGA 4XUFA 4ZIMA 4E26A 4CCBA 5FG8A 3T3UA 3VN9A 2YJSA 2CNUA 4UY9A 4UZDA 4CV8A 1H25A 3SC1A 3ZLYA
chains in the Genus database with same CATH superfamily
3EYHA 4O6LA 4GYGA 4AS0A 5HO8A 4BHZA 2F49A 5M51A 2C5OA 1JOWB 5T6KA 4TYEA 3LIJA 3R7UA 1JSTA 2AC5A 5CT7A 5HEZA 4FIHA 4K18A 4U0IA 1SVEA 1VZOA 4YMJA 2QOFA 5FBOA 2UZUE 2OK1A 1WBOA 2WMUA 4I20A 4I6FA 4UMPA 5FEDA 2ERKA 3OXTA 3TCPA 1BMKA 1F5QA 4JNWA 4G3CA 4FV6A 2QLQA 3P08A 4KIQA 5JGAA 4NM3A 2XIYA 3VJOA 2QONA 3FWQA 3HV6A 2HW6A 2Y8OA 5LQFA 3FMHA 3VUKA 5M57A 3Q3BA 3REPA 3HV7A 4I6HA 4FMQA 5DN3A 2W1GA 4JMQA 3RZBA 2JAVA 2HW7A 1VYZA 3FPQA 4D1ZA 4DF3A 4M84A 4RJ8A 5BPYA 3VS6A 5KMOA 1JSVA 3DQWA 1ZOEA 4WBBB 4BGHA 3OCBA 3D15A 4A07A 3MFSA 4J7BA 1XH9A 3L9MA 5C8MA 3O51A 5E8ZA 4ZJJA 1H24A 4L6QA 4LFIA 3C5UA 1A9UA 3PE2A 4QMVA 5AA8A 4I21A 2HOGA 3MTLA 4IC7A 4NK9A 2R3OA 4O84A 2UZDA 2XUUA 3PXYA 4RIOA 4X2KA 2YERA 4JRNA 1ND4A 3ZSIA 3NLBA 5CAPA 2O5KA 4RGJA 3ORXA 4U9AA 2W05A 3NUYA 1FBNA 4PTEA 4XG9A 1FVVA 2J4ZA 2A1AB 4IW0A 5EHYA 3LCOA 1I09A 3ZLXA 3FMDA 1Q4LA 3A7JA 3OC1A 3C5IA 2WTWA 2ZB1A 5E1SA 4LUDA 2CCHA 1WBNA 3EQCA 3R21A 3PPJA 4IX3A 4YLJA 5CX9A 4ZS0A 2OXYA 1OITA 4YTFA 3DV3A 2ITWA 2X2LA 3JYAA 1R39A 2ITXA 2A2AA 3I60A 3UIMA 2I40A 4D4YA 3NW7A 4IFGA 2YM5A 2BKZA 4XV9A 3F5GA 5D7AA 4RPVA 4E7WA 1STCE 2BZIB 3HVCA 5M4CA 3I0OA 2PMIA 4I24A 3DA6A 4YZCA 2C0IA 5CT0A 4ZSGA 3SDJA 3SHEA 4H3BA 4C36A 1ZMWA 4G2FA 4MF1A 5JMSA 5BX0A 4I6BA 4RBLA 4C37A 4ZLZA 5HIEA 4QMWA 2BRBA 2P33A 4F1OA 2R3LA 2QO9A 3DAKA 4O0VA 1YHSA 2BFYA 5AP0A 4ZTQA 3IW7A 3C4WA 4JBPA 3BELA 2HK5A 2VWUA 3TNPC 2XJ1A 4Z7GA 3PIYA 5BVFA 2X6EA 5LVOA 1GIIA 2GTNA 4JX7A 3R7OA 4FA2A 4DGGA 5IMXA 2QVSE 3KU2A 3NPCA 2OWBA 4RFYA 5B7VA 1UWHA 2RFDA 3AC1A 5AP5A 3I0QA 3OXIA 5AR4A 1K9AA 2OF4A 1ZYSA 2IZSA 4ZMFA 5BUIA 1OUYA 3HMNA 3NR9A 2Z60A 4EL9A 3P86A 4BCKA 4EH4A 4HVSA 4R7BA 4HGSA 4TWPA 5HX8A 3SVVA 2PU8A 2GS7A 3PLAE 4E20A 2I0EA 2WAJA 4XG2A 2ITUA 4C3RA 2VO6A 3UODA 4QP8A 3UVQA 5E1EA 4E6CA 3FUPA 3DFAA 3OWKA 4IMYA 5FEQA 5AX9A 4M7IA 2GNGA 4QP2A 5GHVA 3S2PA 5KCVA 2C6EA 2VN9A 4UBAA 4USDA 2VD5A 4IFCA 3TZMA 4U6RA 4W4VA 3MIAA 2WELA 4JDKA 4RA4A 5J5TA 4OTHA 3TM0A 5EM7A 1ZARA 3F69A 4I5PA 2Z2WA 5CF5A 3CKWA 4E1ZA 3AGLA 5J95A 5IH6A 2RKUA 4EWQA 2XKDA 4QMOA 2VTSA 5H9BA 4KB8A 4BDAA 4TKSA 4HGTA 4ZTMA 3MIYA 1H1RA 4FKWA 5LWMA 2R3HA 3BKBA 2UW3A 4YSJA 5GJDA 4BTMA 3VW8A 2WMVA 1KV1A 3NGAA 4LL0A 1GY3A 3OCTA 4NM7A 3FKLA 4RVKA 3W8QA 3WOWA 3ATTA 2PZPA 3ZM9A 4DTAA 3GGFA 1Y8GA 1ZAOA 1NW1A 3F7WA 4FGBA 4O82A 5IEVA 1TVOA 4B6LA 5A6NA 4YPSA 4BJJB 4EJ7A 4RIWA 1YWRA 2WTKC 4ZTSA 1H1PA 3UOJA 1NY3A 4CG9A 5C4KA 4ZTRA 5LXMA 1UU8A 4O6EA 2BMCA 2VNYA 3GCSA 4FSNA 4XH6A 4F9CA 4RZWA 2V7OA 3JY0A 4O38A 3E62A 5EDPA 3QZIA 5FP5A 5HLPA 4EZ3A 1H0VA 2IW8A 3UMXA 1CM8A 2WMXA 3PJ2A 5CU3A 3EYGA 3R9HA 3MPTA 2PE1A 3R7IA 4FT7A 4ACDA 2FH9A 2UZLA 2ERZE 3VULA 3MVLA 2BFXA 5HG7A 3P9JA 3IG7A 3TI1A 1HCKA 5DWRA 3TNWA 3VRZA 5IPJA 4L3JA 1GAGA 3L9LA 4J98A 5DNRA 5EI2A 2IZRA 4MXCA 1CKIA 2I6LA 3QKKA 4FT9A 4YC6A 4BRXA 2JDRA 3EFLA 3LLAA 5EKOA 1WVWA 3FHIA 3HNGA 5JGBA 3NVMB 2XIZA 4FICA 2A4LA 2JKQA 3ORIA 4GT4A 5M53A 3BBTB 4Q9SA 5ACKA 4R5YA 3PSDA 3BYUA 3C4FA 4FTRA 4BI2A 3OBGA 4BGQA 4C3FA 4IQ6A 2VUWA 1G3NA 1XQZA 3Q4ZA 4NWMA 4XRLA 5EYKA 4OTGA 3TMOA 4MQ2A 1K2PA 3R9DA 2FO0A 2W4KA 3GBZA 4QMQA 3UP2A 3MI9A 2QQ7A 3W0SA 4FV1A 3N4VA 4F78A 1R1WA 3E88A 3OD6X 4BICA 1MRUA 4EHGA 3DXNA 3A60A 4Z55A 5ICPA 2H8HA 3QD2B 4BWKA 2C1AA 2VWXA 4EK6A 2OF2A 1YVJA 2WMSA 2WTCA 4DFLA 1UU3A 1XKKA 4M14A 2YIXA 3L9PA 4C4EA 3TV7A 5LMBA 4BFMA 2FSOX 5L8KA 5E90A 4DFXE 4LOQA 3RINA 4KAOA 3TKHA 2EB2A 5CI6A 4KSPA 2RSVA 1YKRA 4O7WA 4YP8A 5KBRA 4C3PA 5CSXA 4USFA 4K33A 1U54A 4U3YA 5CXHA 4NW5A 4AZEA 5JKGA 1S9IA 3Q60A 5DIAA 4EH2A 4FV0A 4IZYA 4RSSA 3D5UA 3WI6A 2EWAA 4I0TA 2C1BA 1AGWA 4A9TA 3DZOA 5J9YA 4FNWA 5DGZA 2PVFA 1BKXA 2PVHA 2VTAA 4IIRA 1KUTA 4JG8A 4HYHA 5TKDA 2XIRA 4D9TA 3DFCB 3IECA 4QMSA 1JKKA 3PXQA 3W0NA 3CSVA 3NNUA 4AZFA 3TWJA 3LJ2A 4IJ9A 4AZSA 4IVDA 4YJNA 4CRSA 4EWHA 3R7EA 2QG7A 5F94A 2R0IA 4IM0A 5FGKA 5JEBA 2AC3A 5HE3A 4PDYA 3EZRA 3L8XA 3R6XA 4ZOGA 5AP2A 3VO3A 2BAJA 2XJ0A 1W83A 4EBWA 3E64A 4AN3A 4J95A 2Y9QA 5CWZA 1ZZLA 4JI9A 4O2PA 4AN9A 4NKAA 5BV3A 2E9UA 3Q52A 3AKJA 4H36A 3LJ0A 5KZ0A 3RWPA 3P79A 3IDPA 4EOSA 4IACA 4YTCA 3GB2A 4IAYA 4EOPA 1MUOA 4AW5A 1OECA 2CCIA 4EEVA 4RWKA 2GNIA 5LWNA 4MXAA 4FZDB 5AAEA 2OLCA 4DH5A 2PVRA 2XCHA 4FL1A 3H30A 2PULA 4FTCA 3AC8A 4GFOA 4ASXA 3EZVA 3UVPA 3TTIA 3JXWA 5C27A 2OSCA 2R5TA 5M09A 4DT8A 2CGVA 4ZLYA 3SQQA 5AJQA 1UA2A 4L46A 2W1HA 4KRDA 4BDGA 4UXQA 4FV4A 2YAKA 2ZV2A 3AQVA 1RE8A 3PP1A 3QTQA 2RFEA 5JZJA 5L6PA 3LPBA 3SG9A 4IAIA 4DGOA 5A46A 3WZKA 2VTHA 1JKSA 5KMIA 3S95A 3CD8A 2CDZA 2R3FA 2WMAA 4BKZA 3OP5A 3PIZA 4BDFA 3GVUA 3UMWA 3ALNA 4C57A 4KWPA 3WYXA 4NJDA 3HMIA 3P0MA 3DU8A 5HBEA 3B8RA 3ZLSA 4Y5QA 1E1VA 5GIPE 4BVUA 4X2JA 5M44A 4WNMA 1FMOE 1BL7A 1PYXA 4DAWA 3PG3A 1T46A 2X0PA 3NEWA 4FI1A 2BUJA 3L8VA 2G2IA 4QMMA 1AD5A 3OW3A 3CD3A 5ANIA 4LGHA 3DBDA 2OJGA 4Y46A 2XP2A 3V04A 3IGGA 4JVGA 1H01A 3F61A 4D4SA 4NTSA 2VTIA 2VTMA 3GC7A 2XK8A 1OZ1A 2CHLA 5L2WA 4YHTA 2YCRA 2HZIA 3IOKA 3QQLA 5FLFA 4X3FB 2YEXA 3UGCA 1XH8A 2CKQA 3DT1A 4NM0A 2PE2A 2OH0E 4D0WA 2W1FA 3PXFA 4YHJA 2PSQA 3GOKA 4DYMA 2VTPA 2C3JA 3NRMA 5AUXA 2JIUA 4OTPA 4U5JA 5GJGA 4FL2A 4AUAA 1F3MC 4GW8A 2VRXA 4WT6A 4LL5A 3IKAA 5A3XA 1BI7A 4UZHA 2UZNA 5TR6A 1QL6A 2ITVA 5HD7A 3ROYA 4BCPA 2JBPA 3L1SA 3R02A 4ZEGA 4BDJA 4IB0A 2XNOA 3OTUA 3Q6UA 3BI6A 2IW6A 4L3LA 2QHNA 3DDQA 4QMTA 4HJOA 5IQFA 4RQKA 4V04A 3U9NA 2YM4A 4BB4A 4R6VA 4EKLA 4FSQA 3ZZWA 3MPMA 4F7JA 3D7TB 5IQIA 2JIVA 3U55A 3DBCA 3PXRA 3BWJA 5A14A 2HZ4A 3IW6A 4EQUA 5AFVA 3FQHA 4D2WA 4FG8A 4TYIA 4R7HA 4WD5A 4AWIA 3CLYA 4FKUA 4L68A 1F0QA 1H1WA 1ZWSA 5LOHA 4UWYA 2QO7A 2ITYA 3Q4CA 4UMQA 4BCOA 5AR2A 1YW2A 3MJ2A 3UZTA 1V1KA 3AGMA 2V5QA 4NCTC 2CKPA 5CALA 5JN2A 2AEGA 3W2SA 3DAEA 3PPKA 1KE5A 2UW8A 3TJCA 4CRLA 4NYEA 3SD0A 1YOJA 2QI8A 3ZS5A 4RQVA 5EQPA 4AXEA 3OEZA 1P4FA 4G9RA 3ZU7A 1OMWA 5EDQA 1GIJA 3OBJA 2B53A 3NIEA 5CF6A 2Z7QA 4JLCA 3CQEA 3K3IA 1PF8A 2I1MA 4CT2A 2YWPA 2YA9A 3ZSHA 4FTIA 4IZ5A 2J9MA 4IAKA 4OTFA 4DE4A 2QOKA 4H05A 1I44A 4FT3A 2W1CA 3PSBA 3ZXTA 4P5QA 2BVAA 4GCJA 3CPCA 2VU3A 3EFJA 2GDOA 5DOSA 4ZTLA 4BN1A 5C1QB 5HTIA 1CKJA 2VWWA 4YTHA 4WO5A 1H08A 2IEWA 5IQDA 2R7IA 4NM5A 4AXAA 4Q9ZA 2WMRA 4G5PA 5EH0A 4QP6A 2PUNA 1WBSA 4FYNA 4EK4A 2PZIA 2YCQA 1XBAA 3OROA 4CV9A 1BI8A 4AX8A 2XAOA 1EH4A 5KKRC 3QHRA 2ZMDA 3EN4A 1G5SA 2C6DA 3RK5A 3N4UA 1ZZ2A 3VQHA 3E92A 4O7ZA 1ST0A 3PRIA 3SXRA 3R8ZA 5B2MA 3OWJA 5T3QA 3E3PA 3DKGA 2WEVA 4O22A 2DYLA 2WD1A 4N70A 5EI8A 1LP4A 2ZJWA 4FTMA 2VWVA 2UVXA 2BRGA 1SYKA 3PJ8A 4ZMEA 5AADA 3DY7A 1YDRE 4JXFA 1ZMVA 5CU4A 1Q3WA 3EKKA 4CXAA 3BV2A 3W16A 3KY2A 4EC8A 5HORA 4R77A 1PXLA 2YITA 4QO9A 5DE2A 4ZXTA 5EQYA 4OT6A 3FLQA 3R1YA 2FSTX 5ACBC 3G9NA 4FX3A 2PE0A 4L44A 3V01A 4F0GA 1Q24A 1BX6A 3N9XA 2GSFA 2RL5A 4P5ZA 5LVMA 5K4JA 3HV5A 4ZSAA 4G16A 4A7CA 3ITZA 4QMXA 4C8BA 2OIQA 2Y6MA 1V0OA 5DR2A 5LJJA 4O7VA 4CKRA 5JH6A 1J7UA 4FTUA 2ONLA 2JKOA 4XV1A 1YXXA 1OM1A 3ZEWA 4CMUA 4L00A 3W33A 4O0XA 4QMNA 4J8NA 5JQ5A 3BHTA 4FK3A 4D2TA 2UZVA 3QALE 2XNPA 4K8AA 4HCVA 3ZXZA 3HRFA 3BWFA 3W1FA 3LMGA 4QDVA 3BE2A 4PX6A 3C4EA 2VWZA 2ITPA 3FAAA 5I3OA 3W2QA 5F9EA 2PMLX 3MFRA 3UQCA 4OTWA 2EVAA 5DA3A 4YJTA 2R3NA 3MPAA 5CLPA 2OICA 2J7TA 1DI8A 4EOOA 5KO1A 1JKTA 1YOLA 2BAKA 4EK8A 4CVAA 2C3LA 1REKA 3KRRA 3C0IA 5HI2A 4AE6A 2VTRA 3T8OA 4DTKA 4CG8A 3RP9A 3E7VA 3CTJA 4ORKA 2PZYA 4O0WA 3V5PA 5FP6A 1R0EA 3R7VA 3V3VA 2HELA 2WTDA 5HCYA 3F88A 3DLSA 4KBAA 5E8VA 5IQBA 3GU4A 3QD0A 2XBJA 2E2BA 5LVLA 2ESMA 4XJ0A 3I5ZA 4AW0A 3NNVA 3R9OA 3SRVB 5FD2A 1H0WA 3MB6A 4JS8A 2FYSA 2YACA 1SVGA 2XZSA 3QFVA 4DG3E 3D14A 4GEOA 3V6SA 3GC8A 3ID6C 4BTJA 2YM6A 3FMLA 5DG5A 2XKFA 1PMVA 5CZHA 2Y6OA 4UN0C 1ST4A 4FZAB 1JNKA 3KGAA 4YBKA 4JAJA 2I0VA 3V5JA 2C5NA 1Q61A 2AUHA 4F4PA 3Q96A 5K9IA 2YZLA 4OTIA 1XHAA 3CQWA 5KE0A 4TYHA 2GQRA 4RIYB 4X3FC 5KHWA 4G6LA 3RM7A 3AMBA 5IMEA 3POOA 2X7FA 4Y83A 2G2HA 2QU5A 3EQFA 4PWNA 4OAVB 4Z7HA 1M2PA 1P5EA 3OG7A 2XIKA 3KULB 3OVVA 4G5JA 2C0TA 3ZO1A 4ANMA 4R3PA 3WE8A 3OUKA 2V62A 4DEGA 4JR7A 4F08A 2I7QA 3A7FA 4OBQA 3G5DA 2LAVA 2I0YA 3BZ3A 2GCDA 4NJ3A 3UNJA 4GT3A 4V0GA 1JLUE 3ZO2A 3MH3A 2NPQA 4CZTA 2X7OA 3QTUA 1VEBA 4ZK5A 5L2IA 4O7YA 5LVNA 4BJJA 3JPVA 5KMLA 4IX5A 5IH5A 2WMWA 1HOWA 4FF8A 1WMKA 4EOJA 3E8NA 4GT5A 5E8XA 4HVDA 2XRWA 3V8TA 3F3ZA 3LHJA 3WYYA 1W98A 5BMMA 4YZNA 4D2RA 3Q6WA 4IB5A 3W0QA 4GIHA 3N4TA 1ATPE 4KBCA 3GFWA 1YDSE 3ORPA 3MGYA 4RFZA 5AP3A 4L7SA 1JQHA 3HV4A 2XK9A 3IPHA 2IVUA 4ASEA 1Q99A 3G9LX 3KF4A 4MWIA 4I92A 1VR2A 3NDMA 4P4CA 3BX5A 3W2CA 1W2DA 1TFFA 3GNIB 3ML1A 2BIKB 3R9RA 1PXIA 5M08A 4NW6A 2XEZA 3E5AA 2QLUA 3OTVA 2WTKB 2BHEA 3UPXA 3BCEA 3QUPA 4BYIA 4IEBA 4DEHA 1OPJA 3G0EA 4PNKA 1IASA 1ERKA 2IJMA 4JQEA 4JBQA 3RPVA 2B55A 4FSTA 3ZRKA 2FB8A 4HYSA 4PRJA 3AKKA 5CASA 4PL3A 4G6OA 3R04A 4KUJA 3WF9A 3NSZA 4IC8A 4DDGA 1OL1A 3A2CA 5CZIA 5FEEA 4QYYA 3WF5A 4E5WA 3DBFA 2B4SB 4NIFA 2Z7SA 2CKEA 2OZAB 3SGCA 1UVRA 4U97A 4ITJA 5IEYA 4QMLA 4RIXA 3D5XA 2CNQA 3HA6A 2G2FA 4RWIA 1J1BA 4ANSA 5BUJA 1FMKA 2VWYA 4HYIA 3U4WA 2X81A 5J1WA 1XH6A 5IQEA 4GFGA 4QYEA 4ANOA 2CLXA 4FOCA 3EIDA 4UMTA 2O2UA 3EQIA 4WOVA 1DS5A 3U87A 1FVRA 1CKPA 3T9IA 5DR9A 2PVKA 3C13A 4PY1A 1HCLA 2W96B 3DS6A 4D55A 2JFLA 2O63A 4RIWB 1ZYDA 3OMVA 4BBFA 4KA3A 4FZFB 1H1SA 4ZSLA 3FI2A 5ETFA 4BDDA 3IW5A 4YJPA 3PP0A 1QPDA 3HP5A 2R7BA 2JITA 3EQDA 2GS6A 3G6GA 1YXTA 3JUHA 4S34A 4IHPA 2WZJA 3EFWA 3KB7A 4H1MA 4MD7E 4PPCA 5J8IA 5LARA 3RVGA 3LKMA 3Q9YA 4BF2A 3V5QA 4D2PA 4OR5A 3U6IA 4DFBA 3G90X 3OY1A 5AUVA 4FEXA 1JAMA 1WAKA 4BIBA 4YJRA 5CY3A 2QHMA 3RK7A 5FTGA 5L2QA 2GNHA 5F1ZA 2KTYA 3BYOA 5C8NA 2XVDA 3LXPA 4L7FA 4EK5A 3QTXA 3NUUA 4KSQA 4FV8A 5I5ZA 4ZLOA 3W0OA 2C5YA 2OFUA 2UW4A 3E3BX 4ZP5A 5CEOA 2HIWA 4GUEA 4E4XA 1KE6A 4DHZA 3KN5A 1H28A 3VRYA 3VQUA 5IDNA 5EKNA 4AGCA 4TNBA 2Y7JA 2PTKA 2VX0A 5I0BA 4MCVA 1WCCA 4FUYA 2C6KA 1JBPE 2YIWA 5TT7A 3MESA 4F64A 2XB7A 4O0YA 5HVJA 4P7EA 2XJ2A 2FSMX 3P7CA 4ERKA 2EB3A 3A7IA 2BAQA 1W84A 4NKSA 2HZ0A 3D83A 3BQCA 3O23A 3P4KA 1PJKA 3NFGB 3QX4A 5FXQA 3QYZA 4EI4A 2C6IA 2WTVA 4FT5A 4YPDA 1X8BA 5DRBA 5ANDA 1TZDA 5JSMA 4GRBA 3AC2A 4WNPA 3TN8A 1YQJA 2HAKA 2UW7A 1SVHA 3D2IA 3HECA 4IXPA 1YI3A 3LFFA 4QTDA 4UYAA 2C5VA 5HOAA 4CQGA 5IQGA 4GVJA 3TZ7A 1PHKA 3FMMA 4J52A 4NZWB 2XAMA 3QTIA 5K5XA 2WQNA 5KUPA 1PXNA 4ZY4A 4QYHA 4CKJA 3BLAA 5M06A 4QMUA 4WUNA 2GHLA 2J0LA 2UUEA 4X3JA 3FXZA 3VUHA 5HVYA 5HU9A 4EOKA 4O86A 4QQJA 3UO6A 2C3IB 3DJ6A 1FQ1B 4CMTA 4C2WA 3TUCA 4K0YA 4RT7A 5HQ0A 3RPYA 1M7QA 3GQLA 3F5UA 3UIXA 4B0GA 4FSYA 3PJ3A 3PE1A 3ETAA 3IW8A 4K6ZA 4J97A 4CLIA 3CTHA 4EOQA 4ZZMA 3CQUA 5C4LA 1FGKA 3GCPA 3LFEA 3B2WA 4PF4A 4QT1A 3QRUA 4QQTA 2QOQA 4QP3A 2J90A 2GS2A 2J51A 4ASZA 4L42A 3QCQA 1OGUA 5KBQA 4GYIA 5BMSA 2VNWA 4MNEA 1B6CB 2ZOQA 4O4DA 3ORTA 4FKIA 4WG3A 4X0MA 1W8CA 4C4JA 5G1XA 3NS9A 2O8YA 3O8UA 3QTSA 5C9CA 3SXFA 1PXKA 4C0TA 3UYTA 4FIJA 2QOCA 5IQCA 4TPTA 5AX3A 3SXSA 1FGIA 3UNKA 2X2KA 2XCKA 2UV2A 4F1MA 4M69B 4ACGA 3LXKA 3QUDA 5CENA 4C34A 3ORMA 3P23A 4W4YA 3PSCA 4QMYA 2ITQA 4ARKA 3KVWA 5FXSA 3TL8A 2Z7RA 4JG7A 5DI1A 4IAFA 2WMTA 1AQ1A 2NRUA 3KXMA 4W4WA 4CLJA 3VS1A 3PY0A 3ERKA 4NUSA 4ZTHA 3VS2A 2A19B 4XG3A 4EH9A 2Y0AA 2ZB0A 3E7OA 4IANA 4QRCA 4QMZA 5CVHA 1XH7A 1WBTA 1M2QA 4EKKA 2IWIA 3SAYA 5GNKA 2OZOA 4OTDA 1QPEA 5AIKA 3FC2A 4EUTA 1TQIA 4F9YA 1YOMA 2QOLA 5GJFA 1E9HA 3KMWA 3POZA 5DT3A 3C7QA 3KRXA 3LMHA 4S32A 1E1XA 3VC4A 5M07A 2J6MA 3E8EA 3DK7A 4AA4A 3TT0A 2VTTA 1QPCA 2UW9A 3FHRA 3TYKA 3VW6A 3FY0A 2PVMA 2P4IA 4PTGA 3RCJA 5A9UA 4XLVA 5D12A 4RVLA 5A4CA 3TJDA 1KE8A 4EOMA 2YDKA 4APPA 5I9VA 3LFBA 4JAIA 4WSQA 2ZM1A 2W7XA 3ORLA 5L8JA 4AU8A 2R64A 4BDEA 1PXPA 3EOCA 2R3JA 3MFTA 5KMKA 2R2PA 3QC4A 4FSZA 4RJ7A 4E5AX 4LRJA 4YR8A 4IZ7A 2F2CB 4QTAA 1QPJA 4FVQA 1Z57A 1FOTA 4FT0A 1U4DA 4XG7A 4APCA 2ACXA 4AW2A 5M56A 3SW7A 3LM0A 5FUTA 4ITHA 3TKUA 3I7BA 2XK6A 3DKOA 4BCMA 5B0XA 2H34A 4PMTA 1XH4A 3KMMA 4CFFA 3HDNA 1B39A 1LPUA 3MA3A 3ZO4A 3KA0A 3DTWA 4PMSA 4CKIA 3KREA 4WHZA 2B9HA 2E9PA 5HE1A 5GZ8A 5HLWA 2HZNA 3BLQA 3AD6A 3VUTA 4R1VA 4YJSA 2PPQA 5IQHA 3THBA 3MFUA 5AA9A 3VUDA 2BRNA 4BDCA 1ZYLA 4XCUA 3WE4A 4MXZA 3D2KA 4U81A 1Q97A 3TXOA 2XNBA 3QCYA 4G3EA 1OB3A 2PWLA 4I4EA 4GSBA 4I5CA 3DK6A 1H1QA 1Y6BA 1L8TA 2ZM3A 4C35A 4YURA 4RLKA 5CEKA 4CYJA 1W7HA 4WUAA 3IDBA 4DGLC 2XYUA 2VO3A 2X9FA 4FKSA 1O9UA 3F6XA 2G01A 2GNFA 4KINA 1YI4A 4G6NA 3G0FA 1RW8A 2VGOA 4JBVA 4L53A 4FKQA 2YJRA 4TY1A 4ZSJA 5AV0A 5IEXA 4DN5A 3KXGA 3TZ8A 1CDKA 4FIIA 4IH8A 4R7IA 5EM5A 4ZAUA 5KKRB 5L3AA 3C50A 3L8PA 1Q8YA 2C6LA 4JQ7A 4C4IA 3VVHA 4ITIA 2GHMA 3S0OA 5HE0A 2DS1A 4DCAA 4JOAA 5J1VA 4ANQA 4PMPA 3DDPA 5BVWA 4D9UA 4G1WA 3TNQB 4D28A 2GQSA 2EU9A 4O0UA 4FKRA 4PDPA 4ANBA 4IVAA 1GZNA 3DBQA 5BQ0A 2R3MA 2HY0A 5HICA 4GKIA 4NFMA 4RVTA 3H10A 3KRJA 2PL0A 3EL7A 4ZS4A 4JX3A 4AOTA 5JFSA 2R3QA 4D1SA 1ZXEA 3WBLA 5I9YA 4D4VA 2UVYA 5I9ZA 3DB6A 1NA7A 4MVFA 3FXXA 3HMPA 3FZPA 4IDTA 4NU1A 2OXXA 1M14A 2QR7A 3C9WA 3MVHA 3W0PA 3F3VA 5GIOE 2YCSA 3ZBXA 3DCVA 1OUKA 5EHOA 2A27A 5DLSA 4J8MA 3P5JC 4LMNA 2CMWA 3IS5A 4F0FA 1J7LA 4V01A 4OAUC 4DBNA 3RPSA 3UZRA 4YZDA 1ZOHA 5H8BA 3BGQA 3RM6A 1QMZA 3VS4A 4BWPA 3O5AA 4FV7A 5M4UA 2JKMA 4QPMA 3O96A 3EMGA 4QPSA 3KN6A 2Q0NA 4UWBA 3L8SA 2WMQA 4YNEA 4B7TA 3EQHA 5EYCA 5D1JA 2YDJA 5I9UA 3LMIA 2E9OA 3ENMA 4O81A 4NTTA 4BI1A 4XBUA 3AD5A 2ZVAA 3R71A 4YZ9A 2BIYA 3R22A 4KIPA 2XRUA 3A61A 5ANJA 5HNIX 4I6QA 2PZ5A 5E7RA 5JK3A 3R2YA 4BZOA 3ROCA 3VIDA 2GPHA 3AMYA 3Q53A 3U6JA 3W2OA 4K11A 3HL7A 3CIKA 3EN9A 1M2RA 3BU6A 3UP7A 4MF0A 4ACCA 2OJ9A 3QTZA 5HG9A 3I1AA 3MA6A 5BVKA 4HOKA 5IA1A 2CPKE 4GIIA 4JDHA 3QA8A 3R8UA 4LGGA 3PWYA 3R7YA 5F20A 3LW0A 1PMUA 4ID7A 4TNDA 4Y85A 1A48A 2X39A 3KXZA 2LGCA 4UB7A 4A4OA 4FR4A 3MY0A 4DEIA 4HCUA 2C6OA 3ZRLA 4CFMA 3UDZA 5AMNA 4GU9A 3FL5A 2VO7A 3HAMA 3UO4A 4ERWA 4EZ5A 5JFWA 3DZQA 4O0SA 4EBVA 3ACJA 4I94A 4X2GA 4G34A 3KL8A 3QLGA 4WSYA 5I9XA 4C33A 2J2IB 4DITA 3Q9XA