5BUIA

Erk2 complexed with 2-pyridiyl tetrahydroazaindazole
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
338
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5buiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5buiA01
3D5XA 3CSVA 5E8SA 4DFLA 4MD7E 3GU7A 4EYMA 4PPBA 2UZDA 1IRKA 4UXLA 3R63A 3QRUA 4IWOA 2QR8A 3QQJA 3PJ8A 4W9XA 3NGAA 4FF8A 3UNKA 3DGKA 2H8HA 1RE8A 5TR6A 4H3BA 5LVLA 2YJRA 5DA3A 4C4JA 4KS8A 2C69A 2UVXA 3V8SA 1YHVA 2W1DA 5CZHA 4XG2A 3TJCA 3K5UA 4YJTA 3C7QA 4XMOA 2W5AA 3U54A 4CT1A 3G51A 2W1ZA 4BHZA 4N0SA 1AGWA 3HMMA 1YI3A 3C13A 4V04A 3Q96A 4RQVA 2J2IB 3NPCA 2HXLA 4DEIA 3EQDA 1P5EA 2C3LA 1F5QA 2A0CX 4XV9A 1M2QA 4D0XA 2REIA 3L9NA 2V62A 5J79A 4TYHA 2WMXA 4EH9A 4WRSA 1KE5A 4N6YA 3Q9WA 2ETMA 3COMA 4OBPA 4PMTA 1Y6AA 2ITQA 2PHKA 3HV7A 4RJ8A 3PPJA 4YSJA 3L8XA 2YDKA 3KRRA 1MQ4A 2JKOA 2YACA 2C6DA 1SM2A 2BROA 2WHBA 3QAME 3SXSA 3A62A 1Q24A 4O27B 3AT3A 4BDGA 3GCVA 4IACA 2XJ2A 1IG1A 5IISA 4DLJA 1H1RA 3W33A 4EL9A 2KTYA 4NUSA 4EOMA 2VTQA 3E3PA 4HYIA 4AU8A 5C1QB 1VYZA 4IMYA 2WIPA 2ZVAA 4O82A 4O1PA 4AGDA 3S0OA 4NFMA 1OKYA 2ZDUA 4I23A 4QTCA 3MTFA 4M7IA 4FIGA 4BN1A 3C4XA 3MFTA 4WNMA 1U5QA 4FKPA 2YITA 3RBWA 3I60A 4O96A 1ZMUA 5M44A 1OL5A 4P90A 3W55A 3G9LX 4JRNA 4AA4A 4TTHB 3VC4A 4USFA 3MV5A 1URCA 2JBOA 1JPAA 4IAZA 4J96A 3RK7A 2J6MA 4B6LA 4F6UA 5AUTA 3GOPA 3WIKA 5CENA 2VO3A 3ATTA 4BCNA 4RIWB 1W83A 3QTQA 4FT9A 2BMCA 3I6WA 5ANJA 4U40A 5A3XA 1EH4A 4HYSA 4D2SA 3BI6A 3DBEA 3QD0A 4L7SA 2A2AA 1XH6A 3QZGA 4NFNA 4RSSA 5LMAA 4F99A 3F3VA 3POOA 5HD4A 4CZUA 4L9IA 4NU1A 2R3PA 5EI6A 3CQEA 2OJGA 5EW8A 3PZEA 2PWLA 1VJYA 4YTCA 1ZZLA 3ZO3A 3A7JA 5HQ0A 5HKMA 3PDTA 3NIZA 2W5BA 4FV5A 4UMRA 4LOPA 4KIKA 4P5ZA 5IQDA 4KKEA 4CFMA 4KD1A 4H1JA 4B7TA 3V3VA 2YWVA 4LGHA 5EW3A 3R21A 4O7SA 4IX4A 2PULA 3CBLA 2J9MA 3EN5A 3BZ3A 3U55A 5D41A 5B7VA 4QRCA 5ITAA 1XH5A 3R02A 3KREA 4QP8A 4IQ6A 3IO7A 4K0YA 3RI1A 1PMUA 3DK7A 3NNXA 3NW7A 4YSMA 2XM8A 5CLPA 5CTPA 4YJSA 2GDOA 3ZFYA 2V22A 3PG1A 4EOLA 4QMVA 4G6OA 4CEGA 1PYXA 3FMJA 4BBFA 1H1QA 3UOLA 4W4VA 3UPZA 3QUPA 3QQLA 2W1HA 4GJ3A 3D5WA 3IW8A 4IJPA 4QYFA 3VUIA 3Q32A 5BPYA 3BBWA 5LVNA 2C30A 2OG8A 3PJ3A 1CM8A 4FOBA 4IBMA 4QTBA 5DIAA 3TNIA 2J7TA 2GFCA 5L6OA 1V0PA 5JFSA 2XK7A 4QQ5A 1ZOHA 2Y0AA 3LLAA 4WSQA 4HGLA 4IVAA 4PP7A 1CTPE 1YOLA 3BEAA 4FE2A 4K8AA 3V5WA 3AMYA 5FWKK 2ZYBA 5DR6A 4ZSJA 5IEXA 4I6FA 3A4OX 3AGMA 3UJGA 2ZB0A 1PXNA 3KRJA 4M12A 3VUHA 3FMEA 3DOGA 2XIKA 2XKEA 3NAYA 3MWUA 4RBLA 4S30A 5HG9A 3RP9A 3FMDA 3WZEA 4IADA 3EQCA 5CT0A 4FC0A 3MH2A 4BCMA 3VBYA 3ATSA 3FLYA 4L68A 5HE3A 4L46A 2IVVA 3A60A 5AR3A 5BVWA 3C0GA 3I0OA 4R78A 3UZPA 2YIRA 3ZXZA 3HMIA 4BTJA 4DEDA 5LVOA 4PTEA 2OXXA 3QUEA 4BCJA 4JS8A 4WD5A 1B39A 1Q4LA 3OP5A 4FL3A 4YNOA 2FSTX 2PVJA 2WMRA 5IA2A 1JAMA 2A4LA 3AC5A 4I21A 3Q9ZA 3AD6A 3PJ2A 3AXWA 2EXMA 1AD5A 2XCKA 2ITTA 3MJ1A 5EYDA 4O0XA 2CCHA 3LFSA 5HO7A 5GINE 2JDOA 5CNOA 4AZSA 3QRJA 5GJGA 1DS5A 3NZ0A 3UVRA 2X4ZA 4C4GA 3MGYA 1UU7A 2FO0A 2HWOA 3GVUA 4FL2A 5HGIA 5AA9A 3JR1A 4CNHA 2WQOA 4FKJA 4FSYA 5K4JA 3MY0A 3S00A 3NW6A 5JGBA 2W7XA 2C6LA 3PXFA 2G2FA 3UIXA 3EIDA 3CKWA 3PXZA 4MK0A 5EK7A 2P2IA 3EL8A 5FG8A 2XIXA 3TN8A 2B9IA 3BRBA 4RMZA 3TV6A 4A9UA 4EH8A 1NXKA 4NWMA 4F0IA 4EHEA 5HTCA 5AA8A 3MA6A 4EJ7A 4TZRA 4MVFA 5I9UA 5M06A 1VYWA 2P2HA 3EOCA 4ZOGA 2PPQA 4NIFB 4PY1A 3FXXA 3QBNA 5AP6A 4GKIA 2C5OA 2UZTA 4ASEA 4AS0A 1ZYJA 1UU3A 4DGLC 5HLPA 2XNEA 4ERWA 2KULA 4WSYA 5GNKA 3KXGA 3ET7A 3L9PA 2R0IA 2R2PA 3WF6A 3OVVA 3PXRA 3R9DA 5AEPA 4FIHA 4W9WA 2E9NA 3FI2A 3R8PA 1DAYA 1YDTE 2BAJA 3UODA 4KINA 3T9TA 3H0YA 4EJNA 3FY2A 5G6VA 3ZONA 5A4LA 5IDPA 3C50A 2YWPA 3BHUA 4S2ZA 2XUUA 4U81A 1NY3A 3LFBA 4B99A 3R7UA 5CXHA 3NMUF 3R7EA 3DA6A 3H9OA 5L8KA 4CQEA 2O8YA 3KF7A 3CS9A 4MD8E 4N4SA 3RMFA 4JBVA 5M4FA 1M52A 3UMWA 4NCTA 4FT0A 3MPAA 2G2IA 5KKRC 3V01A 2R5TA 2VTMA 4BCFA 5KZ0A 4MBJA 5HCYA 1SVHA 4KIOA 4UMQA 1OIUA 3TT0A 5K5NA 4X3JA 2R3HA 3R83A 4CMTA 2VV9A 3IONA 3H9FA 2H9VA 3SRVA 4EK6A 5HORA 1UNLA 2UZUE 3MFUA 2QURA 1WBNA 3QHRA 3TDWA 2EB2A 3FSKA 2QVSE 3VS5A 4F4PA 5J9YA 5CQUA 3AC8A 3KGAA 3GCQA 4OAUC 3TNHA 4LRKA 2I0VA 4O6EA 4F7JA 1OIYA 3NAXA 5C01A 3DZOA 5B2LA 3C51A 2YZAA 3LXKA 2CLQA 4KS7A 4XNEA 3EQIA 2FSLX 3QGWA 1Q8YA 1VR2A 3RPYA 3MPTA 3DPKA 3PIZA 4B8MA 2YERA 3ZTXA 3KN6A 3FI8A 2NPQA 2Q0BA 4JL9A 2WTCA 4HVDA 2OU7A 4G2FA 3OEFX 1BKXA 1PY5A 2J5FA 3W2OA 3MY5A 2ETKA 4BDBA 4A9RA 4U44A 5CSPA 4HPUE 4ONAA 3LOKA 2UW3A 3MI9A 4IAKA 4EH4A 3BYVA 4FR4A 2ITYA 4BDJA 1OBGA 4FV9A 4FKQA 3RZFA 4B9DA 4NM7A 5CVGA 3GNIB 4FNZA 2P33A 4A9SA 3EN9A 5C8KA 4BRXA 2ETRA 5K9IA 4XUFA 2OFVA 3VBWA 1YRPA 1YI4A 5CU3A 4YR8A 4QMMA 4NYEA 2BHHA 4DF3A 2BDFA 3E7OA 4FZDB 2J51A 4FEXA 3QD4A 1WAKA 2VAGA 1LP4A 4MBIA 3C4CA 4QP6A 1RJBA 3GU8A 4MD9E 3ULZA 5CEPA 3TUBA 1A9UA 1L8TA 4O1OA 1OITA 4F65A 2BDWA 4I92A 1GZNA 1OM1A 3VUMA 4CMUA 4FUYA 3LAUA 2V7AA 2BAKA 3TTJA 4C33A 2UW8A 2WTIA 4AZVA 3N4TA 2Y6MA 2OO8X 4JIKA 2IZTA 2FYSA 2ZM4A 3GP0A 2F7EE 4PL5A 3UIUA 4AZEA 2QHNA 4BIEA 2W9FB 2XNPA 3L8SA 5KMOA 2OK1A 4FSNA 3D5VA 4QMPA 3RM6A 5FBOA 4F9AA 2C5YA 2HOGA 3L9LA 3O7LD 4XJ0A 4EK5A 1W8CA 4UMUA 3OCBA 3FYKX 4JI9A 4PQNA 5E7RA 3P79A 3F3ZA 1PXPA 3NCGA 4L44A 4XOZA 5DI1A 5ANDA 3Q5ZA 3UNZA 2QNJA 3UP7A 4WRGA 2UW5A 2JKQA 3C4WA 2G2HA 3KKVA 4RVLA 3LLTA 4H58A 5CAVA 4GRBA 5DWRA 4BWKA 4DFXE 4ALUA 4O7NA 4FX3A 4RA5A 4JG6A 4L42A 3EN4A 2R3RA 5L8JA 4D1XA 3HP5A 5HG5A 3NYOA 2BAQA 4I0TA 5A14A 5FUTA 2Y4IB 3QTIA 3DTWA 2QOOA 4QMWA 2WMUA 4LUDA 4AFJA 1YHSA 1FPUA 4PMPA 5GHVA 5KBQA 4ACHA 5EKOA 4V0GA 3HRCA 4E7WA 1JNKA 1T46A 1XJDA 3WF8A 2QOKA 2WIHA 3E5AA 3OWJA 3NUAA 2BRHA 2J4ZA 2PK9A 3O2MA 4TN6A 5FM3A 3TKHA 4UEUA 3LCDA 1GIJA 5CSVA 5AP5A 3ZU7A 5LCKA 4EOQA 2ZOQA 5BVDA 3EH9A 3VS1A 2XF0A 2ITXA 1TQPA 3OCTA 3TUDA 5IZFA 2GNIA 5DN3A 4EHZA 2QKWB 1WVWA 4PWNA 1XQZA 4UWYA 3TTIA 5FTGA 4S31A 4DN5A 2GQSA 3COKA 2QODA 1UWHA 5A4QA 3HL7A 2ITPA 2B7AA 2OICA 5FDXA 1V0OA 1ZMWA 4ERKA 3OXIA 5CEIA 2E9OA 4I20A 1H28A 2BRMA 2XBAA 4U9AA 4M0YA 5IA0A 4MXZA 4GU6A 1Z57A 5DFPA 3N4UA 2PZPA 5CU6A 3UO4A 3ZYAA 2DUVA 4RVTA 3SXFA 1PW2A 5CXZA 4JX3A 4YNEA 3G6GA 3EFJA 3UC3A 3EQRA 4RC2A 4BCHA 1JWHA 2BCJA 4N6ZA 3D4QA 3KVXA 3UQFA 2UW4A 4CLIA 4FTIA 4EH6A 1BL7A 1CKIA 5H8GA 1YXTA 3IG7A 5IQCA 4MAOA 4IDVA 5CVHA 1OKWA 3R1QA 5L3AA 3EQGA 2XVDA 3KRLA 1OUKA 3RKBA 4XBRA 3T8OA 4JR7A 3O8UA 4FKLA 3UDBA 2PE1A 3D2KA 1XH7A 3EHAA 4BDEA 2XEZA 3MBLA 4H3QA 4GT4A 4AX8A 4Y85A 4U42A 5CAOA 2XJ1A 1Q5KA 3E8EA 3FMHA 2CJMA 4UZDA 4YHFA 4BDIA 3P1AA 4QO9A 3F9NA 3PA3A 2FH9A 3HV4A 4FKGA 4IX5A 1W7HA 4E4XA 4TT7A 2JD5A 3DJ5A 4NH1A 4OBQA 5EM8A 5HOAA 4D4RA 5M08A 4C37A 3MFSA 2R3OA 3ORKA 3BQCA 2JC6A 4YPSA 2EWAA 3BKBA 2V0DA 2XK4A 3P7CA 5B2MA 3QX4A 3OWLA 5I4NA 4FSMA 3CP9A 4ANSA 4IWQA 4AXAA 3R7GA 3QD3A 4OUCA 2ZDTA 3DZQA 4U45A 1Q99A 3DK6A 4CT2A 4DHFA 3ORTA 3IKAA 1XBAA 5AUWA 4AW1A 5CU0A 4KKGA 4QOXA 4UN0C 1WVYA 2CPKE 1H0VA 3TWJA 1G3NA 2F4JA 2CHLA 4ZK5A 4QQTA 1O9UA 1R0EA 3KK9A 3R9OA 1R0PA 3RINA 4NSTA 2ONLA 5HBHA 1ZYLA 4RIXB 4HJOA 4WBBB 5AV2A 2BUJA 3M42A 3QQKA 4FSTA 4ZEGA 5HTBA 3JVRA 2XK3A 3GI3A 1JSVA 1M2RA 2B9FA 4YZCA 4BWPA 4MNEB 4N70A 4FKIA 3LZBA 1REKA 2FGIA 3LCSA 2JEDA 3DB6A 1ZOGA 1PXKA 2CCIA 2AUHA 2HAKA 3FKLA 4J98A 4DTBA 1M17A 1Q8UA 3QUDA 3R9HA 1KOAA 3LPBA 4RFMA 5IF1A 5IEYA 1JBPE 4RFYA 4CGAA 1M14A 5CI6A 3BCEA 3Q9YA 4C35A 5E9EA 1ZXEA 2PMNX 4X3FA 3RVGA 5DT3A 2UZLA 2WOUA 5BX0A 2QOLA 2PVNA 4GIHA 5AP3A 1RQQA 4IHPA 3D14A 4HNIA 4GFMA 3W8QA 5BUIA 3S95A 2PUPA 4YZDA 3QFVA 3QYWA 2QOCA 2YM7A 3N51A 2YABA 4HPTE 3E8CA 1ZYSA 4MX9A 1J7LA 5C8NA 4JR3A 2OSCA 1H1WA 4GFOA 5A46A 4E6AA 1MRYA 3EB0A 4XV3A 1MP8A 3QU0A 4EK3A 4LUEA 3BELA 2OJFE 1BI8A 2PVLA 2UVZA 2DYLA 2YDIA 1GIIA 2B53A 4HVGA 3DY7A 4APPA 3NEWA 4IZ7A 1ZY4A 2VX3A 3ORLA 3U8WA 2WZJA 4X6RA 4GV1A 1QPCA 3HDNA 4ALVA 3AOXA 3DFCB 1XO2B 1F3MC 3MIAA 5DPVA 5I5ZA 5FXQA 2BVAA 3OT3A 4L3LA 4FSQA 4PX6A 4F7LA 3BHTA 4U79A 1V0BA 2ZMCA 3LFEA 4PTGA 5DVRA 1PRYA 3MN3A 4IVCA 1UV5A 4GT3A 3HNGA 3WE4A 4ACCA 2BHEA 1J3HA 2Z60A 3CQUA 2XRWA 4X2KA 3R8VA 4O81A 1FBNA 4EHVA 2GS7A 4WKQA 2WU6A 2RG6A 3HX4A 2V5QA 2X7FA 3N9XA 4J95A 5B0XA 4BCOA 3CY2A 3JYAA 1FVVA 5EKNA 2CGVA 3P78A 2PZ5A 2R3MA 2FB8A 3EN6A 3TV4A 3M1SA 5M4IA 1G8SA 3RM7A 3Q2JA 3BE2A 3D0EA 3BHVA 4HCVA 3FL5A 5AFVA 2IW6A 3GU6A 3NSZA 4X2JA 3RAHA 4EWHA 4EYJA 2CDZA 2WEIA 1Z5MA 2W05A 2R7IA 4DG3E 3B8RA 5FEEA 4K77A 2UV2A 3C0HA 4CZTA 4E6QA 3R1YA 2OXDA 4FK6A 5JZJA 4J8NA 4XYFA 5HESA 4DFYA 1ND4A 3LJ1A 2WO6A 4RVMA 4KB8A 3OMVA 4E73A 4GCJA 2XK8A 4J8MA 5AUVA 3VUGA 4GK3A 1WCCA 4FEQA 3C4ZA 4CRSA 4DFUA 3KF4A 2VTAA 2JKMA 5AIKA 3QZIA 3W2PA 3JPVA 4YC8A 4D2RA 1QCFA 3IDPA 5FM2A 5H3QA 4YU2A 3EQPA 4H36A 5JH6A 4FTNA 4ASZA 1KE6A 5K0XA 1Q8TA 4PP9A 2WMSA 1ZZ2A 2WB8A 5J7BA 4TWOA 3RPVA 1A48A 3BPRA 4O21A 4CMOA 4UZHA 2W1IA 3NR9A 1U59A 2PVYA 4PTCA 2H96A 3PA4A 2X6DA 3OC1A 3RTPA 4IB0A 5HBEA 3FI4A 5L8LA 3PJ1A 2CN5A 3ZO1A 3ZSIA 4DCEA 4KAOA 4YC3A 4Y46A 2O5KA 1I09A 2QCSA 4BICA 2UZVA 3DDPA 5A4CA 2ZAZA 3EN7A 3F5PA 3GEQA 3R7IA 1PXLA 4O2PA 4AF3A 3O0GA 4FICA 2RG5A 2X6EA 4YJNA 3UYSA 4ANLA 5AUXA 4FYOA 4ZLZA 5L2TA 4XG8A 4Y5QA 2ZB1A 1M2PA 3QTSA 2ESMA 4GL9A 1J91A 4Y5HA 5J87A 5IDNA 2CKOA 2W9ZB 2G01A 4TWPA 5EOBA 3SLSA 3DXQA 2UVYA 1R78A 4D5KA 1UKHA 2OKRA 2GHGA 2B9HA 2HY81 3VUTA 3OCGA 2XYNA 3IPHA 4FODA 2C1AA 4MWIA 2X7GA 2PZIA 3FAAA 5DH3A 1KUTA 2Z7LA 4HGSA 4U7ZA 2FVDA 1OI9A 1O6YA 1A06A 2RFEA 2XS0A 3S3IA 4C2VA 4E26A 2I0YA 4BTKA 4XH6A 4G3FA 2YZLA 3OWPA 4WG5A 3HRBA 4RJ6A 2BZIB 5DT4A 4G5PA 2X8IA 3R71A 4ZTNA 4JQ7A 2R3JA 3SAYA 4I5MA 2C6MA 4QYGA 4Y95A 4C36A 4NL0A 3BV3A 3FSFA 3I1AA 2BALA 4NW6A 5IKWA 2C5XA 3ZRMA 3VBVA 4YO4A 2CNQA 1FMKA 3ENHA 3TNWA 1YVJA 4D55A 4FTQA 3L8VA 4RPVA 2XBJA 3ORIA 5T3QA 4BIBA 2HWPA 4MTAA 2WTWA 4OTGA 4L6QA 2UW7A 4WG3A 4C62A 4HYUA 4OAVB 4RQKA 3TNPC 5ANEA 5TT7A 5AV4A 3LQ3A 3NIEA 1SZMA 2P55A 3K5VA 3VF9A 3CJGA 5E1SA 4HVHA 3M11A 4PRJA 3O17A 5KZIA 2UZNA 4C02A 4DH1A 3PIYA 1PKDA 4IAFA 4LV8A 1IAHA 4UV0A 2BIKB 4QP4A 4ZTLA 1E9HA 4X0MA 5M4CA 2C3JA 4RZVA 2ZM3A 2BDJA 5CZIA 2BZHB 3DBCA 5CF4A 4NTSA 1OZ1A 3FLZA 3P7BA 5LWNA 4FEWA 2YIQA 2QOFA 3COHA 4MEDA 4RZWA 4WUNA 4ITJA 4F9CA 1U4DA 5I0BA 5CEKA 2VWXA 5BVKA 4D1SA 5A4TA 5C4KA 1PKGA 5HVKA 2X8DA 4EBVA 2YCFA 3KXHA 4IM0A 4CKJA 3K3IA 3KK8A 5CAPA 4IX6A 4MXYA 2X2MA 4FT7A 2OF2A 4FKTA 4JRVA 4R3CA 3FZPA 2PYWA 4EWQA 1B38A 1QPEA 4U97A 4O0TA 3QC9A 4RFZA 3TXOA 3RPOA 3ELJA 4LV5A 2HELA 5LXMA 4C0TA 2RKUA 5EM5A 1UNHA 3S4QA 1BL6A 1OL1A 4A4XA 4OTDA 2WQMA 2LAVA 3VRYA 3REPA 4JT3A 3TZ7A 1SNXA 3RJCA 4AW5A 2X9FA 4WNOA 3PUPA 2XM9A 1JKTA 5CS6A 5HVYA 4O84A 2OW3A 2FUMA 3QGYA 4M8TA 2PMIA 4K6ZA 4OTWA 1CDKA 2XNOA 4H1MA 4RWLA 3U9CA 3E92A 3KN5A 4CFNA 2H6DA 3R30A 5AR5A 1OKVA 3O8PA 3R01A 3EKKA 4IVBA 4K1BA 5E8TA 3AGLA 4GKHA 3OROA 3WZKA 3TZ9A 2C3IB 2ONLC 2WTVA 5J9ZA 4O0UA 4E4LA 2WD1A 2ITNA 4I22A 4E6DA 2QHMA 5HLNA 3OTVA 4LMUA 5EI8A 4FIIA 3Q4UA 5DLSA 4OLIA 1YQJA 2VTTA 3KY2A 4G6NA 3BYSA 1MQBA 3QCQA 5GJDA 4CKRA 1P4OA 2X39A 4L52A 3HECA 4LQMA 4XLVA 3D7TA 3QXOA 3MVMA 4DC2A 4ZSAA 4GG5A 4IAAA 2OZOA 5D9HA 3UG2A 2O64A 3ALOA 5D10A 2IVUA 2WGJA 3G6HA 4WOVA 4GYGA 4GG7A 4X3FC 3UVQA 3EFWA 3UP2A 4BI0A 3HVCA 2XNNA 3D83A 1RW8A 2BTSA 3KVWA 3LIJA 4FL1A 2R3QA 2VTNA 2PVRA 1ZLTA 3O71A 4OT6A 3BWFA 5L2QA 2NO3A 4YZ9A 3ZXTA 2NRUA 2VO7A 2OJJA 2ZV8A 3R73A 3THBA 4M69A 5M53A 3G90X 4QMLA 2WTKB 2QOIA 3LJ2A 3C9WA 3G33A 4F09A 5AUUA 4ASXA 5ANGA 1YKRA 3C5UA 3CJFA 2UW9A 1R39A 4XCUA 4BTMA 5BUJA 2XZSA 3VQUA 2ERKA 3HEGA 2R3IA 2Z2WA 5AR2A 2J0KA 4RJ7A 3OG7A 4A4OA 5TOZA 4EOSA 2R9SA 2PE0A 3ANRA 4EHGA 3DCVA 4AW2A 3HV5A 2QLQA 3D2IA 3H0ZA 4DEHA 5CEOA 3MSSA 3Q6UA 5KMLA 3Q5IA 2IW8A 4H05A 2HW7A 4QPSA 3ODZX 4S33A 3OXTA 5HD7A 2WNTA 4BKYA 4HVSA 2XCHA 4OTRA 3VJNA 2C0TA 4GW8A 4JX7A 4GMYA 5I9ZA 3BYMA 5JFVA 3TDVA 3GBZA 1JVPP 3ANQA 4CLJA 5AR7A 4NW5A 4JG8A 5HI2A 3RAWA 3FJQE 4D28A 4U3ZA 3RPRA 5D12A 3LFAA 4O6LA 1QMZA 4BI2A 3R0TA 3FE3A 4FKSA 3ZC5A 3OCSA 4C7TA 4IAIA 1UU9A 4O0RA 4P4CA 4AA0A 4G9CA 5JZNA 3ZLXA 4XS2A 3NUYA 3ZM9A 4G3DA 4HW7A 3QRTA 3GB2A 1YDRE 4ASDA 2X81A 2YCQA 4JDHA 3CGOA 3PRFA 5HE0A 1H08A 1UA2A 3MYGA 1YXSA 3KFAA 3ERKA 1KE9A 3AMAA 4R3RA 5FP5A 4MXCA 3H4JA 1XH4A 1FVTA 4CRLA 2WELA 2O0UA 4NJDA 2UZBA 4FKOA 2JAVA 4G5JA 5HX6A 2XKFA 2JBPA 3ZCLA 4FYNA 4RVKA 3P5KA 3ZUUA 4EKKA 2A19B 2RFSA 3R7YA 4U41A 2OLCA 3NRMA 3G9NA 2VTJA 3KMUA 4BDHA 2NRYA 2VZ6A 4OBOA 3FXZA 3QL8A 4BCGA 3UTOA 4FTKA 4NM0A 2OZAB 4QYHA 4QPAA 5EDRA 2GCDA 4YO6A 5KMNA 4RA4A 2W1GA 3BGPA 1XBBA 2JGZA 5E92A 3E62A 5DBXA 5FD2A 1PJKA 5C8MA 4DA5A 4RX8A 3JS2A 3E87A 5AAEA 4L67A 3K3JA 1OKZA 3B8QA 2YIWA 4EONA 3P9JA 4RIOA 1K9AA 4O22A 5CYIA 1JKSA 4TYEA 4A06A 4DH5A 4APCA 4NZWB 5CEMA 2YEXA 4ZTHA 4I6QA 2HY0A 3HV3A 3H30A 3E3BX 4RJ3A 4FKWA 3VUKA 1XH9A 2IW9A 4I3ZA 4L3JA 3BU5A 5JK3A 1ATPE 4YBKA 3GUBA 5BQ0A 4OW8A 3HP2A 4ALWA 4CYIA 4Z9LA 4K2RA 3JVSA 2C6TA 1PHKA 2QLUA 2Y9QA 3HZTA 5ETIA 3DS6A 4AGWA 4ZS0A 2OI4X 3T3VA 4ZXTA 2GQGA 3UG1A 5BVOA 4EK8A 4BF2A 3PWDA 4G9RA 2FSOX 3VAPA 3E7VA 1KSWA 1LR4A 3E8DA 3L9MA 4BGHA 4GH2A 4PNIA 2VUWA 3NLBA 3POZA 4R5SA 4TNBA 5KHWA 3MVHA 5EYMA 4D4YA 3UBDA 4D5HA 4C3RA 2YM4A 2UZOA 3I79A 3IQ7A 3LKMA 3SW4A 1WVXA 4CXAA 3SW7A 5M56A 2IO6A 4I4EA 3F2RA 3O8TA 2YLEA 4RC3A 2UW6A 1PXOA 3NVKI 4C4IA 3KL8A 5CF5A 4KSPA 3ALNA 3QQUA 2XRUA 5M4UA 4NT4A 3ORPA 4F6SA 4ZTRA 4AN2A 2GFSA 3UC4A 1L3RE 5HG8A 3PSCA 4X2FA 5E8WA 5EG3A 4AOTA 4DITA 3DT1A 3KXNA 3ORNA 2HZ4A 4FTMA 5ANIA 3WIGA 2CN8A 3OBGA 5EHLA 4AZFA 4EQMA 3IOKA 3G15A 1YDSE 4LGDA 4PMMA 2GNHA 4EUUA 4ZJVA 3Q6WA 1Q61A 4ZJIA 1FGIA 4D2TA 4A07A 3FHRA 4FTJA 3SXRA 3PY1A 4J99A 3AD4A 3R2BA 4J1RA 5EDPA 4G34A 4DH7A 3GU5A 2CMWA 5LWMA 3MTLA 4IAYA 1HCKA 2BFYA 5G1XA 3FQEA 4KBAA 2UZEA 1G5SA 3U4WA 1QPJA 3Q2MA 3QQGA 3SHEA 4D4VA 4DBNA 2HZ0A 2OWBA 3ORZA 5IA1A 3PZHA 3ZBXA 2GNLA 4NK9A 2W99B 4UY9A 4DLIA 5J7HA 5CALA 4EORA 3F88A 1J1CA 3TACA 3AC4A 3LM0A 2J90A 4BIDA 1YOMA 4V05A 1K2PA 1Q97A 4ZLOA 2P0CA 4YTHA 5DOSA 5ANKA 3WF7A 3RWPA 4ZSEA 2YM3A 2RFNA 4BKJA 5DNRA 3GOKA 3TNQB 3H3CA 5H2UA 3PVWA 2C0OA 5KMIA 2BTRA 1M7QA 2W1FA 4IM3A 1JSUA 4QQJA 5FLFA 2J0LA 3ZZEA 5BNJA 1PYEA 2XK6A 3A7HA 3IGGA 4GIIA 5CX9A 3Q52A 5E8UA 5TO8A 2O65A 2YFXA 3QCXA 2BIYA 3GC0A 5EYCA 2OXYA 1H00A 4C38A 3W2RA 3FZOA 4BC6A 1Y6BA 4B4LA 1XWSA 2WTJA 4C34A 4YGAA 3S2PA 5ETAA 5IPJA 4EEVA 4E20A 5K3YA 3SG9A 2G15A 5HNIX 5EQPA 3CTJA 4EI4A 3CKXA 2BRNA 4GS6A 3D15A 4HZRA 4C4EA 5CF6A 3SRVB 4FSRA 1KWPA 3HLLA 5FEQA 2CLXA 3OWKA 2HENA 5F20A 5JGAA 4WNPA 5IG1A 5DHJA 5FP6A 3RGFA 4EZ5A 2XA4A 4FZ7A 4M0ZA 3DB8A 5AR4A 2FSMX 5AAGA 3BLQA 4YTFA 5C27A 3I5ZA 3HV6A 3O96A 1OVEA 4QMYA 2Z02A 3F2NA 4BGQA 1WFCA 4PL3A 2JITA 2WOTA 4QMQA 5HLWA 4FEUA 4MKCA 3DLZA 4L01A 2QU6A 3P08A 4AP7A 2QI8A 2GHMA 3NUUA 2C5NA 1OPJA 5FTOA 4BKZA 5E4HA 1BI7A 2CGUA 3AC1A 4IB1A 4RJ4A 4O7RA 1H07A 4G16A 5DRBA 4P7EA 3WARA 2VNWA 3ZRLA 3FXWA 3QCSA 4BBMA 3ORMA 4CD0A 3GCSA 2PUUA 3QRIA 3R1NA 5EDQA 3TIZA 4U3YA 4LL5A 4RIXA 2J0JA 3EKNA 3FHIA 3GENA 2Z8CA 3A2CA 2BKKA 2QC6A 4LYNA 3OZ6A 2QG5A 5AP2A 5HNBA 4AACA 3W2QA 1BMKA 4HOKA 1FMOE 3BYOA 3V6RA 4O7ZA 1Q62A 2PVHA 3GXLA 4MNEA 5EFQA 2QD9A 3TKUA 3VS2A 1E1VA 3TV7A 2WTDA 2OFUA 4DTKA 4TW9A 4BDAA 3QA0A 5E8XA 1UKIA 4IWDA 5HCZA 5ICPA 3MVJA 5IA3A 3KB7A 4FNYA 4AN9A 5LOHA 3T9IA 4AGCA 4OTPA 2QR7A 2QOBA 2Y6OA 5IA4A 4MF0A 3DAKA 5JQ8A 5C9CA 3A7GA 2IZRA 4EH2A 3QTXA 4ZP5A 3AT4A 4E5WA 3UOJA 5EQEA 3I0QA 3FYJX 3FMNA 4ZY6A 2GNFA 3KULA 4AOIA 4BZDA 4ORKA 3W8LA 2G1TA 5EW9A 1TVOA 1YHWA 3U87A 2E9VA 2VU3A 2YJSA 2JAMA 3DV3A 3EQHA 5EYKA 3BHYA 2C4GA 3CTHA 3HA8A 3RHKA 4FV8A 3LFQA 3ZEWA 1IAJA 1H1PA 2HZNA 1FINA 5LVMA 3FQSA 3BYUA 3GC9A 5GIPE 5A6OA 2PVFA 1IASA 4ENXA 4D2WA 3C0IA 4IB3A 5HX8A 3BGZA 1JLUE 4D1ZA 1XBCA 4BZNA 4JG7A 4S32A 4DEGA 4FV6A 3L8PA 4D9UA 3NNWA 4GVJA 2GHLA 5AV1A 4TYJA 3UOKA 2JLDA 2RL5A 2WU7A 4UX9A 1H1SA 1CMKE 1Q8ZA 4OTIA 3PY0A 1GAGA 5E8ZA 1UU8A 4F9BA 3NNVA 3W16A 3GGFA 3BE9A 3F61A 4Y73A 3RZBA 4MXAA 2PZYA 1U5RA 3PVUA 4QP1A 5HEZA 1YXXA 4AFEA 5LVPA 5HZNA 4PUZA 5F95A 5K0KA 2C47A 1MRUA 2B0QA 2VTPA 2PE2A 3LHJA 2EUFB 3PXYA 3QKMA 5AAFA 4AT3A 4HNFA 2B52A 3ZH8A 4DH8A 5JQ5A 4XV1A 4ZZMA 3DNEA 2YHVA 3PVGA 2VWWA 4JAIA 3WZUA 2EXCX 5JMSA 3PJCA 3LXLA 4UALA 3VW6A 5BVFA 4XG6A 4YJQA 1BYGA 5BYYA 4E6CA 3UO5A 4NCTC 3HYHA 4FTAA 3ZLSA 3PVBA 4C3FA 5AV0A 2EU9A 3FV8A 4RWJA 5DEWA 3F5GA 2RFDA 5A54A 4FEVA 3CCNA 2NNWB 2GMXA 2VWZA 5KHXA 3EWHA 2IJMA 3LE6A 4PDSA 2G9XA 3LCKA 5ANOA 3QX2A 5JSMA 5M55A 3KCFA 3TM0A 2WKMA 1CSNA 4GFGA 4RLKA 1OIRA 2B54A 4FV2A 2I1MA 4FT5A 3BX5A 3SC1A 2VO6A 2CKEA 3MJ2A 3DBDA 4JOAA 4CSVA 3FLSA 4QMZA 5AM7A 4IX3A 3QZFA 2R0UA 1IA9A 4I93A 3G2FA 4WA9A 5TE0A 2WMBA 3LMIA 4GEOA 4DG0E 2O2UA 3CLYA 2XEYA 2W06A 3VBXA 3FC2A 1DM2A 1U54B 3I4BA 4AA5A 4D0WA 3BLHA 5I9YA 4II5A 3QC4A 2IZSA 2X4FA 5JT2A 3HA6A 3ZO2A 3UQCA 4UWBA 4W8DA 3SA0A 4EOIA 3FBVA 2W17A 2VGOA 2YLFA 3RNIA 4EBWA 3CPBA 3HRFA 4RGJA 5CU2A 2OIBA 5BYZA 4ANQA 4EH5A 2IG7A 2VGPA 2YM5A 3BLRA 4RC4A 2X7OA 3Q60A 3I81A 3S1HA 3ZSHA 3KA0A 2R3FA 5J1WA 3M2WA 1H26A 3HUCA 4JLCA 2JDSA 3FPMA 4A9TA 4BCKA 2P4IA 3DNDA 3IECA 3C1XA 3V04A 3WE8A 3BQRA 4R6VA 4U0IA 1Y8YA 5LMKA 3V5PA 2RSVA 4IFGA 5HIBA 4AGUA 4P5QA 4E3CA 2BZJA 4R7HA 1GNGA 1PMNA 4LI5A 5BYLA 4ANNA 3HAMA 2VN9A 5LJJA 3TZ8A 2ZJWA 3MH1A 4FG7A 1W84A 4LRJA 4B8LA 5KNJA 1BLXA 1JKLA 2GNGA 5CT7A 4L45A 4Q9ZA 3VF8A 4MH7A 4BHNA 3SVVA 2VTIA 4O7WA 2VWUA 4JQEA 2XIZA 3OY1A 3QXPA 5HHWA 2DQ7X 3VIDA 1F0QA 4Z7GA 4YJRA 5IQHA 2Z7RA 3TL8A 4MQ1A 3ZUTA 1SNUA 1GZ8A 2BKZA 4NJ3A 4R7IA 4EOOA 4EOKA 5C03A 4F9WA 4FNXA 5E91A 3ZM4A 4XP3A 5KMMA 3FMMA 4BDFA 3JXWA 1BUHA 1U46A 4W8EA 2R7BA 4QD6A 4YZNA 5IMEA 2PMLX 3E88A 4CFFA 2ITZA 1P4FA 5EH0A 4AT5A 3U51A 2ITUA 5FEDA 4QMNA 4NKSA 3MVLA 4I5PA 4EK4A 2VO0A 3EZRA 2IWIA 2EB3A 2XP2A 3QF9A 4FBXA 4CFXA 3P23A 4O7VA 3IK3A 2I7QA 3CGFA 2C6KA 3SOCA 3EYHA 2IN6A 4GYIA 1QPDA 4NKAA 1AQ1A 5DRDA 1OL7A 3EMGA 4TWCA 1JSTA 1PXIA 4IC7A 2JDVA 3ZS5A 2VTLA 5CSXA 4AOJA 5CU4A 1CKJA 4IZYA 2C6EA 2X8EA 4FTTA 4RIWA 3FZ1A 4RX9A 2BZKB 3E8NA 3EFKA 4JXFA 3LM5A 3EJ1A 3KMWA 4RG0A 1VEBA 2Q83A 3G0EA 3O23A 5HO8A 2WPAA 1JOWB 3OY3A 5IUGA 4X7QA 4OT5A 3CR0A 4YLKA 5JGDA 5F1ZA 5JFXA 4KBCA 3DXNA 3MW1A 3OEZA 2XB7A 3DTCA 3MY1A 4DG2E 4ZTMA 3BU3A 4XHKB 3HAVA 4TXCA 5AP1A 1ERKA 4PV0A 3K2LA 1H27A 2I40A 2J50A 3UIMA 3V5TA 3MS9A 4U43A 4Y8DA 2ZV9A 2Z7QA 3UO6A 3OD6X 3W2CA 5E1EA 3ZFMA 4FKUA 4CV8A 1LEZA 4Q5EA 2HCKA 2WQEA 5KE0A 3GCPA 3LW0A 3IDBA 3W18A 3QTWA 4EQUA 4K9YA 5CWZA 4RIYB 2X1NA 4QTAA 4BDKA 5K5XA 4FK3A 4PPAA 5CQWA 1KOBA 4UXQA 5DT0A 4O0VA 3BEGA 4JBOA 3PP0A 2B55A 2XNBA 1YWRA 4FMQA 4TNDA 3UQGA 4Z16A 4H39A 4JDIA 4RT7A 4R7BA 1PMVA 3PPZA 4NEUA 4CFVA 2GU8A 4IWPA 4IEBA 3LMGA 4I5CA 4O0SA 4Z3VA 3NUNA 2IPXA 4O7LA 4CG9A 5M09A 3V5JA 2WMQA 3KEXA 3EL7A 3NDMA 3ZC6A 4FGRA 4O91A 4ZZOA 3KRXA 4PMSA 4Y72A 1Z9XA 4QMUA 3LFCA 2WQBA 4QQCA 4UMTA 4FKRA 4U6RA 4GJ2A 3BU6A 3ORXA 5D11A 3TCPA 1KV2A 3V8WA 4PL4A 4YJUA 3AQVA 1HOWA 5LQFA 1X8BA 4OR5A 4WBOA 3LQ8A 4QTDA 4TYGA 3UZRA 3ZBFA 3I5NA 4A4LA 1ZRZA 1WBTA 2DS1A 3KCKA 5EM6A 3F5XA 4YMJA 3AD5A 4FV7A 2FA2A 5HE2A 4D2PA 4DT9A 5M07A 4A9YA 4HVIA 1HCLA 3EQFA 3P4KA 4L53A 2HZIA 4IDTA 3SKCA 2XMYA 1GZKA 1R3CA 5FRIA 2YCSA 1OL2A 5AIRA 4HGEA 1J7IA 4JNWA 4O7TA 2W96B 4O83A 4XP0A 1YXVA 3QZHA 2JFMA 2O63A 5DR9A 4ZAUA 1LEWA 2PVKA 3IW7A 5I3RA 4CKIA 4WNKA 3OS3A 3ZEPA 3SX9A 4QMXA 1H0WA 5JKGA 4I5HA 2VTRA 2C6OA 4W4XA 3PE2A 4MWHA 4GUBA 4QP2A 2QO9A 3FZRA 4FT3A 2QO7A 5KKRB 2XK9A 4OTHA 3MPMA 3RAIA 2F2UA 3LJ0A 4E1ZA 4AG8A 4G3CA 2C6IA 5CF8A 2OBJA 4I6BA 1OBDA 4K11A 1ZARA 4EH7A 4F64A 5J9LA 1FVRA 4O38A 3EQBA 4X21A 1WBOA 2YIYA 3ZSGA 4KIQA 1IEPA 4EH3A 4DFBA 3R22A 3ROYA 1Q41A 2GNJA 3OBJA 5AP0A 4YJOA 2ERZE 4FZAB 4ID7A 1MRVA 1UNGA 2PMOX 3H10A 5IQIA 1NVQA 4DFZE 4E5AX 3UOHA 2CSNA 3IGOA 1YOJA 5IU2A 3E93A 4DE4A 2OZAA 3AC3A 3ZDIA 5CAUA 4DCAA 3F2AA 3VS0A 2WFYA 4O7YA 3QALE 2WAJA 4USDA 4ZJJA 4TYHB 3QD2B 3ZO4A 1OMWA 4FV1A 4BDCA 4UWCA 4NIFA 3QLGA 4D2VA 4EUTA 4KSQA 3FMLA 4O0YA 4F0GA 4EZ3A 1IA8A 3AT2A 1FGKA 4TY1A 3NUXA 5KBRA 2W4KA 5CANA 4M68A 1B6CB 4IANA 3B2TA 5HU9A 4L00A 1NVSA 4I0RA 5HIDA 4CTBA 5GZAA 2B4SB 4FTUA 4ACMA 2X2KA 1MUOA 2F49A 4O86A 4ZS4A 5L6WL 3HGKA 3QQHA 2GTNA 4DGGA 5CY3A 5KX8A 3NCZA 2W4JA 4I0SA 3RCDA 3TUCA 5J95A 4FKVA 5CSWA 3TZMA 4LGGA 3GQIA 4DAWA 2HXQA 5DG5A 5BVNA 1XKKA 4F9YA 4YZMA 3R6XA 5FQDC 3SG8A 3GFWA 2VWYA 3OOMA 4ZY5A 4X2NA 1J1BA 1P2AA 5FBNC 3CC6A 1M7NA 1SVEA 2GS2A 2OH4A 4XG4A 4MCVA 3CD3A 4JBQA 2BRBA 2XIYA 1FOTA 4Q9SA 5HICA 2W0JA 4FI1A 4NTTA 4J52A 3C5IA 4IB5A 4L8MA 1ZYCA 4IIRA 1TQIA 1URWA 3ETAA 2AC3A 4BFMA 2X0GA 1QL6A 3GQLA 4J71A 5IUIA 1DI8A 2I0EA 3H9RA 4FIJA 5DR2A 2JIUA 5LMKC 3Q4CA 4C4HA 4DTAA 1P14A 2UW0A 2BPMA 3MB6A 5AUYA 2Q0NA 1SYKA 4PPCA 3KC3A 5J5SA 1W82A 4XEYA 2R3KA 3PPKA 3FL4A 3GCUA 2X9EA 3BV2A 3W1FA 4F08A 4KIKB 4C58A 4WO5A 5J8IA 4I94A 3A4PA 3DQWA 2PTKA 5HG7A 4JDJA 3R9NA 3UGCA 2I6LA 4MYGA 5AMNA 2PSQA 5CAQA 1GIHA 4KWPA 4AE6A 3DDQA 4R8QA 4BGGA 2UZWE 3D7TB 4ZTQA 3ZDUA 1W98A 4AZTA 2IZUA 3BIZA 3A99A 3NX8A 4AQCA 1VZOA 4BL1A 4QNAA 5DYJA 2R3NA 4PF4A 4RWKA 3VS7A 5I9WA 4XP2A 3RNYA 4I4FA 1PMEA 1ZMVA 3Q9XA 2JIVA 3PRIA 5C26A 4QT1A 4E4MA 4CZYB 4R3PA 3P0MA 2B9JA 4TL0A 3R00A 3OW4A 3LXNA 1IR3A 3PE1A 4M69B 4BWXA 4M14A 4FIFA 4QMSA 1NVRA 4TRLA 3TG1A 1I44A 5KO1A 3CPCA 3U9NA 4CG8A 3VRZA 2ZM1A 2BILB 3F66A 5KMJA 5I9XA 5IQFA 4FZFB 1OGUA 3VVHA 3BBTB 3R8ZA 4NM3A 3ZLYA 2C1BA 3SV0A 1SVGA 4F7NA 4YLJA 3HMOA 5BUEA 2H34A 5H8BA 5IEVA 4F70A 4PDYA 1H24A 4C59A 3FZTA 2VRXA 4XG7A 3CE3A 4HGTA 5E8YA 2W1EA 3GC7A 4E93A 4DYMA 4P2KA 5M51A 3NUPA 3ULIA 2C0IA 3RCJA 3LFDA 4M97A 1NA7A 3Q4ZA 5FXSA 3A8WA 4IZ5A 2A27A 5CASA 2GQRA 3U4UA 4CQGA 2HW6A 4DGMA 1Y91A 3A8XA 1O6KA 3V8TA 3DKCA 4LM5A 3MA3A 1APME 1PXMA 4WG4A 2I0HA 1ZAOA 5AR8A 3BGQA 5JRQA 5L4QA 3OUNB 4GK4A 1ZWSA 2F7XE 4YUQA 2EVAA 3IOPA 3PTGA 4LOQA 4F6WA 3UE4A 3LXPA 3ZUVA 2QQ7A 4ACGA 3FUPA 4NM5A 3QLFA 3VHKA 4M67A 2J5EA 4C4FA 5DEYA 4V01A 4KIPA 2EXEA 3I6UA 2ZV7A 3FKNA 4CTCA 5L2WA 4DEAA 2ZV2A 3AC2A 4AWIA 3O50A 5JFWA 1GOLA 1UWJA 3IS5A 4FUXA 4XLIA 1STCE 5A6NA 4RJ5A 4AUAA 5IH5A 3FLWA 3GT8A 3TJDA 4Q2AA 1NT2A 5T6KA 3QRKA 2VWBA 5HCXA 4G6LA 5DMZA 3F82A 4KRDA 5HTIA 1G8AA 3FEGA 4WT6A 4DFNA 3Q3BA 5IMXA 5IQBA 5M57A 3ZZWA 4H3PA 1GJOA 2W1CA 2IVSA 4GVAA 3WF9A 3DLSA 2WTKC 3QHWA 3VBTA 4KUJA 3NVMB 3QQFA 1DAWA 4M3QA 5AX3A 5CEQA 3A7FA 4FTRA 1UVRA 4CCUA 4X6QC 4O2ZA 5HNGA 2VX1A 4UMPA 5BMSA 3SD0A 2XNGA 3PY3A 4R5YA 4XG3A 3WI6A 3HKOA 4ZSLA 4FTOA 2J0MB 3WILA 4AT4A 1WZYA 1DI9A 3ZFXA 4D58A 3QYZA 1YWNA 4YLLA 5EM7A 4BCPA 5J5TA 3F3TA 4QP7A 1NW1A 4YJPA 1H01A 2CGXA 5HVJA 3EYGA 4GT5A 4I24A 4OTQA 3FKOA 3QWJA 4IH8A 5JRSA 2WMVA 3ROCA 4AE9A 4BVUA 5LMBA 3KXMA 1CKPA 5EQYA 4DGNA 3WOWA 4ZZNA 2QOQA 3DJ6A 3OUKA 2C5VA 3HUBA 3JY9A 3RK9A 3NYNA 3P86A 3AG9A 3D5UA 2F2CB 4QMTA 4ANOA 2OGVA 4CCBA 4CFUA 4DH3A 3R7VA 3ACJA 4JVGA 3R8UA 4B0GA 4ZLYA 3IW5A 4BCQA 3PXQA 4JAJA 3U6IA 1Q3WA 1WMKA 3LFFA 3UMXA 5EI2A 4C2WA 3VHEA 4BB4A 5AP4A 3Q53A 5EOLA 2QKRA 3D9VA 3GU4A 4IJ9A 1H8FA 1TKIA 4YHJA 3D7ZA 2YA9A 5IQGA 3OTUA 2XJ0A 4W4YA 2OF4A 4DGOA 4MQ2A 4IE9A 4IC8A 3E64A 1OB3A 3CQWA 3U6JA 4XBUA 1Y57A 4I1ZA 2Y8OA 2SRCA 4N57A 4E5BA 1LUFA 1WBWA 3R04A 3RAKA 3R8LA 4M15A 3F69A 2RIOA 5BVEA 3OXZA 3MESA 4HYHA 2HYYA 3QTZA 5FGKA 3KMMA 3O51A 2CNUA 2QONA 4AAAA 4ZMEA 2C68A 3ODYX 4LOOA 2DWBA 2JDTA 3C4FA 4UYNA 3RWQA 5AADA 4W4WA 5E90A 3SDJA 3ID6C 2ITOA 1YXUA 5KMKA 3SGCA 3UPXA 3ACKA 3MH0A 3JY0A 4FSWA 3U6HA 3Q04A 3N4VA 2OJIA 2V7OA 3QCYA 2R3GA 3OHTA 1O6LA 3NNUA 2A1AB 4JJRA 4G3GA 4K33A 4LRMA 5FTQA 5IUHA 3VS4A 3FWQA 4HZSA 4FV0A 4QP9A 4QYEA 4K18A 3RK5A 4D4SA 3FY0A 3TI1A 4ZY4A 3DBQA 2YIXA 2X2LA 5FXRA 4G17A 2ZMDA 2NP8A 4QP3A 1H4LA 4Z55A 4FV3A 5AP7A 3R2YA 3FLNC 4QNYA 2JIIA 3LMHA 4DT8A 2GTMA 3KQ7A 3DKFA 5CI7A 3W2SA 4UBAA 3V6SA 4F1TA 4QTEA 5FDPA 2R64A 3MFRA 4TYIA 4PDPA 4RRVA 4U5JA 4BY9E 1ZYDA 3DKGA 4FV4A 3T3UA 4IW0A 5ETCA 4XRLA 5DE2A 2PL0A 1S9IA 4ANMA 1J7UA 3KRWA 5JEBA 4MXOA 4JBPA 3MH3A 4J7BA 4YTIA 3UIBA 5IQAA 1JQHA 3ITZA 4FGBA 4J97A 2QOHA 4CYJA 3PFQA 4YBJA 4EQCA 2F7ZE 2YAAA 3DBFA 3WF5A 4OGRA 3CIKA 4CVAA 4TWNA 4IM2A 3HDMA 2YCRA 3C4EA 3WYYA 2XKCA 4ITHA 4D9TA 4EOJA 2VTSA 5HO6A 5A9UA 1T45A 2YN8A 3ENMA 4HCUA 5C4LA 4FIEA 3WZJA 1OECA 1S9JA 4ACDA 1BX6A 3VN9A 3WZDA 3CD8A 3FLQA 4IFCA 2PUNA 3RALA 3II5A 2R4BA 4GUEA 5F94A 5ACKA 4USEA 3MDYA 3O7LB 3PXKA 4I41A 1U54A 2GPHA 3DQXA 4L43A 5GJFA 1W0XC 2O3PA 4GU9A 2ITWA 2WEVA 3DK3A 4YURA 5L2IA 2QO2A 1GZOA 2WMTA 3EFLA 3IW4A 3NWWA 4QYYA 5H8EA 3VO3A 5T68A 3OF0A 3PWYA 3VBQA 4C8BA 3CTQA 3MIYA 5HE1A 5F4NA 2PU8A 4I6HA 2ACXA 3R7OA 3QA8A 4V0GB 2VWVA 2CNVA 2XNMA 2XH5A 5JN2A 4BCIA 2GSFA 4DEBA 3HMPA 2P3GX 4L7FA 4M13A 3SQQA 3A7IA 3OT8A 3V5QA 3UNJA 4KNBA 5AUZA 4WHZA 4FSUA 3PYYA 4FG9A 5E8VA 3IW6A 4CV9A 5L6PA 5IQEA 2BFXA 4FA2A 3DJ7A 3PLSA 3ZLWA 5D7AA 1Q3DA 5D7VA 2JDRA 3E63A 4IVDA 4U80A 5AX9A 3ZHPC 3FC1X 4FOCA 4R77A 2LGCA 4Z7HA 3NYXA 3NUSA 4JDKA 2F9GA 3B2WA 4UB7A 1YWVA 1Q8WA 2ITVA 3PP1A 3W10A 4ARKA 2Y7JA 5B2KA 3VWAA 4Y83A 3VS6A 4F1MA 2VWIA 2VTHA 3VJOA 4LL0A 3EZVA 4LFIA 3L1SA 5TF9A 3KXZA 5I3OA 5IH4A 2OJ9A 3I7CA 4HCTA 4LG4A 4R1YA 5IH6A 1E1XA 4XG9A 3QKLA 3D94A 4QPMA 2C3KA 4MBLA 4GSBA 2YM6A 2F57A 3COIA 3OOGA 2V55A 1K3AA 1KE7A 2JKKA 4XRJA 2YISA 5AWMA 4X2GA 3ZMMA 4BTFA 2XYUA 3BWJA 1YW2A 1WBSA 4KRCA 3F5UA 3PA5A 4GK2A 4E4NA 2RF9A 4EC9A 4EOPA 3I7BA 4R1VA 5D1JA 2E9UA 3QTRA 4BZOA 5TKDA 1ZY5A 4MF1A 3AMBA 5LARA 3F7ZA 4ENYA 5GIOE 2Y4PA 5HIEA 4J53A 1H25A 4RX7A 3KULB 4KA3A 4WUAA 4BBEA 1R1WA 2VD5A 3KXXA 2PY3A 4JQ8A 4YHTA 3UYTA 1WBVA 2BR1A 3LCTA 3TIYA 4AW0A 2WXVA 4IXPA 1PXJA 4L3PA 3IDCA 4U8ZA 3SOAA 4KBKA 3V5LA 4IZAA 4EC8A 2CKPA 4ZTSA 2R3LA 3F3WA 1V1KA 2CGWA 2OH0E 2Y4IC 4XV2A 1PF8A 1Y8GA 1OPKA 2PZRA 3MB7A 2W5HA 5HBJA 5F9EA 1OL6A 4FVPA 3PSDA 4PNKA 3LFNA 4FZ6A 3PG3A 2IVTA 5CNNA 4JIAA 4BDDA 4M84A 4ZMFA 3VS3A 4YZBA 3A61A 2HK5A 1FQ1B 3QKKA 4BI1A 3PLAE 3CEKA 5HU3A 2RGPA 3JUHA 3DAEA 4UYAA 2E9PA 3LCOA 5L2SA 5H9BA 4RWIA 3UZTA 5KCVA 1WBPA 3TEIA 2AC5A 3WBLA 3DXPA 2AYPA 2E2BA 2YDJA 2WMWA 4A7CA 5ACBC 4TPTA 5I9VA 3LQ5A 5GZ9A 2GS6A 5AV3A 3DKOA 4EZ7A 1REJA 4DBXA 4CFWA 4QMOA 1TQMA 4MXXA 4AZWA 5GZ8A 4G1WA 3VUDA 2OIDA 3P7AA 2B1PA 2XIRA 4FTCA 4DINA 4FNWA 4AN3A 4ITIA 4YPDA 4ANBA 4F0FA 3QTUA 3FI3A 4G3EA 3Q4TA 4RIYA 4TKSA 4G31A 3FMKA 4X3FB 4KABA 2XKDA 3FPQA 4BYIA 4F1OA 1SMHA 3CXWA 3QWKA 5K4IA 4YJVA 3GFEA 4XX9A 2VNYA 5J1VA 1OPLA 2BRGA 3FQHA 4FVQA 3KU2A 4S34A 4WIHA 3NYVA 3RPSA 3OW3A 2QG7A 4BR3A 2JFLA 5DGZA 4BYJA 5BMMA 2PVMA 5KUPA 3FDNA 4ZSGA 1JKKA 3RHXA 1RDQE 1XH8A 2WMAA 4C57A 3G5DA 4C61A 5IA5A 5EHYA 3LVPA 4O0WA 3NW5A 5EHOA 3ZOSA 3TKIA 3PIXA 3R9RA 4YC6A 3DU8A 2OIQA 5CVFA 2PUIA 3ZRKA 3VULA 3DAJA 4DEEA 1GY3A 3F6XA 5CSHA 2CKQA 1LPUA 2UUEA 3R8MA 5AM6A 5LCJA 3BHHA 3UVPA 4OTFA 3VQHA 4FG8A 3FZSA 3HMNA 5ETFA 3K54A 3WYXA 4F7SA 4Q5HA 1YI6A 1KV1A 4C3PA 3GC8A 4FVRA 4YP8A 3VNTA 3G0FA 2J0IA 2VX0A 4FTLA 1XR1A 1ZOEA 2YM8A 4MNFA 4MHAA 1XHAA 4EKLA 4KKHA 4FSZA 1OIQA 5AJQA 4RX5A 2WQNA 1KE8A 3F7WA 3NS9A 4LMNA 3VW8A 3DFAA 2VTOA 4PDOA 4XOYA 3W32A 1OUYA 5A4EA 3CY3A 2HIWA 3PSBA 3R28A 4E8AA 4M66A 3V51A 4RLLA 2QU5A 2W4OA 2Z7SA 3R1SA 4F63A 3OFMA 4ZIMA 2YAKA 3F3UA
chains in the Genus database with same CATH superfamily
3D5XA 3CSVA 5E8SA 4DFLA 4MD7E 3GU7A 4EYMA 4PPBA 2UZDA 1IRKA 4UXLA 3R63A 3QRUA 4IWOA 2QR8A 3QQJA 3PJ8A 4W9XA 3NGAA 4FF8A 3UNKA 3DGKA 2H8HA 1RE8A 5TR6A 4H3BA 5LVLA 1ST0A 2YJRA 5DA3A 4C4JA 4KS8A 2C69A 2UVXA 3V8SA 1YHVA 2W1DA 5CZHA 4XG2A 3TJCA 3K5UA 4YJTA 3C7QA 4XMOA 2W5AA 3U54A 4CT1A 3G51A 2W1ZA 4BHZA 4N0SA 1AGWA 3HMMA 1YI3A 3C13A 4V04A 3Q96A 4RQVA 2J2IB 2XAOA 3NPCA 2HXLA 4DEIA 3EQDA 1P5EA 2C3LA 1F5QA 2A0CX 4XV9A 1M2QA 4D0XA 2REIA 3L9NA 2V62A 5J79A 4TYHA 2WMXA 4EH9A 4WRSA 1KE5A 4N6YA 3Q9WA 2ETMA 3COMA 4OBPA 4PMTA 1Y6AA 2ITQA 2PHKA 3HV7A 4RJ8A 3PPJA 4YSJA 3L8XA 2YDKA 3KRRA 1MQ4A 2JKOA 2YACA 2C6DA 1SM2A 2BROA 2WHBA 3QAME 3SXSA 3A62A 1Q24A 4O27B 3AT3A 4BDGA 3GCVA 4IACA 2XJ2A 1IG1A 5IISA 4DLJA 1H1RA 3W33A 4EL9A 2KTYA 4NUSA 1W2FA 2VTQA 3E3PA 4HYIA 4AU8A 4EOMA 5C1QB 1VYZA 4IMYA 2WIPA 2ZVAA 4O82A 4O1PA 4AGDA 3S0OA 4NFMA 1OKYA 2ZDUA 4I23A 4QTCA 3MTFA 4M7IA 4FIGA 4BN1A 3C4XA 3MFTA 4WNMA 1U5QA 4FKPA 2YITA 3RBWA 3I60A 4O96A 1ZMUA 5M44A 1OL5A 4P90A 3W55A 3G9LX 4JRNA 4AA4A 4TTHB 3VC4A 4USFA 3MV5A 1URCA 2JBOA 1JPAA 4IAZA 4J96A 3RK7A 2J6MA 4B6LA 4F6UA 5AUTA 3GOPA 3WIKA 5CENA 2VO3A 3ATTA 4BCNA 4RIWB 1W83A 3QTQA 4FT9A 2BMCA 3I6WA 5ANJA 4U40A 5A3XA 1EH4A 4HYSA 4D2SA 3BI6A 3DBEA 3QD0A 4L7SA 2A2AA 1XH6A 3QZGA 4NFNA 4RSSA 5LMAA 4F99A 3F3VA 3POOA 5HD4A 4CZUA 4L9IA 4NU1A 2R3PA 5EI6A 3CQEA 2OJGA 5EW8A 3PZEA 2PWLA 1VJYA 4YTCA 1ZZLA 3ZO3A 3A7JA 5HQ0A 5HKMA 3PDTA 3NIZA 2W5BA 4FV5A 4UMRA 4LOPA 4KIKA 4P5ZA 5IQDA 4KKEA 4CFMA 4KD1A 4H1JA 4B7TA 3V3VA 2YWVA 4LGHA 5EW3A 3R21A 3TUDA 4O7SA 4IX4A 2PULA 4DHZA 3CBLA 2J9MA 3EN5A 3BZ3A 4I6LA 3U55A 5D41A 5B7VA 4QRCA 5ITAA 1XH5A 3R02A 3KREA 4QP8A 4IQ6A 3IO7A 4K0YA 3RI1A 1PMUA 3DK7A 3NNXA 3NW7A 4YSMA 2XM8A 5CLPA 5CTPA 4YJSA 2GDOA 3ZFYA 4AQKA 2V22A 3PG1A 4EOLA 4QMVA 4G6OA 4CEGA 1PYXA 3FMJA 4BBFA 1H1QA 3UOLA 4W4VA 3UPZA 5BV3A 3QUPA 3QQLA 2W1HA 4DDGA 4GJ3A 3D5WA 3IW8A 4IJPA 4QYFA 3VUIA 3Q32A 5BPYA 3BBWA 5LVNA 2C30A 2OG8A 3PJ3A 1CM8A 4FOBA 4IBMA 4QTBA 5DIAA 3TNIA 2J7TA 2GFCA 5L6OA 1V0PA 5JFSA 2XK7A 4QQ5A 1ZOHA 2Y0AA 3LLAA 4DHIB 2XAMA 4WSQA 4HGLA 4IVAA 4PP7A 1CTPE 1YOLA 3BEAA 4FE2A 4K8AA 3V5WA 3AMYA 4QDVA 5FWKK 2ZYBA 5DR6A 4ZSJA 5IEXA 4I6FA 3A4OX 3AGMA 3UJGA 2ZB0A 1PXNA 3KRJA 4M12A 3VUHA 3FMEA 3DOGA 2XIKA 2XKEA 3NAYA 3MWUA 4RBLA 4S30A 5HG9A 3RP9A 3FMDA 3WZEA 4IADA 3EQCA 5CT0A 4FC0A 3MH2A 4BCMA 3VBYA 3ATSA 3FLYA 4L68A 5HE3A 4L46A 2IVVA 3A60A 5AR3A 5BVWA 3C0GA 3I0OA 4R78A 3UZPA 2YIRA 3ZXZA 3HMIA 4BTJA 4DEDA 5LVOA 4PTEA 2OXXA 3QUEA 4BCJA 4JS8A 4WD5A 1B39A 1Q4LA 3OP5A 4FL3A 4YNOA 2FSTX 2PVJA 2WMRA 5IA2A 4BJJA 1JAMA 2A4LA 3AC5A 4I21A 3Q9ZA 3AD6A 3PJ2A 3AXWA 2EXMA 1AD5A 2XCKA 2ITTA 3MJ1A 5EYDA 4O0XA 2CCHA 3LFSA 5HO7A 5GINE 2JDOA 5CNOA 4AZSA 3QRJA 5GJGA 1DS5A 3NZ0A 3UVRA 2X4ZA 4C4GA 3MGYA 1UU7A 2FO0A 2HWOA 3GVUA 4FL2A 5HGIA 5AA9A 3JR1A 4CNHA 2WQOA 4FKJA 4FSYA 5K4JA 3MY0A 3S00A 3NW6A 5JGBA 2W7XA 2C6LA 3PXFA 2G2FA 3UIXA 3EIDA 3CKWA 3PXZA 4MK0A 5EK7A 2P2IA 3EL8A 5FG8A 2XIXA 3TN8A 2B9IA 3BRBA 4RMZA 3TV6A 4A9UA 4EH8A 1NXKA 2AQXA 4NWMA 4EHEA 4F0IA 5HTCA 5AA8A 3MA6A 4EJ7A 4TZRA 4MVFA 5I9UA 5M06A 1VYWA 2P2HA 3EOCA 4ZOGA 2PPQA 4NIFB 4PY1A 3FXXA 3QBNA 5AP6A 4GKIA 2C5OA 2UZTA 4ASEA 4AS0A 1ZYJA 1UU3A 4DGLC 5HLPA 2XNEA 4ERWA 2KULA 4WSYA 5GNKA 3KXGA 3ET7A 3L9PA 2R0IA 2R2PA 3WF6A 3OVVA 3PXRA 3R9DA 5AEPA 4FIHA 4W9WA 2E9NA 3FI2A 3R8PA 1DAYA 1YDTE 2BAJA 3UODA 4KINA 3T9TA 3H0YA 4EJNA 3FY2A 5G6VA 3ZONA 5A4LA 5IDPA 3C50A 2YWPA 3BHUA 4S2ZA 2XUUA 4U81A 1NY3A 3LFBA 4B99A 3R7UA 5CXHA 3NMUF 3R7EA 3DA6A 3H9OA 5L8KA 4CQEA 2O8YA 3KF7A 3CS9A 4MD8E 4N4SA 3RMFA 4JBVA 5M4FA 1M52A 3UMWA 4NCTA 4FT0A 3MPAA 2G2IA 5KKRC 3V01A 2R5TA 2VTMA 4BCFA 5KZ0A 4MBJA 5HCYA 1SVHA 4KIOA 4UMQA 1OIUA 3TT0A 5K5NA 4X3JA 2R3HA 3R83A 4CMTA 2VV9A 3IONA 3H9FA 2H9VA 3SRVA 4EK6A 5HORA 1UNLA 2UZUE 3MFUA 2QURA 1WBNA 3QHRA 3TDWA 2EB2A 3FSKA 2QVSE 3VS5A 4F4PA 5J9YA 5CQUA 3AC8A 3KGAA 3GCQA 4OAUC 3TNHA 4LRKA 2I0VA 4O6EA 4F7JA 1OIYA 3NAXA 5C01A 4FJVA 3DZOA 5B2LA 3C51A 2YZAA 3LXKA 2CLQA 4KS7A 4XNEA 3EQIA 2FSLX 3QGWA 1Q8YA 1VR2A 3RPYA 3MPTA 3DPKA 3PIZA 4B8MA 2YERA 3ZTXA 3KN6A 3FI8A 2NPQA 2Q0BA 4JL9A 2WTCA 4HVDA 2OU7A 4G2FA 3OEFX 1BKXA 1PY5A 2J5FA 3W2OA 3MY5A 2ETKA 4BDBA 4A9RA 4U44A 5CSPA 4HPUE 4ONAA 3LOKA 2UW3A 3MI9A 4IAKA 4EH4A 3BYVA 4FR4A 2ITYA 4BDJA 1OBGA 4FV9A 4FKQA 3RZFA 4B9DA 4NM7A 5CVGA 3GNIB 4FNZA 2P33A 4A9SA 3EN9A 5C8KA 4BRXA 2ETRA 5K9IA 4XUFA 2OFVA 3VBWA 1YRPA 1YI4A 5CU3A 4YR8A 4QMMA 4NYEA 2BHHA 4DF3A 2BDFA 3E7OA 4FZDB 2J51A 4FEXA 3QD4A 1WAKA 2VAGA 1LP4A 4MBIA 3C4CA 4QP6A 1RJBA 3GU8A 4MD9E 3ULZA 5CEPA 3TUBA 1A9UA 1L8TA 4O1OA 1OITA 4F65A 2BDWA 4I92A 1GZNA 1OM1A 3VUMA 4CMUA 4FUYA 3LAUA 2V7AA 2BAKA 3TTJA 4C33A 2UW8A 2WTIA 4AZVA 3N4TA 2Y6MA 2OO8X 4JIKA 2IZTA 2FYSA 2ZM4A 3GP0A 2F7EE 4PL5A 3UIUA 4AZEA 2QHNA 4BIEA 2W9FB 3W0MA 2XNPA 3L8SA 5KMOA 2OK1A 4FSNA 3D5VA 4QMPA 3RM6A 5FBOA 4F9AA 2C5YA 2HOGA 3L9LA 3O7LD 4XJ0A 4EK5A 1W8CA 4UMUA 3OCBA 3FYKX 4JI9A 4PQNA 5E7RA 3P79A 3F3ZA 1PXPA 3NCGA 4L44A 4XOZA 5DI1A 5ANDA 3Q5ZA 3UNZA 2QNJA 3UP7A 4WRGA 2UW5A 2JKQA 3C4WA 2G2HA 3KKVA 4RVLA 3LLTA 4H58A 5CAVA 4GRBA 5DWRA 4BWKA 4DFXE 4ALUA 4O7NA 4FX3A 4RA5A 4JG6A 4L42A 3EN4A 1G8KA 2R3RA 5L8JA 4D1XA 3HP5A 5HG5A 3NYOA 2BAQA 4I0TA 5A14A 5FUTA 2Y4IB 3QTIA 3DTWA 2QOOA 4QMWA 2WMUA 4LUDA 4AFJA 1YHSA 1FPUA 4PMPA 5GHVA 5KBQA 4ACHA 5EKOA 4V0GA 3HRCA 4E7WA 1JNKA 1T46A 1XJDA 3WF8A 2QOKA 2WIHA 3E5AA 3OWJA 3NUAA 2BRHA 2J4ZA 2PK9A 3O2MA 4TN6A 5FM3A 3TKHA 4UEUA 3LCDA 1GIJA 5CSVA 5AP5A 3ZU7A 2A98A 1W2CA 5LCKA 2ZOQA 4EOQA 3EH9A 3VS1A 2XF0A 2ITXA 1TQPA 3OCTA 5BVDA 5IZFA 2GNIA 5DN3A 4EHZA 2QKWB 1WVWA 4PWNA 1XQZA 4UWYA 3TTIA 5FTGA 4S31A 4DN5A 2GQSA 3COKA 2QODA 1UWHA 5A4QA 3HL7A 2ITPA 2B7AA 2OICA 5FDXA 1V0OA 1ZMWA 4ERKA 3OXIA 5CEIA 2E9OA 4I20A 1H28A 2BRMA 2XBAA 4U9AA 4M0YA 4O4EA 5IA0A 4MXZA 1G8JA 4GU6A 1Z57A 5DFPA 3N4UA 2PZPA 5CU6A 3UO4A 3ZYAA 2DUVA 4RVTA 3SXFA 1PW2A 5CXZA 4JX3A 4YNEA 3G6GA 3EFJA 3UC3A 3EQRA 4RC2A 4BCHA 1JWHA 2BCJA 4N6ZA 3D4QA 3KVXA 3UQFA 2UW4A 4CLIA 4FTIA 4EH6A 1BL7A 1CKIA 5H8GA 1YXTA 3IG7A 5IQCA 4MAOA 4IDVA 5CVHA 1OKWA 3R1QA 5L3AA 3EQGA 2XVDA 3KRLA 1OUKA 3RKBA 4XBRA 3T8OA 4AXCA 4JR7A 3O8UA 4FKLA 3UDBA 2PE1A 3D2KA 1XH7A 3EHAA 4BDEA 2XEZA 3MBLA 4H3QA 4GT4A 4AX8A 4Y85A 4U42A 5CAOA 2XJ1A 1Q5KA 3E8EA 3FMHA 2CJMA 4UZDA 4YHFA 4BDIA 3P1AA 4QO9A 3F9NA 3PA3A 2FH9A 3HV4A 4FKGA 4IX5A 1W7HA 4E4XA 4TT7A 2JD5A 3DJ5A 4NH1A 4OBQA 5EM8A 5HOAA 4D4RA 5M08A 4C37A 3MFSA 2R3OA 3ORKA 3BQCA 2JC6A 4YPSA 2EWAA 3BKBA 2V0DA 2XK4A 3P7CA 5B2MA 3QX4A 3OWLA 5I4NA 4FSMA 3CP9A 4ANSA 4IWQA 4AXAA 3R7GA 3QD3A 4OUCA 2ZDTA 3DZQA 4U45A 1Q99A 3DK6A 4CT2A 4DHFA 3ORTA 3IKAA 1XBAA 5AUWA 4AW1A 5CU0A 4KKGA 4QOXA 4UN0C 1WVYA 2CPKE 1H0VA 3TWJA 1G3NA 2F4JA 2CHLA 4ZK5A 4QQTA 1O9UA 1R0EA 3KK9A 3R9OA 1R0PA 3RINA 4NSTA 2ONLA 5HBHA 1ZYLA 4RIXB 4HJOA 4WBBB 5AV2A 2BUJA 3M42A 3QQKA 4FSTA 4ZEGA 5HTBA 3JVRA 2XK3A 3GI3A 1JSVA 1M2RA 2B9FA 4YZCA 4BWPA 4MNEB 4N70A 4FKIA 3LZBA 1REKA 2FGIA 3LCSA 2JEDA 3DB6A 1ZOGA 1PXKA 2CCIA 2AUHA 2HAKA 3FKLA 4J98A 4DTBA 1M17A 1Q8UA 3QUDA 3R9HA 1KOAA 3LPBA 4RFMA 5IF1A 5IEYA 1JBPE 4RFYA 4CGAA 1M14A 5CI6A 3BCEA 3Q9YA 4C35A 5E9EA 1ZXEA 2PMNX 4X3FA 3RVGA 5DT3A 2UZLA 2WOUA 5BX0A 2QOLA 2PVNA 4GIHA 5AP3A 1RQQA 4IHPA 3D14A 4HNIA 4GFMA 3W8QA 5BUIA 3S95A 2PUPA 4YZDA 3QFVA 3QYWA 2QOCA 2YM7A 3N51A 2YABA 4HPTE 3E8CA 1ZYSA 4MX9A 1J7LA 5C8NA 4JR3A 2OSCA 1H1WA 4GFOA 5A46A 4E6AA 1MRYA 3EB0A 4XV3A 1MP8A 3QU0A 4EK3A 4LUEA 3BELA 2OJFE 1BI8A 2PVLA 2UVZA 2DYLA 2YDIA 1GIIA 2B53A 4HVGA 3DY7A 4APPA 3NEWA 4IZ7A 1ZY4A 2VX3A 3ORLA 3U8WA 2WZJA 4X6RA 4GV1A 1QPCA 3HDNA 4ALVA 3AOXA 3DFCB 1XO2B 1F3MC 3MIAA 5DPVA 5I5ZA 5FXQA 2BVAA 3OT3A 4L3LA 4FSQA 4PX6A 4F7LA 2AEGA 3BHTA 4U79A 1V0BA 2ZMCA 3LFEA 4PTGA 5DVRA 1PRYA 3MN3A 4IVCA 1UV5A 4GT3A 3HNGA 3WE4A 4ACCA 2BHEA 1J3HA 2Z60A 3CQUA 2XRWA 4X2KA 3R8VA 4O81A 1FBNA 4EHVA 2GS7A 4WKQA 2WU6A 2RG6A 3HX4A 2V5QA 2X7FA 3N9XA 4J95A 5B0XA 4BCOA 3CY2A 3JYAA 1FVVA 5EKNA 2CGVA 3P78A 2PZ5A 2R3MA 2FB8A 3EN6A 3TV4A 3M1SA 5M4IA 1G8SA 3RM7A 3Q2JA 3BE2A 3D0EA 3BHVA 4HCVA 3FL5A 5AFVA 2IW6A 3GU6A 3NSZA 4X2JA 3RAHA 4EWHA 4EYJA 2CDZA 2WEIA 1Z5MA 2W05A 2R7IA 4DG3E 3B8RA 5FEEA 4K77A 2UV2A 3C0HA 4CZTA 4E6QA 3R1YA 2OXDA 4FK6A 3PFYA 5JZJA 4J8NA 4XYFA 5HESA 4DFYA 1ND4A 3LJ1A 3PUFC 2WO6A 4RVMA 4KB8A 3OMVA 4E73A 4GCJA 2XK8A 4J8MA 5AUVA 3VUGA 4GK3A 1WCCA 4FEQA 3C4ZA 4CRSA 4DFUA 3KF4A 2VTAA 2JKMA 5AIKA 3QZIA 3W2PA 3JPVA 4YC8A 4D2RA 1QCFA 3IDPA 5FM2A 5H3QA 4YU2A 4AXEA 3EQPA 4H36A 5JH6A 4FTNA 4ASZA 1KE6A 5K0XA 1Q8TA 4PP9A 2WMSA 1ZZ2A 2WB8A 5J7BA 4TWOA 3RPVA 1A48A 3BPRA 4O21A 4CMOA 4UZHA 2W1IA 3NR9A 1U59A 2PVYA 4PTCA 2H96A 3PA4A 2X6DA 3OC1A 3RTPA 4IB0A 5HBEA 3FI4A 5L8LA 3PJ1A 3UDSA 2CN5A 3ZO1A 3ZSIA 4DCEA 4KAOA 4YC3A 4AXFA 4Y46A 2O5KA 1I09A 2QCSA 4BICA 2UZVA 3DDPA 5A4CA 2ZAZA 3EN7A 3F5PA 3GEQA 3R7IA 1PXLA 4O2PA 4AF3A 3O0GA 4FICA 2RG5A 2X6EA 4O4DA 4YJNA 3UYSA 4ANLA 5AUXA 4FYOA 4ZLZA 5L2TA 4XG8A 4Y5QA 2ZB1A 1M2PA 3QTSA 2ESMA 4GL9A 1J91A 4Y5HA 5J87A 5IDNA 2CKOA 2W9ZB 2G01A 4TWPA 5EOBA 3SLSA 3DXQA 2UVYA 1R78A 4D5KA 1UKHA 2OKRA 2GHGA 2B9HA 2HY81 3VUTA 3OCGA 2XYNA 3IPHA 4FODA 2C1AA 4MWIA 2X7GA 2PZIA 3FAAA 5DH3A 1KUTA 2Z7LA 4HGSA 4U7ZA 2FVDA 1OI9A 1O6YA 1A06A 2RFEA 2XS0A 3S3IA 4C2VA 4E26A 2I0YA 4BTKA 4XH6A 4G3FA 2YZLA 3OWPA 4WG5A 3HRBA 4RJ6A 2BZIB 5DT4A 4G5PA 2X8IA 3R71A 4ZTNA 4JQ7A 2R3JA 3SAYA 4I5MA 2C6MA 4QYGA 4Y95A 4C36A 4NL0A 3BV3A 2X0QA 3FSFA 3I1AA 2BALA 4NW6A 5IKWA 2C5XA 3ZRMA 3VBVA 4YO4A 2CNQA 1FMKA 3ENHA 3TNWA 1YVJA 4D55A 4FTQA 3L8VA 4RPVA 2XBJA 3ORIA 5T3QA 4BIBA 2HWPA 4MTAA 2WTWA 4OTGA 3P5JC 4L6QA 2UW7A 4WG3A 4C62A 4HYUA 4OAVB 4RQKA 3ML1A 3TNPC 5ANEA 5TT7A 5AV4A 3LQ3A 3NIEA 1SZMA 2P55A 3K5VA 3VF9A 3CJGA 5E1SA 4HVHA 3M11A 4PRJA 3O17A 5KZIA 2UZNA 4C02A 4DH1A 2ZFYA 3PIYA 1PKDA 4IAFA 4LV8A 1IAHA 4UV0A 2BIKB 4QP4A 4ZTLA 1E9HA 4X0MA 5M4CA 2C3JA 4RZVA 2ZM3A 2BDJA 5CZIA 2BZHB 3DBCA 5CF4A 4NTSA 1OZ1A 3FLZA 3P7BA 5LWNA 4FEWA 2YIQA 2QOFA 3COHA 4MEDA 4RZWA 4WUNA 4ITJA 4F9CA 1U4DA 5I0BA 5CEKA 3NFGB 2VWXA 5BVKA 4D1SA 5A4TA 5C4KA 1PKGA 5HVKA 2X8DA 4EBVA 2YCFA 3KXHA 4IM0A 4CKJA 3K3IA 3KK8A 5CAPA 4IX6A 4MXYA 2X2MA 4FT7A 2OF2A 4FKTA 4JRVA 4R3CA 3FZPA 2PYWA 4EWQA 1B38A 1QPEA 4U97A 4O0TA 3QC9A 4RFZA 3TXOA 3RPOA 3ELJA 4LV5A 2HELA 5LXMA 4C0TA 2RKUA 5EM5A 1UNHA 3S4QA 1BL6A 1OL1A 4A4XA 4OTDA 2WQMA 2LAVA 3VRYA 3REPA 4JT3A 3TZ7A 1SNXA 3RJCA 4AW5A 2X9FA 4WNOA 3PUPA 2XM9A 1JKTA 5CS6A 5HVYA 4O84A 2OW3A 2FUMA 3QGYA 4M8TA 2PMIA 4K6ZA 4OTWA 1CDKA 2XNOA 4H1MA 4RWLA 3U9CA 3E92A 3KN5A 4CFNA 2H6DA 3R30A 5AR5A 1OKVA 3O8PA 3R01A 3EKKA 4IVBA 4K1BA 5E8TA 3AGLA 4GKHA 3OROA 3WZKA 3TZ9A 2C3IB 2ONLC 2WTVA 5J9ZA 4O0UA 4E4LA 2WD1A 2ITNA 4I22A 4E6DA 2QHMA 5HLNA 3OTVA 4LMUA 5EI8A 4FIIA 3Q4UA 5DLSA 4OLIA 1YQJA 2VTTA 3KY2A 4G6NA 3BYSA 1MQBA 3QCQA 5GJDA 4CKRA 1P4OA 2X39A 4L52A 3HECA 4LQMA 4XLVA 3D7TA 3QXOA 3MVMA 4DC2A 4ZSAA 4GG5A 4IAAA 2OZOA 5D9HA 3UG2A 2O64A 3ALOA 5D10A 2IVUA 2WGJA 3G6HA 4WOVA 4GYGA 4GG7A 4X3FC 3UVQA 3EFWA 3UP2A 4BI0A 3UDZA 3HVCA 2XNNA 3D83A 1RW8A 2BTSA 3KVWA 3LIJA 4FL1A 2R3QA 2VTNA 2PVRA 1ZLTA 3O71A 4OT6A 3BWFA 5L2QA 2NO3A 4YZ9A 3ZXTA 2NRUA 2VO7A 2OJJA 2ZV8A 3R73A 3THBA 4M69A 5M53A 3G90X 4QMLA 2WTKB 2QOIA 3LJ2A 3C9WA 3G33A 4F09A 5AUUA 4ASXA 5ANGA 1YKRA 3C5UA 3CJFA 2UW9A 1R39A 4XCUA 4BTMA 5BUJA 2XZSA 3VQUA 2ERKA 3HEGA 2R3IA 2Z2WA 5AR2A 2J0KA 4RJ7A 3OG7A 4A4OA 5TOZA 4EOSA 2R9SA 2PE0A 3ANRA 4EHGA 3DCVA 4AW2A 3HV5A 2QLQA 3D2IA 3H0ZA 4DEHA 5CEOA 3MSSA 3Q6UA 5KMLA 3Q5IA 2IW8A 4H05A 2HW7A 4QPSA 3ODZX 4S33A 3OXTA 5HD7A 2WNTA 4BKYA 4HVSA 2XCHA 4OTRA 3VJNA 2C0TA 4GW8A 4JX7A 4GMYA 5I9ZA 3BYMA 5JFVA 3TDVA 3GBZA 1JVPP 3ANQA 4CLJA 5AR7A 4NW5A 4JG8A 5HI2A 3RAWA 3FJQE 4D28A 4U3ZA 3RPRA 5D12A 3LFAA 4O6LA 1QMZA 4BI2A 3R0TA 3FE3A 4FKSA 3ZC5A 3OCSA 4C7TA 4IAIA 1UU9A 4O0RA 4P4CA 4AA0A 4G9CA 5JZNA 3ZLXA 4XS2A 3NUYA 3ZM9A 4G3DA 4HW7A 3QRTA 3GB2A 1YDRE 4ASDA 2X81A 2YCQA 4JDHA 3CGOA 3PRFA 5HE0A 1H08A 1UA2A 3MYGA 1YXSA 3KFAA 3ERKA 1KE9A 3AMAA 4R3RA 5FP5A 4MXCA 3H4JA 1XH4A 1FVTA 4CRLA 2WELA 2O0UA 4NJDA 2UZBA 4FKOA 2JAVA 4G5JA 5HX6A 2XKFA 2JBPA 3ZCLA 4FYNA 4RVKA 3P5KA 3ZUUA 4EKKA 2A19B 2RFSA 3R7YA 4U41A 2OLCA 3NRMA 3G9NA 2VTJA 3KMUA 4BDHA 2NRYA 2VZ6A 4OBOA 3FXZA 3QL8A 4BCGA 3UTOA 4FTKA 4NM0A 2OZAB 4QYHA 4QPAA 5EDRA 2GCDA 4YO6A 5KMNA 4RA4A 2W1GA 3BGPA 1XBBA 2JGZA 5E92A 3E62A 5DBXA 5FD2A 1PJKA 5C8MA 4DA5A 4RX8A 3JS2A 3E87A 5AAEA 4L67A 3K3JA 1OKZA 3B8QA 2YIWA 4EONA 3P9JA 4RIOA 1K9AA 4O22A 5CYIA 1JKSA 4TYEA 4A06A 4DH5A 4APCA 4NZWB 5CEMA 2YEXA 4ZTHA 4I6QA 2HY0A 3HV3A 3H30A 3E3BX 4RJ3A 4FKWA 3VUKA 1XH9A 2IW9A 4I3ZA 4L3JA 3BU5A 5JK3A 1ATPE 4YBKA 3GUBA 5BQ0A 4OW8A 3HP2A 4ALWA 4CYIA 2X0PA 4Z9LA 4K2RA 3JVSA 2C6TA 1PHKA 2QLUA 2Y9QA 3HZTA 5ETIA 3DS6A 4AGWA 4ZS0A 2OI4X 3T3VA 4ZXTA 2GQGA 3UG1A 5BVOA 4EK8A 4BF2A 3PWDA 4G9RA 2FSOX 3VAPA 3E7VA 1KSWA 1LR4A 3E8DA 3KIOC 3L9MA 4BGHA 4GH2A 4PNIA 2VUWA 3NLBA 3POZA 4R5SA 4TNBA 5KHWA 3MVHA 5EYMA 4D4YA 3UBDA 4D5HA 4C3RA 2YM4A 2UZOA 3I79A 3IQ7A 3LKMA 3SW4A 3NFFB 1WVXA 4CXAA 3SW7A 5M56A 2IO6A 4I4EA 3F2RA 3O8TA 2YLEA 4RC3A 2UW6A 1PXOA 3NVKI 4C4IA 3KL8A 5CF5A 3BLAA 4KSPA 3ALNA 3QQUA 2XRUA 5M4UA 4NT4A 3ORPA 4F6SA 4ZTRA 4AN2A 2GFSA 3UC4A 1L3RE 5HG8A 3PSCA 4X2FA 5E8WA 5EG3A 4AOTA 4DITA 3DT1A 3KXNA 3ORNA 2HZ4A 4FTMA 5ANIA 3WIGA 2CN8A 3OBGA 5EHLA 4AZFA 4EQMA 3IOKA 3G15A 1YDSE 4LGDA 4PMMA 2GNHA 4EUUA 4ZJVA 3Q6WA 1TFFA 1Q61A 4ZJIA 1FGIA 4D2TA 4A07A 3FHRA 4FTJA 3SXRA 3PY1A 3TMOA 4J99A 3AD4A 3R2BA 4J1RA 5EDPA 4G34A 4DH7A 3GU5A 2CMWA 5LWMA 3MTLA 4IAYA 1HCKA 2BFYA 5G1XA 3FQEA 4KBAA 2UZEA 1G5SA 3U4WA 1QPJA 3Q2MA 3QQGA 3SHEA 4D4VA 4DBNA 2HZ0A 2OWBA 3ORZA 5IA1A 3PZHA 3ZBXA 2GNLA 4NK9A 2W99B 4UY9A 4DLIA 5J7HA 5CALA 4EORA 3F88A 1J1CA 3TACA 3AC4A 3LM0A 2J90A 4BIDA 1YOMA 4V05A 1K2PA 1Q97A 4ZLOA 3W0NA 2P0CA 4YTHA