5BUIA

Erk2 complexed with 2-pyridiyl tetrahydroazaindazole
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
338
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 111
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5buiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5buiA01
4EZ5A 2XK9A 4F63A 3LMHA 4DTBA 3QZIA 4Z55A 2B54A 3JVRA 4CKIA 2VTSA 4BN1A 1BLXA 2EXCX 4B7TA 3FMJA 2F2UA 4ID7A 4A9TA 4QTEA 4Y73A 4AOIA 3TIZA 4JJRA 1B39A 4IDVA 3OF0A 4JIAA 4I93A 4UYAA 3V8SA 2B9IA 1BKXA 1G8AA 2OJIA 4E6AA 5CASA 4FSRA 4W4XA 1JSTA 2X9FA 4V0GA 4XMOA 1MP8A 3MY5A 3FZSA 4FMQA 2A2AA 2BR1A 4EZ7A 4R7BA 3FJQE 5B2MA 4XG3A 2JFLA 3BHYA 5ACBC 1A9UA 3NDMA 4YJTA 3W2OA 3FMMA 4BGQA 4N57A 5IQDA 4TYEA 4V0GB 3C5UA 2IO6A 2R64A 2CNUA 5K0XA 4Q9ZA 3GC8A 2ITYA 1YXXA 5I5ZA 4GSBA 3P4KA 1JOWB 5CVGA 2HWOA 1Q5KA 5HI2A 4KBAA 4AFJA 3S1HA 2WOTA 3MH3A 1ZAOA 3KF7A 1LPUA 2NRUA 3FSKA 4FL1A 5LVPA 4ACGA 5J9YA 2ITTA 4IFCA 1HCLA 3FXWA 3V5WA 2VN9A 5AX9A 4CQEA 5IA4A 5TR6A 4HGSA 4USEA 3FI8A 3VS0A 4UMTA 2CJMA 2PWLA 1MQ4A 1IASA 2Q0NA 2W06A 3EFJA 3EH9A 3FUPA 4K18A 4U3ZA 5AM7A 3WF7A 4BCFA 4DFUA 3OEZA 4HYSA 3UODA 1HOWA 1GOLA 4UN0C 5CAQA 4TWCA 5DEWA 2XKFA 1LEWA 1LUFA 4JBPA 2GNHA 3QXOA 2R3RA 5A46A 4F9YA 4F7LA 3DU8A 4BI0A 5CNOA 2XYUA 3NR9A 2BFXA 3PIZA 5HCYA 2Z60A 4O96A 4LOOA 3ZUVA 4BBMA 4FTNA 4APPA 3FI3A 4CMOA 2W05A 3HRFA 4RMZA 3RAWA 4E7WA 1ZY4A 5CSPA 1YOLA 3NS9A 2V7AA 1QL6A 4IVDA 5CVHA 3VC4A 4CZYB 3HDMA 3ID6C 4N6ZA 3UO5A 1H4LA 4RX5A 2P4IA 3ZSIA 3QQKA 1W0XC 5HIBA 4FTAA 3A60A 5HVJA 3FLZA 2FSTX 4I5PA 3I1AA 1U4DA 1YXTA 2YM6A 4FKWA 3VW8A 4CGAA 1JVPP 1A06A 2G2HA 4YJQA 3RK7A 2BZJA 3G9NA 3RCJA 2YWVA 4OTGA 4R77A 4E5BA 3FQSA 5CVFA 4F6SA 3LE6A 5F1ZA 2C5OA 3NX8A 1OPKA 4F99A 1PMUA 3EN4A 3QHWA 4CQGA 4ERWA 5CQUA 4A9YA 4CYJA 4U6RA 3R8LA 5EKNA 3GCVA 4BDKA 1OL2A 3VBTA 4PRJA 5IEXA 3QRJA 2XIYA 5DR6A 3PSBA 4FVQA 3UC4A 5AA9A 4RC4A 2R3PA 3F3UA 4BTFA 1WCCA 3CLYA 5AIRA 3SVVA 4GVAA 3PFQA 4K0YA 4F65A 2AC3A 2PVRA 3QAME 3Q6WA 3V8WA 4ZAUA 5KHWA 2XNEA 2CKOA 2A0CX 3CQEA 3EQHA 1Q8WA 3RK9A 3BCEA 2BRNA 2EB3A 4S32A 4YMJA 3NYXA 4FA2A 3WIGA 3ZC6A 5EK7A 4E4LA 4QMQA 4J8MA 3TNHA 3RNYA 4EH5A 2IVVA 3N4TA 2QOBA 4TWNA 3VN9A 5LVLA 4JG7A 5HNGA 4PDYA 1TKIA 1OM1A 4DTAA 3DBDA 3EMGA 1H1PA 3CKWA 4O2PA 3UOKA 5GJGA 3F9NA 2WTCA 3WOWA 3EL7A 4ANSA 3DPKA 5FGKA 4PQNA 3F69A 3SG8A 4RQKA 5IG1A 3DFCB 3F2RA 5EKOA 4OUCA 5HU3A 3CD8A 4WUNA 1WVWA 4X6QC 1I09A 4ASZA 1VYZA 3C4CA 4XV3A 5T6KA 2WMTA 4LMUA 2J51A 5HD7A 1UNGA 5IU2A 1VR2A 3IK3A 4YC8A 3VS2A 3TZ7A 1NY3A 3PA4A 3R2YA 2R9SA 5E91A 5LARA 3GU5A 1H07A 2CCHA 4XG7A 4C8BA 5IH4A 1JKSA 3D4QA 4NJDA 5EDRA 4C36A 1ZMUA 5H8EA 5L6PA 4Q5EA 3BQCA 3A7JA 3JVSA 3OC1A 4NW5A 3Q9XA 3C1XA 3U4WA 2JDOA 4FIFA 3G51A 4M7IA 5EG3A 1PMEA 5J87A 3WZEA 3T3VA 3L9NA 4RIXB 5ANGA 4C37A 1V1KA 2R3NA 4AW5A 3PZHA 3PIXA 2YCSA 4JRNA 4ZMFA 3UZPA 3R7GA 4BGHA 3BHHA 3EN6A 5M51A 3Q2MA 4U42A 3WZJA 3POZA 4IAKA 4M69A 3GUBA 5DT0A 2W1ZA 4QOXA 2QKRA 4JDHA 2XJ1A 3QCSA 4E4MA 5A4QA 4XCUA 2VV9A 1UNLA 2WQBA 4MXYA 4N4SA 3VBWA 1UKHA 4G1WA 1GIIA 4M69B 4CVAA 2NP8A 4HPUE 4JX3A 2C0OA 3ZRLA 3BWFA 4GFMA 3BZ3A 2BVAA 3F3ZA 4UMQA 4XV1A 3TIYA 5I9WA 5JEBA 4Z7HA 4RJ7A 4F6UA 1MUOA 5EYCA 2QG7A 2ITUA 3ZS5A 2P3GX 3P7BA 4RPVA 3U6IA 2W1EA 1FVTA 4YLLA 1YHWA 4QTBA 4DFNA 1Z57A 5ANIA 2OFUA 2WQEA 3BYOA 3CY2A 3MH2A 2PE0A 3DB6A 3I7CA 2Y8OA 3ODYX 2J2IB 3PXFA 4KIKA 1KOAA 4F4PA 3DS6A 4K6ZA 4K2RA 3W18A 3ZEWA 3MY0A 5HE2A 3KREA 1PMVA 2I40A 2NPQA 4ZSEA 3I0QA 5HG9A 4Y83A 5AP7A 5EHLA 4EWHA 5DT3A 4FTTA 4LYNA 3KCFA 4DGOA 2XKEA 3QZHA 4FNXA 5J9ZA 5ANDA 3N4VA 3NUAA 2VX1A 4QTDA 3HA8A 5DHJA 4RX7A 3ZFMA 4O7WA 4EKKA 5A4CA 5AAEA 4I21A 5AV2A 3EIDA 4JOAA 1URWA 3R7YA 5F9EA 4FE2A 4BDDA 3NRMA 3C0HA 4TRLA 3HKOA 3VBXA 3NVMB 3NMUF 3BV2A 4D1SA 5LVMA 3PP1A 3PJ8A 2VX0A 3QF9A 4XV2A 3UG1A 5HZNA 3C5IA 4L00A 5FTQA 4AGCA 2YDIA 3WILA 4EZ3A 2PMOX 3EZVA 3QCYA 3E5AA 3HEGA 4Z9LA 4RLKA 3UPXA 5BVFA 3TDVA 3FXZA 2VO6A 3PVUA 2JDSA 5D1JA 2X4ZA 4E73A 1BL6A 3NUXA 2ZB0A 3QQFA 5HORA 3HAVA 4GT3A 5M08A 3AD6A 4TYHA 3DKFA 4IX4A 3KRLA 3PY1A 4P4CA 3EKKA 3AGLA 3EKNA 4I92A 3ZLWA 2ACXA 2YIXA 3O0GA 4AA0A 4FKQA 3PVGA 3PXRA 3QX4A 4W4VA 3GB2A 1PMNA 4LRMA 4AW2A 4TL0A 5EW9A 2R3FA 3TNQB 2FYSA 3NUPA 4RC3A 2XM8A 1P4FA 5IQGA 4Z7GA 3RBWA 4AZEA 3OBJA 3V01A 1FMOE 4FG8A 5HNBA 1EH4A 5HTBA 2UZVA 4O91A 3Q04A 4TYGA 5CWZA 4B8LA 3BRBA 4MD8E 5HE3A 1H00A 4DE4A 3AD4A 4RJ6A 4FSUA 2WTVA 5BVEA 4G5JA 2BKZA 3OXIA 4CXAA 1J91A 2ERKA 4UXLA 5BPYA 3CR0A 2QR7A 3R83A 1OL6A 3E63A 2VWYA 1IA9A 3CQUA 4WOVA 3E3PA 4YPDA 4E5WA 1NW1A 4FTKA 4R78A 5D7AA 2HY81 5LCKA 4D28A 3PRFA 4B0GA 3A8XA 2FUMA 2WTJA 3EHAA 2CSNA 4PMPA 4FGBA 2BIYA 4QQTA 3I4BA 3G2FA 4L43A 4CSVA 5EYDA 2QQ7A 4L44A 5L6WL 3R1YA 4QMOA 4WNKA 2J4ZA 4DFLA 2OWBA 4DGGA 4TTHB 4W9XA 3RZBA 4CMTA 1CSNA 5CS6A 3NGAA 2E9UA 2OZAA 2EXMA 3HMPA 3TJCA 5IQCA 3KMMA 4AZTA 4MQ2A 4RJ5A 1QPDA 4D55A 2QOHA 3PYYA 5CZIA 4KD1A 2OZAB 3D94A 1NVRA 2P55A 4ARKA 5CF6A 3GCSA 3NWWA 4Q5HA 4HVGA 5HIEA 3LCDA 1BI7A 5EFQA 3HV4A 3QKKA 4DEBA 4EH4A 4FOCA 5HE0A 4QD6A 4H05A 4J52A 5J95A 3NW6A 4BHNA 4DEAA 4EKLA 2FH9A 1TQPA 3E64A 4ZJVA 2V0DA 2QKWB 3M2WA 1W84A 4I0TA 3T3UA 4CNHA 5DMZA 4BIEA 4DA5A 4YZMA 5HGIA 2IZUA 4G6OA 4G3CA 4EH7A 4ALWA 2X6DA 2VU3A 4R3PA 4B8MA 3PPJA 2ITWA 1QCFA 2C3JA 3C4EA 3DBFA 1JLUE 3CIKA 3HL7A 3AMBA 3P86A 1UV5A 3GCQA 4HNFA 2HZNA 4QNYA 1H1WA 1UU9A 3I81A 4QO9A 5JQ8A 4C3RA 3F3TA 4O6EA 5ANJA 4JRVA 3QKLA 3PJ3A 2QC6A 4O81A 1YI3A 1FBNA 3G9LX 4RIYB 4IAAA 4RVMA 4JXFA 3TN8A 2IVUA 4TWPA 2GCDA 4FL3A 5A9UA 4GL9A 2QOIA 3CCNA 3I6WA 3F2AA 2UW9A 4FUXA 5HO8A 5IISA 5L2WA 5M53A 4IVAA 3T9TA 5M4UA 4DG3E 4QYYA 4IX3A 5H8BA 5HG5A 3C4XA 4ZTHA 5BYZA 4EBVA 3LFQA 2Y9QA 3UNJA 2BHHA 3A61A 2UW3A 2UZLA 2R0IA 3CGOA 3NUNA 2BDFA 4GT5A 2ZV9A 2RFDA 5DRBA 3CC6A 3D2IA 3H3CA 1V0BA 2ITXA 3G6GA 1YKRA 4NW6A 3ZH8A 2A1AB 2WU6A 3TUBA 4HVSA 1SVEA 5JMSA 1KE7A 3O50A 4Y95A 3QC9A 3KRRA 4IAYA 3PSDA 4LFIA 5EQYA 4GK3A 3HUCA 2QOCA 2VWWA 2PYWA 5AV1A 3AT2A 5AP4A 2W7XA 1O6KA 2G15A 2I6LA 4FIIA 1K9AA 1QMZA 3WARA 4II5A 1X8BA 3II5A 3ZDUA 4FIHA 3OBGA 1ZARA 3UGCA 1WAKA 3VAPA 4FKIA 3PXQA 4C4IA 1SM2A 4UWYA 3OY3A 5CI6A 3TNPC 1XBAA 3OXTA 5CAVA 3I5ZA 4OTPA 4S33A 4FSWA 5TE0A 2IW9A 2R7BA 4GH2A 3LQ3A 4AG8A 4ZTLA 2VWXA 1PXPA 3S2PA 4EQCA 5FUTA 1P2AA 3F5PA 3P9JA 4EC8A 4YZCA 2C0IA 2VNWA 4DH5A 3DJ7A 3ZOSA 5C1QB 4RLLA 2XJ2A 2QG5A 2JAVA 1Y8GA 4UZDA 3UP7A 5GIPE 5FP5A 4OBQA 2G9XA 3DY7A 3KQ7A 5KBRA 3TM0A 2QCSA 1M7NA 3RHXA 2OIQA 4WG4A 2XMYA 3BHVA 5DPVA 3BIZA 4W9WA 3PE1A 4B4LA 4FEXA 5FEDA 3EQPA 4OBPA 3NEWA 5HO6A 2H9VA 5BVOA 5CEMA 3BGPA 4BDHA 3IOPA 3A4OX 2YERA 3NUSA 3QQGA 1XH9A 2IVSA 4NM5A 4CD0A 4I23A 5A4TA 4RIWB 4YJUA 5HTIA 5BYLA 3JPVA 1AD5A 3ALOA 4C61A 2YISA 2OFVA 3KXXA 3R71A 2J0JA 3QBNA 1WFCA 3NNVA 2ITZA 4PL5A 5IDNA 3ODZX 5J5TA 2XRWA 3IECA 3QTRA 4P7EA 5DBXA 2UVXA 5ANEA 2CN8A 2A19B 2WMQA 4C58A 3U9NA 3BU5A 2Q0BA 4JBQA 4UMPA 2WU7A 3QYWA 3NYOA 4DG0E 2VX3A 1YI6A 3THBA 3ZO4A 2QU6A 3W2PA 3L8PA 5CEKA 3U6JA 4WSQA 5CNNA 4EH2A 1M52A 2DYLA 2PZRA 4FTUA 2ZAZA 5DVRA 3C0IA 4EJNA 2Y4IB 4ZMEA 5KZIA 3CTJA 5KNJA 4YJVA 4TW9A 4KSPA 3PXKA 4HVDA 5FP6A 4O7ZA 4DFBA 2XCKA 4NM3A 3GENA 5EI8A 2O63A 5BVKA 4D5HA 4EH8A 2CNQA 4BYIA 2X7OA 4IVCA 4NTSA 3RTPA 4UMUA 3ATTA 3KXHA 1U5RA 3WYXA 1H0VA 5FDPA 5M57A 1WBVA 1CKJA 4LOPA 2Z7QA 2PY3A 3DTWA 5C8KA 3TXOA 4R7IA 3A7HA 4PUZA 2ITQA 2IN6A 2ONLA 3PY3A 4JDKA 4M66A 3DJ6A 4K11A 4C3FA 4BZDA 4C4GA 2YA9A 4QTCA 5E8SA 3TKHA 3WZDA 3OW3A 2OIBA 2FSOX 3G15A 1DAYA 2WQMA 3DXNA 2DS1A 3ORTA 2R3GA 1ZXEA 3KKVA 4I0RA 5CT7A 4EOKA 2FGIA 3IDBA 3VUMA 4ACMA 4GKIA 4KKHA 1OUKA 3NW5A 4W8EA 4FSMA 5L3AA 5FBOA 2IVTA 3ZZEA 3OOMA 4A06A 1XBCA 4FVPA 4J1RA 4CFXA 3CY3A 3Q4ZA 3ZTXA 5M4IA 3UTOA 4BDAA 2C3IB 3Q4TA 1ZYJA 3VUTA 3EN9A 5EM7A 4UXQA 3VJOA 1WBWA 2Y6MA 5F95A 3R63A 4QMXA 4XBRA 1TQMA 3KN5A 1OIQA 3MA3A 3TTJA 4H1MA 3DV3A 1PKDA 4NFMA 2LAVA 2XBAA 4BCPA 4EUUA 1YOMA 3QTXA 4I20A 4U8ZA 4DN5A 1WBNA 5CU2A 4AA4A 2C6LA 5I4NA 2AUHA 2ZOQA 3JXWA 3UYSA 5HCZA 4UMRA 3V3VA 4NM7A 3EN7A 4FKUA 4JG8A 5EM8A 3LPBA 2Z7SA 4X2NA 3W33A 5AUTA 4DAWA 4XP0A 2VTPA 2EB2A 1YDTE 5CI7A 4FYNA 3COMA 3BLHA 4YNOA 5CF8A 2FSMX 2XNMA 1YWNA 3AC5A 4HYIA 4AUAA 4BC6A 4FGRA 3Q4CA 3FMLA 3MWUA 3ERKA 4YSMA 4DG2E 5IPJA 3L8VA 4F0IA 4KBCA 4FSQA 2X2MA 4CRSA 1M17A 3SD0A 4FV5A 4OTRA 5BUIA 4EOIA 1DM2A 3PUPA 5IKWA 5C8NA 3T8OA 2J0KA 4P90A 2UW7A 4CFVA 1R0PA 2W9ZB 3HP5A 2C6IA 2PVJA 1AQ1A 3DZOA 2PVKA 3EQBA 3NPCA 3ORIA 4MBIA 1FOTA 3OT8A 3FC2A 4MF1A 3TKUA 5AP0A 1NT2A 2YFXA 3WF6A 2XKCA 3VS7A 4YNEA 2XS0A 5D12A 4OR5A 4AXAA 1SNXA 2CGXA 3MFSA 4WD5A 4QNAA 2EVAA 5T68A 4LOQA 3PY0A 4PX6A 4DEIA 3GXLA 4QMMA 1LEZA 3P0MA 5CEQA 2ESMA 2YM7A 5FBNC 5H8GA 5IZFA 3ZM9A 2Q83A 3EL8A 2PVYA 4RVTA 3UYTA 1LR4A 5CU4A 3BELA 2F7XE 5CSVA 4D5KA 4TWOA 3ULZA 4FEWA 5K4JA 4FIEA 1TQIA 4DH3A 3Q4UA 5JGBA 4E4XA 3QX2A 1UWHA 2NO3A 2WD1A 3PJCA 4AE9A 5AV3A 2XNOA 4O1OA 1PJKA 4JX7A 4QP2A 4FSTA 4F7NA 1OVEA 3D7TA 3F5XA 5D10A 4AOTA 4F9CA 3KULA 2B4SB 4IB1A 2QODA 4YHJA 2XF0A 3DOGA 3UQCA 4ALVA 4YSJA 2QURA 3SRVA 3NAYA 5L2TA 4JR7A 4I0SA 3CXWA 4UYNA 3K54A 4PP9A 4FKSA 2VAGA 2JGZA 3SW4A 3IW8A 4F6WA 3FZTA 4YHFA 2BTRA 4HGTA 3G0FA 1ZYSA 5AUWA 3B2TA 4OTHA 2YJSA 4JDJA 3IQ7A 5FM3A 3RVGA 1URCA 3KVXA 1XQZA 4H36A 4ZOGA 3VBVA 3L9PA 3KA0A 4FOBA 5FDXA 3W16A 3S00A 2RFNA 3IGGA 3OMVA 4GFOA 2WXVA 3H0YA 2PTKA 3OY1A 4FV3A 4LRJA 5EHYA 3CJGA 2F57A 4R7HA 2PK9A 4E20A 5KKRB 3JUHA 3ETAA 4AT3A 4BCNA 5L2IA 3R02A 4L3LA 5HCXA 1IAHA 2W17A 2WAJA 2XIXA 4U44A 4FTCA 4I24A 4IJ9A 4L01A 5IMXA 5AP1A 4G16A 4DT9A 2PMLX 5LOHA 3TL8A 4NJ3A 2DWBA 4IAIA 4UEUA 5I9VA 3MTFA 2R3LA 4PDPA 3FE3A 3QGWA 5A6NA 4FTIA 3MSSA 3QUPA 2E9PA 4XH6A 3DDQA 4JQ8A 4D0XA 5AUXA 4AU8A 2WMXA 3LAUA 2EWAA 3LZBA 5EYMA 4APCA 2GHGA 2W1CA 1XH5A 3R22A 5G1XA 3UVPA 1J7UA 3DXQA 2UVZA 4FG7A 3ZEPA 4FC0A 5EHOA 1IR3A 4EYMA 5C03A 4FYOA 4F1OA 3DLZA 4O0WA 4DCAA 3PJ2A 3FLSA 1ZOGA 3FY0A 4YGAA 3R9DA 4LMNA 4GW8A 4ENYA 4EONA 5CY3A 5K5XA 2VO7A 2UW0A 2RL5A 5CZHA 2HW7A 2HCKA 2GTMA 2OJGA 3FDNA 3MJ2A 4L67A 2WFYA 4Q9SA 3TZMA 4AA5A 4IB0A 4AOJA 5DIAA 3LVPA 2JAMA 1P4OA 5M44A 3B2WA 2ZJWA 2WTKC 4GT4A 2F7EE 1TVOA 5DGZA 2HW6A 4O0VA 3ALNA 4X3JA 4FKPA 2BCJA 3EQCA 3QZFA 4ZSLA 4DH7A 1OKYA 2YHVA 5LQFA 4ZTMA 2WEIA 2B1PA 4FKRA 3KCKA 2JKOA 4WHZA 4O0YA 4OW8A 4G2FA 3HDNA 2WEVA 2X1NA 5F4NA 3PPZA 3HMIA 3KXNA 2UVYA 2UZNA 2P0CA 5AAGA 3GGFA 5HICA 1Q3WA 3V8TA 1ZZ2A 4H58A 2W5BA 4BKYA 2VGPA 4D9TA 2YIYA 2PZYA 2CKPA 1ZYDA 5I9ZA 4YO6A 3UP2A 3LJ0A 3Q9YA 4C62A 1ATPE 3DB8A 4J98A 4LGHA 4ASDA 4D0WA 1Z5MA 2BZIB 4X2GA 3ENHA 5ETCA 5LVOA 4HVHA 3QA8A 3W2QA 5K9IA 2J5EA 4FIGA 2PHKA 4LI5A 1B6CB 3OUNB 4YTIA 5E9EA 3HVCA 2ZM1A 3P79A 3V5LA 1KV2A 3BBTB 4PPAA 4MQ1A 3FKNA 5AA8A 2WO6A 4BTJA 4BF2A 2X6EA 4FSZA 5CLPA 4FTMA 4KB8A 4PMTA 5JFSA 2PUIA 4JT3A 2CN5A 2GHMA 4L52A 2RGPA 4MXAA 4ONAA 2YLEA 4MWHA 1MQBA 4ACDA 2QHNA 5EI6A 4FNYA 5IA0A 5M4CA 4YC3A 4FKTA 4ZLZA 4FTLA 3CGFA 2OLCA 2OH0E 4D2PA 4ITHA 2Y0AA 4IVBA 1REJA 3HMOA 4FL2A 5E7RA 3RWPA 2WTDA 4RG0A 2OK1A 5AR5A 3RINA 4C4HA 2C5XA 2C6MA 2DUVA 3OWLA 4QYHA 1Y6AA 4GS6A 3TTIA 3MVJA 5IQEA 1OIYA 4CTCA 2R3HA 2W9FB 2X2LA 5E92A 2RIOA 5L8KA 4AQCA 2VTLA 4AZFA 3VS5A 4LV8A 3V5QA 5EYKA 4DBNA 2B52A 1R39A 2UZUE 3UIBA 3VS1A 4C3PA 3I60A 5L8JA 2XEZA 3U8WA 4IX5A 5I9YA 4V05A 3DNEA 3GU7A 5I3OA 2SRCA 1GIHA 2C68A 4ZS4A 5C9CA 5FTOA 1PHKA 1XHAA 2WZJA 2G01A 4GKHA 4IM0A 4QP3A 3OFMA 3ORXA 4AF3A 3CBLA 3KMUA 4GK2A 2BAJA 1QPJA 3TACA 3ANQA 1PYEA 5CXZA 1Q99A 3D14A 4IEBA 1WBPA 4W8DA 1R3CA 5CSHA 4QP1A 4QMPA 4WBOA 5BMMA 3RNIA 3PXZA 1REKA 3POOA 3HLLA 2PUPA 2H8HA 4WKQA 4CLIA 4EBWA 2BZHB 3CTHA 4GJ3A 1SZMA 5HHWA 3SLSA 4E1ZA 4F7SA 5ANKA 2AYPA 5CAPA 5IQBA 5HIDA 3RAHA 2WPAA 3UNZA 2BAQA 1V0OA 1WZYA 3W8LA 5ETFA 4IWPA 1BUHA 3TI1A 3ATSA 5HNIX 3D9VA 1NXKA 4F0FA 3UQFA 5J1WA 1JWHA 4NWMA 3OCGA 5DRDA 2VTIA 4FT0A 2X81A 4X3FA 3PE2A 1L3RE 1FVVA 4O27B 5AR7A 2HZ0A 2PVMA 1IG1A 2BPMA 2OXDA 4WSYA 2AC5A 2W96B 4QP9A 3UDBA 3GC9A 2VWIA 3MVHA 5KMIA 5AR4A 3EQFA 2GS6A 2F49A 4BCGA 3HNGA 2R5TA 4U40A 2YIRA 4YTFA 4GMYA 2BAKA 4KIKB 2R3QA 2XK8A 4ZY5A 5A4LA 2PE1A 3GBZA 2Z8CA 1H24A 5TT7A 2W1FA 1G5SA 2FO0A 5HG8A 5HVKA 2Z7LA 3OEFX 1UWJA 3Q3BA 4CCBA 5A4EA 3L9LA 2XBJA 5M09A 4FV0A 5DI1A 3UVQA 1RW8A 4DYMA 2QONA 1OKVA 4WIHA 4F1MA 4D2TA 1OECA 2BALA 2QNJA 3IDCA 3PG1A 3T9IA 3TNIA 2VTQA 5DA3A 5DG5A 2WMSA 3Q5IA 5KMMA 1WVYA 3FWQA 2GNLA 1KSWA 1YHSA 3IW6A 4JLCA 3MA6A 2QHMA 1ZWSA 1M2PA 2HENA 2OJ9A 5CSXA 4M68A 5L2SA 4L3JA 4I5CA 3R7UA 2KTYA 3FZ1A 1OGUA 3RKBA 3VJNA 4UWBA 3BGZA 3O8PA 2ETRA 3EOCA 3E62A 1UU7A 3ZCLA 4RT7A 5KBQA 5L6OA 2C0TA 2UZWE 2OKRA 3EFWA 3WBLA 5J1VA 2HWPA 1E1VA 2UW8A 4EHGA 3GI3A 2Y4IC 4DGNA 1ZMWA 5IA3A 4TYHB 2WHBA 5AFVA 3QCQA 2C69A 2XNNA 2VWUA 5EOBA 3TV6A 4FEQA 3COHA 1JSVA 4IAFA 3K5UA 4R3CA 3A2CA 4NH1A 3TDWA 2YCQA 2PVHA 4F9WA 1S9JA 2QOFA 3LXKA 5FXQA 4OBOA 5KZ0A 4OAUC 5DE2A 4O7SA 4M8TA 4QTAA 4ANLA 3U9CA 4AX8A 4BRXA 2IZRA 3TUDA 4KKEA 3REPA 1Y91A 2EXEA 3FMDA 4D58A 3C4ZA 2C47A 5LVNA 1SMHA 2WIPA 3PTGA 3ROCA 1Q97A 2ONLC 4FODA 4X2KA 3V5JA 4EQUA 2ZYBA 5C01A 3F88A 3VS6A 4XRLA 2PU8A 3MFRA 4G17A 3ZXZA 1FGKA 4C0TA 3DK7A 1JNKA 2VTTA 4DT8A 3U55A 2WTKB 3HA6A 4JQ7A 4O6LA 4PDSA 3K2LA 1V0PA 2HZIA 4D9UA 5E90A 2YM8A 5CAUA 2UZDA 3QLFA 4J97A 2PUNA 2XZSA 3UNKA 4NYEA 2GHLA 2HOGA 4MAOA 2YZAA 3W2CA 4DLJA 3H30A 5IQHA 5KE0A 3A99A 4ANNA 2ZB1A 4M3QA 3RCDA 2J7TA 2ZV7A 3FZOA 4MWIA 3OS3A 3F82A 4C57A 1DI9A 1XWSA 4BL1A 2HXQA 3GCPA 3WF9A 3JYAA 3OROA 3FEGA 2BMCA 2EU9A 2J5FA 3D5XA 4Q2AA 1XO2B 3O51A 4UBAA 3NYVA 2QOLA 5AADA 5CANA 2W1GA 4FTOA 5A54A 2PMNX 4O7YA 2XYNA 3D5VA 4F9AA 2B9JA 2JKQA 4NT4A 5FWKK 4CT2A 4XP2A 2XK3A 3LHJA 4DEDA 4EK4A 1KE9A 1XH8A 4IANA 4USDA 3EYGA 4EH6A 4IX6A 3DBCA 3KB7A 3PPKA 2BZKB 2UW6A 5IUIA 4TY1A 4FV4A 5GNKA 4U9AA 5HG7A 5CU6A 4EORA 5KHXA 5IQAA 4MNFA 3FPQA 3UOLA 3VHKA 4E6QA 2OG8A 3R8VA 2OW3A 3FZRA 4V01A 5BNJA 4KIOA 2WNTA 4QYGA 1GIJA 4BICA 5KX8A 3FI4A 2O3PA 4CFWA 4DTKA 1PXIA 5BVWA 3U54A 3HRBA 3BLQA 4CKRA 4EOOA 4FR4A 1ZYLA 4PNKA 4GJ2A 3LFSA 4UV0A 4ZTRA 2UW5A 5J7BA 4QPSA 2FB8A 3TJDA 4G3EA 3QD4A 4U45A 4OTFA 4MKCA 3MFTA 4FV8A 3VULA 4O22A 1UKIA 3ZHPC 5B0XA 5G6VA 1GZNA 3OCTA 4C2WA 5M07A 3AC3A 4QP6A 5CYIA 1ZYCA 3BBWA 4M15A 2V5QA 5LMBA 3LLTA 4ITJA 1OIRA 4L3PA 1Q8UA 5DN3A 4LGGA 3G5DA 2ITVA 4KS7A 3EJ1A 3PA3A 3KRJA 3VBYA 1IA8A 1Q8ZA 2I1MA 4L68A 1OIUA 2C5VA 3C4FA 1ZOHA 3MVLA 2ZVAA 5CX9A 4QYEA 3VQUA 1BMKA 2HYYA 4LL5A 4XBUA 4HCUA 5AR3A 4C7TA 4IBMA 4AAAA 5KMJA 4CRLA 3C50A 3QTWA 4H3BA 3TV4A 3IDPA 3GOKA 5JFXA 5GINE 2B9HA 4HGLA 1WBSA 3ORZA 4X6RA 3FQEA 4HJOA 4BFMA 5IF1A 3UG2A 2OH4A 3QXPA 4Y5HA 5JZJA 1Q3DA 3SGCA 2WTWA 3VUKA 1UA2A 2XUUA 1MRVA 3DT1A 3MYGA 3KU2A 3F6XA 2VO3A 2X8DA 4ALUA 1JQHA 4FT7A 5JZNA 4IIRA 3MIAA 2PSQA 2WGJA 4I6HA 4HW7A 3MW1A 2GQGA 2HZ4A 3F3VA 1VYWA 5K5NA 5KKRC 1RE8A 2W1DA 4PV0A 3AC2A 3SOAA 4ERKA 4R1YA 4X2JA 2CGVA 4EC9A 4G34A 3LXLA 4GG7A 4A9UA 5AR8A 4C2VA 2RFEA 4JS8A 5IH6A 5TOZA 4TT7A 1QPEA 2CHLA 2GNFA 4DFXE 4DC2A 3R8MA 2PPQA 3H9RA 4ORKA 4O7RA 1IEPA 3DCVA 3IW7A 2YDKA 3PWDA 3QLGA 4KKGA 4PMSA 4YJNA 2VWZA 1G8SA 4IB3A 2VNYA 4N0SA 4ASEA 5AUVA 3CJFA 2O8YA 3Q52A 4BWPA 1G3NA 4BWXA 2WMRA 3ORLA 1Y6BA 3VWAA 2PVLA 3PJ1A 2A4LA 4I5HA 4YLJA 2WOUA 4BDFA 4ZY4A 4I6FA 3QL8A 5J5SA 4Y72A 1YVJA 3R04A 2QR8A 2HXLA 4RSSA 4MXCA 4EK8A 3EB0A 3SXFA 3RJCA 5JN2A 2R3KA 2R3OA 2XJ0A 2YWPA 3HV6A 3QUEA 2C3KA 2LGCA 3QGYA 4IC8A 4M13A 4AN3A 4BZOA 1MRUA 5IEYA 2CKQA 4C4EA 3HYHA 4BB4A 1SVHA 1IAJA 3DDPA 4O0XA 3U51A 4C4FA 2VTMA 4QPAA 2XH5A 3UVRA 2PULA 4XS2A 3R9NA 4CLJA 1YDRE 4RWLA 4ZJJA 4DEHA 4G5PA 4TNDA 1NA7A 3Q96A 1OKWA 1YWVA 4IE9A 2FA2A 3R1NA 2XK4A 3V5PA 5KO1A 4ZXTA 2W99B 1P14A 3V5TA 3ZFYA 4QRCA 2Z7RA 4XHKB 3QFVA 3RM6A 4OTIA 2WMAA 3SW7A 2GQRA 5GIOE 1O9UA 3AQVA 5CEPA 2PZPA 3PRIA 4CZUA 2A27A 4MVFA 4U5JA 4YJRA 4TPTA 4N6YA 1OITA 1PXMA 4YJSA 3ZSGA 1CDKA 4J7BA 3H4JA 4P5ZA 2QOOA 4YP8A 3VRYA 4AGDA 2JD5A 3R7VA 4FT9A 2BFYA 2FVDA 4ZLOA 4R6VA 3GT8A 5HE1A 4PPBA 5EDQA 1GJOA 5AR2A 5JSMA 4O21A 3JS2A 1ZOEA 4WNOA 4DLIA 3BYMA 4E3CA 4UX9A 4NL0A 2PZ5A 3P5KA 2YM5A 2O0UA 2QI8A 3G90X 4X21A 4MEDA 4FIJA 4O0TA 4H3PA 4ENXA 4CFMA 4A07A 5KMKA 4KIPA 4J71A 4GIHA 3DZQA 3W32A 2F4JA 4F64A 2OICA 3U87A 5EQPA 3W1FA 3ULIA 2YLFA 3HECA 4BDIA 5M06A 1R1WA 4X0MA 3UOHA 3ZLYA 1H1RA 4JBOA 4F70A 5EM6A 4BHZA 4I94A 2JIUA 3LFFA 4U43A 4KBKA 3QWKA 5LWMA 5JRQA 1OL7A 3LXPA 4I5MA 5JRSA 3NIZA 4PNIA 2XCHA 5HOAA 3LFNA 4TXCA 5ICPA 4FTRA 4BCMA 2WQNA 3VUDA 2F2CB 4GYIA 4U3YA 4KINA 4XYFA 2EUFB 2YABA 5E8VA 4C59A 4F0GA 3N4UA 1GZ8A 4D2SA 3LLAA 1H26A 3NNWA 3E87A 2X7FA 1XKKA 5I9XA 3BE9A 2C1BA 5K3YA 1PXLA 3FPMA 2GDOA 3MDYA 3O23A 3EFKA 3R1QA 4IZ5A 5E8YA 4OTQA 4AZWA 3I5NA 3S3IA 4MXOA 4DH8A 4E6CA 4IFGA 4HGEA 4MD9E 4ZZMA 4FKVA 4ANOA 3NCGA 3TNWA 4D1ZA 3PA5A 3PDTA 4FZAB 4O38A 3RPVA 3TZ8A 2IPXA 4FNZA 5L4QA 3I0OA 4NK9A 3D0EA 3MJ1A 4ZTQA 1FGIA 3SA0A 4BIDA 3MPAA 4CEGA 4EH3A 3BI6A 4IQ6A 4MBLA 2B7AA 1NVQA 1XH7A 2H6DA 3DQXA 1U54A 4S30A 4F08A 2NNWB 4FEVA 1PF8A 2GU8A 4LUEA 5HQ0A 3ZU7A 3QD2B 4LL0A 3FMHA 3GFEA 4XX9A 3JY9A 3ZBXA 4K8AA 4CFFA 3LM0A 1FPUA 4CZTA 3ORPA 3TV7A 2W5HA 3UMXA 5AUUA 1H25A 4TZRA 2PMIA 4D1XA 2ERZE 3VO3A 2QO9A 4FKJA 4D4RA 1M14A 2C30A 4YO4A 4H1JA 3C7QA 4Y46A 5B7VA 4FSNA 3ZC5A 2OI4X 2PUUA 5AP6A 3E93A 2YM4A 4IDTA 3A7FA 3SOCA 5HU9A 5I0BA 2RG6A 4NFNA 2OBJA 4JI9A 4M12A 4BCHA 4LG4A 2QO7A 2Z02A 4HCVA 2W4JA 3NUUA 3DAKA 5BX0A 3QD3A 3UZRA 3E8DA 4QMSA 3QALE 3W2SA 5KMNA 1GY3A 5EQEA 3TUCA 3MB7A 3HP2A 4YBKA 3WZUA 3K3IA 4QMWA 4WG3A 4EHZA 3MV5A 5AWMA 2OXXA 4RX9A 5ITAA 4A4LA 3R00A 5HESA 1OPJA 3HAMA 4OT6A 3V6RA 1CKPA 2OXYA 3BYUA 2R4BA 3S4QA 5LWNA 4ZP5A 5HEZA 3G33A 3HMMA 2X2KA 3E8NA 4E6DA 2ITNA 3EN5A 3ZO3A 3KL8A 1YXUA 3TCPA 3LFAA 4QP4A 4NU1A 3Q6UA 3D7TB 3LJ2A 3CQWA 4YJOA 3ORKA 4XG4A 3KULB 1J1BA 3TEIA 4KRDA 4BY9E 4MBJA 1JPAA 2RKUA 4YC6A 3AT3A 4ZS0A 3SRVB 3WE4A 4BTMA 3A7GA 1ND4A 5JGAA 3KN6A 4BCKA 3FY2A 4TKSA 5JT2A 3P78A 5L2QA 3PZEA 4UALA 4DINA 3F2NA 3I79A 3SHEA 1FQ1B 3QRKA 4FX3A 4I41A 4XUFA 3LFEA 3LFDA 5EI2A 4NCTA 3DA6A 4ANBA 3FL4A 3LCOA 3OP5A 4FG9A 1OKZA 3M1SA 3SAYA 2X8IA 4ACHA 2UZEA 4BDBA 3NIEA 4R5SA 3UIMA 5J9LA 1YHVA 1J7LA 3HMNA 1L8TA 2QU5A 3RPYA 2UZTA 3EQDA 3CP9A 1FVRA 3HV5A 3DKOA 4P2KA 3VUHA 4BCIA 5D41A 3ORNA 1YRPA 4XEYA 3R01A 2G2IA 1Y57A 2P2IA 5JKGA 1T46A 2F7ZE 2OF2A 4MNEA 3TT0A 5JFWA 3H9OA 3IS5A 4QMLA 4BDJA 4ZSAA 4ASXA 2XNBA 2W5AA 3AOXA 1FMKA 3ZLSA 4AZSA 3E7VA 4MNEB 2VZ6A 4B99A 3IKAA 3VQHA 4MXXA 3H9FA 5AP2A 4IMYA 5J8IA 3SXRA 4FF8A 4WT6A 4XG6A 4O0SA 4QP8A 3W8QA 1M2RA 4YZBA 5HTCA 3KC3A 3LKMA 5HVYA 2ZMCA 3DAJA 4AZVA 4IM3A 3QTZA 2XB7A 3E8CA 2V7OA 4AACA 3Q9WA 2E9NA 4F09A 2CDZA 4RRVA 4KUJA 1DI8A 1FINA 3U4UA 4J99A 3UO4A 4RA4A 4CCUA 5CENA 1W8CA 4KNBA 2WTIA 3FKOA 3LFBA 4D4VA 3Q53A 2ZM4A 5AV4A 2QLUA 3FZPA 3RK5A 2O65A 3FMEA 3BYSA 2J90A 3N51A 2JFMA 5BVNA 5E8TA 2JITA 5IUHA 1YXSA 4EWQA 1KE5A 4RVKA 4LM5A 4AWIA 4GU6A 3OG7A 2WQOA 4Z16A 3D5WA 1KE8A 2I0VA 2IW6A 2ZDTA 4O7VA 3R8ZA 2YIWA 5C27A 4NIFA 1M2QA 4M14A 5J7HA 2R3IA 4UWCA 2C6KA 3PIYA 3CEKA 5JGDA 5CEIA 1K2PA 3MTLA 5CSWA 3H0ZA 4NIFB 4YURA 1F3MC 2JDRA 3AG9A 2XNGA 2HIWA 4GG5A 4B9DA 4EOQA 2YM3A 2KULA 3ZLXA 3LW0A 4RWJA 1HCKA 5GZAA 4O86A 2QVSE 4S31A 4GYGA 5DLSA 3QRIA 5EDPA 3TWJA 3W55A 2RFSA 3QYZA 2OGVA 1CTPE 4ZSJA 2WKMA 2I0HA 1JBPE 1Q61A 4EOJA 4D4YA 4L9IA 4PTGA 5HX8A 3DK3A 1PXOA 2BRBA 2YITA 2C1AA 4PDOA 3D15A 3OVVA 2PZIA 2YAAA 4FKGA 4FK6A 4G3FA 4AN9A 5IMEA 3EFLA 3KVWA 4DEGA 5CU0A 3KF4A 1XH6A 1A48A 4CG9A 3AC1A 4QYFA 5K0KA 5A6OA 4FICA 5HBHA 1Y8YA 4ZK5A 3RAIA 3FHIA 3UOJA 3BHTA 4CFNA 2JEDA 1KWPA 4J53A 3QTSA 4EHVA 5B2KA 3KK9A 4CV9A 2JBOA 5AIKA 4XJ0A 3V51A 2V22A 4DITA 2YDJA 2B0QA 3ITZA 1B38A 4DEEA 1JKTA 4F1TA 2CLXA 3BYVA 2IJMA 2C4GA 4IWQA 4DFYA 3DJ5A 3ZO2A 4IW0A 3SKCA 2I0EA 5IQIA 4F9BA 3F7ZA 2PVNA 4GU9A 3ACJA 4QMYA 4PY1A 4R3RA 4IWOA 3Q5ZA 3VHEA 4MHAA 3KGAA 2W4OA 1APME 5LMKA 4FZFB 2ITPA 3QTUA 3PVWA 1W98A 3FYKX 4RVLA 5AUYA 4J96A 4H39A 5I3RA 4IM2A 1PXKA 2XIRA 2C6OA 5JFVA 4WNPA 3L9MA 1H8FA 2CCIA 2UW4A 5F20A 2E2BA 3E92A 2VD5A 2XEYA 3FAAA 4PTEA 3MBLA 3FMKA 3MS9A 4AT4A 3QCXA 4IZYA 1W7HA 4OT5A 3QQLA 4EOMA 4BDGA 4A9SA 1Q24A 2BROA 3ZYAA 3Q60A 3TZ9A 4RA5A 4HPTE 4FV9A 4JIKA 3VUIA 3IONA 3DKCA 2GFCA 5AM6A 4L7FA 5DOSA 4M0YA 4U7ZA 5FQDC 4P5QA 4KS8A 1E9HA 4U97A 4YZ9A 4EUTA 4QMUA 3ZDIA 3FHRA 5A3XA 5L8LA 1SVGA 5TO8A 2WMBA 3CS9A 3DAEA 5DR2A 3R6XA 1DAWA 4GFGA 2VTJA 5K4IA 2ZV2A 3KRXA 4L6QA 5EW3A 3Q32A 4XOYA 2J0IA 1RDQE 4AT5A 1Q8YA 4BDEA 5KCVA 4NKAA 2FSLX 5AX3A 5I9UA 5DNRA 4AN2A 3GQLA 5EW8A 5GJDA 1Q62A 2QO2A 4Y85A 1H08A 3V04A 4RFYA 3EYHA 3PWYA 4U79A 2GS2A 3BWJA 4CG8A 2JKKA 4FZDB 4RIXA 3R0TA 2X8EA 2XRUA 5CU3A 4A4OA 3IGOA 4L8MA 4PMMA 1CKIA 4AGWA 5IDPA 3AXWA 4RWIA 2O64A 4D2WA 2VTNA 3ELJA 3PXYA 1UU3A 4DH1A 4Z3VA 2OSCA 4ITIA 4B6LA 4AP7A 5E4HA 3DNDA 3IW4A 4X3FB 5FEQA 4AFEA 2YIQA 1KE6A 3F3WA 4TN6A 3ZO1A 4BIBA 4QMNA 2YEXA 2YJRA 4HVIA 2BDJA 2HK5A 4BBEA 4J8NA 2I7QA 3E7OA 3JR1A 4JL9A 3DKGA 3G6HA 4DBXA 2WIHA 3UPZA 4S2ZA 3RP9A 1ZMVA 3AC8A 3ZONA 3QTQA 2XA4A 2YACA 4GCJA 4E93A 4FKLA 3QTIA 4NEUA 4ZZOA 3UIUA 1P5EA 5AEPA 5JQ5A 2G1TA 3P23A 3FL5A 4EI4A 4R5YA 2OO8X 3Q9ZA 2JBPA 2UV2A 4GRBA 1JKKA 4FT3A 1VJYA 4GEOA 3OZ6A 3HV7A 5EM5A 4FUYA 3WIKA 4QQ5A 4UY9A 4BI1A 2I0YA 3EWHA 1OMWA 3LMGA 3F7WA 4YHTA 5M55A 2ZM3A 3FV8A 5EOLA 3BKBA 2VTAA 3VUGA 3GCUA 2R3JA 1YOJA 3TKIA 3I7BA 4KIQA 2ZDUA 2GS7A 4KAOA 4QMZA 5DH3A 5E1SA 4O83A 3VS4A 1WVXA 4LRKA 3MPTA 1XR1A 3NCZA 2ZV8A 1JSUA 5ANOA 5T3QA 4C4JA 1PYXA 3QHRA 4FV1A 4ZY6A 2CPKE 3W2RA 3GU8A 4QQJA 2BRMA 5CXHA 2H96A 5E8XA 2UZOA 1M7QA 3LIJA 3DK6A 3EQRA 4WBBB 3QC4A 5HX6A 3MIYA 4XLIA 4JNWA 4U80A 3MY1A 4L7SA 4YR8A 1AGWA 2IZTA 5HBJA 3BEGA 4BBFA 3GC0A 4HZRA 3R8UA 4DF3A 5BYYA 3CPCA 3HGKA 4BI2A 4YU2A 4XG8A 4WRSA 1OZ1A 4C35A 3FYJX 4H3QA 2C6EA 5TKDA 1XBBA 3O8UA 2IW8A 4MXZA 1ERKA 5EH0A 4O0UA 2JDTA 3R8PA 4DGMA 2VTOA 4G3GA 5LJJA 1DS5A 3L8XA 1CM8A 1XH4A 3FKLA 4JAIA 2JKMA 4RBLA 4BKZA 1WBTA 4WA9A 5FXSA 4AW0A 5KUPA 3OCSA 2GSFA 1OI9A 2X7GA 4FVRA 5E8UA 3WZKA 5JK3A 3PP0A 3GOPA 3WF5A 5M4FA 3OTUA 4RX8A 3A4PA 4RZWA 3QRUA 3D7ZA 3QWJA 4G9CA 4NM0A 4IH8A 3VVHA 4G6LA 2VWBA 3FMNA 1J3HA 3IG7A 5ETIA 4D4SA 4EEVA 3ROYA 3ZRMA 2C5NA 3LXNA 4U41A 3UMWA 4U0IA 3CE3A 2WMUA 4XNEA 4NKSA 4EYJA 1UU8A 3OXZA 3PLSA 3QZGA 2YAKA 3R9HA 1YQJA 3BE2A 4L42A 3AGMA 5BQ0A 3SG9A 5C4LA 5GZ8A 3MESA 4KWPA 4E26A 4RFZA 3SC1A 4ZTNA 2BRHA 3R9RA 1UVRA 3VF8A 2P33A 3QKMA 4V04A 2B55A 3QU0A 5IQFA 5A14A 3S0OA 4BDCA 1RQQA 5BMSA 3QQHA 3KXGA 2CGUA 3ACKA 3FLYA 1UNHA 1WMKA 4S34A 5H9BA 4CV8A 2Y6OA 2P2HA 4G31A 3DBEA 4FKOA 4RJ3A 5DT4A 4EQMA 4RIOA 3VNTA 4FZ6A 3ZM4A 3DGKA 4YBJA 3DTCA 3HZTA 4JVGA 3ZSHA 5IH5A 5HLWA 3O2MA 4I3ZA 4O2ZA 4O84A 3O8TA 4MF0A 2J6MA 3HUBA 2CNVA 2BHEA 4I22A 4CKJA 5AAFA 4MCVA 2X4FA 5D11A 4C02A 4FI1A 2XIZA 1U59A 4EOSA 4I6QA 5IA2A 3GQIA 4HZSA 4RJ4A 3BV3A 3LQ8A 3BU6A 3I6UA 4W4YA 5HD4A 1ZLTA 2WB8A 3GEQA 2F9GA 4N70A 1PKGA 3ET7A 1O6YA 3ENMA 3KXMA 3UC3A 4NZWB 4X7QA 3GVUA 5ETAA 3WYYA 3NW7A 4UZHA 4XOZA 3COIA 4Y8DA 3SX9A 2UZBA 4I4EA 4F7JA 4TYIA 1H1SA 3LFCA 3Q2JA 3NLBA 5BUEA 5DEYA 3FQHA 4G6NA 4XV9A 3NAXA 2C3LA 1J7IA 3O7LD 4BZNA 4OTDA 3D2KA 4L46A 3MPMA 4MX9A 3DLSA 4GVJA 3OWKA 1NVSA 2OF4A 3A8WA 4MK0A 4RIYA 5F94A 4ZSGA 2CLQA 2OZOA 3E88A 4A7CA 4EK5A 5CEOA 1F0QA 2XIKA 4LGDA 4BYJA 5E1EA 3KFAA 4IZAA 3QD0A 3QRTA 3VW6A 3GFWA 3KMWA 5E8ZA 4M0ZA 3LCKA 4AE6A 4IAZA 4RC2A 3WF8A 2W0JA 2Z2WA 1E1XA 3IW5A 2VTRA 5JH6A 1CMKE 4MTAA 3NYNA 2VUWA 5C26A 3P7CA 4J95A 1H01A 4QMTA 3MH1A 4ZEGA 3NNXA 3S95A 5GJFA 3B8RA 2GNGA 4IB5A 1ZRZA 4QP7A 3F5GA 4XG2A 3VIDA 5DYJA 1H1QA 4FV6A 4DHFA 3GU4A 4FNWA 5HLNA 3BHUA 1SYKA 3CD3A 1ZY5A 3KY2A 3LJ1A 4M67A 4KABA 3SV0A 1PY5A 2JDVA 4I1ZA 2BTSA 2E9VA 3P7AA 1GZOA 3OCBA 4WO5A 4PTCA 1R0EA 3MGYA 3COKA 4WUAA 3P1AA 3QA0A 4JR3A 4Y5QA 4YZDA 5J79A 2NRYA 4LUDA 5AV0A 4ACCA 2QLQA 4YTCA 4IADA 4FBXA 2BRGA 4BCQA 2O5KA 2REIA 2ZMDA 4YUQA 4NCTC 2X0GA 4EOPA 3NUYA 4GIIA 3R2BA 3ZUUA 3OT3A 4UB7A 1PXJA 3RAKA 5H3QA 3FLQA 4K77A 4ANMA 1MRYA 2QOKA 2YZLA 1OUYA 3R30A 4FTJA 1PW2A 5DFPA 3EZRA 2J9MA 4I6BA 3RHKA 2C6DA 4CTBA 2B53A 1OBDA 5CQWA 5FTGA 3RALA 4C38A 3HV3A 4FSYA 3P08A 4IZ7A 4BR3A 4CT1A 3JY0A 3ANRA 3OUKA 2R7IA 5FG8A 3BU3A 5TF9A 2O2UA 4DGLC 4IHPA 3M42A 2IWIA 3IPHA 3KEXA 3PVBA 3L8SA 5FM2A 4CFUA 3UZTA 3GC7A 3ZRKA 4JBVA 2R3MA 1W82A 4ZZNA 4EJ7A 3GP0A 2ITOA 4JG6A 4QQCA 3D5UA 5HLPA 3R28A 3AD5A 1U5QA 5DWRA 3GNIB 1H0WA 3QUDA 3EQIA 1O6LA 3VBQA 3VS3A 5LCJA 2W1HA 3DFAA 4FV2A 4PWNA 5AJQA 4AGUA 1BX6A 2GNJA 2YN8A 3BPRA 4YPSA 3CKXA 1YW2A 4IXPA 3CTQA 4PL4A 4M84A 5CF5A 2Y4PA 4ANQA 5ACKA 3MH0A 2J0MB 3M11A 4TYJA 3DBQA 3MFUA 4RIWA 3RZFA 2GNIA 1YXVA 3UQGA 4BCJA 4E4NA 4HCTA 3C9WA 1JKLA 3R9OA 4ZLYA 1XJDA 1R78A 2PVFA 2XNPA 4HYUA 4GK4A 4O1PA 3DXPA 3O7LB 2ETKA 4NUSA 1OBGA 5GHVA 4EH9A 3RPOA 4OGRA 3OW4A 2YCFA 2ETMA 3OWPA 3RPSA 4M97A 3QQUA 2QOQA 4RGJA 3U6HA 3CPBA 5LXMA 5BVDA 2RF9A 3RGFA 2VWVA 2VRXA 4WRGA 4BCOA 2HELA 4MH7A 4C34A 5LMAA 1GAGA 1ZZLA 4GUBA 4RFMA 4U81A 3RM7A 3R21A 3ZBFA 2XVDA 4AW1A 5AUZA 3C0GA 3NSZA 5IA1A 3UIXA 5AP3A 4QPMA 4JDIA 3LMIA 3KRWA 2BUJA 3F66A 3QQJA 2BDWA 3AMYA 4YZNA 3ZUTA 4XLVA 3VRZA 1H27A 3OTVA 3OHTA 4CYIA 1BYGA 4E5AX 1OL1A 1I44A 2X39A 4K1BA 2JIIA 3HX4A 5C8MA 5IEVA 3OWJA 3FC1X 4FV7A 4FK3A 2XK7A 4L45A 1KV1A 2R2PA 2W4KA 4YJPA 3RI1A 5KMLA 3E3BX 4FTQA 4HNIA 2B9FA 1U46A 4EK6A 3PG3A 4KRCA 3R7OA 2JC6A 1S9IA 2YCRA 4YLKA 4WNMA 5GZ9A 3BEAA 3K3JA 4ZIMA 2IZSA 2OJFE 1T45A 2C5YA 3ZFXA 3E8EA 5CALA 5HO7A 2HY0A 4TNBA 3RWQA 3SDJA 4IJPA 1LP4A 3FLNC 3FXXA 3BQRA 3BX5A 3FSFA 1Q41A 4FT5A 2RG5A 4IACA 4LV5A 4X2FA 3C4WA 4KA3A 4FZ7A 2CGWA 2OIDA 2PE2A 5BUJA 4PPCA 4HYHA 4RZVA 3UBDA 1GNGA 3NNUA 2XK6A 3O17A 3TG1A 5FEEA 3C13A 3WE8A 4OAVB 2IG7A 1Q4LA 4RQVA 2W1IA 2WMVA 3IO7A 2XM9A 1YI4A 3W10A 1VEBA 4K33A 4EL9A 5H2UA 5LMKC 4DFZE 2BIKB 3LQ5A 1JAMA 4G9RA 2H34A 1BL7A 3UO6A 3BGQA 1U54B 4W4WA 2WMWA 5CF4A 3RPRA 3NZ0A 2VTHA 1VZOA 4QT1A 1H28A 2GTNA 2HAKA 5IA5A 1PXNA 4BVUA 1KUTA 4EK3A 3LM5A 2R0UA 4RJ8A 2PL0A 3CSVA 4KSQA 3RMFA 2DQ7X 3IOKA 4QMVA 4A4XA 3MVMA 5FD2A 3NVKI 4OTWA 2CMWA 3LOKA 3VF9A 2VO0A 1Z9XA 3DQWA 3FBVA 2VGOA 4ZTSA 3AC4A 5FXRA 2G2FA 3SQQA 4WG5A 4USFA 4CMUA 4YTHA 3D83A 3KK8A 2J0LA 4PL3A 2JLDA 2OU7A 1OB3A 2RSVA 1GZKA 5KMOA 4D2VA 3PSCA 3OD6X 4IC7A 4OLIA 4BKJA 4O7NA 2GPHA 4MYGA 5AMNA 4O7TA 2V55A 1F5QA 5D9HA 3ZZWA 2QD9A 3FLWA 4GV1A 4R1VA 5D7VA 4RWKA 5C4KA 3OOGA 4PF4A 2OJJA 1OL5A 1BI8A 3GU6A 4NTTA 4FEUA 5HBEA 4MD7E 3A62A 1YWRA 3L1SA 4G3DA 3F61A 3ZXTA 4PP7A 1WBOA 4GUEA 4R8QA 5CT0A 3R1SA 3R73A 3PLAE 4IWDA 2CKEA 2GFSA 2JIVA 2XP2A 4E8AA 4X3FC 1STCE 5HKMA 5CAOA 3B8QA 4BGGA 1OPLA 1W83A 4NSTA 5FRIA 4D2RA 4EOLA 2GQSA 2GMXA 4JQEA 4BWKA 4A9RA 3G0EA 3AMAA 3EQGA 3HRCA 3WI6A 5IUGA 3O96A 5M56A 1K3AA 4XRJA 3LCSA 5DR9A 4ZJIA 3ORMA 4LQMA 3BLRA 3MB6A 2BKKA 3UJGA 2XKDA 3R7EA 1YDSE 4O0RA 2E9OA 4XP3A 1SNUA 2BILB 5CTPA 1KOBA 3N9XA 4C33A 2J50A 5E8WA 4I4FA 3UE4A 4O7LA 4DCEA 3LCTA 2WELA 3FI2A 3ZMMA 4XG9A 3KXZA 3R7IA 1RJBA 3F5UA 4K9YA 5FLFA 4AS0A 2C6TA 1QPCA 1IRKA 2X9EA 4EHEA 2Y7JA 3AT4A 1PRYA 1J1CA 3MN3A 3SXSA 2UUEA 4L53A 3C51A 1Q8TA 4BTKA 5B2LA 3A7IA 2V62A 3H10A 3MI9A 3V6SA 3K5VA 3O71A 4JAJA 4HOKA 5AP5A 4O82A
chains in the Genus database with same CATH superfamily
4EZ5A 2XK9A 4F63A 3LMHA 4DTBA 3QZIA 4Z55A 2B54A 3JVRA 4CKIA 2VTSA 4BN1A 1BLXA 2EXCX 4B7TA 3FMJA 2F2UA 4ID7A 4A9TA 4QTEA 4Y73A 4AOIA 3TIZA 3NFGB 4JJRA 1B39A 4IDVA 3OF0A 4JIAA 4I93A 4UYAA 3V8SA 2B9IA 1BKXA 1G8AA 2OJIA 4E6AA 5CASA 4FSRA 4W4XA 1JSTA 2X9FA 4V0GA 4XMOA 1MP8A 3MY5A 3FZSA 4FMQA 2A2AA 2BR1A 4EZ7A 4R7BA 3FJQE 5B2MA 4XG3A 2JFLA 3BHYA 5ACBC 1A9UA 3NDMA 4YJTA 3W2OA 3FMMA 4BGQA 4N57A 5IQDA 4TYEA 4V0GB 3C5UA 2IO6A 2R64A 2CNUA 5K0XA 4Q9ZA 3GC8A 2ITYA 1YXXA 3VONA 5I5ZA 4GSBA 3P4KA 1JOWB 5CVGA 2HWOA 1Q5KA 5HI2A 4KBAA 4AFJA 3S1HA 2WOTA 3MH3A 1ZAOA 3KF7A 1LPUA 2NRUA 3FSKA 4FL1A 5LVPA 4ACGA 5J9YA 2ITTA 4IFCA 1HCLA 3FXWA 3V5WA 2VN9A 5AX9A 4CQEA 5IA4A 4AXFA 5TR6A 4HGSA 4USEA 3FI8A 3VS0A 4UMTA 2CJMA 2PWLA 1MQ4A 1IASA 2Q0NA 2W06A 3EFJA 3EH9A 3FUPA 4K18A 4O4CA 4U3ZA 5AM7A 3WF7A 4BCFA 4DFUA 3OEZA 4HYSA 3UODA 1HOWA 1GOLA 4UN0C 5CAQA 4TWCA 5DEWA 2XKFA 1LEWA 1LUFA 4JBPA 2GNHA 3QXOA 2R3RA 5A46A 4F9YA 4F7LA 3DU8A 4BI0A 5CNOA 2XYUA 3NR9A 2BFXA 3PIZA 5HCYA 2Z60A 4O96A 4LOOA 3ZUVA 4BBMA 4FTNA 4APPA 3FI3A 4CMOA 2W05A 3HRFA 4RMZA 3RAWA 4E7WA 1ZY4A 5CSPA 1YOLA 3NS9A 2V7AA 1QL6A 4IVDA 5CVHA 3VC4A 4CZYB 3HDMA 4FJVA 3ID6C 4N6ZA 3UO5A 1H4LA 4RX5A 2P4IA 3ZSIA 3QQKA 1W0XC 5HIBA 4FTAA 3A60A 5HVJA 3FLZA 2FSTX 4I5PA 3I1AA 1U4DA 1YXTA 2YM6A 4FKWA 2X0OA 3VW8A 4CGAA 1JVPP 1A06A 2G2HA 4YJQA 3PFYA 3RK7A 2BZJA 3G9NA 3RCJA 2YWVA 3AKJA 4OTGA 4R77A 4E5BA 3FQSA 5CVFA 4F6SA 3LE6A 4QDVA 5F1ZA 2C5OA 3NX8A 1OPKA 4F99A 1PMUA 3EN4A 3QHWA 4CQGA 4ERWA 5CQUA 4A9YA 4CYJA 4U6RA 3R8LA 5EKNA 3GCVA 4BDKA 2NYAA 1OL2A 3VBTA 4PRJA 5IEXA 3QRJA 2XIYA 5DR6A 3PSBA 4FVQA 3UC4A 5AA9A 4RC4A 2R3PA 3F3UA 4BTFA 1WCCA 3CLYA 5AIRA 3SVVA 4GVAA 3PFQA 4K0YA 4F65A 2AC3A 2PVRA 3QAME 3Q6WA 3V8WA 4ZAUA 5KHWA 2XNEA 2CKOA 2A0CX 3CQEA 3EQHA 1Q8WA 3RK9A 3BCEA 2BRNA 2EB3A 4S32A 4YMJA 3NYXA 4FA2A 3WIGA 3ZC6A 5EK7A 4E4LA 4QMQA 4J8MA 3TNHA 3RNYA 4EH5A 2IVVA 3N4TA 2QOBA 4TWNA 3VN9A 5LVLA 4JG7A 5HNGA 4PDYA 2XAOA 1TKIA 1OM1A 4DTAA 3DBDA 3EMGA 1H1PA 3CKWA 4O2PA 3UOKA 5GJGA 3F9NA 2WTCA 3WOWA 3EL7A 4ANSA 3DPKA 5FGKA 4PQNA 3F69A 3SG8A 4RQKA 5IG1A 3DFCB 3F2RA 5EKOA 4OUCA 5HU3A 3CD8A 4WUNA 1WVWA 4X6QC 1I09A 4ASZA 1VYZA 3C4CA 4XV3A 5T6KA 3W0OA 2WMTA 4LMUA 2J51A 5HD7A 1UNGA 5IU2A 1VR2A 3IK3A 4YC8A 3VS2A 3TZ7A 1NY3A 3PA4A 3R2YA 2R9SA 5E91A 5LARA 3GU5A 1H07A 2CCHA 4XG7A 4C8BA 5IH4A 1JKSA 3D4QA 4NJDA 5EDRA 4C36A 1ZMUA 5H8EA 5L6PA 4Q5EA 3BQCA 3A7JA 3JVSA 3OC1A 4NW5A 3Q9XA 3C1XA 3U4WA 2JDOA 4FIFA 3G51A 4M7IA 5EG3A 1PMEA 5J87A 3WZEA 3T3VA 3L9NA 4RIXB 5ANGA 4C37A 1V1KA 2R3NA 4AW5A 3PZHA 3PIXA 2YCSA 4JRNA 4ZMFA 3UZPA 3R7GA 4BGHA 3BHHA 3EN6A 5M51A 3Q2MA 4U42A 3WZJA 3POZA 4IAKA 4M69A 3GUBA 5DT0A 2W1ZA 4QOXA 2QKRA 4JDHA 2XJ1A 3QCSA 4E4MA 5A4QA 4XCUA 2VV9A 1UNLA 4F78A 2WQBA 4MXYA 4N4SA 3VBWA 1UKHA 1TZDA 4G1WA 1GIIA 4M69B 4CVAA 2NP8A 4HPUE 4JX3A 2C0OA 3ZRLA 3BWFA 4GFMA 3BZ3A 2BVAA 3F3ZA 4UMQA 4XV1A 3TIYA 5I9WA 5JEBA 4Z7HA 4RJ7A 4F6UA 1MUOA 5EYCA 2QG7A 2ITUA 3ZS5A 2P3GX 3P7BA 4RPVA 3U6IA 2W1EA 1FVTA 4YLLA 1YHWA 4QTBA 4DFNA 1Z57A 5ANIA 2OFUA 2WQEA 3BYOA 3CY2A 3MH2A 2PE0A 3DB6A 3I7CA 2Y8OA 3ODYX 2J2IB 3PXFA 4KIKA 1KOAA 4F4PA 3DS6A 4K6ZA 4K2RA 3W18A 3ZEWA 3MY0A 5HE2A 3KREA 1PMVA 2I40A 2NPQA 4ZSEA 3I0QA 5HG9A 4Y83A 5AP7A 5EHLA 4EWHA 5DT3A 4FTTA 4LYNA 3W0SA 3KCFA 4DGOA 2XKEA 3QZHA 4FNXA 5J9ZA 5ANDA 3N4VA 3NUAA 2VX1A 4QTDA 3HA8A 5DHJA 4RX7A 3ZFMA 4O7WA 1W2FA 4EKKA 5A4CA 5AAEA 4I21A 5AV2A 3EIDA 4JOAA 1URWA 3R7YA 5F9EA 4FE2A 4BDDA 3NRMA 3C0HA 4TRLA 3HKOA 3VBXA 3NVMB 3NMUF 3W0MA 3BV2A 4D1SA 5LVMA 3PP1A 3PJ8A 2VX0A 3QF9A 4XV2A 3UG1A 5HZNA 3C5IA 4L00A 5FTQA 4AGCA 2YDIA 3WILA 4EZ3A 2PMOX 3EZVA 3QCYA 3E5AA 3HEGA 4Z9LA 4RLKA 3UPXA 5BVFA 3TDVA 3FXZA 2VO6A 3PVUA 2JDSA 5D1JA 2X4ZA 4E73A 1BL6A 3NUXA 2ZB0A 3QQFA 5HORA 3HAVA 4GT3A 5M08A 3AD6A 4TYHA 3DKFA 4IX4A 3KRLA 3PY1A 4P4CA 3EKKA 3AGLA 3EKNA 4I92A 3ZLWA 2ACXA 2YIXA 3O0GA 4AA0A 4FKQA 3PVGA 3PXRA 3QX4A 4W4VA 3GB2A 1PMNA 4LRMA 4AW2A 4TL0A 5EW9A 2R3FA 3TNQB 2FYSA 3NUPA 4RC3A 2XM8A 1P4FA 5IQGA 4Z7GA 3RBWA 4AZEA 3OBJA 3V01A 1FMOE 4FG8A 5HNBA 1EH4A 5HTBA 2UZVA 4O91A 3Q04A 4TYGA 5CWZA 4B8LA 3BRBA 4MD8E 5HE3A 1H00A 4DE4A 3AD4A 4RJ6A 4FSUA 2WTVA 5BVEA 4G5JA 2BKZA 3OXIA 4CXAA 1J91A 2ERKA 4UXLA 5BPYA 3CR0A 2QR7A 3R83A 1OL6A 3E63A 2VWYA 1IA9A 3CQUA 4WOVA 3E3PA 4YPDA 4E5WA 1NW1A 4FTKA 4R78A 5D7AA 2HY81 5LCKA 4D28A 3PRFA 4B0GA 3A8XA 2FUMA 2WTJA 3EHAA 2CSNA 4PMPA 4FGBA 2BIYA 4QQTA 3I4BA 3G2FA 4L43A 4CSVA 5EYDA 2QQ7A 4L44A 5L6WL 3R1YA 4QMOA 4WNKA 2J4ZA 4DFLA 2OWBA 4DGGA 4TTHB 4W9XA 3RZBA 4CMTA 3ML1A 1CSNA 5CS6A 3NGAA 2E9UA 2OZAA 2EXMA 3HMPA 3TJCA 5IQCA 3KMMA 4AZTA 4MQ2A 4RJ5A 1QPDA 4D55A 2QOHA 3PYYA 5CZIA 4KD1A 2OZAB 3D94A 1NVRA 2P55A 4ARKA 5CF6A 3GCSA 3NWWA 4Q5HA 4HVGA 5HIEA 3LCDA 1BI7A 5EFQA 3HV4A 3QKKA 4DEBA 4EH4A 4FOCA 3NFFB 5HE0A 4QD6A 4H05A 4J52A 5J95A 3NW6A 4BHNA 4DEAA 4EKLA 2FH9A 1TQPA 3E64A 4ZJVA 2V0DA 2QKWB 3M2WA 1W84A 4I0TA 3T3UA 4CNHA 5DMZA 4AQKA 4BIEA 4DA5A 4YZMA 5HGIA 2IZUA 4G6OA 4G3CA 4EH7A 4ALWA 2X6DA 2VU3A 4R3PA 4B8MA 3PPJA 2ITWA 1QCFA 2C3JA 3C4EA 3DBFA 1JLUE 3CIKA 3HL7A 3AMBA 3P86A 1UV5A 3GCQA 4HNFA 2HZNA 4QNYA 1H1WA 1UU9A 3I81A 4QO9A 5JQ8A 4C3RA 3F3TA 4O6EA 5ANJA 4JRVA 3QKLA 3PJ3A 2QC6A 4O81A 1YI3A 1FBNA 3G9LX 4RIYB 4IAAA 4RVMA 4JXFA 3TN8A 2IVUA 4TWPA 2GCDA 4FL3A 5A9UA 4GL9A 2QOIA 3CCNA 3I6WA 3F2AA 2UW9A 4FUXA 5HO8A 5IISA 5L2WA 5M53A 4IVAA 3T9TA 5M4UA 4DG3E 4QYYA 4IX3A 5H8BA 5HG5A 3C4XA 4ZTHA 5BYZA 4EBVA 3LFQA 2Y9QA 3UNJA 3P5JC 2BHHA 3A61A 2UW3A 2UZLA 2R0IA 3CGOA 3NUNA 2BDFA 4GT5A 2ZV9A 2RFDA 5DRBA 3CC6A 3D2IA 3H3CA 1V0BA 2ITXA 3G6GA 1YKRA 4NW6A 3ZH8A 2A1AB 2WU6A 3TUBA 4HVSA 1SVEA 5JMSA 1KE7A 3O50A 4Y95A 3QC9A 3KRRA 4IAYA 3PSDA 4LFIA 5EQYA 4GK3A 3HUCA 2QOCA 2VWWA 2PYWA 5AV1A 3AT2A 5AP4A 2W7XA 1O6KA 2G15A 2I6LA 4FIIA 1K9AA 1QMZA 3WARA 4II5A 1X8BA 3II5A 3ZDUA 4FIHA 3OBGA 1ZARA 3UGCA 1WAKA 3VAPA 4FKIA 3PXQA 4C4IA 4DDIA 1SM2A 4UWYA 3OY3A 5CI6A 3TNPC 1XBAA 3OXTA 5CAVA 3I5ZA 4OTPA 4S33A 4FSWA 5TE0A 2IW9A 2R7BA 4GH2A 3LQ3A 4AG8A 4ZTLA 2VWXA 1PXPA 3S2PA 4EQCA 5FUTA 1P2AA 3F5PA 3P9JA 4EC8A 4YZCA 2C0IA 2VNWA 4DH5A 3DJ7A 3ZOSA 5C1QB 4RLLA 2XJ2A 2QG5A 2JAVA 1Y8GA 4UZDA 3UP7A 5GIPE 5FP5A 4OBQA 2G9XA 3DY7A 3KQ7A 5KBRA 3TM0A 2QCSA 1M7NA 3RHXA 2OIQA 4WG4A 2XMYA 3BHVA 5DPVA 3BIZA 4W9WA 3PE1A 4B4LA 4FEXA 5FEDA 3EQPA 4OBPA 3NEWA 5HO6A 2H9VA 5BVOA 5CEMA 3BGPA 3W0QA 4BDHA 3IOPA 3A4OX 2YERA 3NUSA 3QQGA 1XH9A 2IVSA 4NM5A 4CD0A 4I23A 5A4TA 4RIWB 4YJUA 5HTIA 5BYLA 3JPVA 1AD5A 3ALOA 4C61A 2YISA 2OFVA 3KXXA 3R71A 2J0JA 3QBNA 1WFCA 4FRFA 3NNVA 2ITZA 4PL5A 5IDNA 3ODZX 5J5TA 2XRWA 3IECA 3QTRA 4P7EA 5DBXA 2UVXA 5ANEA 2CN8A 2A19B 2WMQA 4C58A 3U9NA 3BU5A 2Q0BA 4JBQA 4UMPA 2WU7A 3QYWA 3NYOA 4DG0E 2VX3A 1YI6A 3THBA 3ZO4A 2QU6A 3W2PA 3L8PA 5CEKA 3U6JA 4WSQA 5CNNA 4EH2A 1M52A 2DYLA 2PZRA 4FTUA 2ZAZA 5DVRA 3C0IA 4EJNA 2Y4IB 4ZMEA 5KZIA 3CTJA 5KNJA 4YJVA 4TW9A 4KSPA 3PXKA 4HVDA 5FP6A 4O7ZA 4DFBA 2XCKA 4NM3A 3GENA 5EI8A 2O63A 5BVKA 4D5HA 4EH8A 2CNQA 4BYIA 2X7OA 4IVCA 4NTSA 3RTPA 4UMUA 3ATTA 3KXHA 1U5RA 3WYXA 1H0VA 5FDPA 5M57A 1WBVA 1CKJA 4LOPA 2Z7QA 2PY3A 3DTWA 5C8KA 3TXOA 4R7IA 3A7HA 4PUZA 2ITQA 2IN6A 2ONLA 3PY3A 4JDKA 4M66A 3DJ6A 4K11A 4C3FA 4BZDA 4C4GA 2YA9A 4QTCA 5E8SA 3TKHA 3WZDA 3OW3A 2OIBA 2FSOX 3G15A 1DAYA 2WQMA 3DXNA 2DS1A 3ORTA 2R3GA 1ZXEA 3KKVA 4I0RA 5CT7A 4EOKA 2FGIA 3IDBA 3VUMA 4ACMA 4GKIA 4KKHA 1OUKA 3NW5A 4W8EA 4FSMA 5L3AA 5FBOA 2IVTA 3ZZEA 3OOMA 4A06A 1XBCA 4FVPA 4J1RA 4CFXA 3CY3A 3Q4ZA 3ZTXA 5M4IA 3UTOA 4BDAA 2C3IB 3Q4TA 1ZYJA 3VUTA 3EN9A 5EM7A 4UXQA 3VJOA 1WBWA 2Y6MA 4O4EA 5F95A 3R63A 4QMXA 4XBRA 1TQMA 3KN5A 1OIQA 3MA3A 3TTJA 4H1MA 3DV3A 1PKDA 4NFMA 2LAVA 2XBAA 4BCPA 4EUUA 1YOMA 3QTXA 4I20A 4U8ZA 4DN5A 1WBNA 5CU2A 4AA4A 2C6LA 5I4NA 2AUHA 2ZOQA 3JXWA 3UYSA 5HCZA 4UMRA 3V3VA 4NM7A 3EN7A 4FKUA 4JG8A 5EM8A 3LPBA 2Z7SA 4X2NA 3W33A 5AUTA 4DAWA 4XP0A 2VTPA 2EB2A 1YDTE 5CI7A 4FYNA 3COMA 3BLHA 4YNOA 5CF8A 2FSMX 4DDGA 2XNMA 1YWNA 3AC5A 4HYIA 4AUAA 4BC6A 4FGRA 3Q4CA 3FMLA 3MWUA 3ERKA 4YSMA 4DG2E 5IPJA 3L8VA 4F0IA 4KBCA 4FSQA 2X2MA 4CRSA 1M17A 3SD0A 4FV5A 4OTRA 5BUIA 4EOIA 1DM2A 3PUPA 5IKWA 5C8NA 3T8OA 2J0KA 4P90A 2UW7A 4CFVA 1R0PA 2W9ZB 3HP5A 2XAMA 2C6IA 2PVJA 1AQ1A 3DZOA 2PVKA 3EQBA 3NPCA 3ORIA 4MBIA 1FOTA 3OT8A 3FC2A 4MF1A 3TKUA 5AP0A 1NT2A 2YFXA 3WF6A 2XKCA 3VS7A 4YNEA 2XS0A 5D12A 4OR5A 4AXAA 1SNXA 2CGXA 3MFSA 4WD5A 4QNAA 2EVAA 5T68A 4LOQA 3PY0A 4PX6A 4DEIA 3GXLA 4QMMA 1LEZA 3P0MA 5CEQA 2ESMA 2YM7A 5FBNC 5H8GA 5IZFA 3ZM9A 2Q83A 3EL8A 2PVYA 4RVTA 3UYTA 1LR4A 5CU4A 3BELA 2F7XE 5CSVA 4D5KA 4TWOA 3ULZA 4FEWA 5K4JA 4FIEA 1TQIA 4DH3A 3Q4UA 5JGBA 4E4XA 3QX2A 1UWHA 2NO3A 2WD1A 3PJCA 4AE9A 5AV3A 2XNOA 4O1OA 1PJKA 4JX7A 4QP2A 4FSTA 4F7NA 1OVEA 3D7TA 3F5XA 5D10A 4AOTA 4F9CA 3KULA 2B4SB 4IB1A 2QODA 4YHJA 2XF0A 3DOGA 3UQCA 4ALVA 4YSJA 2QURA 3SRVA 3NAYA 5L2TA 4JR7A 4I0SA 3CXWA 4UYNA 3K54A 4PP9A 4FKSA 2VAGA 2JGZA 3SW4A 3IW8A 4F6WA 3FZTA 4YHFA 2BTRA 4HGTA 4AXEA 3G0FA 1ZYSA 5AUWA 3B2TA 4OTHA 2YJSA 4JDJA 3IQ7A 5FM3A 3RVGA 1URCA 3KVXA 1XQZA 4H36A 4ZOGA 3VBVA 3L9PA 3KA0A 4FOBA 5FDXA 3W16A 3S00A 2RFNA 3IGGA 3OMVA 4GFOA 2WXVA 3H0YA 2PTKA 3OY1A 4FV3A 4LRJA 5EHYA 3CJGA 2F57A 4O4FA 4R7HA 2PK9A 4E20A 4BJJB 5KKRB 3JUHA 3ETAA 4AT3A 4BCNA 5L2IA 3R02A 4L3LA 5HCXA 1IAHA 2W17A 2WAJA 2XIXA 4U44A 4FTCA 4I24A 4IJ9A 4L01A 5IMXA 5AP1A 4G16A 4DT9A 2PMLX 5LOHA 3TL8A 4NJ3A 2DWBA 4IAIA 4UEUA 5I9VA 3MTFA 2R3LA 4PDPA 3FE3A 3QGWA 5A6NA 4FTIA 3MSSA 3AKKA 3QUPA 2E9PA 4XH6A 3DDQA 4JQ8A 4D0XA 5AUXA 4AU8A 2WMXA 3LAUA 2EWAA 3LZBA 5EYMA 4APCA 2GHGA 2W1CA 1XH5A 3R22A 5G1XA 3UVPA 1J7UA 3DXQA 2UVZA 4FG7A 3ZEPA 4FC0A 5EHOA 1IR3A 4EYMA 5C03A 4FYOA 4F1OA 3DLZA 4O0WA 4DCAA 3PJ2A 3FLSA 1ZOGA 3FY0A 4YGAA 3R9DA 4LMNA 4GW8A 4ENYA 4EONA 1XMMA 5CY3A 5K5XA 2VO7A 2UW0A 2RL5A 5CZHA 2HW7A 2HCKA 2GTMA 2OJGA 3FDNA 3MJ2A 4L67A 2WFYA 4Q9SA 3TZMA 4AA5A 4IB0A 4AOJA 5DIAA 3LVPA 2JAMA 1P4OA 5M44A 3B2WA 2ZJWA 2WTKC 4GT4A 2F7EE 1TVOA 5DGZA 2HW6A 4O0VA 3ALNA 4X3JA 4FKPA 2BCJA 3EQCA 3QZFA 4ZSLA 4DH7A 1OKYA 2YHVA 5LQFA 4ZTMA 2WEIA 2B1PA 4FKRA 3KCKA 2JKOA 4WHZA 4O0YA 4OW8A 4G2FA 3HDNA 2WEVA 2X1NA 5F4NA 3PPZA 3HMIA 3KXNA 2UVYA 2UZNA 2P0CA 5AAGA 3GGFA 5HICA 1W2DA 1Q3WA 3V8TA 1ZZ2A 4H58A 2W5BA 4BKYA 1G8KA 2VGPA 4D9TA 2YIYA 2PZYA 2CKPA 1ZYDA 5I9ZA 4YO6A 3UP2A 3LJ0A 3Q9YA 1ST0A 4C62A 1ATPE 3DB8A 4J98A 4LGHA 4ASDA 4D0WA 1Z5MA 2BZIB 4X2GA 3ENHA 5ETCA 5LVOA 4HVHA 3QA8A 3W2QA 5K9IA 2J5EA 4FIGA 2PHKA 4LI5A 1B6CB 3OUNB 4YTIA 5E9EA 3HVCA 2ZM1A 3P79A 3V5LA 1KV2A 3BBTB 4PPAA 4MQ1A 3FKNA 5AA8A 2WO6A 4BTJA 4AAYA 4BF2A 2X6EA 4FSZA 5CLPA 4FTMA 4KB8A 4PMTA 5JFSA 2PUIA 4JT3A 2CN5A 2GHMA 4L52A 2RGPA 4MXAA 4ONAA 2YLEA 4MWHA 1MQBA 4ACDA 2QHNA 5EI6A 4FNYA 5IA0A 5M4CA 4YC3A 4FKTA 4ZLZA 4FTLA 3CGFA 2OLCA 4LV7A 2OH0E 4D2PA 4ITHA 2Y0AA 4IVBA 1REJA 3HMOA 4FL2A 5E7RA 3RWPA 2WTDA 4RG0A 2OK1A 5AR5A 3RINA 4C4HA 2C5XA 2C6MA 2DUVA 3OWLA 4QYHA 1Y6AA 4GS6A 3TTIA 3MVJA 5IQEA 1OIYA 4CTCA 2AQXA 2R3HA 2W9FB 2X2LA 5E92A 2RIOA 5L8KA 4AQCA 2VTLA 4AZFA 3VS5A 4LV8A 3V5QA 5EYKA 4DBNA 2B52A 1R39A 2UZUE 3UIBA 3VS1A 4C3PA 3I60A 5L8JA 2XEZA 3U8WA 4IX5A 5I9YA 4V05A 3DNEA 3GU7A 5I3OA 2SRCA 1GIHA 2C68A 4ZS4A 5C9CA 5FTOA 1PHKA 1XHAA 2WZJA 2G01A 4GKHA 4IM0A 4QP3A 3OFMA 3ORXA 4AF3A 3CBLA 3KMUA 4GK2A 2BAJA 1QPJA 3TACA 3ANQA 1PYEA 5CXZA 1Q99A 3D14A 4IEBA 1WBPA 4W8DA 1R3CA 5CSHA 4QP1A 4QMPA 4WBOA 5BMMA 3RNIA 3PXZA 1REKA 3POOA 3HLLA 2PUPA 2H8HA 4WKQA 4CLIA 4EBWA 2BZHB 3CTHA 4GJ3A 1SZMA 5HHWA 3SLSA 4E1ZA 4F7SA 5ANKA 2AYPA 5CAPA 5IQBA 5HIDA 3RAHA 2WPAA 3UNZA 2BAQA 1V0OA 1WZYA 3W8LA 5ETFA 4IWPA 1BUHA 3TI1A 2XALA 3ATSA 5HNIX 3D9VA 1NXKA 4F0FA 3UQFA 5J1WA 3BL9A 1JWHA 4NWMA 3OCGA 5DRDA 2VTIA 4FT0A 2X81A 4X3FA 3PE2A 1L3RE 1FVVA 4O27B 5AR7A 2HZ0A 2PVMA 1IG1A 2BPMA 2OXDA 4WSYA 2AC5A 2W96B 4QP9A 3UDBA 3GC9A 2VWIA 3MVHA 5KMIA 5AR4A 3EQFA 2GS6A 2F49A 4BCGA 3HNGA 2R5TA 4U40A 2YIRA 4YTFA 4GMYA 2BAKA 4KIKB 2R3QA 2XK8A 4ZY5A 5A4LA 2PE1A 3GBZA 2Z8CA 1H24A 5TT7A 2W1FA 1G5SA 2FO0A 5HG8A 5HVKA 2Z7LA 3OEFX 1UWJA 3Q3BA 4CCBA 5A4EA 3L9LA 2XBJA 5M09A 4FV0A 5DI1A 3UVQA 1RW8A 4DYMA 2QONA 1OKVA 4WIHA 4F1MA 4D2TA 1OECA 2BALA 2QNJA 3IDCA 3PG1A 3T9IA 3TNIA 2VTQA 5DA3A 5DG5A 2WMSA 3Q5IA 5KMMA 1WVYA 3FWQA 2GNLA 1KSWA 1YHSA 3IW6A 4JLCA 3MA6A 2QHMA 1ZWSA 1M2PA 2HENA 2OJ9A 5CSXA 4M68A 5L2SA 4L3JA 4I5CA 3R7UA 2KTYA 3FZ1A 1OGUA 3RKBA 3VJNA 4UWBA 3BGZA 3O8PA 2ETRA 3EOCA 3E62A 1UU7A 3ZCLA 4RT7A 5KBQA 5L6OA 2C0TA 2UZWE 2OKRA 3EFWA 3WBLA 5J1VA 2HWPA 1E1VA 2UW8A 4EHGA 3GI3A 2Y4IC 4DGNA 1ZMWA 5IA3A 4TYHB 2WHBA 5AFVA 3QCQA 2C69A 2XNNA 2VWUA 5EOBA 3TV6A 4FEQA 3COHA 1JSVA 4IAFA 3K5UA 4R3CA 3A2CA 4NH1A 3TDWA 2YCQA 2NNWB 2PVHA 4F9WA 1S9JA 2QOFA 3LXKA 5FXQA 4OBOA 5KZ0A 4OAUC 5DE2A 4O7SA 4M8TA 4QTAA 4ANLA 3U9CA 4AX8A 4BRXA 2IZRA 3TUDA 4KKEA 3REPA 1Y91A 2EXEA 3FMDA 4D58A 3C4ZA 2C47A 5LVNA 1SMHA 2WIPA 3PTGA 3ROCA 1Q97A 2ONLC 4FODA 4X2KA 3V5JA 4EQUA 2ZYBA 5C01A 3F88A 3VS6A 4XRLA 2PU8A 3MFRA 4G17A 3ZXZA 1FGKA 4C0TA 3DK7A 1JNKA 2VTTA 4DT8A 3U55A 2WTKB 3HA6A 4JQ7A 4O6LA 4PDSA 3K2LA 1V0PA 2HZIA 4D9UA 5E90A 2YM8A 5CAUA 2UZDA 3QLFA 4J97A 2PUNA 2XZSA 3UNKA 4NYEA 2GHLA 2HOGA 4MAOA 2YZAA 3W2CA 4DLJA 3H30A 5IQHA 5KE0A 3A99A 4ANNA 2ZB1A 4M3QA 3RCDA 2J7TA 2ZV7A 3FZOA 4MWIA 3OS3A 3F82A 4C57A 1DI9A 1XWSA 4BL1A 2HXQA 3GCPA 3WF9A 3JYAA 3OROA 3FEGA 2BMCA 2EU9A 2J5FA 3D5XA 4Q2AA 1XO2B 3O51A 4UBAA 2XARA 3AKLA 3NYVA 2QOLA 5AADA 5CANA 2W1GA 4FTOA 5A54A 2PMNX 4O7YA 2XYNA 3D5VA 4F9AA 2B9JA 2JKQA 4NT4A 5FWKK 4CT2A 4XP2A 2XK3A 3LHJA 4DEDA 4EK4A 1KE9A 1XH8A 4IANA 4USDA 3EYGA 4EH6A 4IX6A 5BV3A 3DBCA 3KB7A 3PPKA 2BZKB 2UW6A 5IUIA 4TY1A 4FV4A 5GNKA 4U9AA 5HG7A 5CU6A 4EORA 5KHXA 5IQAA 4MNFA 3FPQA 3UOLA 3VHKA 4E6QA 2OG8A 3R8VA 2OW3A 3FZRA 4V01A 5BNJA 4KIOA 2WNTA 4QYGA 1GIJA 4BICA 5KX8A 3FI4A 2O3PA 4CFWA 4DTKA 1PXIA 5BVWA 3U54A