4KAOA

Focal adhesion kinase catalytic domain in complex with 1-(5-tert-butyl-2-p-tolyl-2h-pyrazol-3-yl)-3-(4-pyridin-3- yl-phenyl)-urea
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
252
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 252
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kaoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kaoA01
3QQUA 2W1GA 4GIIA 2YDJA 4BYJA 3F7ZA 4FSRA 3L8PA 3PWYA 4HYUA 3E93A 1UU9A 1VJYA 4JR3A 3RGFA 3RBWA 4PX6A 5FBOA 4ACMA 4DFUA 2C3IB 1JSVA 2CGUA 3SQQA 4DG0E 3F5UA 4NIFB 4I23A 3Q6WA 3QX2A 3GFWA 1GZKA 2J2IB 4H1MA 2G2HA 2X7FA 3FE3A 3II5A 3OY1A 4L00A 2YCSA 4ANSA 2R3FA 4LI5A 4E1ZA 1OITA 3NEWA 1JLUE 4GJ2A 3CC6A 5KUPA 2QODA 4TNBA 2I0VA 4ERWA 1OZ1A 1W84A 2GQSA 3HMMA 1PXNA 2JGZA 2VO0A 2QU5A 4MXYA 4C34A 4BWKA 5EKNA 2XEYA 4DH5A 3OBGA 4MF1A 5AMNA 4JDKA 1G8AA 4D5HA 4TWCA 2PVYA 4MVFA 4GJ3A 4FNWA 1A9UA 3DLZA 4OTIA 1WBPA 3N4TA 4BWXA 1YXUA 2UUEA 5LVLA 5CZHA 1OL5A 2GQRA 3G51A 4CFMA 1M7QA 1QPJA 4Y73A 2OWBA 3EN4A 2YISA 4FKIA 4RJ3A 4BGQA 2Z2WA 4U8ZA 2BPMA 4FTQA 4PDYA 3HV5A 3DK3A 5JZJA 2ZDUA 3R63A 1CKPA 4X2FA 4B0GA 3MGYA 1NT2A 2UVXA 5CEKA 3ACKA 5IQFA 4LL5A 3IOKA 4TYEA 3OWJA 1IR3A 1JKTA 4TXCA 2P55A 3F3VA 4L46A 3NUXA 4DTAA 2QLQA 4QTCA 5HKMA 4GMYA 2XIZA 4TWNA 1J7LA 4MAOA 4QT1A 3RPOA 3UPZA 2Q83A 1BYGA 2R3PA 4NTTA 3DOGA 4MYGA 3EL8A 3L9PA 4IIRA 4IAAA 4JDJA 4JQ8A 3QTZA 2OXDA 4CTCA 4C62A 3PSDA 2XVDA 1ZARA 2RFEA 5I9VA 4LGGA 5CI7A 5IUHA 3F88A 3H3CA 4XRLA 1YOMA 4EH2A 3PPKA 4V0GB 1R0PA 4WT6A 3ACJA 4LM5A 1L8TA 5LVOA 4K2RA 3FPMA 4QQ5A 3VBQA 5HG7A 4C4FA 4LOOA 3QRTA 1UU3A 1H1QA 4RIYB 2XEZA 4V05A 4UX9A 2XBAA 2FO0A 4AOJA 2F9GA 2BRGA 3QRIA 3ATTA 4KWPA 1QPDA 2X9FA 4JOAA 4P7EA 4IANA 2G9XA 2GFCA 3E62A 2NPQA 3FZTA 3Q96A 3VNTA 2JIUA 4EC8A 4RWKA 3ZUTA 4HJOA 2HWPA 2RFSA 3DDPA 4FV3A 4XHKB 3DQWA 3ZC5A 2OF4A 1Y91A 2X8EA 3TNIA 2B9JA 1GIHA 2XNMA 3MWUA 3PXZA 3T3VA 2YM4A 5DT0A 1H07A 4FA2A 1KV1A 2GNFA 2OZOA 4I41A 3G6HA 5CENA 3MA6A 2XUUA 4IFGA 4O0YA 5LVMA 5A4CA 4QD6A 2CLXA 2X6DA 3ORPA 3FLSA 4AWIA 5IU2A 2FH9A 1CSNA 2X8IA 4XG9A 4UV0A 5EQEA 5AR2A 4TRLA 5I4NA 3HEGA 4ASXA 2VUWA 5HHWA 3DJ5A 5DR6A 5CAOA 3WE4A 3LCTA 2WTKC 3PVGA 4FKGA 4TKSA 4BTMA 2VO7A 4WA9A 4G3CA 5J9LA 5C1QB 3RPYA 4O7RA 3P08A 4BYIA 2XK3A 4H58A 2IVSA 4ZZNA 2DYLA 4FIFA 3F3TA 5I3RA 4D1XA 4O7LA 3ZFMA 4H36A 4O84A 3MIYA 1YOJA 4IM0A 4G5JA 3GBZA 3RM6A 5JKGA 2GSFA 1MUOA 3PXFA 4HYSA 3DAKA 4ZTMA 3C51A 3H30A 4M12A 2BAQA 1PYXA 3KMWA 1J7UA 3VS3A 3UE4A 3OWPA 5K4IA 1KE5A 4QQJA 3D5UA 1URCA 3F2NA 2HZ4A 2C6IA 1Z9XA 4CFVA 3LXPA 4GW8A 3FKLA 2WQBA 4M15A 2UZEA 3KXNA 3DB8A 3EN9A 4X3FC 5IEXA 3MDYA 2QURA 2IZSA 4E5WA 2BIKB 3EQDA 4D4SA 4D4YA 3R8MA 1OB3A 4K6ZA 2CKEA 1PMVA 3HUCA 5I9YA 2J90A 2OBJA 3TWJA 3TDWA 4KD1A 1ZAOA 3FLQA 3QF9A 4FNYA 4RJ7A 4FSYA 5FRIA 5BVEA 3NYVA 2VTNA 4MEDA 3NUYA 4CTBA 5AA9A 4DTBA 3PSCA 5JGBA 5HG9A 2FB8A 2NRUA 2OF2A 3IECA 3QRKA 2HENA 4L7SA 3MY5A 2UVYA 4XEYA 4L7FA 4L42A 3PXRA 2UW7A 4TYHB 3V8TA 2DS1A 2GNJA 5D1JA 4JBVA 1Y6AA 3NAXA 4W4XA 2Y4IC 3DBFA 3D2IA 3KRXA 3WF6A 1YXSA 5GJDA 3VF9A 2OJGA 3FLWA 4JRNA 2A1AB 3VBWA 3TM0A 1T45A 5C26A 3OTUA 3MI9A 4J71A 3TV7A 2WKMA 5F4NA 4PL3A 1YHWA 4YTIA 4TNDA 5IQAA 3OCGA 3WOWA 5EOBA 4NW5A 4PY1A 5HO7A 3R22A 4EHVA 4AA0A 3PIZA 2CKQA 2J5FA 2VX3A 3AGLA 3B8QA 3FMJA 1ZZ2A 5CF4A 3UQGA 3O17A 5ETCA 2P4IA 2IWIA 4CNHA 5BPYA 3QUDA 1SVEA 3MVLA 3UO4A 5I9XA 5L6OA 4NEUA 3UYSA 5EG3A 1J1CA 4QRCA 2YAAA 5JFSA 3NUPA 2GFSA 3CQWA 3AC2A 2OIQA 2QLUA 3EN7A 2C0IA 3KN5A 4JS8A 4FR4A 2ZV8A 3MN3A 3QUEA 4QNYA 1O9UA 2IW9A 5HCZA 4EZ5A 4H3QA 3TN8A 3LZBA 3FXXA 2B53A 2X2MA 3ZBXA 5DRBA 4ZS0A 4OLIA 5BYZA 3OC1A 1S9JA 4RVLA 3R9DA 1OPLA 1FQ1B 2ZV9A 3HV3A 5AUZA 2IG7A 5M53A 3DJ7A 4C58A 4FICA 3LLAA 3VBYA 3C7QA 4JG8A 2UVZA 4YZ9A 3GQIA 3Q4TA 4RVMA 3KKVA 2R3QA 4LOPA 3ZBFA 5HCYA 1AQ1A 5AV2A 2QOQA 4ZTSA 2C0OA 2HW7A 3P7BA 4DGOA 3D5WA 2PZPA 4YZDA 4F0FA 5ACBC 4QYHA 2BAKA 3DXQA 4DE4A 3FQEA 2IZUA 5L2TA 2IZRA 1OMWA 4J53A 1REKA 4F70A 4IM3A 1ATPE 2EXCX 2XKEA 3LOKA 3PIXA 4NW6A 5HIBA 4APPA 5AP7A 4CLJA 4WSYA 2OW3A 4N4SA 2OK1A 5J8IA 3FMKA 4O86A 4N6YA 5F20A 2W1IA 4MX9A 4BCJA 1RJBA 4UY9A 4QPAA 3U9CA 3N51A 5F94A 2UW4A 4K33A 1FINA 4FF8A 3PG1A 4FV2A 1PKGA 3EHAA 4JDHA 2WMTA 5FLFA 4ASDA 5K5XA 4AZWA 2EXEA 1WBVA 5AIKA 2PMOX 2PVMA 4PMMA 3TACA 4I21A 4DINA 5IMEA 3QQHA 1XH7A 2WMSA 3VUMA 4BCPA 1UV5A 5TKDA 3FPQA 4AW2A 2PUNA 4LUEA 4G16A 2B55A 3UMWA 1UU7A 2JC6A 2VTRA 3FHRA 3UOHA 2C6LA 3ZC6A 1PMNA 5L8LA 2QHNA 4CMUA 1E9HA 4QMNA 4DT8A 3BI6A 3COKA 1TKIA 3G5DA 1MQ4A 3IGGA 3VF8A 2W17A 5AR8A 5BVWA 2C5OA 2R2PA 1O6YA 2BZKB 3KC3A 3SW4A 1XJDA 3LFDA 1DAYA 5FTGA 1RE8A 4EOMA 2HXLA 5DT4A 5CEPA 4PNKA 2WMXA 2C6OA 3OCTA 1V1KA 2QO9A 3ZRLA 3IDBA 3R7YA 3QD0A 3VS4A 3QQJA 1Z57A 4XJ0A 5IA5A 4EOLA 3K2LA 3EQFA 4TY1A 4RVKA 3O8PA 3LFQA 3LFBA 3NW6A 3RAWA 2J4ZA 4X0MA 5DG5A 1JKSA 5CSXA 4MXAA 4KIKA 4A4LA 1Q8WA 3AC4A 5AV1A 5AAGA 4RWLA 4NYEA 5E8YA 4RRVA 2JAMA 3A61A 3RWPA 1QCFA 4DEDA 2XA4A 2UZBA 1FBNA 3GCSA 1NVSA 4AZTA 3FMLA 3VC4A 3OVVA 4RLLA 4YLJA 2E9NA 1WCCA 1QPCA 4JVGA 1YXTA 4ZSGA 2NRYA 1IRKA 2LAVA 2RKUA 3ZEWA 4Z7HA 5GHVA 2QD9A 4TYGA 3I79A 3TDVA 4YC3A 3DKGA 4M68A 2XIRA 2X2KA 4IB1A 5H9BA 3VRYA 4F9WA 3NNUA 4DFZE 2J0LA 4FSMA 5HIDA 4FSUA 5JZNA 3QKLA 4EKKA 3EIDA 2B9HA 3Q9YA 4C7TA 5BVOA 4CV8A 4U0IA 5HTCA 2CNVA 2QHMA 3WIGA 2CSNA 2YIWA 1HCLA 1ZMVA 3UGCA 3I7BA 4IB0A 3BBTB 2IO6A 4IVDA 4QYGA 1ZYLA 4O7VA 2VRXA 4DITA 4JBOA 4BIEA 2VTSA 3S1HA 3P0MA 2VTLA 1P2AA 4Q9SA 3VW8A 4BFMA 5CI6A 1FMOE 3PE1A 4J98A 3Q6UA 2J9MA 1KE8A 4KKGA 3F5PA 3C4FA 2QR7A 1ZOHA 3K5VA 1TQMA 2QOKA 4YZBA 4FTLA 4YZMA 4O7WA 3ZONA 3GC9A 3LVPA 3JS2A 3DJ6A 3I81A 4EHZA 5D7AA 2GNIA 3UTOA 5HVYA 2XS0A 3C4CA 3G0EA 2XK9A 5I0BA 3KB7A 2YDKA 4DGGA 3QC4A 3GCQA 3KL8A 4BRXA 3QWJA 4U3YA 2JEDA 4I5CA 2JLDA 3DBEA 4AXAA 4O0WA 3U54A 3D15A 3CSVA 4M13A 5EM6A 2BAJA 3GI3A 4XRJA 4F6SA 3GC7A 1H1PA 2VGPA 4UN0C 1W83A 5FM2A 3KREA 2YABA 3TNPC 2VTIA 4ZMEA 5GZ8A 3PWDA 4EK3A 4YHJA 5AUUA 4I20A 1Q24A 1GIJA 4EC9A 3LQ3A 3AT3A 3ZRKA 4ERKA 3SXSA 2BFXA 5E8TA 2XK6A 5CVFA 3FZSA 3PYYA 3FL4A 3QZIA 3KXGA 3QCXA 4NKAA 5E8WA 5AUWA 4A07A 4BICA 4D4RA 4FEUA 4G3EA 4XLVA 5D10A 3NNXA 5IQCA 3G9LX 3GCVA 2W05A 3MFSA 4WG5A 5DNRA 1H0VA 3ZXTA 3OS3A 4K0YA 5B7VA 3R9HA 4Q5HA 4EH7A 4E3CA 3OXIA 3BBWA 3DBDA 4I6QA 1ZWSA 4FUYA 4IZAA 5M44A 3AMAA 5BVKA 1YRPA 4ZAUA 3MJ1A 4USFA 3PP1A 4FOBA 1PY5A 4RQKA 3G90X 5HNGA 3NYNA 4DGNA 4ZJIA 4M66A 3BV3A 4FL3A 4HVSA 5CF5A 2RSVA 1O6KA 3D4QA 3ULZA 2XK4A 5AADA 4R77A 4DFNA 5J1VA 2BDFA 3OTVA 4DG3E 2BDJA 4A9YA 1Q61A 2WELA 4UALA 3UOKA 4W8DA 1XH8A 1YWNA 2ITYA 4YPSA 1YWRA 4EH4A 4ACGA 3OUNB 5AX3A 4ZSEA 4FSWA 4FTCA 4NM5A 3COHA 2PVNA 3IW5A 3BU6A 4AAAA 3W18A 2YJSA 5AX9A 2ESMA 2QVSE 1R3CA 5JFXA 1KUTA 4EZ3A 1ZOGA 5FXQA 1DS5A 4ZK5A 2C0TA 4GFGA 3S2PA 3W2RA 2PZ5A 5J9ZA 3R9RA 3HP5A 4EH5A 4WG3A 1P14A 4PNIA 3NVKI 5B2LA 4K18A 4J1RA 1J7IA 4YJQA 3R8ZA 5I3OA 3WIKA 4IVAA 3P1AA 4RIWB 2E9VA 4BDGA 4NL0A 3RM7A 5CT7A 5L6WL 4G31A 4YHTA 4NSTA 2B9IA 3E8CA 2XYNA 3V04A 2XNPA 4ZY6A 1TQPA 4E4MA 4I5PA 4R3CA 3ZZWA 4E8AA 4HZSA 4KBCA 3LHJA 4FV5A 4HZRA 2CCIA 1G5SA 3W2CA 2X9EA 4DFXE 2ITPA 1WBTA 3ZEPA 3E64A 4GT5A 5DVRA 5HESA 4F1TA 3TZ7A 1PXMA 4L3PA 3S00A 5TR6A 4O0SA 2PVFA 5GZAA 1R1WA 4JIAA 3BPRA 4EI4A 5J9YA 2X39A 3KRLA 5E8XA 1OKWA 4W8EA 2VD5A 3N9XA 2VN9A 2QOIA 3RALA 2R4BA 4N70A 5TO8A 4KKEA 3SOCA 1U5RA 4IDVA 5EYKA 4X7QA 4DHFA 4K8AA 4E6CA 5KMIA 2OIBA 4RX7A 5CQUA 2CGWA 4FTRA 2VWIA 5AP3A 3CTHA 2E2BA 3M2WA 3VULA 2CN8A 3GOPA 4MTAA 2WO6A 3E8DA 4WOVA 4FKUA 5JGDA 3ORLA 5M4FA 5A9UA 3Q9WA 4E73A 2I40A 4APCA 2GHGA 3Q5IA 3OBJA 1JKKA 4ORKA 2YM5A 1CKJA 2R9SA 4FTOA 4HGSA 3R1YA 4KINA 5C01A 3T8OA 3WF9A 2HOGA 2QOHA 5GJFA 3KF7A 4NIFA 5AV0A 4NZWB 3FXWA 5E90A 4U44A 3UZPA 4UMTA 3AC8A 3NYOA 2BTSA 4MXCA 2VTOA 3ZCLA 5LOHA 4DN5A 4HVDA 1BMKA 2C30A 3O50A 2DQ7X 3FC1X 1JSUA 1YHSA 4HGTA 4NM3A 5E8VA 4U81A 5C27A 4TTHB 1LPUA 5EM8A 2ERKA 4FGRA 2RFDA 2ITNA 3EQGA 3KMUA 3ORZA 4X2GA 3MVHA 3DCVA 3S3IA 3ZZEA 3LFAA 5LCJA 3DKCA 2Q0NA 4CXAA 3UC4A 3BLRA 4A9SA 1L3RE 4AF3A 3VS7A 4EWHA 2QOLA 4BR3A 3QQLA 4CG9A 5M09A 4MXZA 3C4WA 3RNYA 4PMSA 3VUGA 2WOUA 3MPAA 2R3GA 3NDMA 4J97A 4EOIA 4NTSA 3WYXA 4OTWA 3NRMA 3BGQA 4JDIA 3U6IA 4W4VA 3VS0A 3L9NA 5IQHA 5DFPA 5ICPA 4X2JA 2OZAB 4D2TA 5KHXA 5IEYA 4FIHA 2YJRA 4HCVA 4O1PA 4CGAA 4V01A 5EYCA 3E8NA 3E3BX 4KAOA 4TW9A 4N0SA 4FGBA 4AA5A 5BX0A 5KMOA 2OFUA 5HICA 4U45A 2XNOA 1QPEA 2YM8A 3DQXA 4NT4A 5AP2A 3PZEA 4C59A 4ACDA 1QMZA 2Z02A 3FI4A 5CASA 2GTNA 2R0UA 4ACCA 3HUBA 2YLFA 4FTTA 5G1XA 3LM0A 2QKWB 4NJ3A 4S32A 3FL5A 3NNVA 4TYIA 3VS1A 3ZFYA 2YLEA 4BDJA 3PJ2A 3UDBA 5JSMA 1H27A 2CNQA 4J8MA 3A7IA 5E1EA 5FP6A 1CMKE 4EOOA 4F4PA 4V0GA 5A4LA 3D94A 4FG8A 3LFEA 4IBMA 1M52A 3SOAA 4BZNA 3P5KA 4OT6A 5HORA 2PU8A 1OIUA 4QPSA 4W9XA 3KXZA 4AW1A 4Y85A 3RTPA 2CGXA 4M84A 2VWUA 4L3JA 4RIYA 2GHLA 5M57A 5KMKA 2PVHA 5DEWA 4B4LA 4G6LA 2F49A 3NS9A 4N6ZA 1AGWA 3GU6A 5M4CA 5HNBA 3COIA 1A48A 4EH3A 3TIYA 3LXLA 3CPBA 4FT3A 3O8TA 3DGKA 4AG8A 1H25A 3DKFA 3QWKA 4RFZA 2QO7A 4WHZA 2W5BA 2PVLA 4MQ1A 3BYMA 3QTWA 2JDTA 3FZPA 2ZJWA 3EQRA 4XNEA 1RDQE 2A4LA 1UWJA 1ND4A 5FDXA 3DAEA 5GINE 3EOCA 3LCDA 4A9RA 4ENXA 4D28A 4E5BA 4WNOA 4ANQA 4C37A 5J7HA 2Y7JA 2X8DA 2YAKA 3FSKA 5DR9A 3KULB 4BCOA 4C8BA 3TI1A 3BIZA 3A4OX 3CJGA 3QQKA 4R6VA 2ZB0A 1BL6A 5K0KA 5BUEA 2FSLX 4G17A 4QMUA 4YJRA 2W4OA 3MH0A 3REPA 2UV2A 4ZLYA 4IAYA 2C5XA 4C38A 3PFQA 4JJRA 4KUJA 2H6DA 4O82A 5HX6A 3C5UA 5J95A 5IA0A 2FSTX 3GOKA 5CAUA 4YR8A 4F09A 1W7HA 1J3HA 3K5UA 2UW6A 2ITVA 4KBAA 4Y8DA 4DTKA 4OTDA 4FVQA 2GHMA 3CY2A 3GT8A 3GVUA 3RCJA 3CQEA 4HYIA 1Q3DA 3ZMMA 3E92A 2IN6A 3FKNA 2J7TA 2JBOA 3QKMA 2ITOA 5EW3A 1H1SA 3CR0A 3FKOA 3PIYA 5EDPA 3GC8A 2J0MB 5LMAA 2XM8A 1YI3A 4ZSJA 2PMNX 2XM9A 3NUUA 4JX3A 3QL8A 5IEVA 4IH8A 5T3QA 4DYMA 1WBSA 2YZLA 2Y4PA 4P4CA 3DTCA 3A7HA 3HNGA 5M07A 3ZHPC 1H0WA 4DGLC 3LMIA 2IVUA 2C4GA 4WKQA 4FTMA 2VTTA 3G33A 4BI2A 4EOPA 4EWQA 3W2QA 3UIBA 1OGUA 2F2CB 3ENMA 4U80A 5CU6A 1OUKA 2JKMA 3DAJA 4FZAB 4I94A 2RFNA 3A60A 4I6FA 4JQEA 4TYHA 3QALE 3ZDUA 4QP1A 2FSOX 2VZ6A 3MJ2A 3PRIA 4AGDA 5EOLA 4DAWA 2I0HA 4XG4A 3LAUA 4ANNA 3ORTA 4FSTA 4CQEA 5DR2A 4HOKA 5FEQA 3GU8A 2ONLA 2ZV2A 2JAVA 3D5XA 3EQBA 5CXHA 2HK5A 3EQIA 1I44A 4RSSA 3O2MA 2PSQA 4DGMA 2PUPA 4YSMA 4J52A 4ZP5A 2X7GA 4TZRA 2H8HA 5A3XA 1T46A 2ETMA 3LW0A 3G6GA 1NXKA 3FMNA 1XR1A 3TKUA 4U7ZA 4F9BA 3LE6A 4J99A 3MTLA 4FSQA 4LGDA 4UZHA 4Z7GA 1HCKA 3SKCA 3ZUUA 1NW1A 5G6VA 3D0EA 3NR9A 1KE9A 3OZ6A 2XIKA 1BI7A 3D5VA 3BHVA 3O71A 5LVNA 3ALNA 1JVPP 1X8BA 2FYSA 4KBKA 4FVRA 4YC6A 2OJJA 3HZTA 4JT3A 4MK0A 5DT3A 5KMJA 2CKOA 3QQGA 4LG4A 3U4WA 3QTQA 4EEVA 5DIAA 5IPJA 2OH4A 4NCTA 2F4JA 5FDPA 3ORXA 4MBIA 4UWCA 5FM3A 5F95A 3BQRA 3SG9A 3FHIA 2UW9A 1HOWA 1YKRA 4H3PA 4YP8A 3A8XA 4AT5A 3MB6A 1PHKA 2BZIB 3D7ZA 5HU9A 1XBCA 1B6CB 4GH2A 3OWLA 3QXPA 5EH0A 4RX9A 5C8KA 2FGIA 2PE0A 1IASA 3IGOA 4OW8A 4RZWA 4HVHA 5IMXA 5JFWA 5CF8A 5L3AA 3U8WA 4A4XA 4FEQA 2QCSA 4YHFA 2XP2A 4X2NA 1Q41A 4FL2A 3AC5A 2OU7A 3KGAA 3LMGA 5IQBA 4RC4A 5HLPA 2WTIA 4FSNA 4EZ7A 2XCHA 1UKIA 3AT2A 5CWZA 5EDQA 4I0TA 3ET7A 4MNEB 4FKLA 4KS8A 2YACA 3CE3A 3RZFA 5C8MA 1AD5A 3CIKA 4CZYB 4UMUA 2WIPA 2W7XA 4EBVA 3VUDA 3VS6A 3L9MA 4UYNA 3MY0A 3LFNA 3NZ0A 1Y8YA 3BGPA 4KABA 2BTRA 4R8QA 3IOPA 3TTIA 4C2VA 3I0OA 3HMNA 3FJQE 3OCSA 1UU8A 4YTFA 4MF0A 4PP7A 3RP9A 3P7AA 4O6LA 1XQZA 1TQIA 3L8VA 5LVPA 3UOLA 3F5XA 4IWOA 3ZDIA 2YZAA 4O0VA 1ZY5A 4QYEA 4S30A 5HEZA 1KV2A 4QMYA 2ITTA 3FDNA 5JT2A 4NK9A 3FLYA 4GFMA 5HQ0A 4BGHA 4JQ7A 2R3JA 3QZGA 3QTXA 2W1HA 2WU7A 3DLSA 5L2IA 4FV6A 3AQVA 1TVOA 3PPJA 4QMTA 4UBAA 2HXQA 2JKKA 2V5QA 4G6OA 4WNPA 4WO5A 3RVGA 3BLHA 3CBLA 2WQOA 4DLIA 2VAGA 3MH2A 3Q4CA 3IW6A 5K5NA 2Z60A 3ENHA 4D58A 3QBNA 2IVVA 4W4YA 3BHHA 4TT7A 5AA8A 4EK4A 2YM3A 5HTIA 1XBAA 3DY7A 3R8PA 4FIJA 5AFVA 2W5AA 5EDRA 3EJ1A 4YU2A 3DBCA 4M0ZA 3FXZA 1OKVA 4GT3A 2I7QA 1U46A 2Y9QA 5HO6A 4LGHA 2W99B 5KZ0A 4AN2A 4IEBA 5I9WA 3R71A 3FMHA 1M7NA 2C47A 4IJ9A 3LXNA 1BUHA 3VBVA 5ETAA 3E87A 2G2FA 4RA4A 3MIAA 4JBPA 3JUHA 1ZXEA 1Q62A 5CAPA 4BL1A 4PWNA 5M55A 3TKIA 1M14A 5HBHA 3RPSA 5A46A 2QOCA 5J7BA 3LKMA 1G3NA 3F82A 3NIEA 3R8UA 4Y46A 4F1OA 4MH7A 4DFLA 3EFJA 3OT3A 3LCKA 3H4JA 2BRMA 1YHVA 4QMWA 3HL7A 4YLKA 4AW5A 4I0SA 4BHNA 2R5TA 4WBBB 2UW5A 2EB2A 3R8VA 3UOJA 1SMHA 3HA6A 3MA3A 3MESA 3POOA 4EJNA 5L6PA 1G8SA 5CAVA 3GC0A 3O7LD 4FKVA 5J87A 4G9CA 4AQCA 2OI4X 4XLIA 3HLLA 1APME 3VUTA 4BCKA 4HPTE 4XV3A 2WPAA 2BILB 3NX8A 4YZNA 4DLJA 4AFEA 5HTBA 4FNXA 4A4OA 4CFXA 2Y6OA 3IKAA 3QLFA 4GYIA 2XRWA 4E6DA 2VTPA 4AOIA 2G2IA 5HE1A 4F9AA 5CZIA 4IC7A 3JXWA 1FPUA 5TT7A 3QGWA 3FLNC 5H2UA 3NNWA 5EI6A 2PK9A 2W1CA 4QMMA 4FV8A 4FV1A 4XP3A 3E7VA 4FBXA 1JQHA 3QHRA 1PJKA 1M2QA 4E93A 4EUUA 1CKIA 4TWOA 4HW7A 5AV4A 1H26A 1MQBA 4BZOA 4EYMA 5KHWA 4KS7A 3CY3A 4L44A 2P0CA 4O0XA 4M7IA 4BBEA 2F7EE 3H0ZA 2ITUA 1ZLTA 2EVAA 5JH6A 4FUXA 3WE8A 5HNIX 3OEFX 3Q52A 3N4VA 3SHEA 3R01A 2BALA 4HVGA 4ZJVA 4DT9A 4JRVA 4PP9A 1YVJA 5DOSA 3KRRA 2ZMDA 2QOBA 4ID7A 5CAQA 4XG8A 3EFWA 2Z7RA 1LR4A 3VUIA 5IZFA 2G1TA 4KRDA 2WMBA 4XV2A 4CRSA 4OR5A 2XKFA 3F61A 3LCSA 2V55A 2QU6A 4KIPA 4WRGA 1BL7A 5IA3A 3R21A 5KKRB 2VX1A 4RMZA 3AG9A 3Q9ZA 3GNIB 5E9EA 4JAJA 4JL9A 2UZWE 4D9UA 5L8KA 1OL1A 3OD6X 4YJUA 5LJJA 1R39A 3OOGA 2UZOA 4IADA 4FE2A 2PVRA 3O8UA 5E91A 1JKLA 4GSBA 4UWBA 5JRSA 4AP7A 4H1JA 4FKOA 4U79A 4NH1A 2XNGA 5K4JA 1IA8A 2P33A 3DT1A 2SRCA 1UNLA 4EH6A 4PQNA 3JR1A 4M69B 5HBJA 2KTYA 3PA3A 4OBOA 3O23A 5L2QA 4BB4A 2YIXA 2R3NA 1GZNA 2DWBA 3B2TA 3HRFA 4R1VA 4S31A 4BDIA 1ZYJA 3CEKA 5DH3A 5BMMA 3HKOA 4U5JA 4RBLA 3VRZA 1O6LA 4WUAA 3W32A 3ETAA 4FTAA 2W96B 3HMIA 1PF8A 2C6TA 2HWOA 1ZYDA 3IS5A 3NLBA 4BWPA 3R73A 3T9TA 2ZAZA 4BTKA 2XNNA 2J0IA 4FX3A 2E9OA 3ORNA 4QP6A 5IUIA 3H10A 5BUJA 3DFAA 5JMSA 4HYHA 4B99A 1GY3A 3V8SA 4PPBA 4GT4A 2VWZA 2X81A 4OTPA 2WFYA 3DS6A 3MH1A 4O1OA 3F5GA 2A27A 4P5QA 4EQMA 4DG2E 2XIXA 4LMNA 1WBNA 5A6NA 2BMCA 3C50A 4RIWA 3SG8A 3QUPA 2Q0BA 4GU6A 2J51A 3U9NA 3VHEA 4RX5A 4QMPA 2PZYA 2W1ZA 1VEBA 5KCVA 4BIBA 2OJ9A 5LWNA 3AT4A 4M3QA 2W5HA 4JX7A 3U55A 4FV7A 3QLGA 4RGJA 3UC3A 1H24A 3ZU7A 3OHTA 3JY0A 1CDKA 2X4ZA 4XX9A 4CQGA 4FTJA 2CKPA 3BHTA 3LQ8A 2HYYA 4G2FA 3HAMA 4FK6A 4BCMA 2RGPA 4I6HA 4TWPA 2GCDA 2ITWA 3T9IA 2RG5A 2WQNA 1E1VA 4UXQA 3HP2A 4ANOA 1H4LA 5JN2A 4GKIA 2ITXA 2Z8CA 5M4UA 4CFNA 2PHKA 5CQWA 3OP5A 4MD9E 5DYJA 4WBOA 3IG7A 3LQ5A 5ETFA 4CEGA 5AIRA 4ZY4A 3ZLXA 5EHYA 4D4VA 2BHHA 5CEIA 4BDDA 2WOTA 2CJMA 4QO9A 3TUDA 4FYOA 2O8YA 1JBPE 3JVSA 4GV1A 2WTWA 1UVRA 3M11A 3TZMA 3KF4A 3BX5A 2CDZA 4PRJA 3RHKA 4AA4A 4PL5A 3A7JA 2REIA 2VX0A 5K9IA 4RIXB 5HG5A 3GFEA 3BHYA 4ITHA 5GIOE 4EHGA 3UIUA 3ZXZA 2I0EA 4X21A 5A6OA 1REJA 3CCNA 3MH3A 4FZ6A 4YZCA 3EKNA 3E63A 3DU8A 5FWKK 2HY0A 5HZNA 2ZMCA 2VWYA 3H9RA 4BHZA 3BE9A 3SVVA 4CG8A 1FVVA 2WMUA 2XNEA 1CM8A 1Q3WA 3UBDA 3DXPA 3NYXA 4O81A 2PZIA 4KSPA 2WTCA 4QQCA 4FKTA 3R9OA 3MVJA 4IFCA 3WZEA 4F9YA 3AOXA 1SVHA 2R3MA 4O83A 4U9AA 4WSQA 5JGAA 2P2IA 4AFJA 3MV5A 5C9CA 3UQFA 4AE6A 5AEPA 1PKDA 3FZ1A 5D9HA 5HE0A 3V6RA 3K3IA 2QNJA 2VWBA 1K2PA 3KK8A 4IX5A 4FIGA 4JI9A 4RJ6A 5AP1A 5FTOA 4C4EA 5LMKA 1U4DA 4B7TA 5IUGA 4A7CA 2B52A 4C4GA 2HELA 3M1SA 2PE2A 3R04A 1SVGA 5EFQA 4O0TA 2OZAA 1WBOA 3PPZA 2KULA 3EFKA 5IH4A 4U43A 4C3RA 1STCE 4IVBA 1PMEA 3KMMA 2VU3A 3BKBA 3MTFA 5DI1A 3QD2B 3MB7A 3RJCA 5HE2A 4F08A 5CF6A 1IA9A 3VJNA 2UZUE 3R1SA 4M97A 3BU5A 3QC9A 3HMOA 3ZS5A 3VVHA 4C2WA 3IONA 4JIKA 2QKRA 2CMWA 4I24A 2XMYA 5CX9A 3UZTA 4R7BA 5ANIA 3K54A 4PDSA 5AUTA 4I3ZA 5H3QA 4ZJJA 4G6NA 3DV3A 3VUKA 3O7LB 1JSTA 4XUFA 4B8MA 4KKHA 4ZEGA 4IQ6A 3GCUA 3HV6A 3C1XA 4ZIMA 1ZZLA 5HD7A 3SRVB 2OIDA 2VTAA 5A4EA 3NMUF 3PJCA 2W4KA 2WU6A 3EH9A 4ZLZA 2P2HA 3DXNA 1YW2A 4FIIA 4MQ2A 2PUUA 3OUKA 4BF2A 2BROA 2JDRA 3R1NA 4CZTA 1GIIA 1SM2A 4L67A 4X3JA 4H3BA 2R7BA 2BIYA 4RT7A 2UW3A 3HDNA 4FKJA 3DK6A 2ACXA 3QZHA 4GK2A 3O51A 5A54A 4MWIA 4HGLA 3AXWA 2XIYA 2PVJA 3L9LA 2Y6MA 5AP4A 3CJFA 4P5ZA 4F1MA 5LQFA 5ANJA 1BLXA 1PW2A 4E4XA 1YDRE 4XG2A 3WARA 2I1MA 3PA5A 3GP0A 3HDMA 4I5HA 4FKQA 4WD5A 5C8NA 3V5WA 2EWAA 1XKKA 3BEAA 2J0JA 5CU3A 5CY3A 1A06A 2YIYA 3RWQA 5J5SA 2QI8A 5CVGA 1KE7A 2EXMA 4XOYA 3QTRA 4FT9A 2WTVA 2C5YA 4W4WA 4PL4A 4DH3A 3KULA 4FYNA 2YDIA 2ZVAA 3HGKA 3ZSIA 5CTPA 4MD7E 3BYUA 1Q4LA 2B4SB 3V5LA 5CANA 5E8SA 4RG0A 5BYLA 4BCGA 4O2PA 2RF9A 4XS2A 2ITZA 3ZRMA 5IQIA 4IB5A 4Y5HA 5DBXA 3CTJA 3UO6A 4DEBA 2JIVA 5C4LA 2GTMA 3CLYA 3QRUA 4I92A 1WFCA 2UZVA 4NFNA 2EUFB 1Q99A 4ZZOA 4QMLA 3LMHA 2OJFE 3LM5A 4FKWA 4FZFB 4F0IA 5EYMA 5A14A 4WIHA 4U41A 5CS6A 3SAYA 4BCHA 2EU9A 2HAKA 2X1NA 3I7CA 4Y83A 5CXZA 2BHEA 3BWJA 4IE9A 5I9UA 3RMFA 4BDCA 1W82A 1ZRZA 4C36A 2BFYA 3COMA 3ROCA 3BWFA 2BKZA 2Z7LA 4ALUA 4BVUA 1DI9A 4UZDA 4DEEA 3KA0A 4GEOA 1PXLA 3TJDA 1SYKA 4NM7A 3OCBA 3R83A 4FOCA 1OL6A 4BGGA 4RC2A 2B9FA 4CFFA 3P78A 3OT8A 3GENA 4WG4A 5E7RA 3LFFA 3KCKA 3ZM9A 2B54A 2HZNA 3MS9A 4FEVA 3NUNA 2YWVA 3FZRA 4ZZMA 5C03A 3WBLA 5K0XA 4A06A 5IQDA 3VQHA 4CD0A 1PXPA 3DPKA 4YJTA 1MRUA 3RAIA 4C4IA 2CN5A 4ALVA 3WILA 2FVDA 1YI4A 4EONA 4FKRA 5AJQA 4ZS4A 4FV4A 3TZ9A 3Q04A 2BDWA 3TUCA 4K77A 4X3FA 5ITAA 4LRKA 2Y8OA 3TL8A 1WVYA 2RL5A 2OXXA 5KMMA 2C5VA 4WUNA 1YXVA 3AD4A 5CU2A 5AP5A 4RFYA 4F7JA 5HGIA 3F2RA 4BBFA 5HOAA 1VR2A 5L4QA 4BN1A 3EL7A 4RWJA 4E4NA 2JBPA 4RLKA 2BR1A 4BTFA 4L3LA 4LMUA 2VWXA 3C0GA 1R78A 4GK3A 4BKJA 4PTCA 4BDFA 4EQCA 2B0QA 3RK7A 4D2VA 3EMGA 3W2OA 4IWQA 1PXIA 3UNJA 1NA7A 1B38A 2VV9A 3FY2A 3MPMA 4G5PA 3W55A 2OO8X 4B9DA 5KNJA 1UWHA 4PTEA 3WYYA 4P90A 2XK7A 1YDSE 4J8NA 3JVRA 3TCPA 4ZTHA 4LV8A 3CQUA 4YNOA 3WZDA 3T3UA 1M17A 4ZLOA 4IM2A 4D0WA 5EQYA 3FC2A 4FKPA 2PMLX 3LXKA 2UZNA 3KXXA 3QTIA 1YI6A 4R5YA 5ACKA 2ETRA 3F3ZA 2O63A 3U4UA 5DN3A 2VNYA 3KU2A 4CZUA 4EOJA 1OIQA 4DH7A 3FBVA 3PJ1A 4IJPA 5LARA 2FSMX 5ANKA 3GEQA 3E8EA 3UMXA 3CGOA 4QPMA 3PVUA 4XV9A 3V3VA 4X2KA 2W9ZB 3LCOA 2OSCA 2X4FA 2WHBA 4II5A 3UVPA 3NSZA 2VTHA 4GIHA 4F6UA 5LCKA 2YIRA 3AMYA 2FA2A 4QP3A 1OECA 1LEWA 3CPCA 4MNEA 4I5MA 3FQSA 4B6LA 4BKYA 2WIHA 4EBWA 1ZYSA 4QMOA 3RI1A 4D2PA 3DA6A 1Q8YA 4IACA 1H28A 1WAKA 5H8EA 4QTEA 1P4OA 3KY2A 5M06A 4UEUA 2O3PA 3LPBA 3PG3A 4AGCA 4OTRA 4C0TA 2VGOA 2GPHA 2W0JA 1OKYA 3NCZA 2YERA 4RJ5A 2BZHB 3QGYA 4NFMA 3UG2A 4ASZA 4CKRA 3FEGA 4H05A 3C4ZA 2JFMA 4CLIA 4DFYA 1UNHA 4U3ZA 5CU0A 3A4PA 4CCUA 3EZRA 1PMUA 5CEOA 3EWHA 2OG8A 3ID6C 4PDPA 4BIDA 1F0QA 1NVRA 2B1PA 2XZSA 2QQ7A 5D12A 4USDA 1XBBA 1V0BA 3I0QA 3UG1A 2XCKA 4AU8A 1GOLA 2WAJA 3G0FA 4E6AA 4UMPA 2OICA 5FTQA 3R7OA 3F3UA 3P7CA 1NY3A 4KIOA 3QTSA 3R9NA 4AZVA 3EN6A 3L8SA 5DWRA 5DHJA 2C6DA 4BC6A 2NO3A 3ALOA 2RIOA 1J1BA 1OPJA 3TNWA 4FL1A 4XV1A 4R78A 5BVNA 4IAFA 2PPQA 4Z55A 3E3PA 4KRCA 4EYJA 1BI8A 3RK9A 4ONAA 1XO2B 2WTKB 5CSPA 4YLLA 4NM0A 2DUVA 3PVWA 3QX4A 4MHAA 4OTFA 4NUSA 5HE3A 5KBQA 2R64A 4XG6A 5FXRA 1U59A 4G34A 1GNGA 4Q2AA 4FT0A 3LJ2A 4GL9A 5M08A 1F5QA 3A7GA 4YBKA 1H00A 3DZQA 3W8LA 4ANMA 1GZ8A 4AZSA 3R2YA 4XBRA 1VYWA 3WZUA 5IDPA 4CYJA 4FG7A 2XJ2A 5KMLA 5LMKC 4YJPA 1WVXA 3KVXA 4QTDA 4BI1A 4D0XA 4YMJA 1ERKA 5CNNA 4KSQA 4X3FB 5DRDA 4AZEA 5J5TA 3D2KA 2GS2A 3KEXA 4X6QC 4HVIA 3QAME 3DFCB 3M42A 2GS6A 5EHOA 3C0IA 4UB7A 5FXSA 3GUBA 3U6HA 2YIQA 4E6QA 3HYHA 3OG7A 4HNIA 4D9TA 2CHLA 4PF4A 2H9VA 5HD4A 4FTKA 4PV0A 1OI9A 4EKLA 4EK6A 3UP7A 3PSBA 4QMXA 3WZKA 2O5KA 3QQFA 4ALWA 3QU0A 3SV0A 3BCEA 3H9OA 3OMVA 3LJ0A 4F7NA 4IZ7A 1XH5A 4OGRA 4OAVB 1Y57A 5D7VA 3V5TA 3KQ7A 2WD1A 4HCUA 3N4UA 2GU8A 2Y4IB 2E9PA 3R7EA 2ZM3A 4XP2A 4I1ZA 5TE0A 3R28A 1LP4A 2AC5A 4AX8A 4F9CA 3ZSHA 3EFLA 2GNHA 3I6UA 5HX8A 1OIYA 4F63A 4ZXTA 5AAFA 3P79A 4EHEA 3DZOA 1SNXA 3B8RA 5HU3A 3NVMB 3O0GA 1WZYA 2PE1A 2PTKA 3UNKA 3C9WA 3ORKA 5EYDA 1R0EA 3ORIA 4DFBA 1JPAA 4OTHA 3ULIA 5CVHA 2XRUA 4C57A 2HY81 5ANOA 1IAJA 3PA4A 2QONA 3FMMA 1OVEA 4YBJA 5EW8A 3Q2MA 2NNWB 4FZ7A 5L2WA 2UZLA 2ITQA 4RIOA 2QG5A 5I9ZA 3UO5A 3SLSA 3W8QA 4U40A 3TJCA 4FTUA 3CKXA 3TEIA 3D7TB 4AN3A 2XB7A 1XH4A 3GQLA 3HRCA 1OBGA 2C3JA 4DH8A 2JIIA 5JFVA 3GU4A 2PULA 1FVTA 4ZTLA 4C33A 5DGZA 5DLSA 2OH0E 5EQPA 3PJ8A 1URWA 2ZYBA 3VS5A 2WMWA 3TG1A 2JD5A 4P2KA 3I6WA 3LIJA 3MSSA 2IJMA 5FG8A 4NU1A 2XKDA 3O96A 2PMIA 1H08A 1SZMA 3I60A 3I4BA 5GZ9A 4QP8A 3VWAA 4IW0A 3ZO1A 4AGWA 2A19B 4YNEA 3LJ1A 4GUBA 4XP0A 4CRLA 4O22A 4PPAA 5BVDA 3S95A 4BI0A 3UZRA 4W9WA 2WTDA 3ORMA 5DE2A 2ZV7A 2WMRA 5IDNA 4O7YA 4WNKA 5FD2A 5BVFA 4HCTA 4QNAA 3R0TA 4R5SA 4C3FA 2AYPA 5IH5A 4L53A 4YPDA 1WVWA 5HVKA 3RKBA 4YTCA 3P9JA 3EQHA 3C5IA 5HVJA 5F9EA 4XG7A 4D1SA 4C4HA 4M69A 5E4HA 1P5EA 3NUSA 1P4FA 5FP5A 3VQUA 4RPVA 5L2SA 1S9IA 3BZ3A 3QYWA 4MKCA 4ANLA 1FGIA 5EKOA 1PRYA 3RINA 4WRSA 3QTUA 4HPUE 3OW3A 3OY3A 3R02A 1ZMWA 3CKWA 5TOZA 1Y6BA 4AN9A 2QG7A 2R0IA 3A7FA 3Q60A 2VO3A 4PDOA 3Q4UA 5C4KA 3DTWA 5JQ5A 4H39A 3VIDA 1YOLA 4FEWA 5H8GA 2GMXA 2I6LA 3D83A 2PVKA 4FVPA 4QP7A 5HLWA 5IF1A 4FC0A 4FEXA 4LFIA 3P86A 3RZBA 4LRJA 4ZTRA 2ZM4A 5CEMA 1IG1A 3BYOA 2H96A 3CTQA 2C3KA 4R3PA 3R7VA 2R3IA 3UQCA 2V7AA 4PPCA 3BLQA 5FEDA 2XNBA 5KE0A 5FUTA 3IW8A 2GNLA 4QP4A 4BKZA 4F7SA 5AP6A 4GVAA 2X7OA 3GXLA 3TNHA 4AE9A 3IW4A 5FEEA 4FI1A 4ACHA 5HG8A 2F2UA 4ITJA 2WNTA 4BCNA 4RFMA 1JOWB 1OIRA 3MFUA 2YN8A 3HRBA 3F3WA 2O64A 3SXRA 4KNBA 2VWWA 3TTJA 3UP2A 2HW6A 2R3RA 3KCFA 4G3FA 4EOKA 3K3JA 4G3GA 2VTJA 2ZM1A 3PE2A 4L01A 5AV3A 3I5NA 2IW8A 3PLAE 4QOXA 4UYAA 4OBPA 1V0PA 4R3RA 4ZY5A 1PYEA 4GUEA 4IB3A 4QMZA 4O0UA 1FMKA 1ZMUA 4OTGA 1DM2A 3NCGA 3BYSA 2BRNA 4BDAA 5FQDC 3OW4A 3IPHA 3MFRA 4GFOA 4S34A 3C13A 3FWQA 4ARKA 3Q9XA 3W2SA 5LMBA 5KX8A 3EQPA 2YA9A 5ANDA 2HZIA 5A4TA 3DNEA 4NKSA 4RQVA 5A4QA 4YJVA 2IVTA 2VTQA 3W2PA 2CLQA 2QOOA 3B2WA 2IW6A 3ANRA 4RIXA 4YSJA 1FOTA 3RCDA 3FSFA 3ODZX 2OFVA 4QTBA 3S0OA 4AOTA 3R2BA 4I0RA 4OT5A 5D11A 3S4QA 4FMQA 4O7TA 3VO3A 3SW7A 5IH6A 5I5ZA 3VBTA 3WI6A 2C5NA 3Q4ZA 5AUXA 5AR5A 1W98A 2W9FB 3KXMA 4YTHA 2I0YA 4O7ZA 5IA1A 4FV9A 4U97A 2YM6A 3MY1A 4O91A 3A62A 3W33A 4JG6A 4I22A 3W10A 4QTAA 1Q8UA 4E5AX 1OM1A 4O2ZA 2F7ZE 3RPVA 4BCIA 4IC8A 5IQGA 3KFAA 1JAMA 4LUDA 5LXMA 2QR8A 4EH8A 4BCQA 2ERZE 2BCJA 3VJOA 4DEGA 2VNWA 4L8MA 3RAKA 2J50A 4TN6A 3QZFA 3NW7A 4MXOA 1PXKA 4E4LA 4Q9ZA 3MW1A 4GVJA 4LOQA 3TZ8A 4Z16A 2J0KA 5EM7A 3ODYX 1M2RA 2Y0AA 4U6RA 4FKSA 4M67A 4OTQA 1NVQA 3GCPA 1F3MC 2C6KA 3AC3A 3EZVA 2XYUA 3OFMA 4CCBA 4D5KA 5AP0A 3ITZA 3PXYA 4BDEA 4O7NA 5BQ0A 3FQHA 3NWWA 3BV2A 3ERKA 3AC1A 4JAIA 4D2SA 2Z7SA 3KN6A 1Z5MA 2XJ1A 5CT0A 4YJOA 2UZDA 4AGUA 3RAHA 1IAHA 4ZTQA 4F99A 4NJDA 2X2LA 4JG7A 4GKHA 2GS7A 3PXQA 3SRVA 2HIWA 3JY9A 4L68A 3SC1A 4K9YA 4GCJA 4JLCA 4CMTA 2BUJA 3AD6A 3GB2A 1XHAA 4QYFA 4OBQA 4IAIA 1WMKA 2WEIA 2WQMA 3G15A 5KZIA 3R7GA 5ANGA 5HI2A 2GNGA 4EOSA 3THBA 3PRFA 3ZTXA 3DBQA 1ZOEA 3FAAA 2R3LA 4ITIA 3ZO3A 3ZLSA 3WF8A 4CYIA 3TT0A 4E26A 4EL9A 4TL0A 3CXWA 2ONLC 1KOBA 5GJGA 3ZSGA 3PP0A 3E5AA 4TPTA 3FYKX 1U54A 3NIZA 3PY0A 3OF0A 5AR4A 3IDCA 4J7BA 5E92A 5T6KA 4U42A 3FI8A 4BDKA 4ASEA 4IAZA 4IDTA 4UMQA 4GRBA 3FYJX 4AS0A 4LV5A 4EQUA 5M56A 1YQJA 4RJ8A 5EHLA 3ZFXA 2OKRA 3HV7A 4IZYA 4YUQA 3HV4A 1UNGA 4AZFA 5BUIA 1M2PA 4GS6A 4R1YA 2JDOA 3ZLYA 4FIEA 4DF3A 2IPXA 1PXJA 3FI3A 2WMQA 3R7IA 3HAVA 3V6SA 4RJ4A 4F7LA 3IQ7A 5M51A 2VWVA 2WGJA 4JNWA 5AR3A 3MBLA 1IEPA 3V01A 4D1ZA 4HNFA 4NCTC 4IX3A 2H34A 5J1WA 1W0XC 2GDOA 2BRHA 2XF0A 3PXKA 5AM6A 1BX6A 3V8WA 2NP8A 4XCUA 5BNJA 4QP9A 4CKIA 2F57A 4C61A 4XBUA 3C0HA 4EORA 3QYZA 4BBMA 4F65A 3QKKA 3D14A 2R3KA 3SA0A 3DK7A 4FV0A 1KOAA 4M14A 1H1RA 4D2RA 1QL6A 5KBRA 2LGCA 3WF7A 5K3YA 2W06A 3G2FA 5AR7A 3SX9A 4LRMA 4DEHA 4O38A 2PUIA 2XKCA 4A9TA 2WZJA 4DCEA 2P3GX 4C4JA 5J79A 5AUYA 4MD8E 5M4IA 3TV6A 3F66A 1J91A 2XK8A 3BHUA 4FTNA 2C1BA 4EOQA 2C68A 4JR7A 4LL0A 4AUAA 4C3PA 2C6MA 4R7HA 2CCHA 4OAUC 4FTIA 4CFUA 5HCXA 3PUPA 5ANEA 5DEYA 2BKKA 3Q5ZA 5JEBA 5CLPA 3FI2A 4IMYA 1RQQA 4IVCA 3WZJA 1Y8GA 4XH6A 4DEAA 2V0DA 3P4KA 3PDTA 5KKRC 1FVRA 4YURA 2VTMA 4BDBA 4G3DA 5IKWA 3V5PA 3IO7A 4M8TA 2JITA 3GU7A 5AUVA 3LFCA 3FUPA 4L45A 3CD3A 5HO8A 2BRBA 4J96A 4QQTA 3POZA 3NPCA 3Q32A 3VHKA 3P23A 3DB6A 4UMRA 3PY1A 1GAGA 4Y5QA 1WBWA 4EUTA 4XOZA 4DH1A 4YC8A 5EM5A 4JBQA 4GG5A 4NWMA 3OXTA 2W1FA 4QP2A 3VW6A 2OLCA 3MPTA 3WF5A 3IW7A 2YEXA 4V04A 1PXOA 3V5QA 4KA3A 3F2AA 4YO4A 1Q8ZA 4FODA 3SXFA 3R00A 3TXOA 3UPXA 2PY3A 2PL0A 4YJSA 3R1QA 2O2UA 3R30A 4RWIA 3V51A 4O6EA 3ZUVA 2WB8A 3H0YA 4XG3A 2WQEA 3BRBA 3PTGA 2YCFA 1OPKA 2GQGA 1XH6A 4L6QA 3UYTA 5F1ZA 4AW0A 4IXPA 1K9AA 5EI8A 4N57A 5DMZA 1MP8A 4RZVA 3UIMA 2OXYA 2V22A 3FZOA 1E1XA 2RG6A 4IAKA 3ZM4A 3I1AA 3UVQA 4LQMA 2PZRA 2XH5A 3CD8A 3ZOSA 5DA3A 1MRVA 4UXLA 2O0UA 2R7IA 2X0GA 1LEZA 2WXVA 5B0XA 5EK7A 1U54B 1Q8TA 3D9VA 2A0CX 3KVWA 4MBJA 4PTGA 4XMOA 4C02A 1OKZA 3EN5A 4DBNA 2YHVA 3L8XA 3BYVA 4RC3A 4MBLA 3IK3A 4WNMA 4F64A 4KIKB 3A2CA 2AUHA 4BZDA 1OBDA 3OEZA 4F0GA 2F7XE 3ZYAA 3NW5A 3KXHA 5E1SA 3CP9A 1VZOA 5IQEA 3VAPA 3A99A 3QD4A 2C6EA 3BQCA 3PVBA 3UVRA 3V5JA 4DEIA 3A8WA 4O21A 1RW8A 1I09A 4L43A 4MXXA 2JKQA 4FZDB 1Q97A 3QHWA 5B2MA 2HCKA 1GJOA 3DDQA 1UKHA 5TF9A 4S33A 3U87A 4EH9A 4TYJA 3QA8A 5GIPE 4MWHA 1H8FA 3OWKA 5JRQA 3GU5A 4A9UA 3SD0A 3W1FA 3AD5A 4I6BA 5KMNA 3BE2A 4IHPA 1XWSA 4O96A 5HIEA 1MRYA 3TNQB 2A2AA 4K11A 1K3AA 4AT3A 4D55A 4CSVA 4GK4A 3BELA 2W1DA 1YDTE 3R6XA 2YITA 4LYNA 4EK8A 3JYAA 4G1WA 2QOFA 3E7OA 2JFLA 3FLZA 5EI2A 5EW9A 3MFTA 3RK5A 4USEA 2HZ0A 3ATSA 3F9NA 4RX8A 2PWLA 4CFWA 4CVAA 4QMVA 4K1BA 5CU4A 5B2KA 4BTJA 4ZSAA 2JDVA 2C69A 4FT5A 4PUZA 5JK3A 2E9UA 4IWPA 1JWHA 3F69A 4PMTA 4EJ7A 3LLTA 4ZTNA 3C4EA 2XJ0A 2EB3A 4HGEA 2PYWA 5AM7A 5HBEA 3ROYA 2AC3A 2YCQA 3H9FA 3L1SA 4KB8A 2XBJA 5AAEA 2UW0A 4Y72A 1YXXA 3ZH8A 1H1WA 4B8LA 1BKXA 2CGVA 3U6JA 3ZO4A 1OL7A 5CALA 4QYYA 3RHXA 4DBXA 3G9NA 3QCYA 4CKJA 5IA2A 2R3OA 3PZHA 5L8JA 3ZO2A 3QFVA 4M0YA 1Q5KA 5E8ZA 3EKKA 3HECA 4G9RA 5FGKA 5T68A 3EQCA 4O7SA 5CYIA 4BY9E 4KIQA 4AACA 3QD3A 1FGKA 5HLNA 2G15A 1W8CA 1DAWA 5IISA 3E88A 3W16A 3NGAA 3IDPA 4EK5A 3ZLWA 3AGMA 2ZB1A 2CNUA 4RA5A 3EYGA 3HX4A 3QA0A 2O65A 3TUBA 3KRJA 4FSZA 3UIXA 3VUHA 1DI8A 2W4JA 3QXOA 3QRJA 3FY0A 2C3LA 3BU3A 3UODA 2WTJA 3ANQA 4E20A 1OL2A 5IA4A 2CPKE 5GNKA 3EYHA 2YCRA 4PMPA 3BGZA 3CS9A 4Z3VA 3QCQA 4QMSA 2IZTA 2OJIA 4GYGA 4BDHA 5DPVA 2X6EA 3PJ3A 3F7WA 4I4FA 3PY3A 2WMAA 5JQ8A 4J95A 3OXZA 3U51A 3EB0A 1CTPE 2YM7A 1SNUA 2G01A 2YFXA 3VS2A 1OUYA 4ENYA 2WMVA 4CMOA 1XH9A 2R3HA 5BYYA 3TIZA 2B7AA 5H8BA 2ZDTA 3FMEA 2BVAA 3CGFA 4Q5EA 3UJGA 2BZJA 3TV4A 1KSWA 3F6XA 4GU9A 5FBNC 3JPVA 3VN9A 4FK3A 4S2ZA 4O27B 4QMQA 2J5EA 3OROA 1KE6A 4JXFA 4BCFA 3C4XA 1H01A 3FMDA 4IZ5A 1VYZA 3HA8A 3LFSA 2JDSA 1ZY4A 3D7TA 1KWPA 4I93A 4Y95A 3GGFA 5CSWA 3SDJA 5E8UA 5LWMA 3MVMA 2WEVA 4YGAA 4GG7A 3KRWA 4X6RA 2JKOA 3NUAA 4DA5A 4F6WA 4XYFA 3FV8A 4CT2A 3ELJA 3HMPA 5AWMA 5IG1A 4FNZA 4OUCA 3HVCA 5CEQA 3RPRA 2ZOQA 4ANBA 1V0OA 2UW8A 2UZTA 5CSHA 4CV9A 1UA2A 2ETKA 3MYGA 2V62A 4IWDA 3TKHA 4MCVA 5CSVA 3VBXA 4CT1A 4FG9A 2C1AA 3DNDA 2QC6A 4FT7A 1JNKA 4R7IA 4ZMFA 4ZOGA 2YWPA 1U5QA 2VO6A 2QO2A 4IX6A 4L52A 4IX4A 4MNFA 3KK9A 4YO6A 5D41A 5BMSA 1ZYCA 2J6MA 3PLSA 3Q3BA 3Q53A 3R8LA 4I4EA 4YJNA 4L9IA 5KO1A 3SGCA 5CNOA 3QCSA 4UWYA 4DC2A 1YWVA 4E7WA 3DKOA 4Z9LA 2V7OA 3I5ZA 1LUFA 3OOMA 2FUMA 3BEGA 3UNZA 2OGVA 4RVTA 4C35A 3Q2JA 1B39A 3R7UA 5ETIA 4ZSLA 2W1EA 3AMBA 4O0RA 3RNIA 4AT4A 1GZOA 4DCAA 3NAYA 1EH4A 2Z7QA 4D2WA
chains in the Genus database with same CATH superfamily
3QQUA 2W1GA 4GIIA 2YDJA 4BYJA 3F7ZA 4FSRA 3L8PA 3PWYA 4HYUA 3E93A 1UU9A 1VJYA 4JR3A 3RGFA 3RBWA 4PX6A 5FBOA 4ACMA 4DFUA 2C3IB 1JSVA 2CGUA 3SQQA 4DG0E 3F5UA 4NIFB 4I23A 3Q6WA 3QX2A 3GFWA 1GZKA 2J2IB 4H1MA 2G2HA 2X7FA 3FE3A 3II5A 3OY1A 4L00A 2YCSA 4ANSA 2R3FA 4LI5A 4E1ZA 1OITA 3NEWA 1JLUE 4GJ2A 3CC6A 5KUPA 2QODA 4TNBA 2I0VA 4ERWA 1OZ1A 1W84A 2GQSA 3HMMA 1PXNA 2JGZA 2VO0A 2QU5A 4MXYA 4C34A 4BWKA 5EKNA 2XEYA 4DH5A 3OBGA 4MF1A 5AMNA 4JDKA 1G8AA 4D5HA 4TWCA 2PVYA 4MVFA 4GJ3A 4FNWA 1A9UA 3DLZA 4OTIA 1WBPA 3N4TA 4BWXA 1YXUA 2UUEA 5LVLA 5CZHA 1OL5A 2GQRA 3G51A 4CFMA 1M7QA 1QPJA 4Y73A 2OWBA 3EN4A 2YISA 4FKIA 4RJ3A 4BGQA 2Z2WA 4U8ZA 2BPMA 4FTQA 4PDYA 3HV5A 3DK3A 5JZJA 2ZDUA 3R63A 1CKPA 4X2FA 4B0GA 3MGYA 1NT2A 2UVXA 5CEKA 3ACKA 5IQFA 4LL5A 3IOKA 4TYEA 3OWJA 1IR3A 1JKTA 4TXCA 2P55A 3F3VA 4L46A 3NUXA 4DTAA 2QLQA 4QTCA 5HKMA 4GMYA 2XIZA 4TWNA 1J7LA 4MAOA 4QT1A 3RPOA 3UPZA 2Q83A 1BYGA 2R3PA 4NTTA 4JMQA 3DOGA 4MYGA 3EL8A 3L9PA 4IIRA 4IAAA 4JDJA 4JQ8A 3QTZA 2OXDA 4CTCA 4C62A 3PSDA 2XVDA 1ZARA 2RFEA 5I9VA 4LGGA 5CI7A 5IUHA 3F88A 3H3CA 4XRLA 1YOMA 4EH2A 3PPKA 4V0GB 2IF8A 1R0PA 4WT6A 3ACJA 4LM5A 1L8TA 5LVOA 4K2RA 3FPMA 4QQ5A 3VBQA 5HG7A 4C4FA 4LOOA 3QRTA 1UU3A 1H1QA 4RIYB 2XEZA 4V05A 4UX9A 2XBAA 2FO0A 4AOJA 2F9GA 2BRGA 3QRIA 3ATTA 4KWPA 1QPDA 2X9FA 4JOAA 4P7EA 4LDTA 4IANA 2G9XA 2GFCA 3E62A 2NPQA 3FZTA 3Q96A 3VNTA 2JIUA 4EC8A 4RWKA 3ZUTA 4HJOA 2HWPA 2RFSA 3DDPA 4FV3A 4XHKB 3DQWA 3ZC5A 2OF4A 1Y91A 2X8EA 3TNIA 2B9JA 1GIHA 2XNMA 3MWUA 3PXZA 3UDSA 3T3VA 2YM4A 5DT0A 1H07A 4FA2A 1KV1A 2GNFA 2OZOA 4I41A 3W0MA 3G6HA 5CENA 3MA6A 2XUUA 4IFGA 4O0YA 5LVMA 5A4CA 4QD6A 2CLXA 2X6DA 3ORPA 3FLSA 4AWIA 5IU2A 2FH9A 1CSNA 2X8IA 4XG9A 4UV0A 5EQEA 5AR2A 4TRLA 5I4NA 3HEGA 4ASXA 2VUWA 5HHWA 3DJ5A 5DR6A 5CAOA 3WE4A 3LCTA 2WTKC 3PVGA 4FKGA 4TKSA 4BTMA 2VO7A 4WA9A 4G3CA 5J9LA 5C1QB 3RPYA 4O7RA 3P08A 4BYIA 2XK3A 4H58A 2IVSA 4ZZNA 2DYLA 4FIFA 3F3TA 5I3RA 4D1XA 4O7LA 3ZFMA 4H36A 4O84A 3MIYA 4AXFA 1YOJA 4IM0A 4G5JA 3GBZA 3RM6A 5JKGA 2GSFA 1MUOA 3PXFA 4HYSA 3DAKA 4ZTMA 4QEBA 3C51A 3H30A 4M12A 3NFFB 2BAQA 1PYXA 3KMWA 1J7UA 3VS3A 3UE4A 3OWPA 5K4IA 1KE5A 4QQJA 3D5UA 1URCA 3F2NA 2HZ4A 2C6IA 1Z9XA 4CFVA 3LXPA 4GW8A 3FKLA 2WQBA 4M15A 2UZEA 3KXNA 3DB8A 3EN9A 4X3FC 5IEXA 3MDYA 2QURA 2IZSA 4E5WA 2BIKB 3EQDA 4D4SA 4D4YA 3R8MA 1OB3A 4K6ZA 2CKEA 1PMVA 3HUCA 5I9YA 2J90A 2OBJA 3TWJA 3TDWA 4KD1A 1ZAOA 3FLQA 3QF9A 4FNYA 4FRFA 4FSYA 4RJ7A 5FRIA 5BVEA 3NYVA 2VTNA 4MEDA 3NUYA 4CTBA 5AA9A 4DTBA 3PSCA 5JGBA 5HG9A 2FB8A 2NRUA 2OF2A 3IECA 3QRKA 2HENA 4L7SA 3MY5A 2UVYA 4XEYA 4L7FA 4L42A 3PXRA 2UW7A 4TYHB 3V8TA 2DS1A 2GNJA 5D1JA 4JBVA 1Y6AA 3NAXA 4W4XA 2Y4IC 3DBFA 3D2IA 3KRXA 3WF6A 1YXSA 5GJDA 3VF9A 2OJGA 3FLWA 4JRNA 2A1AB 3VBWA 3TM0A 1T45A 5C26A 3OTUA 3MI9A 4J71A 3TV7A 2ZFYA 2WKMA 5F4NA 4PL3A 1YHWA 4YTIA 4TNDA 5IQAA 3OCGA 3WOWA 5EOBA 4NW5A 4PY1A 5HO7A 3R22A 4EHVA 4AA0A 3PIZA 2CKQA 2J5FA 2VX3A 3AGLA 3B8QA 3FMJA 1ZZ2A 5CF4A 3UQGA 3O17A 5ETCA 2P4IA 2IWIA 4CNHA 5BPYA 3QUDA 1SVEA 3MVLA 3UO4A 5I9XA 5L6OA 4NEUA 3UYSA 4DDGA 5EG3A 1J1CA 4QRCA 2YAAA 5JFSA 3NUPA 2GFSA 3CQWA 3AC2A 2OIQA 2QLUA 3EN7A 2C0IA 3KN5A 4JS8A 4FR4A 2ZV8A 3MN3A 3QUEA 4QNYA 1O9UA 2IW9A 5HCZA 4EZ5A 4H3QA 3TN8A 3LZBA 3FXXA 2B53A 2X2MA 3ZBXA 5DRBA 4ZS0A 4OLIA 5BYZA 3W0PA 3OC1A 1S9JA 4RVLA 3R9DA 1OPLA 1FQ1B 2ZV9A 3HV3A 5AUZA 2IG7A 5M53A 3DJ7A 4C58A 4FICA 3LLAA 3VBYA 3C7QA 4JG8A 2UVZA 4YZ9A 3GQIA 3Q4TA 4RVMA 3KKVA 2R3QA 4LOPA 3ZBFA 5HCYA 1AQ1A 5AV2A 2QOQA 4ZTSA 2C0OA 2HW7A 3P7BA 4DGOA 3D5WA 2PZPA 4YZDA 4F0FA 5ACBC 4QYHA 2BAKA 3DXQA 4DE4A 3FQEA 2IZUA 5L2TA 2IZRA 1OMWA 4O4EA 4J53A 1REKA 4F70A 4IM3A 1ATPE 2EXCX 2XKEA 3LOKA 3PIXA 4NW6A 5HIBA 4APPA 5AP7A 4CLJA 4WSYA 2OW3A 4N4SA 2OK1A 5J8IA 3FMKA 4O86A 3W0RA 4N6YA 5F20A 2W1IA 4MX9A 4BCJA 1RJBA 4UY9A 4QPAA 3U9CA 3N51A 5F94A 2UW4A 4K33A 1FINA 4FF8A 3PG1A 4FV2A 1PKGA 3EHAA 4JDHA 2WMTA 5FLFA 4ASDA 5K5XA 4AZWA 2EXEA 1WBVA 5AIKA 2PMOX 2PVMA 4PMMA 3TACA 4I21A 4DINA 5IMEA 3QQHA 1XH7A 2WMSA 3VUMA 4BCPA 1UV5A 5TKDA 3FPQA 4AW2A 2PUNA 4LUEA 4G16A 2B55A 3UMWA 1UU7A 2JC6A 2VTRA 3FHRA 3UOHA 2C6LA 3ZC6A 1PMNA 5L8LA 2QHNA 4CMUA 1E9HA 4QMNA 4DT8A 3BI6A 2NYAA 3COKA 1TKIA 3G5DA 1MQ4A 3IGGA 3VF8A 2W17A 5AR8A 5BVWA 3UDTA 2C5OA 2R2PA 1O6YA 2BZKB 3KC3A 3SW4A 1XJDA 3LFDA 1DAYA 5FTGA 1RE8A 4EOMA 2HXLA 5DT4A 5CEPA 4PNKA 2WMXA 2C6OA 3OCTA 1V1KA 2QO9A 3ZRLA 3IDBA 3R7YA 3QD0A 3VS4A 3QQJA 1Z57A 4XJ0A 5IA5A 4EOLA 3K2LA 3EQFA 4TY1A 4RVKA 3O8PA 3LFQA 3LFBA 3NW6A 3RAWA 2J4ZA 4X0MA 5DG5A 1JKSA 5CSXA 4MXAA 4KIKA 4A4LA 1Q8WA 3AC4A 5AV1A 5AAGA 4RWLA 4NYEA 5E8YA 4RRVA 2JAMA 3A61A 3RWPA 1QCFA 4DEDA 2XA4A 2UZBA 1FBNA 3GCSA 1NVSA 4AZTA 3FMLA 3VC4A 3OVVA 4RLLA 4YLJA 2E9NA 1WCCA 1QPCA 4JVGA 1YXTA 4ZSGA 2NRYA 1IRKA 2LAVA 2RKUA 3ZEWA 3TYKA 4Z7HA 5GHVA 2QD9A 4TYGA 3I79A 3TDVA 4YC3A 3DKGA 4M68A 2XIRA 2X2KA 4IB1A 5H9BA 3VRYA 4F9WA 3NNUA 4DFZE 2J0LA 4FSMA 5HIDA 4FSUA 5JZNA 3QKLA 4EKKA 3EIDA 2B9HA 3Q9YA 4C7TA 5BVOA 4CV8A 4U0IA 5HTCA 2CNVA 3PFYA 2QHMA 3WIGA 2CSNA 2YIWA 1HCLA 1ZMVA 3UGCA 3I7BA 4IB0A 3BBTB 2IO6A 4IVDA 4O4BB 1W2DA 1ZYLA 4QYGA 2VRXA 4O7VA 4DITA 4JBOA 4BIEA 2VTSA 3S1HA 3P0MA 2VTLA 1P2AA 4Q9SA 3VW8A 4BFMA 5CI6A 1FMOE 3PE1A 4J98A 3Q6UA 2J9MA 1KE8A 4KKGA 3F5PA 3C4FA 2QR7A 1ZOHA 3K5VA 1TQMA 2QOKA 4YZBA 4FTLA 4YZMA 4O7WA 3ZONA 3GC9A 3LVPA 3JS2A 3DJ6A 3I81A 4EHZA 5D7AA 2GNIA 3UTOA 5HVYA 2XS0A 3C4CA 3G0EA 2XK9A 5I0BA 3KB7A 2YDKA 4DGGA 3QC4A 3GCQA 3KL8A 4BRXA 3QWJA 4U3YA 2JEDA 4I5CA 2JLDA 3DBEA 4AXAA 4O0WA 3U54A 3D15A 3CSVA 4M13A 5EM6A 2BAJA 3GI3A 4XRJA 4F6SA 3GC7A 1H1PA 2VGPA 4UN0C 1W83A 5FM2A 3KREA 3VONA 2YABA 3TNPC 2VTIA 4ZMEA 5GZ8A 3PWDA 4EK3A 4YHJA 5AUUA 4I20A 1Q24A 1GIJA 4EC9A 3LQ3A 3AT3A 3ZRKA 4ERKA 3SXSA 2BFXA 5E8TA 2XK6A 5CVFA 3FZSA 3PYYA 3FL4A 3QZIA 3KXGA 3QCXA 4NKAA 5E8WA 5AUWA 4A07A 4BICA 4D4RA 4FEUA 4G3EA 4XLVA 5D10A 3NNXA 4BJJA 5IQCA 2A98A 3G9LX 3GCVA 2W05A 3MFSA 4WG5A 5DNRA 1H0VA 3ZXTA 3OS3A 4K0YA 5B7VA 3R9HA 1G8JA 4Q5HA 4EH7A 4E3CA 3OXIA 3BBWA 3DBDA 4I6QA 1ZWSA 4FUYA 4IZAA 5M44A 3AMAA 5BVKA 1YRPA 4ZAUA 3MJ1A 4USFA 3PP1A 4FOBA 1PY5A 4RQKA 3G90X 5HNGA 3NYNA 4DGNA 4ZJIA 4M66A 3BV3A 4FL3A 4HVSA 5CF5A 2RSVA 1O6KA 3D4QA 3ULZA 3AKKA 2XK4A 5AADA 4R77A 4DFNA 5J1VA 2BDFA 3OTVA 4DG3E 2BDJA 4A9YA 1Q61A 2WELA 4UALA 3UOKA 4W8DA 1XH8A 1YWNA 2ITYA 4YPSA 1YWRA 4EH4A 4ACGA 3OUNB 5AX3A 4ZSEA 4FSWA 4FTCA 4NM5A 3COHA 2PVNA 3IW5A 3BU6A 4AAAA 3W18A 2YJSA 5AX9A 2ESMA 2QVSE 1R3CA 5JFXA 1KUTA 4EZ3A 1ZOGA 5FXQA 1DS5A 4ZK5A 2C0TA 4GFGA 3S2PA 3W2RA 2PZ5A 5J9ZA 3R9RA 3HP5A 4EH5A 4WG3A 1P14A 4PNIA 3W0SA 5B2LA 4K18A 4J1RA 1J7IA 3NVKI 4YJQA 3R8ZA 5I3OA 3WIKA 4IVAA 3P1AA 4RIWB 2E9VA 4BDGA 4NL0A 3RM7A 5CT7A 5L6WL 4G31A 4YHTA 4NSTA 2B9IA 3E8CA 2XYNA 3V04A 2XNPA 4ZY6A 1TQPA 4E4MA 4I5PA 4R3CA 3ZZWA 4E8AA 4HZSA 4KBCA 3LHJA 4FV5A 4HZRA 2CCIA 1G5SA 3W2CA 2X9EA 4DFXE 2ITPA 4AQKA 1WBTA 3ZEPA 3E64A 4GT5A 5DVRA 5HESA 4F1TA 3TZ7A 1PXMA 4L3PA 3S00A 5TR6A 4O0SA 2PVFA 5GZAA 1R1WA 4JIAA 3BPRA 4EI4A 5J9YA 2X39A 3KRLA 5E8XA 1OKWA 4W8EA 2VD5A 3N9XA 2VN9A 2QOIA 3RALA 2R4BA 4N70A 5TO8A 4KKEA 3SOCA 1U5RA 4IDVA 5EYKA 4X7QA 4DHFA 4K8AA 4E6CA 5KMIA 2OIBA 1ST4A 4RX7A 5CQUA 2CGWA 4FTRA 2VWIA 5AP3A 3CTHA 2E2BA 3M2WA 3VULA 2CN8A 3GOPA 4MTAA 2WO6A 3E8DA 4WOVA 4FKUA 5JGDA 3ORLA 5M4FA 5A9UA 3Q9WA 4E73A 2I40A 4APCA 2GHGA 3Q5IA 3OBJA 1JKKA 4ORKA 2YM5A 1CKJA 2R9SA 4FTOA 4HGSA 3R1YA 4KINA 5C01A 3T8OA 3WF9A 2HOGA 2QOHA 5GJFA 3KF7A 4NIFA 5AV0A 4NZWB 3FXWA 5E90A 4U44A 3UZPA 4UMTA 3AC8A 3NYOA 2BTSA 4MXCA 2VTOA 3ZCLA 5LOHA 4DN5A 4HVDA 1BMKA 2C30A 3O50A 2DQ7X 3FC1X 1JSUA 1YHSA 4HGTA 4NM3A 5E8VA 4U81A 5C27A 4TTHB 1LPUA 5EM8A 2ERKA 4FGRA 2RFDA 2ITNA 3EQGA 3KMUA 3ORZA 4X2GA 3MVHA 3DCVA 3S3IA 3ZZEA 3LFAA 5LCJA 3DKCA 2Q0NA 4CXAA 3UC4A 3BLRA 4A9SA 1L3RE 4AF3A 3VS7A 4EWHA 2QOLA 4BR3A 3QQLA 4CG9A 5M09A 4MXZA 3C4WA 3RNYA 4PMSA 3VUGA 2WOUA 3MPAA 2R3GA 3NDMA 4J97A 4EOIA 4NTSA 3WYXA 4OTWA 4AXDA 3NRMA 3BGQA 4JDIA 3U6IA 4W4VA 3VS0A 3L9NA 5IQHA 5DFPA 2X0PA 5ICPA 4X2JA 2OZAB 4D2TA 5KHXA 5IEYA 4FIHA 2YJRA 4HCVA 4O1PA 4CGAA 4V01A 5EYCA 3E8NA 3E3BX 4KAOA 4TW9A 4N0SA 4FGBA 4AA5A 5BX0A 5KMOA 2OFUA 5HICA 4U45A 2XNOA 1QPEA 2YM8A 3DQXA 4NT4A 5AP2A 3PZEA 4C59A 4ACDA 1QMZA 2Z02A 3FI4A 5CASA 2GTNA 2R0UA 4ACCA 3HUBA 2YLFA 4FTTA 5G1XA 3LM0A 2QKWB 4NJ3A 4S32A 3FL5A 3NNVA 4TYIA 3VS1A 3ZFYA 2YLEA 4BDJA 3PJ2A 3UDBA 5JSMA 1H27A 2CNQA 4J8MA 3A7IA 5E1EA 5FP6A 1CMKE 4EOOA 4F4PA 4V0GA 5A4LA 3D94A 4FG8A 3LFEA 4IBMA 1M52A 3SOAA 4BZNA 3P5KA 4OT6A 5HORA 2PU8A 1OIUA 4QPSA 4W9XA 3KXZA 4AW1A 4Y85A 3RTPA 2CGXA 4M84A 2VWUA 4L3JA 4RIYA 2GHLA 5M57A 4QDVA 5KMKA 2PVHA 5DEWA 4B4LA 4G6LA 2F49A 3NS9A 4N6ZA 1AGWA 3GU6A 5M4CA 5HNBA 3COIA 1A48A 4EH3A 3P5JC 3TIYA 4DHIB 3LXLA 3CPBA 4FT3A 3O8TA 3DGKA 4AG8A 1H25A 3DKFA 3QWKA 4RFZA 2QO7A 4WHZA 2W5BA 2PVLA 4MQ1A 3BYMA 3QTWA 2JDTA 3FZPA 2ZJWA 3UDZA 3EQRA 4XNEA 1RDQE 2A4LA 1UWJA 1ND4A 5FDXA 3DAEA 5GINE 3EOCA 3LCDA 4A9RA 4ENXA 4D28A 4E5BA 4WNOA 4ANQA 4C37A 5J7HA 2Y7JA 2X8DA 2YAKA 3FSKA 5DR9A 3KULB 4BCOA 4C8BA 3TI1A 3BIZA 3A4OX 3CJGA 3QQKA 4R6VA 2ZB0A 1BL6A 5K0KA 5BUEA 2FSLX 4G17A 4QMUA 4YJRA 2W4OA 3MH0A 3REPA 1OGYA 2UV2A 4ZLYA 4IAYA 2C5XA 4C38A 3PFQA 4JJRA 4KUJA 2H6DA 4O82A 5HX6A 3C5UA 5J95A 5IA0A 2FSTX 3GOKA 5CAUA 4YR8A 4F09A 1W7HA 1J3HA 3K5UA 2UW6A 2ITVA 4KBAA 4Y8DA 4DTKA 4OTDA 4FVQA 2GHMA 3CY2A 3GT8A 3GVUA 3RCJA 3CQEA 4HYIA 1Q3DA 3ZMMA 3E92A 2IN6A 3FKNA 2J7TA 2JBOA 3QKMA 2ITOA 5EW3A 1H1SA 3CR0A 3FKOA 3PIYA 5EDPA 3GC8A 2J0MB 5LMAA 2XM8A 1YI3A 4ZSJA 2PMNX 2XM9A 3NUUA 4JX3A 3QL8A 5IEVA 4IH8A 5T3QA 4DYMA 1WBSA 2YZLA 2Y4PA 4P4CA 3DTCA 3A7HA 3HNGA 5M07A 3ZHPC 1H0WA 4DGLC 3LMIA 2IVUA 2C4GA 4WKQA 4FTMA 2VTTA 3G33A 4BI2A 4EOPA 4EWQA 3W2QA 3UIBA 1OGUA 2F2CB 3ENMA 4U80A 5CU6A 1OUKA 2JKMA 3DAJA 4FZAB 4I94A 2RFNA 3A60A 4I6FA 4JQEA 4TYHA 3QALE 1W2FA 3ZDUA 4QP1A 2FSOX 2VZ6A 3MJ2A 3PRIA 4AGDA 5EOLA 4DAWA 2I0HA 4XG4A 3LAUA 4ANNA 3ORTA 4FSTA 4CQEA 5DR2A 4HOKA 5FEQA 3GU8A 2ONLA 2ZV2A 2JAVA 3D5XA 3EQBA 5CXHA 2HK5A 3EQIA 1I44A 4RSSA 2XAMA 3O2MA 2PSQA 4DGMA 2PUPA 4YSMA 4J52A 4ZP5A 2X7GA 4TZRA 2H8HA 5A3XA 1T46A 2ETMA 3LW0A 3G6GA 1NXKA 3FMNA 1XR1A 3TKUA 4U7ZA 4F9BA 3LE6A 4J99A 3MTLA 4FSQA 4LGDA 4UZHA 4Z7GA 1HCKA 3SKCA 3ZUUA 1NW1A 5G6VA 3D0EA 3NR9A 1KE9A 3OZ6A 2XIKA 1BI7A 3D5VA 3BHVA 3O71A 5LVNA 3ALNA 1JVPP 1X8BA 2FYSA 4KBKA 4FVRA 4YC6A 2OJJA 3HZTA 4JT3A 4MK0A 5DT3A 5KMJA 2CKOA 3QQGA 4LG4A 3U4WA 3QTQA 4EEVA 5DIAA 5IPJA 2OH4A 4NCTA 2F4JA 5FDPA 3ORXA 4MBIA 4UWCA 5FM3A 5F95A 3BQRA 3SG9A 3FHIA 2UW9A 1HOWA 1YKRA 4H3PA 4YP8A 3A8XA 4AT5A 3MB6A 1PHKA 2BZIB 3D7ZA 5HU9A 1XBCA 1B6CB 4GH2A 3OWLA 3QXPA 5EH0A 4RX9A 5C8KA 2FGIA 2PE0A 1IASA 3IGOA 4OW8A 4RZWA 4HVHA 5IMXA 5JFWA 5CF8A 5L3AA 3U8WA 4A4XA 4FEQA 2QCSA 4YHFA 2XP2A 4X2NA 1Q41A 4FL2A 3AC5A 2OU7A 3KGAA 3LMGA 5IQBA 4RC4A 5HLPA 2WTIA 4FSNA 4EZ7A 2XCHA 1UKIA 3AT2A 5CWZA 5EDQA 4I0TA 3ET7A 4MNEB 4FKLA 4KS8A 2YACA 3CE3A 3RZFA 5C8MA 1AD5A 3CIKA 4CZYB 4UMUA 2WIPA 2W7XA 4EBVA 3VUDA 3VS6A 3L9MA 4UYNA 3MY0A 3LFNA 3NZ0A 1Y8YA 3BGPA 4KABA 2BTRA 4R8QA 3IOPA 3TTIA 4C2VA 3I0OA 3HMNA 3FJQE 3OCSA 1UU8A 4YTFA 4MF0A 4PP7A 3RP9A 3P7AA 4O6LA 1XQZA 1TQIA 3L8VA 5LVPA 3UOLA 3F5XA 4IWOA 3ZDIA 2YZAA 4O0VA 1ZY5A 4QYEA 4S30A 5HEZA 1KV2A 4QMYA 2ITTA 3FDNA 5JT2A 4NK9A 3FLYA 4GFMA 3BL9A 5HQ0A 4BGHA 4JQ7A 2R3JA 3QZGA 3QTXA 2W1HA 2WU7A 3DLSA 5L2IA 4FV6A 3AQVA 1TVOA 3PPJA 4QMTA 4UBAA 2HXQA 2JKKA 2V5QA 4G6OA 4WNPA 4WO5A 3RVGA 3BLHA 3CBLA 2WQOA 4DLIA 2VAGA 3MH2A 3Q4CA 3IW6A 5K5NA 2Z60A 3ENHA 4D58A 3QBNA 2IVVA 4W4YA 3BHHA 4TT7A 5AA8A 4EK4A 2YM3A 5HTIA 1XBAA 3DY7A 3R8PA 4FIJA 5AFVA 2W5AA 5EDRA 3EJ1A 4YU2A 3DBCA 4M0ZA 3FXZA 1OKVA 4GT3A 2I7QA 1U46A 2Y9QA 5HO6A 4LGHA 2W99B 5KZ0A 4AN2A 4IEBA 5I9WA 3R71A 3FMHA 1M7NA 2C47A 4IJ9A 3LXNA 1BUHA 3VBVA 5ETAA 3E87A 2G2FA 4RA4A 3MIAA 4JBPA 3JUHA 1ZXEA 1Q62A 5CAPA 4BL1A 4PWNA 5M55A 3TKIA 1M14A 5HBHA 3RPSA 5A46A 2QOCA 5J7BA 3LKMA 1G3NA 3F82A 3NIEA 3R8UA 4Y46A 4F1OA 4MH7A 4DFLA 4QDEA 3EFJA 3OT3A 3LCKA 3H4JA 2BRMA 1YHVA 4QMWA 3HL7A 4YLKA 4AW5A 4I0SA 4BHNA 2R5TA 4WBBB 2UW5A 2EB2A 3R8VA 3UOJA 1SMHA 3HA6A 3MA3A 3MESA 3POOA 4EJNA 5L6PA 1G8SA 5CAVA 3GC0A 3O7LD 4FKVA 5J87A 4G9CA 4AQCA 2OI4X 4XLIA 3HLLA 1APME 3VUTA 4BCKA 4HPTE 4XV3A 2WPAA 2BILB 3NX8A 4YZNA 4DLJA 4AFEA 5HTBA 4FNXA 4A4OA 4CFXA 2Y6OA 3IKAA 3QLFA 4GYIA 4F78A 2XRWA 4E6DA 2VTPA 4AOIA 2G2IA 5HE1A 4F9AA 5CZIA 4IC7A 3JXWA 1FPUA 5TT7A 3QGWA 3FLNC 5H2UA 3NNWA 5EI6A 2PK9A 2W1CA 4QMMA 4FV8A 4FV1A 4XP3A 3E7VA 4FBXA 1JQHA 3QHRA 1PJKA 1M2QA 4E93A 4EUUA 1CKIA 4TWOA 4HW7A 5AV4A 1H26A 1MQBA 4BZOA 4EYMA 5KHWA 4KS7A 3CY3A 4L44A 2P0CA 4O0XA 4M7IA 4BBEA 2F7EE 3H0ZA 2ITUA 1ZLTA 2EVAA 5JH6A 4FUXA 3WE8A 5HNIX 3OEFX 3Q52A 3N4VA 3SHEA 3R01A 2BALA 4HVGA 4ZJVA 4DT9A 4JRVA 4PP9A 1YVJA 5DOSA 3KRRA 2ZMDA 2QOBA 4ID7A 5CAQA 4XG8A 3EFWA 2Z7RA 1LR4A 3VUIA 5IZFA 2G1TA 4KRDA 2WMBA 4XV2A 4CRSA 4OR5A 2XKFA 3F61A 3LCSA 2V55A 2QU6A 4KIPA 4WRGA 1BL7A 5IA3A 3R21A 5KKRB 2VX1A 4RMZA 3AG9A 3Q9ZA 3GNIB 5E9EA 4JAJA 4JL9A 2UZWE 4D9UA 5L8KA 1OL1A 3OD6X 4YJUA 5LJJA 1R39A 3OOGA 2UZOA 4IADA 4FE2A 2PVRA 3O8UA 5E91A 1JKLA 4GSBA 4UWBA 5JRSA 4AP7A 4H1JA 4FKOA 4U79A 4NH1A 2XNGA 5K4JA 1IA8A 2P33A 3DT1A 2SRCA 1UNLA 4EH6A 4PQNA 3JR1A 4M69B 5HBJA 2KTYA 3PA3A 4OBOA 3O23A 5L2QA 4BB4A 2YIXA 2R3NA 1GZNA 2DWBA 3B2TA 3HRFA 4R1VA 4S31A 4BDIA 3AKLA 1ZYJA 3CEKA 5DH3A 5BMMA 3HKOA 4U5JA 4RBLA 3VRZA 1O6LA 4WUAA 3W32A 3ETAA 4FTAA 2W96B 3HMIA 5BV3A 1PF8A 2C6TA 2HWOA 1ZYDA 3IS5A 3NLBA 4BWPA 3R73A 3T9TA 2ZAZA 4BTKA 2XNNA 2J0IA 4FX3A 2E9OA 3ORNA 2XALA 4QP6A 5IUIA 3H10A 5BUJA 3DFAA 5JMSA 4HYHA 4B99A 1GY3A 3V8SA 4PPBA 4GT4A 2VWZA 2X81A 4OTPA 2WFYA 3DS6A 3MH1A 4O1OA 3F5GA 2A27A 4P5QA 4EQMA 4DG2E 2XIXA 4LMNA 1WBNA 5A6NA 2BMCA 3C50A 4RIWA 3SG8A 3QUPA 2Q0BA 4GU6A 2J51A 3U9NA 3VHEA 4RX5A 4QMPA 2PZYA 2W1ZA 1VEBA 5KCVA 4BIBA 2OJ9A 5LWNA 3AT4A 4M3QA 2W5HA 4JX7A 3U55A 4FV7A 3QLGA 4RGJA