4KAOA

Focal adhesion kinase catalytic domain in complex with 1-(5-tert-butyl-2-p-tolyl-2h-pyrazol-3-yl)-3-(4-pyridin-3- yl-phenyl)-urea
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
252
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 252
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kaoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kaoA01
3GCSA 4MEDA 3BLQA 3WIGA 1YDTE 4OBQA 5BX0A 2HWOA 4OT6A 3R7YA 2JFLA 3P0MA 1OGUA 2RG6A 5CLPA 3WZDA 4CRSA 2GNIA 2JLDA 4TWOA 4GFOA 5C9CA 1OECA 3QTIA 3HUCA 1GZNA 5BYYA 2BTRA 4O7YA 1SNUA 2VAGA 4YR8A 3QQGA 3UBDA 5B2KA 4QTCA 2B54A 5E8UA 5K0KA 3U9NA 3IG7A 4OTRA 5A14A 4U42A 3WIKA 5AV0A 3MH0A 3VUHA 3D2KA 2P2IA 3AT3A 2GQSA 3OW4A 2VV9A 3O8PA 4XHKB 2WMTA 2LAVA 5FWKK 2IVUA 4YJTA 2C1AA 2OSCA 3LJ0A 3Q32A 4IQ6A 4HVSA 1DAWA 4TXCA 2X7GA 5KNJA 4MD9E 3EOCA 3ORLA 3V5PA 4KD1A 5DRBA 2XRUA 3C0HA 3QL8A 4KKGA 3RZBA 3DV3A 3G90X 4YO6A 4XEYA 4BY9E 4IX3A 4FNYA 4QPSA 3IW4A 3Q96A 1XH9A 3LVPA 4HPUE 2C6IA 2OZAA 5JMSA 1NY3A 5KMKA 4PDPA 3HP5A 3KVXA 4I5HA 3IGOA 4YC8A 4AN3A 2BIYA 5K9IA 5LCJA 3HX4A 2IG7A 4CGAA 4G34A 4IXPA 2PMOX 3R7UA 3QC4A 3V5JA 2PUNA 2VTHA 2QR8A 2XVDA 3CCNA 1YXSA 2CMWA 2G2IA 4X21A 3Q9WA 3U9CA 1YDRE 3OTVA 3U54A 4PY1A 4D58A 3NLBA 3HV5A 4WBOA 4PMPA 2YACA 3QLFA 4E5AX 1URCA 1R78A 3LXLA 4QNYA 4D55A 5KMNA 1YHVA 4BBFA 3FI8A 2DUVA 2R5TA 3BRBA 4BCNA 4U44A 1PHKA 3TNIA 5LMBA 1PXNA 3I5ZA 4G3EA 3HUBA 4FG9A 2GNHA 3VUDA 4XOYA 4C4GA 5KCVA 2CCHA 3OY1A 3U87A 4EOPA 4FZ7A 2J2IB 2OXDA 4FKGA 3JR1A 5CEPA 1CSNA 2HY81 4GVAA 2H34A 1PYEA 4EH8A 4JXFA 4CV8A 3MPTA 4ZOGA 4TNBA 5KBQA 1FVVA 1ZZ2A 1K9AA 4KRCA 3UC4A 4DG2E 2F2CB 4ACMA 4A4OA 2QU6A 1WBPA 1ZYJA 3G9NA 3M42A 3EZRA 3V8TA 3V8SA 4ZXTA 3R9RA 2I7QA 3A8XA 2ZYBA 3BYUA 4AT3A 5JT2A 4WBBB 4BBMA 2OK1A 4P90A 3ZSIA 3EYHA 3FE3A 3OWKA 3PPJA 4FZFB 4IX6A 3RP9A 1LEWA 4WD5A 5IKWA 3TI1A 3KEXA 2C6MA 2HIWA 2BHHA 2O64A 4NJDA 4CG9A 2R3JA 4D1XA 1CMKE 4FL1A 3SX9A 3R9HA 2OFUA 2QO7A 2XF0A 3WE8A 3K5UA 4A4XA 4E5WA 4CMUA 1ZOEA 4V05A 3U55A 3QTUA 1REJA 4AA0A 4QMOA 5F1ZA 1JLUE 3DBEA 1FOTA 4TW9A 4EH3A 4EH9A 4ASEA 2O2UA 2JBPA 5EYDA 2C5NA 4QMQA 3BHVA 3VHKA 4FV9A 5EW8A 4CZYB 5CAPA 3EMGA 1UU7A 4FKIA 3OVVA 2NRUA 3BI6A 4IVBA 4HVIA 3Q4TA 2VTPA 2AC5A 3QKKA 5KZIA 5K4IA 3SG8A 2BZHB 5BUJA 4L6QA 4XBRA 4ENYA 2W1HA 5E7RA 5EDPA 2J5EA 4UXQA 3AG9A 4UALA 4QNAA 3ZS5A 4BZOA 3CJGA 4L7SA 1Y91A 1F0QA 3DJ7A 2NO3A 2ESMA 4FBXA 4FV7A 4IIRA 1KWPA 3KN6A 5DBXA 5AP2A 1GOLA 3R8ZA 2QD9A 2R64A 3ZBFA 3PE1A 4EI4A 4LG4A 3Q9XA 5EI8A 5HTIA 2G15A 4UMTA 5CI7A 5M57A 2UZEA 3DDPA 3TN8A 2C6DA 2PTKA 3UIXA 5TO8A 1W83A 2Z8CA 3BELA 2W1IA 3KK8A 3HP2A 2EU9A 4B9DA 3ORXA 3HMNA 3FMHA 5CU4A 4XLVA 2ONLA 3KXGA 3AD5A 3ZC5A 4CD0A 4C34A 4AQCA 4TT7A 4ACHA 4QYEA 3O8TA 4BZNA 3CJFA 5HBJA 5CQWA 3QFVA 1UU8A 1VJYA 3E7VA 3R8VA 5L3AA 4M0YA 5M44A 5GIOE 3PVBA 1FPUA 3C5UA 2YISA 3KREA 5L6WL 5CI6A 3TIYA 4BCGA 3LLTA 3FHRA 3GU5A 5I4NA 3TXOA 2J6MA 5AUUA 3GC8A 2W0JA 3PLSA 4G3CA 4P2KA 2ITXA 3FI4A 1YVJA 4YPSA 2R3HA 4N4SA 2XIRA 3Q3BA 3BYSA 4O0RA 2E9OA 5AV4A 4FIGA 4W4VA 5KBRA 2QHMA 2EB2A 3EFJA 3UC3A 1ZOGA 4M14A 4PTGA 1JKKA 3DB8A 3VJNA 4QQTA 4M66A 4O22A 4RIOA 4FKTA 4BRXA 3S1HA 2CGUA 5AR3A 1GY3A 2HZ4A 1UNHA 4JX7A 4CQEA 4XP2A 1XH4A 2P4IA 3HVCA 4CFNA 2ZM3A 3CD3A 5HVKA 2PSQA 1GZOA 3A7IA 3V5QA 5AIKA 2FYSA 3VUMA 3LKMA 4N0SA 2W9FB 4AZEA 4F0GA 4A9TA 3SG9A 1X8BA 3ORIA 2BAJA 2PVYA 2YFXA 3ZUVA 1FINA 4EBVA 5M06A 2HZ0A 3LPBA 3AD4A 3ORNA 4GH2A 5C1QB 4RJ4A 1S9JA 1XH5A 2X8DA 1QPJA 4FKLA 4ZSGA 3V5LA 3OCTA 4YNEA 3DKOA 1GIJA 3HRFA 3ZDIA 5J9ZA 3OW3A 3ZRMA 4DITA 4FEVA 2C5VA 2J0JA 4HYUA 2CCIA 4RPVA 3ZHPC 5J1VA 3O0GA 2W1EA 4EZ7A 1IEPA 2BR1A 5E8SA 1J7UA 4ANOA 1H0VA 2VO7A 3OUKA 4C7TA 5F9EA 4FZAB 1JOWB 3L9LA 5DE2A 3LFDA 4N70A 2UW6A 3F3TA 5DI1A 4ZY6A 4EQCA 2UW3A 2ZV8A 3BZ3A 3VBTA 5BVDA 4QMZA 4RIWA 2BKKA 1H25A 3CR0A 5LOHA 5H8BA 3SVVA 3NR9A 4WNOA 2PL0A 1KE6A 2BDJA 5CXHA 5GZ8A 5CU6A 1XBBA 3R02A 3OCBA 4DTBA 5DR9A 5E1EA 4BVUA 3HRCA 4QQ5A 4HVDA 2YM3A 4XNEA 2ITWA 3TZMA 2XB7A 1DM2A 4U79A 2ITUA 3MY1A 1RW8A 3UOHA 3F69A 1A06A 3TCPA 1DAYA 3TUDA 3LCTA 2CLXA 3DNDA 4FSTA 4TTHB 4AT4A 2BUJA 2NRYA 2J0KA 4UB7A 1PXJA 1W84A 1WZYA 2WMQA 3D0EA 3D5XA 3DLSA 3JUHA 4KA3A 2IW6A 4CVAA 2RFSA 4FYNA 4F65A 3TNHA 3VBWA 3H9RA 5IISA 5CASA 2C69A 4IWDA 3R8MA 1FMOE 3LMHA 3LW0A 2CSNA 3NNXA 4LMUA 4BBEA 2VTJA 4FK6A 2F9GA 4EOMA 2XIZA 3FLZA 3GBZA 4PQNA 4DEIA 5IDNA 3HDNA 5L6PA 5LVPA 3NMUF 1PKDA 5IA1A 4BZDA 4G3DA 1SMHA 2B9FA 3CY2A 3BBWA 1RDQE 3L8VA 5A46A 3NRMA 1W82A 3DCVA 4WSQA 3IO7A 4YGAA 2GDOA 3DKFA 1ZMVA 4FYOA 1DS5A 2OIDA 1V1KA 2ZV2A 2XNGA 3L9NA 3MFUA 2E9PA 3NW6A 4IAZA 4V0GB 3E64A 1OB3A 5HGIA 5M56A 4DBXA 4TY1A 3UOJA 3EZVA 3W2RA 4MXXA 4O83A 3GCVA 3OC1A 4NW6A 3CP9A 5EKNA 4TWPA 1YHWA 2BZKB 3P08A 3PJCA 5IUGA 5IEYA 3QHRA 3ZM9A 3BPRA 2R3NA 2JC6A 3IOPA 3LCOA 3TZ8A 4A4LA 3MVHA 4WHZA 4AGUA 4FA2A 4KIQA 3MESA 5HBEA 5A6NA 3T3VA 5A4TA 4PP7A 3R2BA 4KBAA 3PIXA 5CF5A 2PE1A 5CSWA 5HZNA 4NT4A 3UPZA 4EWQA 4J99A 4X3FB 4AGDA 4C02A 4NM5A 4RC2A 4QP6A 3BEGA 2BRMA 2ETMA 3UE4A 2QKWB 3DK6A 1TQMA 3TZ9A 3ZYAA 3FZ1A 5FXRA 2H8HA 3LFAA 4PPAA 4RJ8A 3TTIA 3I6UA 4XG2A 2YLFA 5BUIA 1JVPP 1R39A 1UA2A 1M52A 4PWNA 2GFSA 2WTDA 3FKOA 5AAFA 3ALOA 5HQ0A 5ICPA 1OI9A 3VUKA 2HYYA 2YHVA 2IVVA 2PULA 4J8NA 2BPMA 3R8PA 4FSWA 2OLCA 5CEQA 5M4FA 4E7WA 2UZOA 3EB0A 1GAGA 4MBLA 5FUTA 1JSTA 4NEUA 1PMVA 4D28A 4KIOA 1MP8A 3HECA 4RRVA 3GU8A 3LLAA 1ZLTA 4XUFA 1Q5KA 3I79A 4ACGA 4FGBA 4RC4A 4KKEA 4CQGA 3UNZA 4AZWA 4O0TA 4BDKA 2J0IA 2Y0AA 3JVSA 4BCMA 4WNKA 3PXKA 4U6RA 4WNPA 5D10A 3ROCA 3BGPA 3Q6WA 3F2RA 1IA8A 1AD5A 2W1DA 3A2CA 3RWQA 3QCYA 4GG7A 3BU6A 3VF8A 4JS8A 4XH6A 4JG8A 4ACCA 4F9CA 5I5ZA 3RAWA 4Z7GA 3G51A 3RM6A 3CTQA 2YM4A 3LQ5A 4AZTA 4BGHA 2V5QA 4QOXA 5AJQA 5J79A 4UMQA 4CEGA 4EOOA 2UVXA 2UZUE 3HL7A 1ZXEA 3LAUA 2WQNA 2XBAA 5EK7A 3BU3A 5A4CA 4PNIA 3W2SA 4BCFA 1OM1A 3PFQA 3ZFMA 4LRKA 5DOSA 4FEWA 3G33A 4G1WA 4IBMA 1Q8YA 5CAQA 2A1AB 4K11A 5FEEA 2IZSA 3PA4A 3CLYA 4IFCA 1PXIA 3QD2B 5DPVA 3DB6A 2JDRA 4RGJA 4AWIA 3A7GA 5J5SA 2W1GA 5EQPA 3PVWA 4RG0A 5L8LA 1UVRA 3GFWA 4Y72A 3HAVA 2BFYA 3N51A 5TOZA 4BFMA 4DFZE 5M53A 4R1YA 4GFMA 5AWMA 4BF2A 3DJ5A 4BDAA 5CT0A 3NNWA 4O1PA 2IZRA 5EHYA 5EW3A 4PDYA 4O0WA 1NVQA 2QHNA 3R7OA 3T9TA 4GKHA 3A62A 3ZXZA 4EOKA 3UVQA 1S9IA 3VJOA 4N57A 4AG8A 1JAMA 1Q99A 2HZIA 4ZJIA 5IH5A 3ENHA 4J53A 3C51A 4A9SA 5KKRC 4R78A 3JS2A 2FSOX 2VTMA 3CIKA 1JBPE 3ZLYA 5F4NA 3TDVA 4YSJA 3TV4A 4HCTA 3QD0A 5L2QA 3A7HA 4YHFA 1BLXA 2WTKB 3QD3A 3BE2A 4F9AA 1OZ1A 3FV8A 3FL4A 3QTSA 3GC7A 3FKNA 5CAUA 1G8AA 3C4EA 3DAEA 3Q4CA 4MBIA 1H28A 5LVNA 3ZZWA 2R3IA 1H27A 4JIKA 4FTQA 1AGWA 4YO4A 4TN6A 4AF3A 4LOQA 4JDHA 5AP7A 1H8FA 4MNEB 3BV3A 4AS0A 5KHWA 2W7XA 4YJRA 3MFSA 1JKSA 1Q3DA 4DFXE 4L00A 4XV1A 2EB3A 4KBCA 5J7HA 2PPQA 1M2QA 5IQGA 1OIRA 5JGDA 2XBJA 3TZ7A 1H26A 3ODZX 3E88A 1U54B 2EWAA 5HO8A 1J91A 4IH8A 4O0VA 3PTGA 1YOMA 3FZRA 3L9PA 4UN0C 4GYGA 4JG6A 5LXMA 4FT5A 2GNJA 3QCXA 1KOAA 1M17A 4CFVA 1XQZA 4QTBA 4ZSLA 2VX0A 2UW7A 3HLLA 5CY3A 4TYHB 4D2WA 4C3FA 3DAKA 3RZFA 4ACDA 3A4PA 1VEBA 2OZOA 2QC6A 5FD2A 4IB3A 4YJVA 5LWNA 3BGZA 4C3RA 3QRUA 3ZUTA 3EQPA 4GU6A 2VGPA 3ID6C 4AZFA 3F2NA 1OPKA 3PXRA 3DLZA 3QZIA 3WI6A 3IS5A 3SA0A 5HIDA 4B6LA 5B2LA 5J87A 3ATSA 1OKZA 3QWKA 4C38A 3W16A 3F5UA 1U5RA 3R28A 3RHKA 3KF4A 2PVMA 4FKWA 1PF8A 4I92A 2QOQA 2OJFE 4YTFA 5CNOA 1DI9A 2W17A 2XKCA 4IWQA 2OXXA 4DE4A 1H1RA 3F3VA 2JKKA 2DYLA 2UZBA 3ALNA 3I60A 3P78A 4M7IA 5AR4A 4EJNA 3NGAA 4MHAA 2YCFA 4MXYA 5EKOA 4HGLA 4KAOA 4OTQA 4YZBA 4QYGA 3IW5A 5DFPA 1GZ8A 4G9CA 4MQ2A 1YI4A 1WVXA 3C50A 4WG4A 4O7VA 3R63A 3GOPA 2P55A 2PVNA 3NEWA 2CLQA 3LMGA 3F5PA 5KO1A 3PY1A 2I0YA 2IPXA 1IRKA 3FDNA 3VS5A 5B2MA 1SVEA 1WFCA 1FBNA 2CKQA 3P5KA 4L53A 4YHTA 5EYCA 3LCKA 4EK5A 2R4BA 5EI2A 5F94A 4BCKA 4HZSA 4DINA 3AOXA 3GB2A 5JQ5A 5A4QA 1SVGA 5AMNA 1WBNA 5IEXA 2GCDA 2J7TA 4PPBA 1JWHA 4O6EA 4HVHA 3RVGA 4DEDA 3LFSA 3LFEA 4L68A 4ASZA 4KIKA 3Q2MA 1P5EA 3NUAA 3VWAA 1JKTA 2PMIA 5AP1A 3RNIA 5IMXA 1I44A 3R7EA 4QMXA 4PRJA 3MA6A 1F3MC 2X6DA 3NCGA 2Z2WA 3C1XA 2V62A 5ANEA 3HV4A 4PUZA 4Q5EA 4BGQA 1Z57A 3O50A 2VTSA 3GT8A 2ACXA 2UZTA 3Q9ZA 5FDXA 3NUUA 4L01A 4MF0A 4MXCA 3BWFA 5E8XA 3VW6A 2R3QA 3F2AA 1XKKA 4NK9A 3R21A 5AR8A 4A9UA 1OPLA 4G17A 4Y8DA 2UVZA 2B1PA 4BKJA 3LFQA 5IH4A 4AFJA 2VRXA 3NZ0A 3QAME 3AGLA 4WA9A 2B55A 4GYIA 3OMVA 2W96B 4CKJA 4AW0A 5CT7A 3QWJA 4G2FA 3JVRA 4DHFA 3KRLA 3CGFA 3RAIA 4QTEA 4LUDA 5TR6A 3ZEPA 3DXPA 5CU0A 5FG8A 3NSZA 4EOIA 2ZJWA 4HGSA 5F20A 4RFMA 2RKUA 4G31A 2HXLA 2XKDA 2XM8A 4QYYA 2VNWA 4CLIA 4F64A 3S0OA 3W2OA 4H3PA 1HCKA 2OJGA 4G5JA 3QGYA 1PJKA 3QCQA 4KABA 3H9OA 4II5A 4QMUA 5D7AA 3VIDA 1B6CB 4C2VA 3DDQA 3MI9A 2IVSA 2XYNA 3AC2A 4L45A 4LRJA 4DLIA 4WIHA 5GJDA 2PWLA 1Y8YA 3DBCA 4FT7A 1OMWA 1UWJA 3V3VA 1Q41A 3W2CA 2HELA 1OBDA 1A48A 1EH4A 2GTNA 4K1BA 4RLLA 3WF5A 3V6SA 4FV8A 3S3IA 5JFSA 2C5OA 5AP5A 5HVYA 2GU8A 5AAGA 4DBNA 1L8TA 3NVKI 3EQBA 3H10A 2R3GA 1XBCA 3NUPA 4I3ZA 4ITHA 1Q61A 3T3UA 4QMTA 1H4LA 4ZLOA 3MV5A 2PY3A 4L3JA 1YWNA 5F95A 1Q4LA 4RWKA 3E5AA 3HA8A 5LVLA 4EZ5A 4TKSA 1PXOA 2YERA 2WFYA 4R8QA 3FL5A 5LMAA 3U6JA 3LFFA 4GK3A 4CT1A 4J8MA 2XKFA 2C6OA 3NYXA 1W0XC 3TIZA 5B7VA 3CKXA 4RVKA 4U0IA 4UZHA 4HNFA 3UNKA 2GHGA 1YKRA 2JGZA 2RF9A 2OF2A 4FOCA 4FGRA 3KL8A 2UZLA 4ASDA 2XH5A 5LVMA 3UQFA 2XMYA 5AUTA 3CQUA 4YHJA 2Y7JA 2VU3A 2VUWA 2FH9A 3PXFA 5KMIA 2YIYA 5DHJA 3OEZA 5CSPA 1OL7A 3P1AA 4QP3A 5CVHA 4YPDA 4JJRA 4XG6A 3RAKA 4XMOA 5J9LA 2CPKE 3DBDA 5KMOA 4NTTA 4CTCA 3U4WA 4D2TA 5HORA 3PJ1A 2GHLA 3FMJA 4GIHA 4KS7A 2V55A 3G9LX 3PYYA 2O5KA 4CSVA 2BVAA 2UW5A 2BALA 4QO9A 3DK7A 3A7JA 3W32A 1CKIA 3QQJA 4MNFA 3GVUA 4RQVA 4TYGA 4LI5A 4ZSEA 4Z9LA 4BIBA 5EOLA 4IAKA 5BUEA 2J50A 1YHSA 3DA6A 4DFLA 4LRMA 3KCKA 2JFMA 2PK9A 3NS9A 4YLLA 2X9FA 4FF8A 4F1OA 4MKCA 3POZA 5FGKA 5M4CA 3L1SA 2XIKA 4BC6A 4CYJA 4XJ0A 2WIPA 4IVCA 5H9BA 3V01A 4EH7A 4O7LA 3ANRA 3L8PA 4FIEA 4XBUA 4GJ2A 5M51A 5D1JA 5GHVA 2XIXA 2BILB 3OHTA 3KRXA 4FIFA 3VQHA 3TKHA 2HW6A 2AUHA 2J9MA 3NYOA 3RKBA 1UKHA 4IADA 4E6DA 2YDIA 3FEGA 1IR3A 3QX2A 4I0SA 5EDQA 4BDHA 4JX3A 4H39A 4CYIA 4L42A 2HWPA 3DKCA 1XO2B 3MJ2A 3NVMB 3UIMA 3NIEA 2C0IA 2C30A 2VN9A 3FI3A 4FKQA 5CF8A 3OCGA 4AT5A 4EQUA 4ORKA 3SHEA 4XG8A 4X2GA 4JQEA 4UWBA 5JSMA 2Y6OA 4NFMA 4O0YA 5EM7A 2ITNA 2JEDA 2R7IA 2G01A 4JQ7A 2HXQA 2HY0A 3ZLXA 4DFYA 4O2ZA 1GNGA 4UWYA 3D4QA 4A06A 5IDPA 2OIQA 1GJOA 4PP9A 5EM5A 2CKPA 2XK8A 4OT5A 4OTPA 4DEEA 4DCEA 3F3ZA 4NWMA 4FKVA 4EK6A 3JYAA 4LV8A 4G6NA 4JDJA 4BI2A 3GQIA 4GJ3A 3UIUA 5JH6A 4FICA 5JN2A 3EFWA 4F1TA 4E5BA 1H07A 2WQOA 3QTZA 3IOKA 1YRPA 5ITAA 2PVRA 3PPZA 4DAWA 4FTMA 4GK2A 4GT4A 4HYSA 3FPMA 1DI8A 4EKKA 4FTNA 4RIXA 3QUEA 4FZ6A 4E6QA 5DVRA 2OU7A 4FKUA 3PVGA 5HI2A 4HJOA 3SQQA 4EH4A 3AC3A 3SV0A 5IQBA 4D2RA 4TWNA 3Q53A 5ACKA 3PSBA 4EEVA 4YTCA 4BKZA 3FC1X 3H9FA 4RIWB 1KE5A 4QP4A 3R7IA 2WMXA 3AT2A 4O81A 3TACA 2PYWA 3TG1A 5AP4A 4Z7HA 4QYHA 3DS6A 4RWIA 2RL5A 4MH7A 1R0EA 3UVPA 4OW8A 4N6YA 3BKBA 1VYWA 4GG5A 5E8YA 3VUIA 5IG1A 4FIIA 4JVGA 4ZTMA 3COHA 4FIJA 1ND4A 5IQHA 3KU2A 3RCDA 3S4QA 2ITVA 2JAMA 4DH7A 4DH5A 3OG7A 3E3PA 1NT2A 2FSLX 3VW8A 4YZMA 3LXPA 4GRBA 2GQRA 3F6XA 5DA3A 3E7OA 4FTLA 4U97A 4ZZOA 1E9HA 5T68A 3RGFA 3ZC6A 5AFVA 2E2BA 3MTLA 5DGZA 2CKEA 1PW2A 4LGHA 2QOFA 3DKGA 1FVTA 4QMMA 2O3PA 3QLGA 3FPQA 2VX3A 2VTQA 1PXMA 3U4UA 4A07A 4RLKA 2VTTA 1O6KA 3CPBA 4MAOA 4FSUA 1J1CA 5J9YA 1WBWA 4BB4A 2BDWA 2UZVA 2AYPA 3HEGA 3NAYA 4QRCA 1ZYLA 3F7ZA 3W8LA 4EOLA 3IGGA 4R77A 3TT0A 2Y9QA 5E4HA 4YC6A 3UZPA 3WF6A 3R1SA 2XUUA 2OO8X 3OUNB 4GEOA 5AR2A 4RA4A 4L7FA 3C0IA 3NDMA 4ZLYA 4AX8A 1Q97A 3QTRA 4J97A 2FA2A 1KOBA 3NX8A 5A54A 2UW8A 1ZWSA 2QVSE 4M8TA 4AOJA 4CRLA 4ANMA 2BRBA 4IVDA 5D7VA 3UO6A 3MTFA 4IDVA 4KB8A 4U8ZA 4YNOA 3GQLA 3TDWA 4TL0A 4NW5A 3UDBA 3ZLWA 4RZVA 3EHAA 3DXQA 4BWXA 4FV4A 3C4CA 4DEHA 2Y4PA 1CM8A 5H8GA 4RIYA 5HCXA 3T8OA 2ETRA 3CQEA 3VF9A 5L8KA 4RWLA 3U8WA 3KQ7A 5CWZA 2JAVA 4W8DA 2OF4A 5E8VA 4FTCA 4ONAA 5HG8A 2ITQA 3OBGA 1JSVA 4LFIA 2BZJA 3MIYA 4X7QA 5FTOA 4JRNA 4RX9A 4B4LA 5HG9A 2QO9A 2ZMCA 4CCUA 3BHTA 3DOGA 4O7WA 1WAKA 3VBQA 1J1BA 3VRZA 2OJJA 2ITZA 4IMYA 1O6YA 3IW8A 4XCUA 3SKCA 4DEAA 2R3PA 4JOAA 4TWCA 3QTQA 2C6LA 3E3BX 4J71A 2QOIA 4I20A 3VAPA 3ZCLA 3CY3A 2VO6A 5L2WA 4O86A 1MQBA 4RJ3A 1XR1A 3RALA 4ERKA 4F63A 4ASXA 3E62A 4UMPA 2VWIA 3ODYX 2CJMA 4MXZA 2DQ7X 5BMSA 1CTPE 4PL4A 3P4KA 5CF4A 2QG7A 3EQHA 4I22A 5I9VA 3EQDA 2Z7LA 4XOZA 1MRYA 4I6HA 3OS3A 1OL5A 4J1RA 5CQUA 4H1JA 1YI6A 3D83A 3MH3A 4E8AA 2YAAA 4IDTA 1T45A 2ITOA 4QMSA 3U6IA 3E8EA 3FAAA 3G2FA 5M55A 4FEXA 3CC6A 4D2SA 4E26A 2GS2A 3G0FA 3GP0A 5KX8A 4GK4A 1M7NA 1YW2A 4DCAA 3TM0A 5HESA 4X3FC 2GHMA 4B7TA 1Q8ZA 3QALE 4NCTC 5DR2A 5L4QA 3UQGA 3EQCA 2X4FA 4QP8A 5CYIA 5GZAA 5KHXA 4U3YA 3C7QA 3Q60A 4AAAA 2B7AA 2XYUA 4OUCA 5A4EA 3AMBA 1OKVA 3FMEA 1TVOA 2XJ0A 3CS9A 4FTOA 3C4WA 2HCKA 4S33A 4C57A 2NP8A 3L8SA 4E6AA 4C61A 5C8MA 2VWVA 4FT9A 3KGAA 4M97A 1U4DA 3WBLA 4DC2A 2GPHA 3POOA 2G9XA 2X39A 5FTQA 1PXKA 3LIJA 4FT0A 3VRYA 4E20A 5G6VA 2YN8A 2YJRA 4ZTLA 5KUPA 3GFEA 2OGVA 4IX5A 4D4RA 4C2WA 3D94A 5EQYA 4L67A 3NYVA 4QPMA 2QOBA 4EHGA 1FQ1B 3UYSA 4C62A 4P5QA 4EC9A 2C0TA 2BRGA 3FY0A 4Q5HA 3QQUA 3H0ZA 4BTMA 2PE0A 1YXXA 4PTEA 2J90A 4QMLA 3PY0A 2VO0A 5AEPA 3ZMMA 4A9YA 5BYZA 2C3KA 4FVPA 3DK3A 1QPCA 3D7ZA 3DAJA 3R04A 4F4PA 4NYEA 4YZCA 3TNWA 3M1SA 5EW9A 4FL3A 2ZV9A 3KY2A 5J8IA 2O8YA 4ZSAA 2G2HA 1V0PA 3KRRA 4G6LA 5IUIA 1NVRA 5DMZA 1W98A 3FYKX 4R3RA 5DEWA 3LJ2A 4R3CA 3DZOA 3P7AA 4FR4A 4FTAA 4R5SA 4WUAA 1K3AA 4K2RA 4O0UA 4D2VA 4M13A 1KSWA 2BZIB 3PJ8A 1E1VA 4FTRA 1BL7A 2WB8A 3DBFA 4C4JA 4L3LA 3QRTA 5D9HA 5C27A 4IACA 4EWHA 5IF1A 2QU5A 2WMUA 2UUEA 3D14A 4FC0A 3EH9A 3QBNA 3E93A 4S30A 4EORA 4O82A 4QQCA 4CXAA 4KIPA 4CNHA 5DT0A 4C4HA 4DFNA 5IUHA 3TKUA 2C5YA 2YDKA 3R9OA 2VTIA 3FKLA 3RPVA 5I9YA 1Z5MA 5IA0A 3OWPA 4R6VA 5IQCA 3T9IA 5CEOA 4IAYA 3CSVA 1XBAA 2ZDUA 4FG7A 1I09A 2F4JA 2X7FA 2XRWA 4IFGA 5BVNA 2QKRA 5AP3A 4QMPA 5AP0A 4E6CA 5IA4A 4QMYA 3P79A 4CKIA 3FWQA 5E9EA 5LMKC 2IN6A 2WOUA 3HV3A 3GCQA 4AE9A 4FUXA 3F9NA 4D0WA 4TZRA 4MK0A 3G5DA 3IW6A 4BHNA 2WQEA 1BYGA 4DH3A 4XG3A 3PG1A 2XCHA 5M07A 4JQ8A 2QLQA 2WTWA 4K6ZA 2QONA 5EM6A 4ZMEA 4ZS4A 3RI1A 4CKRA 1ERKA 3BYMA 4I1ZA 4JIAA 2Z60A 3GOKA 4ZLZA 3WF8A 4XRLA 3EQRA 4FI1A 4IAIA 4OGRA 2O63A 3SAYA 2C3JA 2ZAZA 5CEKA 2X6EA 3CQWA 4OBOA 3EYGA 4DEBA 3F5XA 2YIRA 2B52A 3UNJA 5AUZA 4H05A 5FTGA 1M2PA 4O2PA 4ERWA 4FK3A 2PVHA 1ZYSA 3UPXA 5JZJA 3PA3A 3R8UA 5DNRA 2X2KA 3SGCA 2QURA 5E92A 2ETKA 2Q0NA 3A8WA 2X0GA 5AA9A 3RAHA 5DN3A 5KZ0A 5D11A 1Y6BA 3CD8A 2WXVA 3WF9A 3SOAA 3CPCA 3II5A 3L9MA 3KULA 3UOLA 3ZFYA 3DZQA 3BX5A 3QF9A 4E4NA 5ANGA 2FB8A 1ZARA 2W05A 3QCSA 2YIXA 4NIFA 4C4FA 2VTNA 3FBVA 5EQEA 4MCVA 3IW7A 4K33A 2W1CA 5ANJA 1BKXA 1QCFA 5HG5A 4AZVA 4BL1A 2XNEA 2PUIA 4NZWB 3OOGA 3EQFA 3QU0A 3GI3A 5A3XA 3LQ3A 4RFZA 2JDTA 1TQIA 4FT3A 4RX5A 5I0BA 4CTBA 4XYFA 5HICA 4ZK5A 4R7HA 2XKEA 4D4YA 4FOBA 5JZNA 4RZWA 3ZFXA 2PE2A 2W1FA 3PG3A 2HK5A 3S2PA 2B4SB 4FTUA 2IZUA 4ZSJA 4DTAA 4TYJA 4OTHA 5E90A 5EDRA 2BRHA 4S31A 2JIUA 3MJ1A 4YBKA 2WD1A 5I3RA 1GIHA 3R1YA 4TRLA 5GIPE 2EUFB 4EONA 3PRFA 1ZZLA 3AQVA 3KC3A 4KS8A 2WZJA 3G15A 4IWPA 1J7LA 4IM0A 4LQMA 3MN3A 3W33A 4FTIA 2WQMA 5IMEA 4E3CA 4X0MA 2YDJA 4CFFA 3HMOA 3EL8A 4YZDA 1BX6A 1YDSE 1IG1A 3D5VA 4YTHA 4GU9A 4ZTRA 3UVRA 3COKA 3BLRA 4FE2A 3EN4A 5CSXA 1MQ4A 2VTOA 1U46A 4JRVA 5DLSA 5FRIA 2CKOA 1QMZA 2OKRA 2WMVA 2XNMA 3FC2A 3IONA 3DTWA 5HCZA 1CKJA 4W8EA 4RC3A 3W2PA 5CSVA 2X4ZA 4M15A 4A9RA 3KCFA 3LHJA 4FV3A 4BDEA 3UMXA 3F7WA 4AA4A 3FQEA 3E8NA 4Z3VA 4U5JA 4PX6A 3PSCA 4RJ6A 4DGLC 4G16A 1T46A 4K18A 4EZ3A 2I0EA 3DT1A 3R7VA 1Y6AA 3QHWA 4XLIA 2A0CX 2QR7A 1BI8A 2G2FA 2R9SA 4I6FA 4Y83A 4YSMA 2WMAA 5EYMA 4MTAA 1WCCA 4ANSA 4EH6A 4GVJA 3M11A 4U80A 1F5QA 1VR2A 2JKOA 5B0XA 3GU6A 2YZLA 2REIA 5ETFA 3LOKA 4M0ZA 4ZZNA 3NNVA 3BHUA 1Y57A 4BDJA 1J3HA 5ANDA 5IEVA 1XH8A 2XIYA 5CEMA 4HZRA 2IO6A 2F57A 3QKLA 3UOKA 4V01A 1H08A 2EVAA 2FUMA 3RMFA 3QQKA 3COIA 5D12A 3D7TB 3SW4A 1P4OA 4F09A 4FKSA 3DPKA 3ZOSA 4I93A 3FLWA 5JQ8A 4X3FA 1SVHA 4NCTA 3QQLA 4RX8A 4D2PA 1H1PA 4USFA 4P5ZA 5IU2A 2A4LA 2ITTA 4DGOA 4O27B 4TYIA 4NKSA 2V7OA 2GTMA 3I6WA 4E93A 2QCSA 3W8QA 1G8SA 2O0UA 4OTGA 3VUTA 2YJSA 3OOMA 3ROYA 4HPTE 2BRNA 2X1NA 4H1MA 3E8CA 3RCJA 2IW8A 4DN5A 3DY7A 3EKKA 4BTFA 3RINA 4X6RA 5CNNA 5EFQA 3PLAE 2UW4A 3ANQA 4QP7A 4FVQA 4M69A 2J5FA 2OICA 2VTLA 3EQGA 3UG1A 4F7JA 4RVMA 1LR4A 3UO5A 3BCEA 4NKAA 2BROA 3VUGA 2BCJA 4C0TA 2BFXA 4P7EA 4EOJA 2XK9A 4QMVA 3TV7A 3MGYA 4K0YA 3MY5A 4O84A 2PMLX 2YWPA 4L9IA 2C4GA 1Q8WA 4HCUA 4QPAA 1OL1A 3E87A 4UXLA 4ZZMA 5HE3A 3DTCA 3HYHA 3R0TA 5BMMA 1YWVA 1RE8A 4EYJA 4BCOA 5EI6A 5IQAA 5IQDA 3DQWA 4LL5A 2CGWA 3VBVA 2XS0A 4IZ5A 3Q2JA 2HZNA 2R2PA 2OZAB 2YIQA 3NUNA 3ACJA 4G5PA 1V0BA 1YI3A 3QQHA 1XH7A 5CTPA 4RVTA 1P4FA 4AW5A 5DT4A 3BWJA 5FBOA 4IB5A 1BUHA 3ORKA 5A4LA 4ANLA 3TUCA 3SOCA 1PY5A 4F7LA 2BAKA 2BKZA 2F7XE 4G3FA 3VS2A 4FODA 4YJUA 3VS6A 3SRVA 3ZO3A 4QP2A 3Q6UA 3M2WA 4X2KA 1WBOA 5AV1A 1YWRA 4UMUA 2CN8A 2FGIA 2YCSA 3OWLA 3RJCA 3EFLA 4UYNA 3WF7A 3OP5A 2VD5A 4EK3A 4QMNA 3RK7A 1MUOA 3W55A 4MYGA 3RBWA 4OLIA 2QI8A 3QKMA 3R1NA 5C8KA 4DA5A 1UNGA 2F2UA 3HGKA 2ONLC 4PV0A 4V04A 2J0LA 3KXMA 4YJPA 4C35A 4PMTA 3DJ6A 3OF0A 4EUUA 2R3OA 5H8EA 1UU9A 4O96A 5DH3A 3DNEA 4BR3A 5GJGA 3CTHA 4USDA 4AACA 4CFMA 3TKIA 5A9UA 3JPVA 4MF1A 1H0WA 3D5UA 4JNWA 3MW1A 5AR5A 5AUXA 5HX6A 4GKIA 5DRDA 5IA2A 3A7FA 2C6KA 5ETAA 3W2QA 1KE8A 2PZ5A 3UMWA 2X81A 3N9XA 4GIIA 4I0TA 3GNIB 4AGWA 4AN2A 4F6WA 5K4JA 4F6SA 3DFCB 2PZPA 4RIXB 2WTVA 1YOJA 5AX3A 5HLNA 2C6EA 4JDIA 1WBSA 2X8EA 1OUKA 2VO3A 3KXNA 5E8WA 2V0DA 3RK9A 4LL0A 4R7BA 4NL0A 3VBYA 2W4KA 3LM5A 5BPYA 4IX4A 4RA5A 3G6GA 4JBPA 4J7BA 3BLHA 3NW7A 3R01A 3ZDUA 4ZS0A 4E73A 4DGMA 4EJ7A 4L3PA 3NWWA 4JAJA 3GGFA 3A99A 2GNLA 3PRIA 2CGVA 4DLJA 3EN6A 4FSMA 5AX9A 3UG2A 4BCPA 4G6OA 3WYXA 5CF6A 4BI1A 1MRUA 2CDZA 2WHBA 4HGTA 5FEQA 4WKQA 4MX9A 2OW3A 1XWSA 4MBJA 3QYZA 3QXOA 3HZTA 5HIEA 3KF7A 5JRQA 5HLPA 4ZTHA 3AGMA 2JKMA 4FSQA 4I6QA 5AR7A 2ERZE 3NIZA 3KMUA 4KBKA 3D5WA 5ANOA 3OFMA 3CE3A 1REKA 2QQ7A 1HCLA 5CALA 2WNTA 4AXAA 4JBVA 5CENA 4DH8A 4ARKA 5IQIA 3UYTA 1AQ1A 2XK3A 3BYVA 2Y8OA 2Y4IB 4OTWA 5FEDA 4EBWA 1QPEA 2R0IA 3I81A 5ETIA 5JKGA 5E8ZA 2JDVA 4NTSA 5HNGA 5J95A 4IEBA 2C3LA 4UYAA 1PYXA 4RX7A 4Q9SA 4RVLA 3IDCA 3REPA 5KMJA 3L8XA 2I0HA 4UV0A 4J98A 3FXZA 4BWKA 4EL9A 5JRSA 4ANBA 2DS1A 3OXIA 4DTKA 4ITIA 3F3WA 3IKAA 3PJ3A 4YC3A 2YABA 3BV2A 2WEVA 2BHEA 3PE2A 4GT5A 4O6LA 4E1ZA 5HTCA 5LJJA 5GINE 2ITYA 2IZTA 3FUPA 2ZB0A 4I94A 4FTJA 4I23A 3RPOA 3QRKA 5DEYA 1YXTA 2W06A 2RFNA 5DT3A 1L3RE 3ATTA 4O7TA 5HTBA 4ALUA 4BCQA 4I5PA 3A4OX 5CVGA 5KMMA 3MFRA 4B8LA 2JDSA 3FQHA 2B9HA 5CU3A 1JQHA 4I6BA 5I9UA 5LVOA 3KVWA 2CGXA 4EUTA 2HENA 4RIYB 5AM7A 5BVEA 4DH1A 4M3QA 1OUYA 3ORMA 3W1FA 2WU7A 3FMLA 3FQSA 3OT3A 4J95A 4UMRA 3AMYA 3QRJA 3OZ6A 5C26A 5HX8A 4U41A 1M7QA 3BQCA 4U3ZA 4UEUA 4ANQA 2OI4X 1YOLA 3FZSA 3IDPA 4M68A 2E9UA 4IW0A 5K5XA 2B0QA 2C68A 5DG5A 2XJ1A 3FYJX 3LXKA 1U59A 2V7AA 2A2AA 4PL5A 4WOVA 3UP2A 2ZMDA 3WE4A 1NW1A 3VNTA 2XEYA 2YCQA 3UP7A 4P4CA 5K3YA 2JBOA 3CGOA 4F9WA 4X3JA 5IA5A 4AOIA 1TQPA 3MIAA 3AXWA 2WO6A 3BE9A 3AC5A 2V22A 5CSHA 4O7RA 4Z55A 1PMNA 4JAIA 3Q5ZA 1IAJA 5IH6A 2Y6MA 3I5NA 3NYNA 3PZEA 2HOGA 3H4JA 2KULA 2PZYA 4YLKA 4NU1A 3P7BA 4GT3A 4DYMA 2ZOQA 5I3OA 5H3QA 1G5SA 1XHAA 4FSRA 3B8RA 3P9JA 4KNBA 4W4YA 4PDOA 3WZKA 2I40A 3RK5A 5E1SA 5C03A 4U40A 3MB6A 1W8CA 5HE2A 3LM0A 2H6DA 3R71A 4D9UA 3C4ZA 5HNIX 2X2MA 5G1XA 2JIVA 4DF3A 3VS4A 4FMQA 4NM0A 3Q4UA 1H01A 4Z16A 4AU8A 3RWPA 3JY0A 3JY9A 5TE0A 5HO7A 3D2IA 4IANA 5A6OA 3N4TA 3DGKA 1H1SA 3NW5A 4WT6A 5EOBA 2RGPA 3ULIA 3HV7A 5AUWA 4FSZA 4DT8A 1ZY4A 4W4WA 1ZYDA 4CFXA 5CEIA 3MH2A 3RHXA 5ANIA 4CMOA 1VZOA 5JGBA 3TJDA 2ZB1A 1U5QA 2Z7SA 4ZTQA 4F7NA 4BIDA 4G9RA 3V6RA 1ZOHA 1CDKA 2QNJA 4LGGA 4EHZA 4XS2A 2QODA 3UTOA 4IWOA 2ZDTA 3WZJA 3O23A 4DG0E 3AC4A 4DGGA 4EOQA 4FG8A 3HRBA 2CN5A 3GENA 4DGNA 2UV2A 3G6HA 4KKHA 3KK9A 2P3GX 5L8JA 4O7NA 3N4UA 2EXMA 4PMSA 4IB1A 3MFTA 2WKMA 4TYEA 4B99A 2R3MA 2XCKA 5HU3A 5CU2A 4ZEGA 2YEXA 2VGOA 4X6QC 4AE6A 4UZDA 1UKIA 3WOWA 3R2YA 3BBTB 3WZUA 4ITJA 4MD8E 2XP2A 4I4EA 4D4VA 2WTIA 5CVFA 5DYJA 3H30A 4WNMA 4BCHA 3ELJA 4W9WA 3N4VA 1Q8UA 4CLJA 1ZMUA 1ZYCA 2ERKA 4O21A 2PUPA 4BICA 4O91A 2GNFA 3EFKA 3R8LA 1Q62A 4JR7A 3GC9A 2HAKA 3FSKA 3UIBA 4BGGA 4AA5A 3FMMA 4ANNA 2BIKB 5I9ZA 4FKOA 2ITPA 3HMPA 3KA0A 4XG4A 2OJIA 3FMKA 3O7LD 4F08A 4UWCA 5BVFA 1O9UA 3Q9YA 4YU2A 1WBTA 2B53A 4EK8A 4FNWA 4QQJA 2YM7A 4LOPA 3R30A 4D9TA 2YIWA 2GS6A 3ACKA 4YMJA 4QMWA 4AUAA 2YITA 4KWPA 1KUTA 4J52A 5FXQA 4XG9A 2XK6A 3AD6A 4UX9A 5K5NA 5JFWA 4YURA 4O38A 4KSPA 4J96A 3Q04A 3SXRA 4AZSA 4FV0A 4KRDA 2W4JA 3EWHA 4WRGA 3B2WA 5HKMA 3OEFX 4BDCA 4KUJA 3R22A 5AUYA 5M4IA 4R5YA 1PRYA 3OT8A 3U6HA 1WBVA 2VNYA 1Z9XA 3QZGA 2VWBA 3AC1A 2QOHA 3O71A 4I5CA 2GMXA 5JGAA 2C47A 2CNUA 3MPAA 4IJ9A 3TTJA 3ZO1A 1UWHA 2H96A 1VYZA 1YXVA 2J51A 4Y95A 2VTRA 5LWMA 5AADA 3O17A 1GIIA 1H1QA 3VVHA 4F70A 4Y5QA 2CHLA 3PDTA 1SNXA 5D41A 2J4ZA 2VX1A 1YXUA 1PMUA 2PVJA 2WTCA 4EK4A 1OIYA 4MWIA 4YJSA 1OBGA 4DG3E 4IJPA 2GQGA 3GU7A 4Y46A 3WARA 3OWJA 4EHEA 3KXHA 3OY3A 4K77A 2WELA 5AIRA 4N6ZA 3NUXA 4U81A 3RNYA 3CEKA 4ZP5A 3OROA 2PVLA 4XV3A 3GC0A 4FZDB 4I21A 4HOKA 5C01A 3WYYA 3K3IA 5CANA 2IWIA 3KULB 3GCUA 1APME 2YM8A 3LZBA 4C59A 4F9BA 2IW9A 4M12A 5HG7A 2W1ZA 5J7BA 2Q83A 1OIUA 1Y8GA 2ZM1A 4CT2A 4NIFB 3ZRLA 3O2MA 2RFEA 3KRWA 1YQJA 4FVRA 3BIZA 4BDIA 4EKLA 3PXZA 4CZTA 4FNZA 4Q9ZA 5I9WA 3ZLSA 5L2SA 3QYWA 2QLUA 4D5HA 4EQMA 2I0VA 4K8AA 4LUEA 1PMEA 3MYGA 4D5KA 3UZTA 3MVMA 4U7ZA 2WMWA 4C37A 1BL6A 3HA6A 1R0PA 2FO0A 3KFAA 5I9XA 2R3FA 1IA9A 3PSDA 4XX9A 3ZXTA 4RWJA 4S2ZA 5FM2A 4APPA 3ERKA 2GS7A 2B9JA 3OXZA 1M14A 2QOLA 3VS3A 4C3PA 4YUQA 1KV2A 5M08A 1OL6A 2YM5A 2HW7A 4JL9A 1A9UA 3NNUA 3TJCA 3VS0A 4L52A 5AP6A 3E92A 4BTKA 2WPAA 3UQCA 1M2RA 1LPUA 1XJDA 3FXXA 3R9NA 3P7CA 5C4KA 4QTAA 1BI7A 4LM5A 3I4BA 4FEUA 4RBLA 4D1SA 4RT7A 4YJOA 4DFBA 3I7CA 4BYJA 3QUDA 3RM7A 3ZSHA 2YLEA 4PNKA 3OCSA 4A7CA 3LFCA 5AM6A 3VS7A 3O7LB 3OXTA 4NH1A 5FM3A 1W7HA 2UZDA 3QTWA 3QUPA 4LYNA 4GSBA 3PPKA 4KSQA 2UW9A 4YJQA 4WO5A 3P23A 5BQ0A 3H0YA 3FHIA 5TF9A 4OTDA 2LGCA 4I5MA 2JD5A 2UZNA 5FP5A 4QTDA 3TWJA 5KMLA 3KN5A 3PJ2A 4WRSA 5EG3A 3ZBXA 3RTPA 4EOSA 3ZRKA 1B39A 5IZFA 2YZAA 4OTIA 2QG5A 3G0EA 5AV3A 4QT1A 3CXWA 3MSSA 4OTFA 2PUUA 5DIAA 3W10A 4MXAA 3IDBA 5HU9A 2YA9A 3V04A 3FXWA 4GV1A 3UODA 3AMAA 4AW1A 1NVSA 3O51A 2IVTA 4GCJA 3LFBA 3Q52A 4L43A 3PIYA 2XJ2A 4QP9A 4BKYA 2R3LA 3HMIA 2C0OA 3MVLA 4GFGA 3PA5A 2Z7QA 4IZYA 4K9YA 4FKPA 1WMKA 4NUSA 5HO6A 1LUFA 3K5VA 4E4LA 3QA8A 3EKNA 3MB7A 5JFVA 2VWUA 3AC8A 5HCYA 2RFDA 3EJ1A 4LMNA 3WILA 4UBAA 4C58A 5HOAA 2WTKC 1CKPA 5BVWA 3TEIA 2CNVA 3FY2A 3O96A 4FV1A 4WG3A 2W5HA 4FIHA 3DXNA 3QGWA 4ZTSA 3Q4ZA 4QYFA 2W99B 4XRJA 2C3IB 1IASA 4IM2A 3QXPA 1K2PA 3KMWA 4Y85A 2YWVA 1Q3WA 4USEA 3HAMA 2ZVAA 3IPHA 3ZSGA 2R3RA 4BDFA 4LOOA 4OBPA 5HE0A 5HE1A 3B2TA 4ZJVA 5DR6A 3R83A 4YTIA 5E91A 5IPJA 1ZRZA 5ETCA 3ZUUA 3ETAA 2Q0BA 3OBJA 5CS6A 4HYIA 4XV9A 3ZO2A 4RQKA 5CZHA 3PXQA 5KE0A 3V51A 2B9IA 2XK7A 4L8MA 2VWYA 2GSFA 4IVAA 5TT7A 1R1WA 3R6XA 3MPMA 4IC8A 4JBQA 4M69B 4HNIA 3VN9A 3K54A 4I24A 5IA3A 3BGQA 2RIOA 3KXZA 4JR3A 4R1VA 3VHEA 3PY3A 3C13A 3P86A 5K0XA 2JITA 3QZHA 2QOOA 3HNGA 4HCVA 5GJFA 4CFUA 5M09A 4FEQA 2PVFA 4XV2A 1SZMA 4BN1A 3RPYA 3C4XA 2OH4A 3COMA 3D9VA 1QL6A 4GUBA 1LEZA 4KINA 4IB0A 4D4SA 2X7OA 3FLYA 5FLFA 1XH6A 4NM7A 4ZIMA 4C33A 3KRJA 4APCA 2WEIA 1SYKA 2X2LA 5EH0A 3QRIA 4TPTA 4ZY5A 3CKWA 1QPDA 2GFCA 2W4OA 4YLJA 4AW2A 4BDGA 1J7IA 3I0QA 3EL7A 2C6TA 3BQRA 4MWHA 3RPSA 3ZM4A 4AOTA 4F7SA 3BHHA 2J0MB 1E1XA 3ENMA 2XZSA 3CTJA 3ITZA 3PWDA 3FLNC 4FKRA 4WUNA 4F9YA 1G3NA 2PU8A 2FSTX 4KIKB 5T6KA 3GXLA 4ALVA 3PP1A 3GU4A 3UGCA 3SRVB 3LMIA 4JDKA 3FMNA 1UNLA 1NA7A 3R1QA 3BU5A 3MDYA 4IE9A 4I4FA 2PVKA 3LXNA 3VBXA 4C4EA 4CV9A 2WAJA 4W9XA 4D1ZA 3C0GA 3IK3A 2EXCX 2UZWE 1FVRA 2C1BA 4LGDA 3TV6A 1ATPE 4FX3A 3QA0A 4WG5A 3MWUA 2OG8A 2NNWB 2EXEA 2F7EE 3F82A 2ZM4A 3TNQB 3S00A 5T3QA 2SRCA 2G1TA 4C8BA 3TUBA 3ORPA 3C4FA 3ET7A 1HOWA 4FNXA 3SXFA 3ORZA 4EH2A 4RMZA 3I7BA 2I6LA 5CZIA 1V0OA 2GNGA 3OD6X 3JXWA 3MS9A 3NUSA 4X2FA 4D0XA 4BHZA 5AV2A 3R9DA 5EM8A 2RSVA 3BEAA 4JI9A 2OXYA 5HD7A 1WVYA 5FBNC 3ZEWA 5HEZA 4PDSA 4W4XA 2Z7RA 2QOKA 3MA3A 2Z02A 4OAVB 2VWZA 2WMBA 4CFWA 1NXKA 4CG8A 5EHOA 4DFUA 4HVGA 4R7IA 4FL2A 4MD7E 4PMMA 4RJ7A 1FMKA 4V0GA 4CZUA 4AFEA 4L46A 5HD4A 3NAXA 2BAQA 2OJ9A 4CCBA 2F49A 4CMTA 4QP1A 2P0CA 4O7SA 3IECA 4ID7A 4FSYA 3MVJA 4FTKA 1KE7A 4Y73A 3HDMA 2KTYA 5J1WA 4XG7A 2R3KA 3DBQA 3V5WA 3AT4A 5AA8A 3F61A 4JG7A 3EN9A 3SW7A 4GMYA 3GCPA 5ANKA 2AC3A 3EN5A 2CNQA 4HGEA 3I0OA 5EHLA 4ALWA 4IZ7A 2YCRA 1OKYA 1TKIA 2UW0A 4H3QA 1JKLA 4JBOA 4PPCA 2RG5A 3D15A 4O0SA 1H00A 3E63A 4BI0A 3A61A 5BYLA 2VTAA 4FTTA 1Q24A 4IAAA 4G3GA 4RSSA 5IQFA 4E4XA 2YAKA 1H1WA 2WQBA 4I41A 1JPAA 4L44A 5AAEA 4FUYA 5GNKA 4JLCA 2A19B 2BTSA 2R7BA 3PP0A 5HNBA 1Q8TA 3R73A 4EH5A 3SC1A 4O7ZA 5LCKA 1WVWA 2R0UA 4PF4A 2BMCA 2X8IA 1SM2A 3OTUA 3EIDA 3QZFA 3F66A 4OR5A 4FV2A 3SDJA 3SD0A 5HLWA 4AP7A 3KKVA 1RJBA 3FJQE 3MBLA 3PVUA 4ZTNA 4GL9A 4R3PA 5FXSA 3KXXA 1ZAOA 3ZZEA 4E4MA 5FP6A 3CBLA 4F0FA 3MH1A 3LE6A 4EYMA 4O1OA 3E8DA 3FZOA 2OBJA 4FV5A 3RPRA 3FZPA 4S32A 4IAFA 3H3CA 4AN9A 3ZO4A 3ORTA 4C4IA 2P2HA 2WMRA 4ENXA 3K3JA 5DWRA 4BCJA 4BWPA 2OIBA 4B8MA 3FSFA 3NUYA 4U45A 4BTJA 2XNOA 5CXZA 4BDBA 2WGJA 4XP0A 4DEGA 4HW7A 5BVOA 1FGKA 3ZONA 4S34A 3U51A 3I1AA 4FV6A 3HMMA 3LCSA 5JFXA 5FDPA 2OH0E 5HBHA 1ZMWA 1H24A 5JK3A 3DU8A 2W9ZB 4X2NA 2OWBA 3QTXA 3R7GA 2JKQA 4H3BA 3V8WA 4IC7A 4YZ9A 2PMNX 4NFNA 5HVJA 5AUVA 3F3UA 3LJ1A 1MRVA 3FLSA 5KKRB 3BYOA 2Y4IC 3LCDA 2W5AA 4RJ5A 3QC9A 2H9VA 3TL8A 3VS1A 4F1MA 3LFNA 1PKGA 4PTCA 4M84A 3THBA 2OFVA 3PWYA 3F5GA 4EC8A 2VZ6A 3GUBA 2WIHA 3NCZA 3C5IA 2I1MA 4JT3A 3V5TA 1GZKA 5M4UA 3UZRA 1OL2A 2IJMA 5CAOA 3PZHA 4QD6A 3ZTXA 5JEBA 2VWWA 1OIQA 4BYIA 4M67A 3FLQA 3NPCA 5HIBA 2E9NA 2QOCA 1PXPA 1KV1A 2UVYA 3FZTA 4U9AA 5FQDC 5L6OA 5IQEA 2F7ZE 3UJGA 4MQ1A 2C5XA 4H58A 4YZNA 5BNJA 2BDFA 2NPQA 2XM9A 2XEZA 5TKDA 5CX9A 3S95A 2JIIA 1RQQA 5H2UA 5J5TA 1FGIA 5LQFA 4MVFA 3GEQA 4RFYA 3MY0A 3PIZA 3PUPA 1ZY5A 3B8QA 4ZMFA 2JDOA 5LMKA 4DT9A 1BMKA 5LARA 4IM3A 4MXOA 1P2AA 2FSMX 4U43A 2XNNA 2YM6A 3DQXA 3W18A 5L2IA 3HV6A 2PHKA 5L2TA 3ZU7A 2E9VA 1UV5A 2VWXA 1OKWA 3A60A 4BIEA 3O8UA 4YJNA 5EYKA 5CAVA 3ULZA 4BDDA 2ZV7A 3QX4A 4I0RA 3R00A 4GS6A 1KE9A 3FI2A 5HHWA 3VQUA 2WU6A 4LV5A 4PL3A 3F88A 1B38A 1P14A 4Q2AA 3IQ7A 4MNEA 1JNKA 2W5BA 2PZRA 2WOTA 1STCE 3HKOA 1OPJA 1OVEA 1OITA 2XK4A 4YP8A 4YBJA 4F6UA 3DFAA 4ZJJA 4O0XA 3PXYA 4WSYA 4Y5HA 3LQ8A 3QD4A 2FVDA 5BVKA 3ZH8A 4AGCA 1U54A 4FSNA 4GUEA 4IZAA 4GW8A 3C9WA 3EN7A 3VC4A 1URWA 2XNPA 3FMDA 5C8NA 2XA4A 3SLSA 4EHVA 4F0IA 2WTJA 3BHYA 3EQIA 4IHPA 1JSUA 4NJ3A 4NM3A 4X2JA 1IAHA 3K2LA 5E8TA 1UU3A 3TNPC 2QO2A 3WZEA 4B0GA 4ZY4A 1LP4A 4TYHA 2DWBA 5ACBC 2XNBA 1PXLA 4C36A 4OAUC 5C4LA 4FKJA 2WMSA 2X9EA 3KMMA 4HYHA 4F99A 4NSTA 3SXSA 2A27A 4H36A 4UY9A 4XP3A 5GZ9A 4ZAUA 3Q5IA 4TNDA 1O6LA 3KB7A 3D7TA 2PZIA 3UO4A 3VULA 3VO3A 3QQFA 2O65A 4BCIA 1R3CA 2P33A
chains in the Genus database with same CATH superfamily
3GCSA 4MEDA 3BLQA 3WIGA 1YDTE 4OBQA 5BX0A 2HWOA 4OT6A 3R7YA 2JFLA 3P0MA 1OGUA 2RG6A 5CLPA 3WZDA 4CRSA 2GNIA 2JLDA 4TWOA 4GFOA 5C9CA 1OECA 3QTIA 3HUCA 1GZNA 5BYYA 2BTRA 4O7YA 1SNUA 2VAGA 4YR8A 3QQGA 3UBDA 5B2KA 4QTCA 2B54A 5E8UA 3BL7A 5K0KA 3U9NA 3IG7A 4OTRA 5A14A 4U42A 3WIKA 5AV0A 3MH0A 3VUHA 3D2KA 2P2IA 3AT3A 2GQSA 3OW4A 2VV9A 3O8PA 4XHKB 2WMTA 2LAVA 5FWKK 2IVUA 4YJTA 2C1AA 2OSCA 3LJ0A 3Q32A 4IQ6A 4HVSA 1DAWA 4TXCA 2X7GA 5KNJA 4MD9E 3EOCA 3ORLA 3V5PA 4KD1A 5DRBA 2XRUA 3C0HA 3QL8A 4KKGA 3RZBA 3DV3A 3G90X 4YO6A 4XEYA 4BY9E 4IX3A 4FNYA 4QPSA 3IW4A 3Q96A 1XH9A 3LVPA 4HPUE 2C6IA 2OZAA 5JMSA 1NY3A 5KMKA 4PDPA 3HP5A 3KVXA 4I5HA 3IGOA 4YC8A 4AN3A 2BIYA 5K9IA 5LCJA 3HX4A 2IG7A 4CGAA 4G34A 4IXPA 2PMOX 3R7UA 3QC4A 3V5JA 2AQXA 2PUNA 2VTHA 2QR8A 2XVDA 3CCNA 1YXSA 2CMWA 2G2IA 4X21A 3Q9WA 3U9CA 1YDRE 3OTVA 3U54A 4PY1A 4D58A 3NLBA 3HV5A 4WBOA 4PMPA 2YACA 3QLFA 4E5AX 1URCA 1R78A 3LXLA 4QNYA 4D55A 5KMNA 1YHVA 4BBFA 3FI8A 2DUVA 2R5TA 3BRBA 4BCNA 4O4FA 4U44A 3W0RA 1PHKA 3TNIA 5LMBA 1PXNA 3I5ZA 4G3EA 3HUBA 4FG9A 2GNHA 3VUDA 4XOYA 4C4GA 5KCVA 4QEBA 2CCHA 3OY1A 3U87A 4EOPA 4FZ7A 2J2IB 2OXDA 4FKGA 3JR1A 5CEPA 1CSNA 2HY81 4GVAA 2H34A 1PYEA 4EH8A 4JXFA 4CV8A 3MPTA 4ZOGA 4TNBA 5KBQA 1FVVA 1ZZ2A 1K9AA 4KRCA 3UC4A 4DG2E 2F2CB 4ACMA 4A4OA 2QU6A 1WBPA 1ZYJA 3G9NA 3M42A 3EZRA 3V8TA 3V8SA 4ZXTA 3R9RA 1ST4A 2I7QA 3A8XA 2ZYBA 3BYUA 4AT3A 5JT2A 4WBBB 4BBMA 2OK1A 4P90A 3ZSIA 3EYHA 3FE3A 3OWKA 3PPJA 4FZFB 4IX6A 3RP9A 1LEWA 4WD5A 5IKWA 3TI1A 3KEXA 2C6MA 2HIWA 2BHHA 2O64A 4NJDA 4CG9A 2R3JA 4D1XA 1CMKE 4FL1A 3SX9A 3R9HA 2OFUA 2QO7A 2XF0A 3WE8A 3K5UA 4A4XA 4E5WA 4CMUA 1ZOEA 4V05A 3U55A 4F78A 3QTUA 1REJA 4AA0A 4QMOA 5F1ZA 1JLUE 3DBEA 1FOTA 4TW9A 4EH3A 4EH9A 4ASEA 2O2UA 2JBPA 5EYDA 2C5NA 4QMQA 3BHVA 3VHKA 4FV9A 5EW8A 4CZYB 5CAPA 3EMGA 1UU7A 4FKIA 3OVVA 1G8JA 4BJJB 2NRUA 3BI6A 4IVBA 4HVIA 3Q4TA 2VTPA 2AC5A 3QKKA 5KZIA 5K4IA 3SG8A 2BZHB 5BUJA 4L6QA 4XBRA 4ENYA 2W1HA 5E7RA 5EDPA 2J5EA 4UXQA 3AG9A 4UALA 4QNAA 3ZS5A 4BZOA 3CJGA 4L7SA 1Y91A 1F0QA 3DJ7A 2NO3A 2ESMA 4FBXA 4FV7A 4IIRA 1KWPA 3KN6A 5DBXA 5AP2A 1GOLA 3R8ZA 2QD9A 2R64A 3ZBFA 3W0PA 3PE1A 4EI4A 4LG4A 3Q9XA 5EI8A 5HTIA 2G15A 4UMTA 5CI7A 5M57A 2UZEA 3DDPA 3TN8A 2C6DA 2PTKA 3UIXA 5TO8A 1W83A 2Z8CA 3BELA 2W1IA 3KK8A 3HP2A 2EU9A 4B9DA 3ORXA 3HMNA 3FMHA 5CU4A 4XLVA 2ONLA 3KXGA 3AD5A 3ZC5A 4CD0A 4C34A 4AQCA 4LDTA 4TT7A 4ACHA 4QYEA 3O8TA 4BZNA 3CJFA 5HBJA 5CQWA 3QFVA 1UU8A 1VJYA 3E7VA 3R8VA 5L3AA 4M0YA 5M44A 5GIOE 3PVBA 1FPUA 3C5UA 2YISA 3KREA 5L6WL 5CI6A 3TIYA 4BCGA 3LLTA 3FHRA 3GU5A 5I4NA 3TXOA 2J6MA 5AUUA 3GC8A 2W0JA 3PLSA 4G3CA 4P2KA 2ITXA 3FI4A 1YVJA 4YPSA 2R3HA 4N4SA 2XIRA 3Q3BA 3BYSA 4O0RA 2E9OA 5AV4A 4FIGA 4W4VA 5KBRA 4O4DA 2QHMA 2EB2A 3EFJA 3UC3A 1ZOGA 4M14A 4PTGA 1JKKA 3DB8A 3VJNA 4QQTA 4M66A 4O22A 4RIOA 3ML1A 4FKTA 4BRXA 3W0OA 3S1HA 2CGUA 5AR3A 1GY3A 2HZ4A 1UNHA 4JX7A 4CQEA 4XP2A 1XH4A 2P4IA 3HVCA 4CFNA 2ZM3A 3CD3A 5HVKA 2PSQA 1GZOA 3A7IA 3V5QA 5AIKA 2FYSA 3VUMA 3LKMA 4N0SA 2W9FB 4AZEA 4F0GA 4A9TA 3SG9A 1X8BA 3ORIA 2BAJA 2PVYA 2YFXA 3ZUVA 1FINA 4EBVA 5M06A 2HZ0A 3LPBA 3AD4A 3ORNA 4GH2A 5C1QB 4RJ4A 1S9JA 1XH5A 2X8DA 1QPJA 4FKLA 4ZSGA 3V5LA 3OCTA 4YNEA 3DKOA 1GIJA 3HRFA 3ZDIA 5J9ZA 3OW3A 3ZRMA 4DITA 4FEVA 2C5VA 2J0JA 4HYUA 2CCIA 4RPVA 3ZHPC 5J1VA 3O0GA 2W1EA 4EZ7A 1IEPA 2BR1A 5E8SA 1J7UA 4ANOA 1H0VA 2VO7A 3OUKA 4C7TA 5F9EA 4FZAB 1JOWB 3L9LA 5DE2A 3LFDA 4N70A 2UW6A 3F3TA 5DI1A 4ZY6A 4EQCA 2UW3A 2ZV8A 3BZ3A 3VBTA 5BVDA 4QMZA 4RIWA 2BKKA 1H25A 3CR0A 5LOHA 5H8BA 3SVVA 3NR9A 4WNOA 2PL0A 1KE6A 2BDJA 5CXHA 5GZ8A 5CU6A 1XBBA 3R02A 3OCBA 3W0NA 4DTBA 5DR9A 5E1EA 4BVUA 3HRCA 4QQ5A 4HVDA 2YM3A 4XNEA 2ITWA 3TZMA 2XB7A 1DM2A 4U79A 2ITUA 3MY1A 1RW8A 3UOHA 3F69A 1A06A 3TCPA 1DAYA 3TUDA 3LCTA 2CLXA 3DNDA 4FSTA 4TTHB 4AT4A 2BUJA 2NRYA 2J0KA 4UB7A 1PXJA 1W84A 1WZYA 2WMQA 3D0EA 3D5XA 3DLSA 3JUHA 4KA3A 2IW6A 4CVAA 2RFSA 4FYNA 4F65A 3TNHA 3VBWA 3H9RA 5IISA 5CASA 2C69A 4IWDA 3R8MA 1FMOE 3LMHA 3LW0A 2CSNA 3NNXA 4LMUA 4BBEA 2VTJA 4FK6A 2F9GA 4EOMA 2XIZA 3FLZA 3GBZA 4PQNA 4DEIA 5IDNA 3HDNA 5L6PA 5LVPA 3NMUF 1PKDA 5IA1A 4BZDA 4G3DA 1SMHA 2B9FA 3CY2A 3BBWA 1RDQE 3L8VA 5A46A 3NRMA 1W82A 3DCVA 4WSQA 3IO7A 4YGAA 2GDOA 3DKFA 1ZMVA 4FYOA 1DS5A 2OIDA 1V1KA 2ZV2A 2XNGA 3L9NA 3MFUA 2E9PA 3NW6A 4IAZA 4V0GB 3E64A 1OB3A 5HGIA 5M56A 4DBXA 4TY1A 3UOJA 3EZVA 3W2RA 4MXXA 4O83A 3GCVA 3OC1A 4NW6A 3CP9A 5EKNA 4TWPA 1YHWA 2BZKB 3P08A 3PJCA 5IUGA 5IEYA 3QHRA 3ZM9A 3BPRA 2R3NA 2JC6A 3IOPA 3LCOA 3TZ8A 4A4LA 3MVHA 4WHZA 4AGUA 4FA2A 4KIQA 3MESA 5HBEA 5A6NA 3T3VA 5A4TA 4PP7A 3R2BA 4KBAA 3PIXA 5CF5A 2PE1A 5CSWA 5HZNA 4NT4A 3UPZA 4EWQA 4J99A 4X3FB 4AGDA 4C02A 4NM5A 4RC2A 4QP6A 3BEGA 2BRMA 2ETMA 3UE4A 2QKWB 3DK6A 1TQMA 3TZ9A 3ZYAA 3FZ1A 5FXRA 2H8HA 4O4EA 3LFAA 1W2DA 4PPAA 4RJ8A 3TTIA 3I6UA 4XG2A 2XAOA 2YLFA 5BUIA 1JVPP 1R39A 1UA2A 1M52A 4PWNA 2GFSA 2WTDA 3FKOA 5AAFA 3ALOA 5HQ0A 5ICPA 1OI9A 3VUKA 2HYYA 2YHVA 2IVVA 2PULA 4J8NA 2BPMA 3R8PA 4FSWA 2OLCA 5CEQA 5M4FA 4E7WA 2UZOA 3EB0A 1GAGA 4MBLA 5FUTA 1JSTA 4AAYA 4NEUA 1PMVA 4D28A 4KIOA 1MP8A 3HECA 4RRVA 3GU8A 3LLAA 1ZLTA 4XUFA 1Q5KA 3I79A 4ACGA 4FGBA 4RC4A 4KKEA 4CQGA 3UNZA 4AZWA 4O0TA 4BDKA 2J0IA 2Y0AA 3JVSA 4BCMA 4WNKA 3PXKA 4U6RA 4WNPA 5D10A 3ROCA 3BGPA 3Q6WA 3F2RA 1IA8A 1AD5A 2W1DA 3A2CA 3RWQA 3QCYA 4GG7A 3BU6A 3VF8A 4JS8A 4XH6A 4JG8A 4ACCA 4F9CA 5I5ZA 3RAWA 4Z7GA 3G51A 3RM6A 3CTQA 2YM4A 3LQ5A 4AZTA 4BGHA 2V5QA 4QOXA 5AJQA 5J79A 4UMQA 4CEGA 4EOOA 2UVXA 2UZUE 3HL7A 1ZXEA 3LAUA 2WQNA 2XBAA 5EK7A 3BU3A 5A4CA 4PNIA 3W2SA 4BCFA 1OM1A 3PFQA 3W0QA 3ZFMA 4LRKA 5DOSA 4FEWA 3G33A 4G1WA 4IBMA 1Q8YA 5CAQA 2A1AB 4K11A 5FEEA 2IZSA 3PA4A 3CLYA 4IFCA 1PXIA 3QD2B 5DPVA 3DB6A 2JDRA 4RGJA 4AWIA 3A7GA 5J5SA 2W1GA 5EQPA 3PVWA 4RG0A 5L8LA 1UVRA 3GFWA 4Y72A 3HAVA 2BFYA 3N51A 5TOZA 4BFMA 4DFZE 5M53A 4R1YA 4GFMA 5AWMA 2XALA 4BF2A 3DJ5A 4BDAA 5CT0A 3NNWA 4O1PA 2IZRA 5EHYA 5EW3A 4PDYA 4O0WA 1NVQA 2QHNA 3R7OA 3T9TA 4GKHA 3A62A 3ZXZA 4EOKA 3UVQA 1S9IA 3VJOA 4N57A 4AG8A 1JAMA 1Q99A 2HZIA 4ZJIA 5IH5A 3ENHA 4J53A 3C51A 4A9SA 5KKRC 4R78A 3JS2A 2FSOX 2VTMA 3CIKA 1JBPE 3ZLYA 5F4NA 3TDVA 4YSJA 3TV4A 4HCTA 3QD0A 5L2QA 3A7HA 4YHFA 1BLXA 2WTKB 3QD3A 3BE2A 4F9AA 1OZ1A 3FV8A 3FL4A 3QTSA 3GC7A 3FKNA 5CAUA 1G8AA 3C4EA 3DAEA 3Q4CA 4MBIA 1H28A 5LVNA 4DHIB 3ZZWA 2R3IA 1H27A 4JIKA 4FTQA 1AGWA 4YO4A 4TN6A 4AF3A 4LOQA 4JDHA 5AP7A 1H8FA 4MNEB 3BV3A 4AS0A 5KHWA 2W7XA 4YJRA 3MFSA 1JKSA 1Q3DA 4DFXE 4L00A 4XV1A 2EB3A 4KBCA 5J7HA 2PPQA 1M2QA 5IQGA 1OIRA 5JGDA 1OGYA 2XBJA 3TZ7A 1H26A 3ODZX 3E88A 1U54B 2EWAA 5HO8A 1J91A 4IH8A 4O0VA 3PTGA 1YOMA 3FZRA 3L9PA 4UN0C 4GYGA 4JG6A 5LXMA 4FT5A 2GNJA 3QCXA 1KOAA 1M17A 4CFVA 1XQZA 4QTBA 4ZSLA 2VX0A 2UW7A 3HLLA 5CY3A 4TYHB 4D2WA 4C3FA 3DAKA 3RZFA 4ACDA 3A4PA 1VEBA 2OZOA 2A98A 2QC6A 5FD2A 4IB3A 4YJVA 5LWNA 3BGZA 4C3RA 3QRUA 3ZUTA 3EQPA 4GU6A 2VGPA 3ID6C 4AZFA 3F2NA 1OPKA 3PXRA 3DLZA 3QZIA 3WI6A 3IS5A 3SA0A 5HIDA 4B6LA 5B2LA 5J87A 3ATSA 1OKZA 3QWKA 4C38A 3W16A 3F5UA 1U5RA 3R28A 3RHKA 3KF4A 2PVMA 4FKWA 4FRFA 1PF8A 4I92A 2QOQA 2OJFE 4YTFA 5CNOA 3P5JC 1DI9A 2W17A 2XKCA 4IWQA 2OXXA 4DE4A 1H1RA 3F3VA 2JKKA 2DYLA 2UZBA 3ALNA 3I60A 3P78A 4M7IA 5AR4A 4EJNA 3NGAA 4MHAA 2YCFA 4MXYA 5EKOA 4HGLA 4KAOA 4OTQA 4YZBA 4QYGA 3IW5A 5DFPA 1GZ8A 4G9CA 4MQ2A 1YI4A 1WVXA 3C50A 4WG4A 4O7VA 3R63A 3GOPA 4DDIA 4JMQA 2P55A 2PVNA 3NEWA 1VLRA 2CLQA 3LMGA 3F5PA 5KO1A 2ZFYA 3PY1A 2I0YA 2IPXA 1IRKA 3FDNA 3VS5A 5B2MA 1SVEA 1WFCA 1FBNA 2CKQA 3P5KA 4L53A 4YHTA 5EYCA 3LCKA 4EK5A 2R4BA 5EI2A 5F94A 4BCKA 4HZSA 4DINA 3AOXA 3GB2A 5JQ5A 5A4QA 1SVGA 5AMNA 1WBNA 5IEXA 2GCDA 2J7TA 4PPBA 1JWHA 4O6EA 4HVHA 3RVGA 4DEDA 3LFSA 3LFEA 4L68A 4ASZA 4KIKA 3Q2MA 1P5EA 3NUAA 3VWAA 1JKTA 2PMIA 5AP1A 3RNIA 5IMXA 1I44A 3R7EA 4QMXA 4PRJA 3MA6A 1F3MC 2X6DA 3NCGA 2Z2WA 3C1XA 2V62A 5ANEA 3HV4A 4PUZA 4Q5EA 4BGQA 1Z57A 3O50A 2VTSA 3GT8A 2ACXA 2UZTA 3Q9ZA 5FDXA 3NUUA 4L01A 4MF0A 4MXCA 3BWFA 5E8XA 3VW6A 2R3QA 3F2AA 1XKKA 4NK9A 3R21A 5AR8A 4A9UA 4QDEA 1OPLA 4G17A 4Y8DA 2UVZA 2B1PA 4BKJA 3LFQA 5IH4A 4AFJA 3UDTA 2VRXA 3NZ0A 3QAME 3AGLA 4WA9A 2B55A 4GYIA 3OMVA 2W96B 4CKJA 4AW0A 5CT7A 3QWJA 4G2FA 3JVRA 4DHFA 3KRLA 3CGFA 3RAIA 4QTEA 4LUDA 5TR6A 3ZEPA 3DXPA 3UDSA 5CU0A 5FG8A 3NSZA 4EOIA 2ZJWA 4HGSA 5F20A 4RFMA 2RKUA 3AKJA 4G31A 2HXLA 2XKDA 2XM8A 4QYYA 2VNWA 4CLIA 4F64A 3S0OA 3W2OA 4H3PA 1HCKA 2OJGA 4G5JA 3QGYA 1PJKA 3QCQA 4KABA 3H9OA 4II5A 4QMUA 5D7AA 3VIDA 1B6CB 4C2VA 3DDQA 3MI9A 2IVSA 2XYNA 3AC2A 4L45A 4LRJA 4DLIA 4WIHA 5GJDA 2PWLA 1Y8YA 3DBCA 4FT7A 1OMWA 1UWJA 3V3VA 1Q41A 3W2CA 2HELA 1OBDA 1A48A 1EH4A 2GTNA 4K1BA 4RLLA 3WF5A 3V6SA 4FV8A 3S3IA 5JFSA 2C5OA 5AP5A 5HVYA 2GU8A 5AAGA 4DBNA 1L8TA 3NVKI 3EQBA 3H10A 2R3GA 1XBCA 3NUPA 4I3ZA 4ITHA 1Q61A 3T3UA 4QMTA 1H4LA 4ZLOA 3MV5A 2PY3A 4L3JA 1YWNA 5F95A 1Q4LA 4RWKA 3E5AA 3HA8A 5LVLA 4EZ5A 4TKSA 1PXOA 2YERA 2WFYA 4R8QA 3FL5A 5LMAA 3U6JA 3LFFA 4GK3A 4CT1A 4J8MA 2XKFA 2C6OA 3NYXA 1W0XC 3TIZA 5B7VA 3CKXA 4RVKA 4U0IA 4UZHA 4HNFA 3UNKA 2GHGA 1YKRA 2JGZA 2RF9A 2OF2A 4FOCA 4FGRA 3KL8A 2UZLA 4ASDA 2XH5A 5LVMA 3UQFA 2XMYA 5AUTA 4MUQA 3CQUA 4YHJA 2Y7JA 2VU3A 2VUWA 2FH9A 3PXFA 5KMIA 2YIYA 5DHJA 3OEZA 5CSPA 1OL7A 3P1AA 2X0QA 4QP3A 5CVHA 4YPDA 4JJRA 4XG6A 3RAKA 4XMOA 5J9LA 2CPKE 3DBDA 5KMOA 4NTTA 4CTCA 3U4WA 4D2TA 5HORA 3PJ1A 2GHLA 3FMJA 4GIHA 4KS7A 2V55A 3G9LX 3PYYA 2O5KA 4CSVA 2BVAA 2UW5A 2BALA 4QO9A 3DK7A 3A7JA 3W32A 1CKIA 3QQJA 4MNFA 3GVUA 4RQVA 4TYGA 4LI5A 4ZSEA 4Z9LA 4BIBA 5EOLA 4IAKA 5BUEA 2J50A 1YHSA 3DA6A 4DFLA 4LRMA 3KCKA 2JFMA 2PK9A 3NS9A 4YLLA 2X9FA 4FF8A 4F1OA 4MKCA 3POZA 5FGKA 5M4CA 3L1SA 2XIKA 4BC6A 4CYJA 4XJ0A 2WIPA 4IVCA 5H9BA 3V01A 4EH7A 4O7LA 3ANRA 3L8PA 4FIEA 4XBUA 4GJ2A 5M51A 5D1JA 5GHVA 2XIXA 2BILB 3OHTA 3KRXA 4FIFA 3VQHA 3TKHA 2HW6A 2AUHA 2J9MA 3NYOA 3RKBA 1UKHA 4IADA 4E6DA 2YDIA 3FEGA 1IR3A 3QX2A 4I0SA 5EDQA 4BDHA 4JX3A 4H39A 4CYIA 4L42A 2HWPA 3DKCA 1XO2B 3MJ2A 3NVMB 3UIMA 3NIEA 2C0IA 2C30A 2VN9A 3FI3A 4FKQA 5CF8A 3OCGA 4AT5A 4EQUA 4ORKA 3SHEA 4XG8A 4X2GA 4JQEA 4UWBA 5JSMA 2Y6OA 4NFMA 4O0YA 5EM7A 2ITNA 2JEDA 4AXDA 2R7IA 2G01A 4JQ7A 2HXQA 2HY0A 3ZLXA 4DFYA 4O2ZA 1GNGA 4UWYA 3D4QA 4A06A 5IDPA 2OIQA 1GJOA 4PP9A 5EM5A 2CKPA 2XK8A 4OT5A 4OTPA 4DEEA 4DCEA 3F3ZA 4NWMA 4FKVA 4EK6A 3JYAA 4LV8A 4G6NA 4AXEA 4JDJA 4BI2A 3GQIA 4GJ3A 3UIUA 5JH6A 4FICA 5JN2A 3EFWA 4F1TA 4E5BA 1H07A 2WQOA 3QTZA 3IOKA 1YRPA 5ITAA 2PVRA 3PPZA 3TMOA 4DAWA 4FTMA 4GK2A 4GT4A 4HYSA 3FPMA 1DI8A 4EKKA 4FTNA 4RIXA 3QUEA 4FZ6A 4E6QA 5DVRA 2OU7A 4FKUA 3PVGA 5HI2A 4HJOA 3SQQA 4EH4A 3AC3A 3SV0A 5IQBA 4D2RA 4TWNA 3Q53A 5ACKA 3PSBA 4EEVA 4YTCA 4BKZA 3FC1X 3H9FA 4RIWB 1KE5A 4QP4A 3R7IA 2WMXA 3AT2A 4O81A 3TACA 2PYWA 3TG1A 5AP4A 4Z7HA 4QYHA 3DS6A 4RWIA 2RL5A 4MH7A 1R0EA 3UVPA 4OW8A 4N6YA 3BKBA 1VYWA 4GG5A 5E8YA 3VUIA 5IG1A 4FIIA 4JVGA 4ZTMA 4FJVA 3COHA 4FIJA 1ND4A 5IQHA 3KU2A 3RCDA 3S4QA 2ITVA 2JAMA 4DH7A 4DH5A 3OG7A 3E3PA 1NT2A 2FSLX 3VW8A 4YZMA 3LXPA 4GRBA 2GQRA 3F6XA 5DA3A 3E7OA 4FTLA 4U97A 4ZZOA 1E9HA 5T68A 3RGFA 3ZC6A 5AFVA 2E2BA 3MTLA 5DGZA 2CKEA 1PW2A 4LGHA 2QOFA 3DKGA 1FVTA 4QMMA 3W0MA 2O3PA 3QLGA 3FPQA 2VX3A 2VTQA 1PXMA 3U4UA 4A07A 4RLKA 2VTTA 1O6KA 3CPBA 4MAOA 4FSUA 1J1CA 5J9YA 1WBWA 4BB4A 2BDWA 2UZVA 2AYPA 3HEGA 3NAYA 4QRCA 1ZYLA 3F7ZA 3W8LA 4EOLA 3IGGA 4R77A 3TT0A 2Y9QA 5E4HA 4YC6A 3UZPA 3WF6A 3R1SA 2XUUA 2OO8X 3OUNB 4GEOA 5AR2A 4RA4A 4L7FA 3C0IA 3NDMA 4ZLYA 4AX8A 3O5AA 1Q97A 3QTRA 4J97A 2FA2A 1KOBA 3NX8A 5A54A 2UW8A 1ZWSA 2QVSE 4M8TA 4AOJA 4CRLA 4ANMA 2BRBA 4IVDA 5D7VA 3UO6A 3MTFA 4IDVA 4KB8A 4U8ZA 4YNOA 3GQLA 3TDWA 4TL0A 4NW5A 3UDBA 3ZLWA 4RZVA 3EHAA 3DXQA 2AEGA 4BWXA 4FV4A 3C4CA 4DEHA 2Y4PA 1CM8A 5H8GA 4RIYA 5HCXA 4O4CA 2ETRA 3CQEA 3T8OA 3VF9A 5L8KA 4RWLA 3U8WA 3KQ7A 5CWZA 2JAVA 4W8DA 2OF4A 5E8VA 4FTCA 4ONAA 5HG8A 2ITQA 3OBGA 1JSVA 4LFIA 2BZJA 3MIYA 4X7QA 5FTOA 4JRNA 4RX9A 4B4LA 5HG9A 2QO9A 2ZMCA 4CCUA 3BHTA 3DOGA 4O7WA 1WAKA 3VBQA 1J1BA 3VRZA 2OJJA 2ITZA 4IMYA 1O6YA 3IW8A 4XCUA 3SKCA 4DEAA 2R3PA 4JOAA 4TWCA 3QTQA 2C6LA 3E3BX 4J71A 2QOIA 4I20A 3VAPA 3ZCLA 3CY3A 2VO6A 5L2WA 4O86A 1MQBA 4RJ3A 1XR1A 3RALA 4ERKA 4F63A 4ASXA 3E62A 4UMPA 2VWIA 3ODYX 2CJMA 4MXZA 2DQ7X 5BMSA 1CTPE 4PL4A 3P4KA 5CF4A 2QG7A 3EQHA 4I22A 5I9VA 3EQDA 2Z7LA 4XOZA 1MRYA 4I6HA 3OS3A 1OL5A 4J1RA 5CQUA 4H1JA 1YI6A 3D83A 3MH3A 4E8AA 2YAAA 4IDTA 1T45A 2ITOA 4QMSA 3U6IA 3E8EA 3FAAA 3G2FA 5M55A 4FEXA 3CC6A 4D2SA 4E26A 2GS2A 3G0FA 3GP0A 5KX8A 4GK4A 1M7NA 1YW2A 3BL9A 3TM0A 4DCAA 5HESA 4X3FC 2GHMA 4B7TA 1Q8ZA 3QALE 4NCTC 5DR2A 5L4QA 3UQGA 3EQCA 2X4FA 4QP8A 5CYIA 5GZAA 5KHXA 4U3YA 3C7QA 3Q60A 4AAAA 2B7AA 2XYUA 4OUCA 5A4EA 3AMBA 1OKVA 3FMEA 1TVOA 2XJ0A 3CS9A 4FTOA 1XMLA 3C4WA 2HCKA 4S33A 4C57A 2NP8A 3L8SA 4E6AA 3BLAA 4C61A 5C8MA 2VWVA 4FT9A 3KGAA 4M97A 1U4DA 3WBLA 4DC2A 2GPHA 3POOA 2G9XA 2X39A 5FTQA 1PXKA 3LIJA 4FT0A 3VRYA 4E20A 5G6VA 2YN8A 2YJRA 4ZTLA 5KUPA 3GFEA 2OGVA 4IX5A 4D4RA 4C2WA 3D94A 5EQYA 4L67A 3NYVA 4QPMA 2QOBA 4EHGA 1FQ1B 3UYSA 4C62A 4P5QA 4EC9A 2C0TA 2BRGA 3FY0A 4Q5HA 3QQUA 3H0ZA 4BTMA 2PE0A 1YXXA 4PTEA 2J90A 4QMLA 3PY0A 2VO0A 5AEPA 3ZMMA 4A9YA 5BYZA 2C3KA 4FVPA 3DK3A 1QPCA 3D7ZA 3DAJA 3R04A 4F4PA 4NYEA 4YZCA 3TNWA 3M1SA 5EW9A 4FL3A 2ZV9A 3KY2A 5J8IA 2O8YA 4ZSAA 2G2HA 1V0PA 1ST0A 3KRRA 4G6LA 5IUIA 1NVRA 5DMZA 1W98A 3FYKX 4R3RA 5DEWA 3LJ2A 4R3CA 3DZOA 3P7AA 4FR4A 4FTAA 4R5SA 4WUAA 1K3AA 4K2RA 4O0UA 4D2VA 4M13A 1KSWA 2BZIB 3PJ8A 1E1VA 4FTRA 1BL7A 2WB8A 3DBFA 4C4JA 4L3LA 3QRTA 5D9HA 5C27A 4IACA 4EWHA 5IF1A 2QU5A 2WMUA 2UUEA 3D14A 4FC0A 3EH9A 3QBNA 3E93A 4S30A 4EORA 4O82A 4QQCA 4CXAA 4KIPA 4CNHA 5DT0A 4C4HA 4DFNA 5IUHA 3TKUA 2C5YA 2YDKA 3R9OA 2VTIA 3FKLA 3RPVA 5I9YA 1Z5MA 5IA0A 3OWPA 4R6VA 5IQCA 3T9IA 5CEOA 4IAYA 3CSVA 1XBAA 2ZDUA 4FG7A 1I09A 2F4JA 2X7FA 2XRWA 4IFGA 5BVNA 2QKRA 5AP3A 4QMPA 5AP0A 4E6CA 5IA4A 4QMYA 3P79A 4CKIA 3FWQA 5E9EA 5LMKC 2IN6A 2WOUA 3HV3A 3GCQA 4AE9A