5AX9A

Crystal structure of the kinase domain of human traf2 and nck-interacting protein kinase in complex with compund 9
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
282
Chain Sequence
EIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAF2 and NCK-interacting protein kinase
publication title TNIK inhibition abrogates colorectal cancer stemness
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 282
sequence length 296
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ax9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ax9A01
3U9CA 4B6LA 4FKLA 3WE4A 4FVPA 3MVHA 5FP5A 3EHAA 3HA6A 4CTCA 4UB7A 2XKFA 1RDQE 3LPBA 4NFNA 2C5YA 5FBOA 2ZM4A 4RX9A 1GJOA 1H25A 1AD5A 3R1NA 4HPUE 4RC3A 4DTBA 5I3RA 3GGFA 3AGMA 3QD4A 4GU9A 4YHJA 5FLFA 4QYGA 3CGOA 5AWMA 4H3PA 2C6EA 4GVAA 4NT4A 4F6SA 4S32A 1WZYA 2HW6A 3KU2A 3Q9XA 4TNBA 4FT9A 5HE0A 3BHTA 2IW8A 1PXOA 1Q62A 4X2KA 4UMUA 5CSPA 3FYJX 1SNXA 3RAIA 4G6OA 1OKZA 4YSJA 5A3XA 2AUHA 5TR6A 1K2PA 3AOXA 3F2NA 3VRZA 2H34A 5KUPA 5I4NA 4C8BA 2CKOA 5IA4A 3UJGA 1IR3A 5DBXA 3MWUA 2Z60A 3IG7A 3QQKA 2X81A 3MH0A 3ORKA 3BKBA 3ZFYA 2PPQA 2VO6A 3DKFA 3O8TA 4PMMA 3FL4A 3OCGA 3GU5A 2GQRA 3NUSA 2WQBA 3KF7A 4FEWA 1H07A 3ALNA 4E7WA 4H05A 5C03A 2J90A 3KXZA 3T9IA 5CNNA 3UC4A 4D9UA 4HOKA 3JS2A 2WEIA 3C7QA 4QMVA 3I7CA 3NAYA 3OCBA 2NNWB 3S1HA 4I5HA 4L7FA 2F7ZE 4PDYA 2ZYBA 2BILB 3PIZA 2WAJA 3PZHA 1OL7A 4YZDA 4MXXA 2FSLX 5JH6A 5C8MA 3R2YA 2OWBA 2PMLX 3GU7A 4Z9LA 3BHYA 1DAWA 4Y46A 3ZFMA 4EH3A 4I0RA 2CSNA 4QYYA 3EN6A 5E8WA 4XG8A 4DEAA 4AA0A 3R04A 3FMMA 3ZBFA 3KXMA 5JQ5A 1WBOA 3RAWA 5IG1A 4I5MA 1FBNA 4GKHA 2GHGA 2CMWA 4RIOA 5GJFA 3WILA 5TOZA 2Q0NA 3W2QA 5CASA 5HLNA 5GJDA 5I9VA 1Q3DA 4HYUA 4O0WA 4KKEA 3RP9A 2F7EE 3SG9A 1IASA 4PP9A 4FZ6A 3QKMA 2W4KA 3DOGA 4JXFA 2OGVA 4FUYA 3LKMA 3F7ZA 4EK4A 4G5PA 5CENA 3EQCA 4L44A 5E1EA 1WAKA 5CY3A 3A4OX 4WT6A 4KIOA 3W2RA 4HPTE 1M2RA 4HYSA 4IAYA 5EM7A 5HO7A 4ZSLA 4PNKA 2Y8OA 3QTZA 3ZUTA 3CD8A 3QALE 4E5BA 1IAJA 4S34A 4K33A 2OF2A 3FXWA 5E90A 2XK7A 3Q04A 4I21A 3MPTA 3D5VA 4NM3A 1XBCA 1ZLTA 3QBNA 5G1XA 4JR7A 2W9FB 3WF6A 2GMXA 2JKOA 3V8TA 4C02A 3RJCA 1YXTA 4RVMA 5K5XA 4TYHB 4LM5A 3CIKA 4DF3A 4C59A 4C62A 4G6LA 3I7BA 4ZMEA 1GZ8A 2J6MA 4ZTNA 5ETFA 2WMRA 1SMHA 4BBMA 4XX9A 5K0XA 3NWWA 5BUIA 1W83A 5M06A 2BPMA 3NNVA 2ZMCA 5EM6A 1ZRZA 3EFKA 3AQVA 2ITYA 5H8EA 4BCQA 4U97A 1P14A 1XO2B 1JKKA 3PPJA 5EM8A 4BDCA 4F9AA 4UYAA 2XEZA 4FV6A 2W4OA 4N6ZA 3RPSA 3WZUA 3NVKI 2BROA 3FMDA 1H0VA 1CDKA 1PKDA 2F57A 2XVDA 2B4SB 3SAYA 2F7XE 5FXSA 1PJKA 1PXMA 4RA5A 4FOBA 3HZTA 3CCNA 2EU9A 4BI2A 1GY3A 1BMKA 2F4JA 2BRMA 3C4FA 2PZYA 4EOMA 3NX8A 2Y4IC 2ITQA 4E5WA 1Y57A 3BLRA 4M8TA 2QLQA 3UZPA 4K0YA 1WVWA 2GTNA 2OFUA 5IMXA 3EMGA 4MXCA 3GCVA 4D2WA 4O7RA 3AG9A 3AT3A 4KRDA 5DIAA 2OJIA 1XH6A 2PZ5A 3R9NA 3QKLA 3C4CA 4C4EA 2BVAA 2O0UA 3T9TA 4DEIA 4QRCA 2XBJA 3GEQA 3RHKA 4QQJA 4FKPA 4BN1A 3OY1A 4PTGA 5C4KA 1YDSE 4IX6A 1DI9A 4FKUA 4TY1A 5ANGA 1YHSA 2X0GA 2JKQA 2WQMA 3RALA 2VTPA 4RWKA 5JSMA 4YTFA 2F2CB 5AFVA 4MWIA 1PYEA 1RE8A 4MF0A 1H1WA 4DEGA 4RLLA 2BDFA 1KV1A 2W1EA 4GKIA 4BWPA 4KNBA 4QP7A 4FEQA 2F49A 4HVSA 3A99A 2H96A 2ACXA 2G2HA 3R9HA 4G3DA 4F1MA 5BUJA 3EQHA 4YBJA 5ACKA 1BKXA 4JDIA 5M55A 3II5A 4FKTA 1FOTA 3MH1A 4APCA 3BYUA 5F20A 5AUYA 2W1ZA 1OI9A 3HEGA 3P7CA 4FIJA 4R5YA 4PDSA 4NCTC 1O6KA 3VNTA 3CSVA 4A9UA 5DYJA 3HECA 1UV5A 5EKNA 4RBLA 3VUKA 4RQVA 1PKGA 5K4IA 2HZ4A 3KGAA 4YJOA 4U9AA 3PSCA 4QP8A 3F3WA 3DBEA 3ENHA 3P0MA 4CFFA 2X2MA 5D7AA 4ZK5A 3FHRA 2EXMA 3EQBA 4IWOA 4XP3A 4BB4A 3LVPA 2GQSA 4FI1A 1BUHA 1APME 5CVFA 3I6UA 4L8MA 1U5RA 4BI1A 4QMOA 2W9ZB 5EI8A 5T68A 3GC0A 1JLUE 1JSVA 3ZXZA 4L42A 1R0PA 4LOQA 5CSWA 4LOOA 4YP8A 3QQHA 3QZHA 4B9DA 3EKNA 1ZY5A 5FWKK 2QG7A 3E93A 4ZJIA 3VJNA 5CZHA 3U6HA 2JDRA 3A61A 4L52A 4AUAA 3MN3A 2UV2A 3OCSA 4OBOA 3PIXA 4PPCA 4BCGA 3F3TA 5HIDA 5HD4A 2QD9A 3MVMA 1U46A 4ASXA 4KBAA 4MAOA 1PXLA 4FKVA 4FIHA 4QTCA 3VN9A 3V04A 2WTKC 2XEYA 4EZ7A 4JIKA 4JX7A 4RJ6A 1WBTA 4LG4A 3RINA 4IB0A 2XIXA 3A4PA 5DT0A 1WBPA 2C1BA 3CQWA 4L3PA 4C4JA 5AP1A 2RFEA 4BCHA 1GOLA 4AG8A 3IS5A 2O5KA 1O9UA 5ETAA 4FNYA 3DA6A 4I0TA 4IAIA 4EKKA 4MTAA 5DHJA 3MY1A 5JZJA 3ZCLA 4CMOA 2PHKA 1M7QA 3Q5ZA 3PP0A 5CQUA 5K9IA 2GCDA 3R6XA 2PULA 2XRUA 3BBWA 1Y8YA 5D41A 3A8WA 4F1OA 4ZEGA 3S4QA 2AYPA 3ZLWA 4MKCA 4TRLA 3ZUVA 4YNOA 4PP7A 3AC2A 4FBXA 4WIHA 2BUJA 4WNPA 5LJJA 4M67A 1ZYLA 2WMTA 4JQ8A 2ITWA 3HGKA 3ORXA 1BL6A 3OUKA 4F08A 3OCTA 4YC3A 3ERKA 3Q6UA 1T46A 3R7VA 4FTJA 5AJQA 4U6RA 3ZFXA 2PUNA 3KXXA 2X6DA 3OOGA 5DLSA 1F5QA 3DT1A 2QVSE 4ONAA 5DOSA 5CAQA 2GNJA 1DS5A 5M4FA 5IUGA 2HXQA 4IWPA 2B9JA 3Q96A 4OBPA 2XKDA 4EZ5A 3OWLA 4JI9A 4FSWA 1UNGA 4RX7A 2JIVA 3NIEA 1I44A 1PMNA 3FSKA 2XMYA 4RMZA 3L8PA 1L8TA 2OXDA 2RFNA 3AD6A 4JIAA 4RPVA 3I5ZA 4GEOA 4PMTA 4EH8A 5C8KA 1U4DA 4I3ZA 3TNIA 3WIKA 1EH4A 4JDKA 2DUVA 3P08A 3RM6A 5CWZA 4NYEA 5B7VA 5HBHA 3FMHA 4BBEA 2JFLA 2W5HA 2OIQA 2GHMA 3V8SA 4L53A 4CT1A 4P4CA 4O81A 2BAQA 5TT7A 3QXOA 4V0GA 5KBQA 3QCQA 3CC6A 3OWKA 5E4HA 3WF8A 5AR4A 2XRWA 3DBQA 4L6QA 3NIZA 5DR2A 3ET7A 3MH3A 3Q2MA 5A4EA 4OW8A 1P4FA 4IZAA 1GIJA 3FMKA 3D5UA 2YIWA 4FIGA 2O3PA 3COHA 1IA9A 2HK5A 2I0YA 4JRNA 4FV9A 1JNKA 5I5ZA 5FXRA 2BFYA 4RVLA 4S31A 5HGIA 1NVRA 4PQNA 2OO8X 4UALA 4O7WA 2ZM1A 1H8FA 3FI2A 2VV9A 4U40A 2FYSA 5CS6A 4CRLA 3DAKA 3DU8A 4J53A 3UPXA 1BX6A 3AC4A 5HX6A 4D0WA 5C26A 4FKRA 4ZZOA 2GNFA 2BHHA 2OSCA 3NYNA 4X6RA 1WVYA 4FUXA 2WTDA 4XNEA 3FZ1A 1ND4A 2VAGA 4FC0A 5CI6A 4QO9A 3QTWA 4O1PA 5AR8A 3DFCB 3MFRA 4QPAA 4IANA 3KXGA 3L1SA 1W8CA 3PPZA 4QD6A 3CEKA 4DE4A 1HOWA 4QMNA 2XKCA 4L68A 3E64A 2VWIA 4GW8A 4Y8DA 2B0QA 3MVLA 2FA2A 4U8ZA 4O2PA 3QF9A 5ANOA 2BIKB 2OFVA 3RZBA 3VBVA 4KAOA 3WZDA 3ATSA 4BZDA 4RSSA 3ODZX 4IAKA 4M14A 4RWJA 4C35A 4GYIA 4DFYA 3UC3A 3V01A 3E87A 3GCPA 1PMUA 2UW0A 2VTAA 4NM5A 4LL0A 4XMOA 4L46A 1ZY4A 4S33A 3GP0A 1E1XA 1UNLA 2C3LA 2C0TA 4HNFA 3VUMA 5JFXA 3LMIA 3HAMA 1BLXA 3OY3A 4O0YA 5CANA 2RFSA 4AS0A 3F3ZA 3U4UA 1DI8A 2BTSA 1FVVA 3F82A 1QPJA 4GVJA 3VS7A 3KF4A 1V1KA 3KK8A 1G3NA 3D94A 3K54A 4IE9A 5EOLA 3KY2A 2OW3A 3MSSA 4HYIA 2HY81 1A9UA 2H8HA 4FEXA 4AA4A 4Y83A 4V0GB 4YNEA 4DBXA 4FMQA 2B1PA 4LYNA 3RI1A 4IZYA 4I93A 3LMGA 3QA8A 3RHXA 3ZO3A 4MD8E 1YXVA 3LE6A 3UPZA 3LZBA 3OMVA 3MBLA 3LFCA 5E8VA 4GT3A 1Y8GA 3D5XA 3HNGA 4U41A 2VTRA 2IW9A 3VS2A 3AMYA 4U5JA 3DTWA 5LXMA 3FY0A 2VWUA 2ITNA 4EONA 3BLHA 2IZUA 4TWOA 4MBIA 3UG2A 4FNWA 2YAAA 5KKRC 3LFNA 3F3UA 5FEDA 4UWCA 3MPMA 5AAFA 3WARA 5FRIA 2Q83A 2R3KA 2WIPA 3MYGA 4XYFA 3Q9YA 4ZTHA 4NCTA 1TQMA 2CLXA 1OVEA 3NUYA 4TWPA 5HO6A 4BCMA 5HQ0A 5IA2A 5IQFA 2VWYA 3KN6A 1JWHA 4BGGA 5CF6A 1JKTA 5HIEA 2I0VA 4U45A 5IQIA 4K2RA 2ITXA 4YJPA 2QHMA 4FL1A 4E1ZA 1OPKA 5J1VA 3OROA 4JG8A 2W7XA 3FMEA 4NUSA 3O7LB 4G6NA 4I20A 3QRTA 3OUNB 4FTUA 4FIFA 5CEMA 5HCYA 4DG0E 3ZLSA 2O2UA 2YM8A 3EFWA 5LARA 3WF7A 4A9TA 3LFAA 3C5IA 2DQ7X 2WXVA 2UZDA 3EN7A 2RSVA 1YXUA 5EW9A 2P2IA 3TUCA 1H1RA 2ZDUA 3GCQA 3QZGA 4YZBA 1OZ1A 3ZO1A 3GOPA 4FTTA 3R71A 3D7TA 4DLIA 4B7TA 3TUBA 4U42A 4D0XA 5BVDA 3OP5A 5DRBA 3MS9A 5BYZA 5AV4A 5FTGA 4L3JA 2VNWA 3C0GA 3NMUF 1SNUA 4D5KA 3HRFA 3GFWA 4U80A 5A6NA 4FT3A 3QUPA 4DHFA 2Y4IB 4E6AA 4O7TA 2VTOA 4EK3A 3BEAA 2R3NA 3D5WA 2ZVAA 3FQSA 3E62A 3ANRA 3PTGA 3EQRA 4M13A 4MEDA 4W4VA 4FGBA 3TJDA 4ZLZA 3S00A 5CEQA 4RWLA 4HVDA 3PXYA 4FSZA 3MIYA 2G15A 4MXAA 4A06A 1R0EA 3JVSA 4IM0A 5EYCA 4HGEA 2QOBA 3VWAA 5L8KA 2J0LA 5KMLA 3DZQA 5A14A 2I40A 4O22A 4D1XA 1Q24A 2ITTA 3EQIA 1YI3A 2R3FA 3IQ7A 3RK7A 3SOCA 4AGUA 5HU3A 1SVHA 3LQ5A 4TWCA 3DB8A 1B38A 5L6PA 1ERKA 1KOBA 4LRJA 4I5CA 1Q8ZA 3GC8A 1ZAOA 5D12A 4BBFA 3IOKA 3FC2A 1GZOA 4YLJA 3R8UA 2PVNA 2YACA 4FA2A 4FNXA 3R1YA 1MQ4A 2WKMA 2PMNX 2Z8CA 1OIRA 3L9NA 5CAUA 2JGZA 2NPQA 3V5LA 5HVKA 4UXQA 2R0IA 4C38A 1UA2A 2VO7A 3G33A 3OTVA 4GH2A 5HKMA 2JLDA 4MQ1A 2W1IA 4BCOA 4G3CA 4LI5A 2QKWB 2UVYA 3SC1A 4HCUA 3OHTA 2G2FA 3DXNA 2PVHA 3FQEA 4OAVB 2JKMA 3BELA 3D7ZA 4ANQA 4F70A 3FZSA 3GU6A 5ANKA 2W17A 4MNFA 4AN9A 1ZZLA 3VIDA 4FG9A 2XH5A 4GU6A 2XNMA 3O96A 3MY5A 3MI9A 2KTYA 4L9IA 4YJVA 5AV0A 5AX9A 2VD5A 5IZFA 3FI3A 4YC8A 4CYIA 4J98A 3QRUA 3LAUA 4IM2A 4QNAA 4RZVA 4U44A 4USEA 3QTIA 5AV3A 5EI6A 1Q41A 4C4GA 2H6DA 4WNMA 2LGCA 2XYNA 1UWJA 3LQ8A 4FX3A 3PA5A 5ANIA 3VQUA 4ERWA 4QTEA 3D7TB 5I9ZA 4O7ZA 5KCVA 2EXCX 4QP3A 4I4EA 3A60A 5EDQA 4O82A 3U54A 5HCZA 4MXZA 4UWBA 3FMLA 4W9WA 4AW5A 1J91A 4F7JA 5DRDA 2WTKB 3Q60A 4QPSA 4FL3A 1H1SA 1CM8A 4CMUA 4HVHA 2VX0A 3DQXA 4X7QA 1A06A 2W96B 5FD2A 1XKKA 3R30A 1OKYA 2A2AA 3U6IA 4FGRA 2ZV8A 3R7OA 3CTJA 2VX3A 4ANNA 2ERKA 2CGVA 1JPAA 5M4CA 3NUUA 4BZOA 3FI8A 3Q32A 4NEUA 4AN3A 2XNOA 5I0BA 1ZARA 5CXHA 3RK9A 5LVMA 1NT2A 3E7VA 4C33A 3AC1A 2O63A 4DITA 4PX6A 5TF9A 3QQGA 3W18A 4LRKA 4CLIA 3FBVA 5BNJA 3FLQA 3EOCA 4O7VA 4KIQA 2XJ1A 2YABA 3F88A 3PXKA 5CU3A 5JZNA 5HG7A 4ANBA 4USFA 4F0FA 3W10A 4BF2A 1YDRE 1KSWA 1NA7A 2NO3A 5ACBC 4D1SA 1B6CB 3K5VA 4JL9A 5HG8A 4R1YA 3ZSHA 4ZTSA 1QL6A 3G9LX 5IH6A 4X3FA 5HICA 4R3RA 3SKCA 4JBQA 5E91A 3R7IA 4CXAA 2PUPA 2PVLA 5CU2A 1PXKA 4O0VA 5BVKA 4APPA 2BRHA 3DK7A 3PG1A 4OTFA 4DYMA 2CGXA 3KC3A 4P7EA 4D4SA 2H9VA 2PY3A 1FGIA 4G31A 4O7LA 3VF9A 2B54A 4XH6A 4IAZA 2FB8A 5EDRA 3W2OA 5L3AA 1ZZ2A 2C5VA 3DAJA 3LXLA 4KWPA 4O6LA 4EC8A 5HTBA 3LCSA 5EHLA 4FSTA 5FDXA 4QMQA 4NZWB 1H24A 1JQHA 4MCVA 2YEXA 4KRCA 4RGJA 2JAVA 4BFMA 4FEVA 3G6HA 3F5UA 4AE9A 3QXPA 4NIFA 2BAJA 4P5ZA 3R8ZA 3QD0A 4MVFA 3F5XA 3T8OA 4FEUA 5EHOA 2YM4A 3QC4A 1XH7A 2QOKA 3IW6A 5EKOA 5BPYA 4GT5A 5AP4A 4JRVA 4CCUA 4CG8A 5HNGA 2YITA 4OGRA 2B53A 3ZMMA 3FKOA 1YKRA 2HCKA 3AD4A 3NYVA 4RIWA 5IA5A 5BVFA 4FODA 5CU0A 3VUGA 3NUAA 4G3EA 3GXLA 3BBTB 5EW8A 4WG4A 4AA5A 2ONLC 4IEBA 4IW0A 3MPAA 3UODA 3QUDA 4KUJA 2XJ2A 4BHZA 4E26A 3R8VA 2DS1A 1KUTA 5FM3A 4PV0A 3C4ZA 3R1SA 4AF3A 2HELA 4DGNA 5J5TA 2P0CA 3SOAA 1H26A 3DKOA 5IDNA 4IDVA 1M2PA 4IVBA 1Q5KA 3VBYA 5M57A 3L8XA 2WEVA 3TIYA 3PP1A 5KHXA 1BL7A 3DNDA 3CTQA 2EB3A 1M7NA 4BRXA 4EBVA 4GK4A 5EQPA 1R1WA 2XA4A 5KMOA 4D2RA 5DI1A 4EWQA 2W5AA 3QC9A 4B0GA 4B8LA 1CKIA 4MQ2A 5DWRA 2VUWA 3AGLA 1H27A 3P78A 4HZRA 3EH9A 4J97A 4X3FB 4QOXA 3UNZA 4DA5A 2JD5A 4BIDA 2GNHA 2OJ9A 3MV5A 4GJ3A 3ROYA 4DGLC 2E9VA 2YERA 4W8EA 5CEOA 1KE6A 3I60A 5AR3A 4EK5A 4FTLA 3B2WA 3EN9A 4NU1A 3OOMA 4EHGA 5AAEA 4MBJA 4RT7A 3KL8A 3LFBA 4Y95A 3NCZA 2V55A 3T3UA 3CKXA 3R28A 4C36A 2QURA 2BR1A 3EQFA 3FY2A 4Q2AA 5M53A 3IOPA 1OL6A 1OITA 1H01A 3RPOA 4I6QA 5AV2A 5M44A 4UX9A 4O7YA 4XBUA 4O96A 2BKZA 1TQPA 4N57A 4CV9A 4BCIA 3M11A 3SDJA 1FINA 3CJGA 4NIFB 1PMEA 1WBNA 5AR7A 3O71A 5G6VA 2DYLA 3OEFX 2J0MB 1CKPA 1TKIA 2C3KA 5J7HA 2CHLA 4ENYA 3SG8A 3ORMA 2FUMA 4BTKA 3CY3A 3BWFA 4FKQA 2WGJA 3MB6A 3JVRA 4RIWB 1MRVA 1OL1A 3BYOA 5L2WA 4QMUA 3OXIA 3O51A 3ZO2A 4XRLA 3VUIA 4S30A 1OB3A 3MFUA 3OD6X 4XCUA 3WE8A 5KKRB 2NRUA 3OFMA 4WBBB 4MF1A 4TW9A 4PDPA 3U9NA 3LCKA 1YOMA 4KD1A 2VO3A 3P1AA 3UQCA 3CQUA 3CE3A 4FF8A 2OU7A 2OG8A 3U8WA 5EFQA 2WMXA 4P2KA 4UZHA 1XH9A 3M2WA 5AP7A 2XB7A 3COIA 3FZTA 3E8EA 4JQ7A 4J96A 5AR2A 5L2QA 4BDJA 2X2KA 2X9FA 2VTMA 4CFVA 4CNHA 4BDFA 4YZMA 5LVPA 3GFEA 1NXKA 3CPBA 3QHWA 3KVWA 4G5JA 5AX3A 4TYIA 4ANSA 5JN2A 1PRYA 3V6RA 4USDA 4CGAA 4OTGA 3OXZA 1LR4A 1M2QA 4FT5A 3V51A 3VUDA 5CF8A 3I0QA 4KBCA 4EBWA 3VUTA 4WNOA 2X8EA 5E9EA 5IQEA 4TKSA 3W1FA 4EOOA 3DS6A 1KE8A 2OZAA 2UZBA 3HMNA 2PK9A 5EK7A 4PPAA 3OZ6A 3SV0A 4UMPA 1ZOHA 2GTMA 4AZTA 1O6YA 2HWOA 2W05A 4X0MA 2CKPA 2HIWA 3HV6A 3FPMA 3QD2B 2QLUA 4EQUA 4ZP5A 3HMIA 2WB8A 2A4LA 2GDOA 4FK3A 4RIXA 3W16A 4EK6A 2JC6A 5C4LA 4JS8A 3P23A 3FLYA 5KX8A 3G6GA 4E6QA 4E4LA 4HGLA 2P3GX 4UY9A 3POZA 2BKKA 4LMUA 2QONA 5AMNA 2HXLA 3FL5A 5E8ZA 5LMKC 2R64A 3ACKA 1OPJA 2BFXA 4H3QA 3VW6A 2REIA 3UIBA 5BX0A 5A46A 4KABA 3NS9A 3O7LD 4AE6A 4KS8A 3JY9A 2F2UA 4IAFA 5F9EA 3TKHA 5KO1A 3HVCA 3H9RA 3KMWA 4CQGA 4ORKA 2JDSA 4PNIA 5CAVA 5AUUA 3HP5A 2IN6A 3OS3A 3GC7A 1H28A 3OVVA 3P5KA 3PG3A 5BMMA 4DFNA 2YAKA 4NL0A 4PMPA 4ZIMA 3TT0A 2QOOA 2XNGA 2C6TA 2WZJA 1UNHA 2YCFA 4O0UA 1LEWA 3I1AA 3B2TA 2X9EA 4ANLA 3HMMA 4LL5A 2X1NA 1ZMWA 2WELA 1Z57A 2QODA 1CKJA 3KRWA 2XK9A 3RZFA 2OXYA 4ITHA 3ALOA 3GU8A 5CSXA 3VS0A 4CZYB 3C5UA 4F4PA 5EW3A 2YLFA 4LUDA 4XP2A 2CN5A 4E8AA 5LQFA 2C6KA 2UVZA 5HHWA 4E5AX 5AP6A 3SQQA 4ID7A 4ZSGA 2R3JA 3F7WA 2C5XA 4HJOA 3BRBA 3PXFA 4BL1A 2W1DA 3GVUA 1PY5A 2VX1A 3Q5IA 2ITZA 2YM7A 4WD5A 3IDCA 1TQIA 5IDPA 4YZCA 2CJMA 2R2PA 3D2IA 1Q8TA 2CNUA 1R39A 3MH2A 3PVBA 2CGUA 2ZB0A 3BHHA 5HCXA 5H8BA 2OZAB 3RM7A 5LVNA 5CAOA 2YIXA 3TZ7A 2Z7SA 4ZTQA 4C3FA 2XNEA 2CNQA 3KULA 1GAGA 3OF0A 1ATPE 5IEXA 1JBPE 2QR8A 3FMJA 3MJ2A 5E8UA 1H0WA 4RIXB 2BMCA 4GIIA 2QC6A 3JR1A 1Z9XA 3AT2A 4D55A 3PWDA 3FPQA 3KN5A 1PMVA 4X2GA 5IA1A 3CLYA 5J79A 4DCAA 4C58A 4O38A 3QX2A 2UW8A 2ONLA 3LIJA 5FDPA 4P90A 3VF8A 5IUHA 2JITA 4BDHA 5HG5A 3QAME 2XK8A 2WOTA 2HAKA 2Q0BA 4NM7A 3QRIA 3BI6A 3DXPA 3HUBA 4J8NA 4WOVA 5TKDA 4C3RA 3R02A 1Q61A 5L2SA 4ZAUA 4IMYA 3MESA 4YPSA 3QLGA 4YO6A 4AP7A 3E8DA 5ETIA 4EH9A 3SVVA 1WVXA 4WKQA 4MH7A 3DDQA 2X7GA 4CV8A 3K3JA 1YXXA 2BAKA 3BX5A 4BR3A 3KA0A 2YJSA 3FLZA 4G3FA 4ANMA 4CEGA 3MTLA 1VYWA 4N4SA 4W4XA 4ALVA 2FVDA 4D9TA 4O21A 3BCEA 5L2IA 2VN9A 4RLKA 5JFSA 4ZLYA 3W2CA 1Q97A 3EJ1A 2Z7RA 4GK2A 2BRBA 4B99A 4DFZE 4XV1A 3SLSA 4LFIA 3ZM4A 3ZSIA 3SRVA 5AR5A 1L3RE 4DTAA 4QPMA 4D4RA 3GU4A 4G1WA 4KS7A 4DT8A 5DEWA 4X21A 3RBWA 5F95A 3TACA 5JEBA 4I94A 4QMWA 4RC2A 4I92A 3VUHA 5HIBA 1H4LA 3OWJA 5GNKA 1NVSA 3LXNA 1XH4A 4GJ2A 3DBCA 4GUBA 1QMZA 4JG7A 4TWNA 3UIUA 4CFWA 2R4BA 2P2HA 2FH9A 3QCYA 4JVGA 4RWIA 3HV7A 4YLKA 4G16A 3I6WA 3LCOA 3MGYA 3NR9A 3Q2JA 4BIEA 2XIYA 3KMUA 2PZPA 3DDPA 3MTFA 5BQ0A 5DG5A 4O2ZA 4QYFA 4BCKA 2ITVA 3PA3A 5EOBA 5HD7A 3F5GA 4G34A 2BALA 4PRJA 4YTHA 1X8BA 3ZLXA 4DEDA 3G90X 2C69A 3RGFA 4Z16A 5KMMA 5D10A 2E2BA 3A62A 2O65A 5DH3A 4BVUA 2PWLA 3S3IA 2EWAA 4NK9A 3BEGA 4YJUA 3R7EA 4EI4A 2C4GA 2YM3A 5CU6A 5CSHA 3SD0A 3TTJA 3W33A 4BTJA 3R7UA 3FQHA 4C57A 2OXXA 3MY0A 2ETMA 3LQ3A 3PJ3A 4IAAA 2HY0A 5IQAA 2XF0A 3ZRMA 4IB1A 3KB7A 3ORLA 4X2FA 4ZOGA 2UVXA 3F69A 1GZKA 3E88A 4QMMA 4EL9A 5BVNA 2R3GA 4KINA 2YCRA 4FVQA 4YJQA 3HP2A 4C3PA 4PTEA 4H1JA 2J0IA 1BYGA 3ZSGA 3TEIA 4YU2A 4RJ4A 4FKOA 4QP2A 2P4IA 5HTCA 3KRRA 5IPJA 5K0KA 4JX3A 4YR8A 4IM3A 5CLPA 3CPCA 2ZJWA 5EQEA 3WYYA 5DFPA 3DK6A 5E92A 4TN6A 3E3BX 2W1GA 4QP6A 4MX9A 5HVYA 1H1QA 5CVGA 4O0XA 4ACMA 2SRCA 4M3QA 4EQMA 2V7AA 2VNYA 1OBGA 2XCKA 4FKWA 4F6WA 3QTXA 2QQ7A 3POOA 4X2NA 5I9WA 2UZNA 3PJ8A 1JKLA 4RJ8A 4EEVA 4LV5A 2J0JA 3R00A 4W4WA 2XBAA 1SVGA 3PRIA 2CLQA 2VTJA 3JXWA 1U5QA 5EYDA 4O83A 4XOZA 2VTNA 2X8IA 4L67A 2OLCA 4D5HA 3RTPA 5IQHA 3RCDA 2HOGA 3LFQA 4OTRA 5LMKA 4PL5A 4S2ZA 2WMVA 3UVPA 5CF4A 3C4WA 3I0OA 4BDAA 2PVRA 2GS7A 2HZNA 2XS0A 2YISA 3C50A 3OXTA 5AUVA 2YHVA 4FG8A 5I3OA 4JBVA 3Q4ZA 4DBNA 3FEGA 3ORPA 4QMSA 2KULA 1OL5A 5CU4A 1P5EA 3C0HA 5HNBA 4DFXE 4GFGA 3ZU7A 1J1CA 4FV3A 3FLSA 4I6BA 2VWWA 2XK3A 1M17A 4FTOA 4R7IA 1URCA 4TT7A 4XLIA 5H2UA 5JRSA 4AGWA 4CKJA 5IF1A 5FEQA 1UU3A 5FTOA 2IVUA 2R3IA 5H8GA 4G2FA 4IZ7A 4BDKA 5BVOA 4YZ9A 4WHZA 3BPRA 4QMPA 4NJDA 4ZSJA 5KZIA 3UQFA 3TN8A 2R3PA 3D2KA 5AP2A 5JT2A 3WZEA 5EM5A 2IZTA 4BI0A 3QWKA 1OPLA 3VJOA 4I1ZA 5T6KA 5HX8A 5F4NA 3UGCA 3ZOSA 4BIBA 3B8RA 2PZRA 4TTHB 2AC3A 4YHFA 1XBAA 2JEDA 2PUUA 3ORIA 2VWXA 4I22A 5CXZA 3MIAA 3F2RA 3IONA 2BDJA 2W1FA 3C1XA 3Q52A 3TCPA 5C9CA 4YHTA 4FKIA 4CMTA 4ZTLA 4V01A 5EQYA 3BZ3A 1VZOA 1OIQA 1RQQA 2EB2A 4LGGA 2ZV2A 4YJTA 3TV6A 4GG7A 4KBKA 3U55A 2AC5A 2E9NA 4QMYA 3TNHA 2XCHA 4DH7A 2YZLA 5HLPA 2VTHA 5AM7A 2C30A 5CTPA 4ZTMA 3GQLA 3R01A 4EHEA 3VBWA 2XYUA 3NW5A 3K3IA 3O2MA 2J50A 5FTQA 2Z02A 4AXAA 3ZDIA 5DA3A 1XBBA 4NJ3A 4BWKA 2WMBA 4O84A 1OM1A 4JR3A 3UYTA 1B39A 4GS6A 1R78A 4AOJA 4ASDA 2GNLA 2WU6A 3BHVA 4ERKA 3OW3A 3CXWA 4FR4A 3V5PA 2QOIA 5HE2A 4AT4A 3IPHA 3V8WA 4IIRA 4DGMA 4TNDA 3TIZA 3TV7A 3CJFA 3ZRLA 4EWHA 3EB0A 3EQPA 4Q9ZA 3BU6A 3DTCA 2YJRA 4HYHA 3HRCA 4F9BA 4OTWA 4MD7E 4GV1A 4PY1A 4NSTA 4XG4A 3NUNA 5CNOA 4YGAA 5FQDC 1IG1A 3A2CA 4PL3A 5A4QA 3NNUA 4FTIA 4BGHA 5IQCA 1YWVA 5M56A 2WTJA 2Z2WA 5IH5A 3G15A 3JYAA 4IC7A 4XV9A 3UIMA 3WIGA 1Q8YA 1XQZA 5KE0A 4XHKB 5HO8A 5GINE 1RW8A 4BDEA 4CD0A 4FTCA 4ZMFA 3EQDA 4UZDA 1QPEA 3LFSA 2B7AA 4FSRA 3RPVA 3TKIA 4MK0A 4XLVA 1K9AA 2J2IB 2R3HA 2DWBA 5LMAA 4CLJA 1FVRA 3NLBA 4AW1A 3RNYA 3GNIB 5IUIA 4JT3A 3LXKA 3EFJA 4FSNA 4CFUA 3L8VA 5AUXA 2QR7A 2CKQA 3PDTA 2I1MA 3V5TA 3R63A 3QKKA 2RIOA 1H08A 3PXQA 4GK3A 4CRSA 4EOIA 3F61A 1UU7A 3CKWA 4MHAA 3O0GA 3MA3A 3OG7A 4BICA 5M08A 3CTHA 1VR2A 2BTRA 2FSOX 4Y85A 5J8IA 4BC6A 1P4OA 5HU9A 3UOKA 4XG2A 1YXSA 3FV8A 2YWVA 5CX9A 3FZRA 3R8PA 2GNGA 2PZIA 2XIRA 3NGAA 2CNVA 2P55A 2PMOX 4K8AA 2UZEA 3E8CA 3ORTA 1TVOA 3LFDA 3M1SA 3F3VA 3JUHA 2W1HA 5CEIA 1LEZA 4A9YA 4E20A 2YIQA 1VEBA 3IDBA 4NTTA 3ATTA 1F3MC 2QNJA 1J1BA 2QG5A 3AXWA 3F5PA 5HE3A 4DEBA 4ZJVA 4EOSA 4AGDA 2ITUA 5GJGA 2R3QA 3NNXA 2QHNA 1RJBA 3G0FA 2X8DA 3C4XA 3COKA 2BIYA 3QLFA 4IX5A 4RFMA 4UV0A 4EOQA 3TDVA 3FXXA 4U7ZA 4RVKA 5L8LA 2J0KA 5DT3A 4MNEA 2XNBA 3KK9A 3DJ5A 2QOFA 3U87A 3FC1X 1J3HA 4YMJA 4AZFA 2R9SA 3HV5A 4FKSA 2R3LA 3QFVA 2PTKA 5CT0A 3ZZEA 3R9RA 1CMKE 1GNGA 2B9IA 1Y6AA 2VTQA 3QWJA 4JDHA 2WFYA 3FWQA 4IX3A 2UZTA 4NW6A 3RPYA 3GT8A 5DPVA 1GIHA 1YRPA 4QQ5A 2XZSA 3EKKA 2J51A 3R0TA 4AX8A 5KNJA 4LQMA 4RZWA 4D4YA 4M84A 3VS4A 3SX9A 4FT7A 5ANJA 1I09A 3OC1A 4IACA 2FSMX 5HBJA 2WMSA 2BZKB 1SVEA 3PVUA 2BRGA 2RG5A 4FV5A 2B52A 3EL7A 5CEKA 2X7FA 4R77A 5LMBA 5CAPA 4ACHA 4YZNA 3TZ8A 1S9IA 3A7JA 3ELJA 2I0EA 3DAEA 2ESMA 4AQCA 4BKYA 3SW4A 2LAVA 1Z5MA 3C4EA 2W4JA 4FZ7A 4EUTA 3QRJA 2R3MA 4IZ5A 4EYMA 5HNIX 2C3IB 4F0GA 4I41A 1A48A 4ZTRA 4ACDA 3F9NA 3GI3A 2QI8A 5KBRA 2G1TA 3VBQA 2IG7A 3BYMA 4Y72A 3DB6A 3OW4A 4GIHA 3OT8A 5DT4A 4FV8A 4JNWA 4GL9A 2X39A 3AMBA 2BDWA 4D1ZA 1F0QA 3TJCA 2B9HA 1UWHA 3BV2A 4XV2A 1V0OA 3NAXA 4C34A 2PL0A 2W99B 3UTOA 2UW3A 5KZ0A 5HE1A 3ANQA 4F0IA 5FG8A 5DE2A 4OT6A 5GHVA 1HCLA 3E8NA 3LM5A 4X6QC 1UU8A 4FTKA 3UYSA 4HCVA 4C4FA 3TNWA 4DH1A 3NUPA 5KHWA 5FUTA 2C68A 2I0HA 1KV2A 3L8SA 1XH5A 2JBPA 3KFAA 4C2WA 4CKIA 3GCSA 5BYYA 1BI8A 2PVFA 4Z7HA 5LOHA 2J7TA 3A7IA 5HVJA 5AEPA 3P79A 3RCJA 4QYEA 2G01A 4MNEB 3G0EA 1JKSA 2Y4PA 2HYYA 4J7BA 4QMTA 1KOAA 2XUUA 5BVWA 5J1WA 5E8XA 3QTQA 4F7NA 1W7HA 3HYHA 4AWIA 2OH4A 1MUOA 4QMLA 2W1CA 4H58A 2C0IA 4L45A 3DLZA 5CSVA 3QQUA 3ZO4A 4I6HA 2V62A 4FIEA 3GCUA 3PY3A 4P5QA 3A7GA 4AW2A 4WNKA 4WO5A 2YFXA 3KVXA 4IB3A 1LUFA 4D2TA 1OUKA 2C0OA 3NRMA 1V0PA 2EXEA 3C0IA 2UW6A 5HLWA 2GHLA 5HBEA 5BMSA 5IQBA 5AUZA 3HLLA 3PVWA 3LJ1A 5B0XA 3QCSA 2PMIA 4XEYA 2ZAZA 5M09A 3GB2A 2QU6A 5A4LA 2JDVA 3QTSA 1JSTA 3ENMA 2C6IA 5JRQA 4CFNA 4XV3A 2E9PA 3PSBA 5JGDA 4W9XA 2WD1A 3PXRA 2BRNA 3FAAA 3U51A 3VS3A 5ETCA 3EYHA 2ZB1A 2QO2A 1OIYA 3DLSA 3FKNA 4R78A 4DTKA 3CR0A 3DNEA 4LUEA 5L6WL 1XR1A 4EJNA 2J5EA 3NPCA 3PZEA 5AUWA 4BYJA 4DH8A 4DGGA 4Y5QA 5DMZA 4RA4A 3TDWA 1HCKA 4LV8A 2JDTA 4YSMA 3CY2A 3QUEA 4V04A 3HA8A 4OUCA 3G2FA 3NW7A 4TYHA 4IXPA 4QTBA 2X7OA 3PE2A 2ERZE 4UWYA 3UOHA 4OTDA 3W2SA 4UMRA 4YUQA 5EH0A 4Z3VA 2BZHB 2V0DA 2OI4X 5DR9A 4UXLA 4R5SA 3G51A 1WBSA 4LGDA 3VS1A 4FZAB 4FZDB 4DEEA 4FL2A 3GENA 3UDBA 3D0EA 3LOKA 2UZWE 4E4XA 3EN5A 3NUXA 4IFGA 3QQLA 4MBLA 4WUAA 3QTRA 4IJ9A 2FO0A 3F2AA 4EH7A 1CSNA 4G3GA 5IQDA 4AGCA 2YCQA 4WRGA 5C1QB 5HORA 5ITAA 4PTCA 4XUFA 3FXZA 3JY0A 2E9OA 5J5SA 4RFYA 4ENXA 4ZSEA 3UBDA 3IW8A 4M68A 3NSZA 2WU7A 1G8SA 4CG9A 3PA4A 5FGKA 2UUEA 4IC8A 4NFMA 3I79A 3DKGA 3DY7A 2VO0A 2X2LA 4QP9A 3HKOA 3LLTA 4ZJJA 3ZS5A 3A7HA 5J87A 2JBOA 4O27B 2IPXA 4QP4A 4RX5A 1JAMA 5AA9A 1WCCA 2VWBA 3WZKA 4E4NA 5H9BA 4C4HA 1QCFA 2IJMA 2WIHA 3PJ1A 4ZY5A 5M51A 2IWIA 4OAUC 4N70A 3PVGA 5EHYA 4N6YA 2VTLA 3H30A 4J95A 2E9UA 4IB5A 2QOQA 4IWDA 2PUIA 5K5NA 3CBLA 4RVTA 4A4OA 1V0BA 4DINA 3UNKA 3HMOA 3HDNA 4FKGA 4BWXA 3AC8A 2X4ZA 4EQCA 4ZZNA 4ITIA 5IKWA 4R7BA 1YOJA 5DVRA 3O17A 4IBMA 2VTTA 1OMWA 1UKIA 4CZUA 2RKUA 5EYKA 3O8PA 4PMSA 2UZOA 2XM9A 4YJSA 2UW7A 5D1JA 4NW5A 4FK6A 1OKWA 4M15A 4AU8A 1O6LA 2X4FA 1PYXA 4XJ0A 3QX4A 1M52A 3TWJA 4C4IA 3CP9A 3ZEWA 3EFLA 1PXIA 4FSMA 5LVOA 4DT9A 2YDJA 2QOCA 4Q9SA 4ZY6A 5KMIA 2OKRA 2QU5A 3PUPA 4EJ7A 4JLCA 2ITPA 3ZRKA 4FTQA 2VZ6A 3ACJA 4K9YA 4PF4A 3DGKA 3KRLA 4AOTA 3D83A 4E6DA 5GZ9A 4YC6A 2R0UA 3EWHA 2GPHA 2RGPA 5FM2A 3LJ2A 3VO3A 3D9VA 3E5AA 2QOHA 4C2VA 5IEYA 3DKCA 4KIKA 4QYHA 4XS2A 2B55A 5JGAA 5AIKA 5DGZA 2YN8A 4I5PA 2ITOA 4IVDA 4K18A 4O1OA 4AZSA 4EHZA 4TL0A 4QTAA 2WTCA 2Y6OA 3ITZA 4FTAA 5E7RA 4XG9A 4YBKA 5EI2A 1ZOEA 1P2AA 3KEXA 3CD3A 5DEYA 3O50A 4R7HA 5D7VA 3VHKA 4CSVA 4EH5A 4N0SA 2UW5A 4R6VA 3V5JA 4DFBA 4Q5EA 2PVYA 4KA3A 4L00A 1FMOE 1FVTA 3WBLA 5CZIA 3MA6A 4YTCA 2XIKA 4RQKA 4CT2A 5EYMA 4CTBA 4Y5HA 4QMXA 4GUEA 3NYXA 5B2LA 1W82A 3FMNA 2YWPA 3L9LA 1SM2A 4LGHA 4Y73A 4FYOA 3HAVA 4HVGA 4EOKA 4TZRA 3FLNC 3HDMA 4XG3A 4ZSAA 5IMEA 3C9WA 4XP0A 4L3LA 1UVRA 3VAPA 3R2BA 3IDPA 5KMKA 3F66A 5FEEA 3PYYA 4X2JA 3LJ0A 3EZVA 5DN3A 2GSFA 4M7IA 4BKJA 5BYLA 2OJFE 5AA8A 3SGCA 3R9DA 4F6UA 3CQEA 2G2IA 2QO9A 3VRYA 4AZWA 3WYXA 3EL8A 4TPTA 1W84A 5TE0A 3HL7A 3LMHA 4FV4A 3ULIA 2BCJA 1SYKA 3UO4A 2VGPA 3LFFA 3A7FA 3N9XA 4I23A 4NH1A 4ACCA 2IZSA 2OIDA 3LCDA 3P4KA 4EH4A 3QTUA 4OLIA 3D4QA 4KB8A 4O7SA 4DCEA 4IX4A 4HW7A 4KKGA 3B8QA 1Q8WA 3PIYA 4O86A 4KIPA 2WQNA 3R7GA 2ZMDA 5CVHA 5C01A 3ZBXA 4IADA 2PVMA 2GS6A 4NKAA 5AP5A 5E8TA 1YHWA 3JPVA 3VBXA 3HUCA 4M0ZA 4AT5A 4F9YA 4RIYA 3HV4A 2PE2A 3MDYA 4U43A 5JMSA 1NVQA 3IW5A 4HZSA 4KIKB 3Q9ZA 4WRSA 2BZJA 2IZRA 2WMUA 4J71A 5B2KA 5GIOE 5ANDA 4DH3A 3TL8A 3WOWA 3QCXA 3UQGA 2PE1A 2CDZA 4IH8A 3G5DA 4AOIA 3CS9A 1GIIA 2OBJA 4QTDA 5IH4A 2R7BA 5D11A 5K3YA 5IA3A 2CN8A 2CPKE 3KXNA 3WF5A 2YIRA 4DLJA 2HENA 4E3CA 2QOLA 1YVJA 4NWMA 4RC4A 4J99A 4ZS0A 4F7SA 3UO5A 2XIZA 2R3OA 4ASEA 4R1VA 1MRYA 4L7SA 2QO7A 4U0IA 2QKRA 3UP2A 3FZPA 4GCJA 4PDOA 4WG5A 4WSQA 4H39A 3ZTXA 3ODYX 5LCJA 4FV2A 2C5NA 5H3QA 4BZNA 5FP6A 4YO4A 1WBVA 2C1AA 3RK5A 3U4WA 3EN4A 2YDKA 1FMKA 5L2TA 1WFCA 3P9JA 3UMWA 1PXJA 2WPAA 4K1BA 4KKHA 4LOPA 3UOLA 1G5SA 4AN2A 4IFCA 5L6OA 4XBRA 3F6XA 3GUBA 3H10A 1YHVA 4FNZA 3IW7A 4LRMA 3N4VA 4ZS4A 3W8QA 4XG7A 3NCGA 2VU3A 5BUEA 4XRJA 4FZFB 3KRXA 1KE9A 4K77A 2UZLA 4ARKA 5E8YA 4WBOA 4MXYA 1MQBA 2JAMA 5A9UA 3C13A 3UVRA 3NNWA 1Q8UA 1W98A 4AZEA 3EYGA 3ZLYA 4PUZA 3ZONA 4EOLA 4FSQA 3TV4A 4F9CA 5I9XA 3KULB 4E93A 3D14A 3VW8A 2I6LA 2VWVA 3DZOA 4PWNA 4W4YA 3FHIA 3O8UA 1JVPP 1IRKA 3FDNA 1T45A 2JDOA 2ETRA 3D15A 3N51A 3R73A 3FUPA 4PPBA 4QT1A 3REPA 1PXNA 3QZFA 1NW1A 3TI1A 4KSPA 3E7OA 3VULA 3BYSA 4QMZA 4WUNA 5J9YA 4M69A 1ZWSA 4C0TA 4RIYB 1ZXEA 3H9OA 5IA0A 2YCSA 3ID6C 5AP3A 4O0SA 4GG5A 3FSFA 5HESA 5M4IA 3H9FA 3BQRA 4O6EA 3PPKA 3VC4A 4C37A 4AFEA 3HX4A 3ROCA 4GMYA 4GT4A 4RJ7A 3DPKA 4F9WA 1PF8A 3DFAA 3FKLA 4JBOA 5ANEA 3ORZA 1KE7A 3UMXA 5C8NA 3OT3A 4EK8A 1Q99A 3LHJA 2Y6MA 3QQJA 2RF9A 2VTSA 4IWQA 4H36A 2ZM3A 4F1TA 4Z55A 2PE0A 4NTSA 3BHUA 3KCFA 3QZIA 3KRJA 3FJQE 2FGIA 1REKA 3QHRA 2WMWA 4IDTA 5HZNA 1DM2A 1LPUA 1ZYDA 1Q3WA 3PJCA 3OTUA 4A4XA 3UVQA 4EYJA 4EHVA 2ZV7A 4C61A 3RWQA 4G17A 2HW7A 2VTIA 3GC9A 4FYNA 4GFOA 3ZXTA 3BE2A 5CI7A 3NZ0A 1U54A 4F65A 2FSTX 4YPDA 1YWNA 3C51A 3SXSA 1PW2A 2A0CX 4JOAA 5CALA 4IVAA 4KSQA 4E4MA 3EZRA 4H1MA 3KMMA 1IEPA 4RFZA 1OBDA 3MFTA 2ETKA 4K11A 4U81A 4MYGA 3GQIA 3E3PA 3KQ7A 3RAKA 3SRVB 4BTFA 5A4TA 3I81A 2OJJA 3OWPA 2W0JA 3PJ2A 5CT7A 4O7NA 4ZZMA 3TG1A 1FQ1B 3Q4TA 3NVMB 3BU5A 2WOUA 2EUFB 5J9LA 4BKZA 3VS5A 5GZ8A 3ZH8A 3BWJA 1WMKA 3UG1A 2WO6A 4JQEA 4GRBA 3EQGA 3R8LA 4EC9A 2JIIA 3FYKX 2JKKA 3PLSA 1OGUA 4FV1A 3UO6A 4EOJA 3TZ9A 3R83A 2V7OA 3KKVA 2YIYA 2CKEA 4X3FC 2YM6A 4U3YA 5JK3A 4IVCA 2PVJA 4C7TA 1MP8A 2IO6A 2JFMA 4JBPA 4AACA 5JQ8A 2J4ZA 1J7UA 3ZHPC 3VS6A 3V3VA 4BTMA 4M69B 2YZAA 3R7YA 4ASZA 3H3CA 3MW1A 1AQ1A 4D2VA 3PLAE 1H00A 3DV3A 4J1RA 4BDIA 4JJRA 3KCKA 2YDIA 1STCE 3G9NA 5IU2A 4XOYA 5GIPE 4CFMA 2YM5A 1OECA 4II5A 3MFSA 3LXPA 2GFSA 4OBQA 2GU8A 3PE1A 2PU8A 2RFDA 3IGOA 5HOAA 4BDGA 3GBZA 3IO7A 3MB7A 1R3CA 2HZIA 3BV3A 1K3AA 3Q4UA 3QU0A 4MWHA 4QQTA 5B2MA 5JGBA 4AFJA 2OZOA 3RWPA 3ZEPA 5AADA 3LM0A 2CCIA 2R7IA 1OL2A 2WMAA 3UE4A 3M42A 3HMPA 3NW6A 4D2PA 3H0YA 2C6MA 2BHEA 2C6DA 2PVKA 4PL4A 5BVEA 1YOLA 2IVTA 2OF4A 3LCTA 4GYGA 1Y91A 1YW2A 5K4JA 2WNTA 2V5QA 4TXCA 3TNQB 3DBFA 1U54B 2XKEA 3ETAA 3H4JA 1ZMUA 3IGGA 4D4VA 5IQGA 4QNYA 1ZYJA 2GQGA 1YI6A 4DG2E 3FE3A 3DBDA 3Q4CA 2G9XA 1M14A 2R5TA 4OTIA 1E9HA 3SA0A 1IAHA 3AMAA 3AC5A 3HV3A 4WA9A 4G9RA 2R3RA 3MVJA 4FKJA 4ZXTA 3V5WA 5ICPA 4FTNA 3W55A 2HZ0A 2O8YA 4HGTA 5DNRA 1JOWB 4OTPA 3I4BA 4ACGA 5FXQA 2VRXA 3ZM9A 3E92A 4YLLA 5A54A 5LCKA 5A4CA 5J9ZA 4JDJA 5L4QA 3KXHA 3O23A 3QD3A 5CQWA 2CGWA 3PY1A 3WI6A 3UIXA 2GNIA 3P86A 4OT5A 5CF5A 3TM0A 4Z7GA 5JKGA 5JFVA 2NRYA 3VHEA 2V22A 2Y0AA 4RG0A 2YA9A 4ANOA 4BHNA 5M4UA 2JIUA 3A8XA 3QGYA 4U79A 3CGFA 4CZTA 4JAIA 3T3VA 4DC2A 5JFWA 3NYOA 4GSBA 3ZUUA 1H1PA 1OKVA 4FV7A 5T3QA 4O0RA 3ZC6A 2C6OA 3QQFA 2IVSA 4M97A 5E1SA 3Q53A 1KWPA 4FICA 2EVAA 4G9CA 4BDDA 3R9OA 4O91A 4ALUA 4OTQA 4GFMA 4ITJA 5EG3A 3SHEA 2XP2A 4UMTA 3WF9A 1MRUA 3BYVA 3AD5A 4BCPA 1ZOGA 1PHKA 4UN0C 3UOJA 1BI7A 2WTWA 4CFXA 3MJ1A 3K2LA 1VYZA 1XJDA 4A7CA 4FVRA 3PWYA 1ZMVA 3RKBA 3RNIA 2A27A 4EOPA 1CTPE 2OIBA 1ZYSA 2ZV9A 3R22A 2RL5A 1YQJA 2UW4A 5LVLA 3RPRA 4B8MA 4DFLA 2RG6A 4CVAA 1U59A 4M12A 4JAJA 4E6CA 3R21A 3IK3A 4HCTA 5HTIA 3NEWA 1FGKA 2P33A 3UZRA 3ZDUA 4TYEA 4B4LA 4BCFA 1URWA 4FTMA 2C47A 4EH2A 3BGZA 3QGWA 4V05A 2I7QA 1SZMA 4BCJA 2WQOA 5C27A 5L8JA 4UBAA 3FI4A 4DG3E 2WTVA 3TKUA 4BCNA 2UZUE 3UP7A 3UZTA 4FTRA 4IQ6A 3BE9A 4DN5A 4OTHA 3Q3BA 4XG6A 2XK4A 4F63A 4L43A 4YURA 1UU9A 4F64A 1FPUA 2B9FA 4O0TA 2Z7LA 3PRFA 3DK3A 1W0XC 4RJ5A 1GZNA 3ULZA 1J7IA 3S95A 2CCHA 5CEPA 5LWNA 3LLAA 3IECA 2GFCA 4A9SA 3KREA 2J9MA 3P7BA 4CYJA 2IW6A 1AGWA 4YTIA 4BYIA 2WQEA 2C5OA 2WMQA 4WG3A 4UMQA 5EDPA 5FBNC 3RVGA 3DJ6A 3V6SA 1WBWA 4BGQA 2WTIA 4LMNA 2J5FA 3PXZA 4Q5HA 3AC3A 3OEZA 4FIIA 2GS2A 4HVIA 1Y6BA 3LW0A 5AIRA 4R3CA 2XNPA 1Q4LA 4R3PA 4JG6A 5KMJA 3W32A 3GOKA 4DFUA 4W8DA 2OH0E 1DAYA 3IKAA 5I9YA 4F7LA 3AT4A 4MD9E 5J7BA 2UZVA 3DQWA 4ZY4A 2OICA 3H0ZA 4BDBA 4IHPA 3E63A 1PXPA 4U3ZA 4NKSA 5KMNA 3N4UA 3OBGA 3Q6WA 4FSUA 4QP1A 5I9UA 1KE5A 5CYIA 3THBA 3W8LA 4F09A 3RAHA 3FZOA 3UNJA 4NM0A 2F9GA 2HWPA 4ALWA 4FV0A 3BLQA 3S0OA 4DH5A 1S9JA 2XK6A 2OK1A 3BGQA 2UW9A 4I6FA 4ZLOA 3K5UA 5HI2A 2IVVA 4CCBA 4F99A 5F1ZA 4R8QA 3BQCA 1XHAA 2C3JA 4RX8A 5IISA 4I0SA 1XH8A 3TTIA 3SXFA 2NP8A 3SXRA 4D2SA 4RRVA 4UYNA 1YWRA 3TZMA 4E73A 3QRKA 4FG7A 1REJA 2XJ0A 3L9MA 4HGSA 5HG9A 5AP0A 4K6ZA 5DR6A 1LP4A 3P7AA 4I24A 2C6LA 4EKLA 3PY0A 3VQHA 3TUDA 3V5QA 4I4FA 3VBTA 2XM8A 4D58A 4CQEA 4MXOA 4FSYA 4J52A 4YJRA 2Y7JA 4TYGA 4YJNA 2ZOQA 3DCVA 5J95A 2BZIB 4L01A 4FOCA 5AAGA 1QPDA 3QYZA 4J8MA 3COMA 3Q9WA 4AT3A 2VGOA 3BU3A 1YDTE 3R8MA 3PFQA 4AW0A 4DGOA 4UEUA 3NDMA 4CKRA 4AZVA 1XWSA 2Z7QA 4M66A 3WZJA 4A4LA 1QPCA 4AAAA 3ORNA 4D28A 3HRBA 4IJPA 5E8SA 3OBJA 1OUYA 1UKHA 4H3BA 2VWZA 2XNNA 4HNIA 4A9RA 2ZDTA 2QCSA 4RJ3A 3ZYAA 4DEHA 3N4TA 3DXQA 5A6OA 3LFEA 4FT0A 5IEVA 2WHBA 4M0YA 4EZ3A 3RMFA 5TO8A 3TXOA 1J7LA 3BIZA 3DJ7A 3QYWA 3W2PA 4QQCA 4FE2A 5GZAA 1YI4A 2YLEA 3S2PA 2X6EA 2A19B 2PSQA 1ZYCA 4EORA 3FLWA 4OR5A 3ZZWA 1JSUA 4EH6A 4BY9E 2OJGA 1IA8A 2W06A 5AV1A 2A1AB 3IW4A 5AM6A 1NY3A 3BGPA 5M07A 1E1VA 5HEZA 3U6JA 2W5BA 3SW7A 3VVHA 5D9HA 4X3JA 4DAWA 4TYJA 3ZC5A 5AUTA 2O64A 3PSDA 3QL8A 3TNPC 4EUUA 3R1QA 3L9PA 5F94A 4A07A 1VJYA 3I5NA 4WSYA 5LWMA 2PYWA 3EIDA 3QA0A 1G8AA 2Y9QA 1OIUA
chains in the Genus database with same CATH superfamily
3U9CA 4B6LA 4FKLA 3WE4A 4FVPA 3MVHA 5FP5A 3EHAA 3HA6A 4CTCA 4UB7A 2XKFA 1RDQE 3LPBA 4NFNA 2C5YA 5FBOA 2ZM4A 4RX9A 1GJOA 1H25A 1AD5A 3R1NA 4HPUE 4RC3A 4DTBA 5I3RA 3GGFA 3AGMA 3QD4A 4GU9A 4YHJA 5FLFA 4QYGA 3CGOA 5AWMA 2XANA 4H3PA 2C6EA 4GVAA 4NT4A 4F6SA 4S32A 1WZYA 2HW6A 3KU2A 3Q9XA 4TNBA 4FT9A 5HE0A 3BHTA 2IW8A 1PXOA 1Q62A 4X2KA 4UMUA 5CSPA 3FYJX 1SNXA 3RAIA 4G6OA 1OKZA 4YSJA 5A3XA 2AUHA 5TR6A 1K2PA 4DHIB 3AOXA 3F2NA 3VRZA 2H34A 5KUPA 5I4NA 4C8BA 2CKOA 5IA4A 3UJGA 1IR3A 5DBXA 3MWUA 2Z60A 3IG7A 3QQKA 2X81A 3MH0A 3ORKA 3BKBA 3ZFYA 2PPQA 2VO6A 3DKFA 3O8TA 4PMMA 3FL4A 3OCGA 3GU5A 2GQRA 3NUSA 2WQBA 3KF7A 4FEWA 1H07A 3ALNA 4E7WA 4H05A 5C03A 2J90A 3KXZA 3T9IA 5CNNA 3UC4A 4D9UA 4HOKA 3JS2A 2WEIA 3C7QA 4QMVA 3I7CA 3NAYA 3OCBA 2NNWB 3S1HA 4I5HA 4F78A 4L7FA 1VLRA 2F7ZE 4PDYA 2ZYBA 2BILB 3PIZA 2WAJA 3PZHA 1OL7A 4YZDA 4MXXA 2FSLX 5JH6A 5C8MA 3R2YA 2OWBA 2PMLX 3GU7A 4Z9LA 3BHYA 1DAWA 4Y46A 3ZFMA 4EH3A 4I0RA 2CSNA 4QYYA 3EN6A 5E8WA 4XG8A 4DEAA 4AA0A 3NFFB 3R04A 3FMMA 3ZBFA 3KXMA 5JQ5A 1WBOA 3RAWA 5IG1A 4I5MA 1FBNA 4GKHA 2GHGA 2CMWA 4RIOA 5GJFA 3WILA 5TOZA 2Q0NA 3W2QA 5CASA 5HLNA 5GJDA 5I9VA 1Q3DA 4HYUA 4O0WA 4KKEA 3RP9A 2F7EE 3SG9A 1IASA 4PP9A 4FZ6A 3QKMA 2W4KA 3DOGA 4JXFA 2OGVA 4FUYA 3LKMA 3F7ZA 4EK4A 4G5PA 5CENA 3EQCA 4L44A 5E1EA 1WAKA 5CY3A 3A4OX 4WT6A 4KIOA 3W2RA 4HPTE 1M2RA 4HYSA 4IAYA 5EM7A 5HO7A 4ZSLA 4PNKA 2Y8OA 3QTZA 3ZUTA 3CD8A 3QALE 4E5BA 1IAJA 4AXDA 4S34A 4K33A 2OF2A 3FXWA 5E90A 2XK7A 3Q04A 4I21A 3MPTA 3D5VA 4NM3A 1XBCA 1ZLTA 3QBNA 5G1XA 4JR7A 2W9FB 3WF6A 1XMMA 2GMXA 2JKOA 3V8TA 2AEGA 4C02A 3RJCA 1YXTA 4RVMA 5K5XA 4TYHB 4LM5A 3CIKA 4DF3A 4C59A 4C62A 4G6LA 3I7BA 2XALA 4ZMEA 1GZ8A 2J6MA 4ZTNA 5ETFA 2WMRA 1SMHA 4BBMA 4XX9A 5K0XA 3NWWA 5BUIA 1W83A 5M06A 2BPMA 3NNVA 2ZMCA 5EM6A 1ZRZA 3EFKA 3AQVA 2ITYA 5H8EA 4BCQA 4U97A 1P14A 1XO2B 1JKKA 3PPJA 5EM8A 4BDCA 4F9AA 4UYAA 2XEZA 4FV6A 2W4OA 4N6ZA 3RPSA 3WZUA 3NVKI 2BROA 3FMDA 1H0VA 1CDKA 1PKDA 2F57A 2XVDA 2B4SB 3W0NA 3SAYA 2F7XE 5FXSA 1PJKA 1PXMA 4RA5A 4FOBA 3HZTA 3CCNA 2EU9A 4BI2A 1GY3A 1BMKA 2F4JA 2BRMA 3C4FA 2PZYA 4EOMA 3NX8A 2Y4IC 2ITQA 4E5WA 1Y57A 3BLRA 4M8TA 2QLQA 3UZPA 4K0YA 1WVWA 2GTNA 2OFUA 5IMXA 3EMGA 4MXCA 3GCVA 4D2WA 4O7RA 3AG9A 3AT3A 4KRDA 5DIAA 2OJIA 1XH6A 2PZ5A 3R9NA 3QKLA 3C4CA 4C4EA 2BVAA 2O0UA 3T9TA 4DEIA 4QRCA 2XBJA 3GEQA 3RHKA 4QQJA 4FKPA 4BN1A 3OY1A 4PTGA 5C4KA 1YDSE 4IX6A 1DI9A 4FKUA 4TY1A 5ANGA 1YHSA 2X0GA 2JKQA 2WQMA 3RALA 2VTPA 4RWKA 5JSMA 4YTFA 2F2CB 5AFVA 4MWIA 1PYEA 1RE8A 4MF0A 1H1WA 4DEGA 4RLLA 2BDFA 1KV1A 2W1EA 4GKIA 4BWPA 4KNBA 4QP7A 4FEQA 2F49A 4HVSA 3A99A 2H96A 2ACXA 2G2HA 3R9HA 4G3DA 4F1MA 5BUJA 3EQHA 4YBJA 5ACKA 1BKXA 4JDIA 5M55A 3II5A 4FKTA 1FOTA 3MH1A 4APCA 3BYUA 5F20A 5AUYA 2W1ZA 1OI9A 3HEGA 3P7CA 4FIJA 4R5YA 4PDSA 4NCTC 1O6KA 3VNTA 3CSVA 4A9UA 5DYJA 3HECA 1UV5A 5EKNA 4RBLA 3VUKA 4RQVA 1PKGA 5K4IA 2HZ4A 3KGAA 4YJOA 4U9AA 3PSCA 4QP8A 3F3WA 3DBEA 3ENHA 3P0MA 4CFFA 2X2MA 5D7AA 4ZK5A 3FHRA 2EXMA 3EQBA 4IWOA 4XP3A 4BB4A 3LVPA 2GQSA 4FI1A 1BUHA 1APME 5CVFA 3I6UA 4L8MA 1U5RA 4BI1A 4QMOA 2W9ZB 5EI8A 5T68A 3GC0A 1JLUE 1JSVA 3ZXZA 4L42A 1R0PA 4LOQA 5CSWA 4LOOA 4YP8A 3QQHA 3QZHA 4B9DA 3EKNA 1ZY5A 5FWKK 2QG7A 1OGYA 3E93A 2X0OA 4ZJIA 5CZHA 3VJNA 3U6HA 2JDRA 3A61A 4L52A 4AUAA 3MN3A 2UV2A 3OCSA 4OBOA 3PIXA 4PPCA 4BCGA 3F3TA 5HIDA 5HD4A 2QD9A 3MVMA 1U46A 4ASXA 4KBAA 4MAOA 1PXLA 4FKVA 4FIHA 4QTCA 3VN9A 3V04A 2WTKC 2XEYA 4EZ7A 4JIKA 4JX7A 4RJ6A 1WBTA 4BJJB 4LG4A 3RINA 4IB0A 2XIXA 3A4PA 5DT0A 1WBPA 2C1BA 3CQWA 4L3PA 4C4JA 5AP1A 2RFEA 4BCHA 1GOLA 4AG8A 3IS5A 2O5KA 1O9UA 5ETAA 4FNYA 3DA6A 4I0TA 4IAIA 4EKKA 4MTAA 5DHJA 3MY1A 5JZJA 3ZCLA 4CMOA 2PHKA 1M7QA 3Q5ZA 3PP0A 5CQUA 5K9IA 2GCDA 3R6XA 2PULA 2XRUA 3BBWA 1Y8YA 5D41A 3A8WA 4F1OA 4ZEGA 3S4QA 2AYPA 3ZLWA 4MKCA 4TRLA 3ZUVA 4YNOA 4PP7A 3AC2A 4FBXA 4WIHA 2BUJA 4WNPA 5LJJA 4M67A 1ZYLA 2WMTA 4JQ8A 2ITWA 3HGKA 3ORXA 1BL6A 3OUKA 4F08A 3OCTA 4YC3A 3ERKA 3Q6UA 1T46A 3R7VA 4FTJA 5AJQA 4U6RA 3ZFXA 2PUNA 3KXXA 2X6DA 3OOGA 5DLSA 1F5QA 3DT1A 2QVSE 4ONAA 5DOSA 5CAQA 2GNJA 1DS5A 5M4FA 5IUGA 2HXQA 4IWPA 2B9JA 3Q96A 4OBPA 2XKDA 4EZ5A 3OWLA 4JI9A 4FSWA 1UNGA 4RX7A 2JIVA 3NIEA 1I44A 1PMNA 3FSKA 2XMYA 4RMZA 3L8PA 1L8TA 2OXDA 2RFNA 3AD6A 4JIAA 4RPVA 3I5ZA 4GEOA 4PMTA 4EH8A 5C8KA 1U4DA 4I3ZA 3TNIA 3WIKA 1EH4A 4JDKA 2DUVA 3P08A 3RM6A 5CWZA 4NYEA 5B7VA 5HBHA 3FMHA 4BBEA 2JFLA 2W5HA 2OIQA 2GHMA 3V8SA 4L53A 4CT1A 4P4CA 4O81A 2BAQA 5TT7A 3QXOA 4V0GA 5KBQA 3QCQA 3CC6A 3OWKA 5E4HA 3WF8A 5AR4A 2XRWA 3DBQA 4L6QA 3NIZA 5DR2A 3ET7A 3MH3A 3Q2MA 5A4EA 4OW8A 1P4FA 4IZAA 1GIJA 3FMKA 3D5UA 2YIWA 4FIGA 2O3PA 3COHA 1IA9A 2HK5A 2I0YA 4JRNA 4FV9A 1JNKA 5I5ZA 5FXRA 2BFYA 4RVLA 4S31A 5HGIA 1NVRA 4PQNA 2OO8X 4UALA 4O7WA 2ZM1A 1H8FA 3FI2A 2VV9A 4U40A 2FYSA 5CS6A 4CRLA 3DAKA 3DU8A 4J53A 3UPXA 1BX6A 3AC4A 5HX6A 4D0WA 5C26A 4FKRA 4ZZOA 2GNFA 2BHHA 2OSCA 3NYNA 4X6RA 1WVYA 4FUXA 2WTDA 4XNEA 3FZ1A 1ND4A 2VAGA 4FC0A 5CI6A 4QO9A 3QTWA 4O1PA 5AR8A 3DFCB 3MFRA 4QPAA 4IANA 3KXGA 3L1SA 1W8CA 3PPZA 4QD6A 3CEKA 4DE4A 1HOWA 4QMNA 2XKCA 4L68A 3E64A 2VWIA 4GW8A 4Y8DA 2B0QA 3MVLA 2FA2A 4U8ZA 4O2PA 3QF9A 5ANOA 2BIKB 4FJVA 2OFVA 3RZBA 3VBVA 4KAOA 3WZDA 3ATSA 4BZDA 4RSSA 4O4EA 3ODZX 4IAKA 4M14A 4RWJA 4C35A 3AKKA 4GYIA 4DFYA 3UC3A 3V01A 3E87A 3GCPA 1PMUA 2UW0A 2VTAA 4NM5A 4LL0A 4XMOA 4L46A 1ZY4A 4S33A 3GP0A 4DDGA 1E1XA 1UNLA 2C3LA 2C0TA 4HNFA 3VUMA 5JFXA 3LMIA 3HAMA 1BLXA 3OY3A 4O0YA 5CANA 2RFSA 4AS0A 3F3ZA 3U4UA 1DI8A 2BTSA 1FVVA 3F82A 1QPJA 4GVJA 3VS7A 3KF4A 1V1KA 3KK8A 1G3NA 3D94A 3K54A 4IE9A 5EOLA 3KY2A 3P5JC 2OW3A 3MSSA 4HYIA 2HY81 1A9UA 2H8HA 4FEXA 4AA4A 4Y83A 4V0GB 4YNEA 4DBXA 4FMQA 2B1PA 4LYNA 3RI1A 4IZYA 4I93A 3LMGA 3QA8A 3RHXA 3ZO3A 4MD8E 1YXVA 3LE6A 3UPZA 3LZBA 3OMVA 3MBLA 3LFCA 5E8VA 4GT3A 1Y8GA 3D5XA 3HNGA 4U41A 2VTRA 2IW9A 3VS2A 3AMYA 4U5JA 3DTWA 5LXMA 3FY0A 2VWUA 2ITNA 4EONA 3BLHA 2IZUA 4TWOA 4MBIA 3UG2A 4FNWA 2YAAA 5KKRC 3LFNA 3F3UA 5FEDA 4UWCA 3MPMA 5AAFA 3WARA 5FRIA 2Q83A 2R3KA 2WIPA 3MYGA 4XYFA 3Q9YA 4ZTHA 4NCTA 1TQMA 2CLXA 1OVEA 3NUYA 4TWPA 5HO6A 4BCMA 5HQ0A 5IA2A 5IQFA 2VWYA 3KN6A 1JWHA 4BGGA 5CF6A 1JKTA 5HIEA 2I0VA 4U45A 5IQIA 4K2RA 2ITXA 4YJPA 2QHMA 4FL1A 4E1ZA 1OPKA 5J1VA 3OROA 4JG8A 2W7XA 3FMEA 3BLAA 4NUSA 3O7LB 4G6NA 4I20A 3QRTA 3OUNB 4FTUA 4FIFA 5CEMA 5HCYA 4DG0E 3ZLSA 2O2UA 2YM8A 3EFWA 5LARA 3WF7A 4A9TA 3LFAA 3C5IA 2DQ7X 2WXVA 2UZDA 3EN7A 2RSVA 1YXUA 5EW9A 2P2IA 3TUCA 1H1RA 2ZDUA 3GCQA 3NFGB 3QZGA 4YZBA 1OZ1A 3ZO1A 3GOPA 4FTTA 3R71A 3D7TA 4DLIA 4B7TA 3TUBA 4U42A 4D0XA 5BVDA 3OP5A 5DRBA 3MS9A 5BYZA 5AV4A 5FTGA 4L3JA 2VNWA 3C0GA 3NMUF 1SNUA 4D5KA 3HRFA 3GFWA 4U80A 5A6NA 4FT3A 3QUPA 4DHFA 2Y4IB 4E6AA 4O7TA 2VTOA 4EK3A 3BEAA 2R3NA 3D5WA 2ZVAA 3FQSA 3E62A 3ANRA 3PTGA 3EQRA 4M13A 4MEDA 4W4VA 4FGBA 3TJDA 4ZLZA 3S00A 5CEQA 4RWLA 4HVDA 3PXYA 4FSZA 3MIYA 2G15A 4MXAA 4A06A 1TFFA 1R0EA 3JVSA 4IM0A 5EYCA 4HGEA 2QOBA 3VWAA 5L8KA 2J0LA 5KMLA 3DZQA 5A14A 2I40A 4O22A 4D1XA 1Q24A 2ITTA 3EQIA 1YI3A 2R3FA 3IQ7A 3RK7A 3SOCA 4AGUA 5HU3A 1SVHA 3LQ5A 4TWCA 3DB8A 1B38A 5L6PA 1ERKA 1KOBA 4LRJA 4I5CA 1Q8ZA 3GC8A 1ZAOA 5D12A 4BBFA 3IOKA 3FC2A 1GZOA 4YLJA 3R8UA 2PVNA 2YACA 4FA2A 4FNXA 3R1YA 1MQ4A 2WKMA 2PMNX 2Z8CA 1OIRA 3L9NA 5CAUA 2JGZA 2NPQA 3V5LA 3UDTA 2XAOA 5HVKA 4UXQA 2R0IA 4C38A 1UA2A 2VO7A 3G33A 3OTVA 4GH2A 5HKMA 2JLDA 3BL7A 4MQ1A 2W1IA 4BCOA 4G3CA 4LI5A 2QKWB 2UVYA 3SC1A 4HCUA 3OHTA 2G2FA 3DXNA 2PVHA 3FQEA 4OAVB 2JKMA 3BELA 3D7ZA 4ANQA 4F70A 3FZSA 3GU6A 5ANKA 2W17A 4MNFA 4AN9A 1ZZLA 3VIDA 4FG9A 2XH5A 4GU6A 2XNMA 3O96A 3MY5A 3MI9A 2KTYA 4L9IA 4YJVA 5AV0A 5AX9A 2VD5A 5IZFA 3FI3A 4YC8A 4CYIA 4J98A 3QRUA 3LAUA 4IM2A 4QNAA 4RZVA 4U44A 4USEA 3QTIA 4AXEA 5AV3A 5EI6A 1Q41A 4C4GA 2H6DA 4WNMA 2LGCA 2XYNA 1UWJA 3LQ8A 4FX3A 3PA5A 5ANIA 3VQUA 4ERWA 4QTEA 3D7TB 5I9ZA 4O7ZA 5KCVA 2EXCX 4QP3A 4I4EA 3A60A 5EDQA 4O82A 3U54A 5HCZA 4MXZA 4UWBA 3FMLA 4W9WA 4AW5A 1J91A 4F7JA 5DRDA 2WTKB 3Q60A 4QPSA 4FL3A 1H1SA 1CM8A 4CMUA 1W2FA 4HVHA 2VX0A 3DQXA 4X7QA 1A06A 2W96B 5FD2A 1XKKA 3R30A 1OKYA 2A2AA 3U6IA 4FGRA 2ZV8A 3R7OA 3CTJA 2VX3A 4ANNA 2ERKA 2CGVA 1JPAA 5M4CA 3NUUA 4BZOA 3FI8A 3Q32A 4NEUA 4AN3A 2XNOA 5I0BA 1ZARA 5CXHA 3RK9A 5LVMA 1NT2A 3E7VA 4C33A 3AC1A 2O63A 4DITA 4PX6A 5TF9A 3QQGA 3W18A 4LRKA 4CLIA 3FBVA 5BNJA 3FLQA 1G8JA 3EOCA 4O7VA 4KIQA 2XJ1A 2YABA 3F88A 3PXKA 5CU3A 5JZNA 5HG7A 4ANBA 4USFA 3PUFC 4F0FA 3W10A 4BF2A 1YDRE 1KSWA 1NA7A 2NO3A 5ACBC 4D1SA 1B6CB 3K5VA 4JL9A 5HG8A 4R1YA 3ZSHA 4ZTSA 1QL6A 3G9LX 5IH6A 4X3FA 5HICA 4R3RA 3SKCA 3TYKA 4JBQA 5E91A 3R7IA 4CXAA 2PUPA 2PVLA 5CU2A 1PXKA 4O0VA 5BVKA 4APPA 2BRHA 3DK7A 3PG1A 4OTFA 4DYMA 2CGXA 3KC3A 4P7EA 4D4SA 2H9VA 2PY3A 1FGIA 4G31A 4O7LA 3VF9A 2B54A 4XH6A 4IAZA 2FB8A 5EDRA 3W2OA 5L3AA 1ZZ2A 2C5VA 3DAJA 3LXLA 4KWPA 4O6LA 4EC8A 5HTBA 3LCSA 5EHLA 4FSTA 5FDXA 4QMQA 4NZWB 1H24A 1JQHA 4MCVA 2YEXA 4KRCA 4RGJA 2JAVA 4BFMA 4FEVA 3G6HA 3F5UA 4AE9A 3QXPA 4NIFA 2BAJA 4P5ZA 3R8ZA 3QD0A 4MVFA 3F5XA 2X0QA 3T8OA 4FEUA 5EHOA 2YM4A 3QC4A 1XH7A 2QOKA 3IW6A 5EKOA 5BPYA 4GT5A 1W2CA 5AP4A 4JRVA 4CCUA 4CG8A 5HNGA 2YITA 4OGRA 2B53A 3ZMMA 3FKOA 1YKRA 2HCKA 3AD4A 3NYVA 4RIWA 5IA5A 5BVFA 4FODA 5CU0A 3W0MA 3VUGA 3NUAA 4G3EA 3GXLA 3BBTB 5EW8A 4WG4A 4AA5A 2ONLC 4IEBA 4IW0A 3MPAA 3UODA 3QUDA 4KUJA 2XJ2A 4BHZA 4E26A 3R8VA 2DS1A 1KUTA 5FM3A 4PV0A 3C4ZA 3R1SA 4AF3A 2HELA 4DGNA 5J5TA 2P0CA 3SOAA 1H26A 3DKOA 5IDNA 4IDVA 1M2PA 4IVBA 1Q5KA 3VBYA 5M57A 3L8XA 2WEVA 3TIYA 3PP1A 5KHXA 1BL7A 3DNDA 2EB3A 3CTQA 1M7NA 4BRXA 4EBVA 4GK4A 5EQPA 1R1WA 2XA4A 5KMOA 4D2RA 5DI1A 4EWQA 2W5AA 3QC9A 4B0GA 4B8LA 1CKIA 4MQ2A 5DWRA 2VUWA 3AGLA 1H27A 3P78A 4HZRA 3EH9A 4J97A 2XARA 4X3FB 4QOXA 3UNZA 4DA5A 2JD5A 4BIDA 2GNHA 2OJ9A 3MV5A 4GJ3A 3ROYA 4DGLC 2E9VA 2YERA 4W8EA 5CEOA 1KE6A 3I60A 5AR3A 4EK5A 4FTLA 3B2WA 3EN9A 4NU1A 3OOMA 4EHGA 5AAEA 4MBJA 4RT7A 3KL8A 3LFBA 4Y95A 3NCZA 2V55A 3T3UA 3CKXA 3R28A 4C36A 2QURA 2BR1A 3EQFA 3FY2A 4Q2AA 5M53A 3IOPA 1OL6A 1OITA 1H01A 3RPOA 4I6QA 5AV2A 5M44A 4UX9A 4O7YA 4XBUA 4O96A 2BKZA 1TQPA 4N57A 4CV9A 4BCIA 3M11A 3SDJA 4FRFA 1FINA 3CJGA 4NIFB 1PMEA 1WBNA 5AR7A 3O71A 5G6VA 2DYLA 3OEFX 2J0MB 1CKPA 1TKIA 2C3KA 5J7HA 2CHLA 4ENYA 3SG8A 3ORMA 2FUMA 4BTKA 3CY3A 3BWFA 4FKQA 2WGJA 3MB6A 3JVRA 4RIWB 1MRVA 1OL1A 3BYOA 5L2WA 4QMUA 3OXIA 3O51A 3ZO2A 4XRLA 3VUIA 4S30A 1OB3A 3MFUA 3OD6X 4XCUA 3WE8A 5KKRB 2NRUA 3OFMA 4WBBB 4MF1A 4TW9A 4PDPA 3U9NA 3LCKA 1YOMA 4KD1A 2VO3A 3P1AA 3UQCA 3CQUA 3CE3A 4FF8A 2OU7A 4O4FA 2OG8A 3U8WA 5EFQA 2WMXA 4P2KA 4UZHA 1XH9A 3M2WA 5AP7A 2XB7A 3COIA 3FZTA 3E8EA 4JQ7A 4J96A 5AR2A 5L2QA 4BDJA 2X2KA 2X9FA 2VTMA 4CFVA 4CNHA 4BDFA 4YZMA 5LVPA 3W0RA 3GFEA 1NXKA 3CPBA 3QHWA 3KVWA 4G5JA 5AX3A 4TYIA 4ANSA 5JN2A 1PRYA 3V6RA 4USDA 4CGAA 4OTGA 3OXZA 1LR4A 1M2QA 4FT5A 3V51A 3VUDA 5CF8A 3I0QA 4KBCA 4EBWA 3VUTA 4WNOA 2X8EA 5E9EA 5IQEA 4TKSA 3W1FA 4EOOA 3DS6A 1KE8A 2OZAA 2UZBA 2X0PA 3HMNA 2PK9A 5EK7A 4PPAA 3OZ6A 3SV0A 4UMPA 1ZOHA 2GTMA 3W0PA 4AZTA 1O6YA 2HWOA 2W05A 4X0MA 2CKPA 2HIWA 3HV6A 3FPMA 3QD2B 2QLUA 4EQUA 4ZP5A 3HMIA 3O5AA 2WB8A 2A4LA 2GDOA 4FK3A 4RIXA 3W16A 4EK6A 2JC6A 5C4LA 4JS8A 3P23A 3FLYA 5KX8A 3G6GA 4E6QA 4E4LA 4HGLA 2P3GX 4UY9A 3POZA 2BKKA 4LMUA 2QONA 5AMNA 2HXLA 3FL5A 5E8ZA 5LMKC 2R64A 3ACKA 1OPJA 2BFXA 4H3QA 3VW6A 2REIA 3UIBA 1W2DA 5A46A 5BX0A 4KABA 3NS9A 3O7LD 4AE6A 4KS8A 3JY9A 2F2UA 4IAFA 5F9EA 3TKHA 5KO1A 3HVCA 3H9RA 3KMWA 4CQGA 4ORKA 2JDSA 4PNIA 2IEWA 5AUUA 5CAVA 3HP5A 2IN6A 3OS3A 3GC7A 1H28A 3OVVA 3P5KA 3PG3A 5BMMA 4DFNA 2YAKA 4NL0A 4PMPA 4ZIMA 3TT0A 2QOOA 2XNGA 2C6TA 2WZJA 1UNHA 2YCFA 4O0UA 1LEWA 3I1AA 3B2TA 2X9EA 4ANLA 3HMMA 4LL5A 2X1NA 1ZMWA 2WELA 1Z57A 2QODA 1CKJA 3KRWA 2XK9A 3RZFA 2OXYA 4ITHA 3ALOA 3GU8A 5CSXA 3VS0A 4CZYB 3C5UA 4F4PA 5EW3A 2YLFA 4LUDA 4XP2A 2CN5A 4E8AA 5LQFA 2C6KA 2UVZA 5HHWA 4E5AX 5AP6A 3SQQA 4ID7A 4ZSGA 2R3JA 3F7WA 2C5XA 4HJOA 3BRBA 3PXFA 4BL1A 2W1DA 3GVUA 1PY5A 2VX1A 3Q5IA 2ITZA 2YM7A 4WD5A 3IDCA 1TQIA 5IDPA 4YZCA 2CJMA 2R2PA 3D2IA 1Q8TA 2CNUA 1R39A 3MH2A 3PVBA 2CGUA 2ZB0A 3BHHA 5HCXA 5H8BA 2OZAB 3RM7A 5LVNA 5CAOA 2YIXA 3TZ7A 2Z7SA 4ZTQA 4C3FA 2XNEA 2CNQA 3KULA 1GAGA 3OF0A 1ATPE 5IEXA 1JBPE 2QR8A 3FMJA 3MJ2A 5E8UA 1H0WA 4RIXB 2BMCA 4GIIA 2QC6A 3JR1A 1Z9XA 3AT2A 4D55A 3PWDA 3FPQA 3KN5A 4QDVA 1PMVA 4X2GA 5IA1A 3CLYA 5J79A 4DCAA 4C58A 4O38A 3QX2A 2UW8A 2ONLA 3LIJA 5FDPA 4P90A 3VF8A 5IUHA 2JITA 4BDHA 5HG5A 3QAME 2XK8A 2WOTA 2HAKA 2Q0BA 4NM7A 3QRIA 3BI6A 3DXPA 3HUBA 4J8NA 4WOVA 5TKDA 4C3RA 3R02A 1Q61A 5L2SA 4ZAUA 4IMYA 3MESA 4YPSA 3QLGA 4YO6A 4AP7A 3E8DA 5ETIA 4EH9A 3SVVA 1WVXA 4WKQA 4MH7A 3DDQA 2X7GA 4CV8A 3K3JA 1YXXA 2BAKA 3BX5A 4BR3A 3KA0A 2YJSA 3FLZA 4G3FA 4ANMA 4CEGA 3MTLA 1VYWA 4N4SA 4W4XA 4ALVA 2FVDA 4D9TA 4O21A 3BCEA 5L2IA 2VN9A 4RLKA 5JFSA 4ZLYA 3W2CA 1Q97A 3EJ1A 2Z7RA 4GK2A 2BRBA 4B99A 4DFZE 4XV1A 3SLSA 4LFIA 3ZM4A 3ZSIA 3SRVA 5AR5A 1L3RE 4DTAA 4QPMA 4D4RA 3GU4A 4G1WA 4KS7A 4DT8A 5DEWA 4X21A 3RBWA 5F95A 3TACA 5JEBA 4I94A 4QMWA 4RC2A 4I92A 3VUHA 5HIBA 1H4LA 3OWJA 5GNKA 1NVSA 3LXNA 1XH4A 4GJ2A 3DBCA 4GUBA 1QMZA 4JG7A 4TWNA 3UIUA 4CFWA 2R4BA 2P2HA 2FH9A 3QCYA 4JVGA 4RWIA 3HV7A 4YLKA 4G16A 3I6WA 3LCOA 3MGYA 3NR9A 3Q2JA 4BIEA 2XIYA 3KMUA 2PZPA 3DDPA 3MTFA 5BQ0A 5DG5A 4O2ZA 4QYFA 4BCKA 2ITVA 3PA3A 5EOBA 5HD7A 3F5GA 4G34A 2BALA 4PRJA 4YTHA 1X8BA 3ZLXA 4DEDA 3G90X 2C69A 3RGFA 4Z16A 5KMMA 5D10A 2E2BA 3A62A 2O65A 5DH3A 4BVUA 2PWLA 3S3IA 2EWAA 4NK9A 3BEGA 4YJUA 3R7EA 4EI4A 2C4GA 2YM3A 5CU6A 5CSHA 3SD0A 3TTJA 3W33A 4BTJA 3R7UA 3FQHA 4C57A 2OXXA 3MY0A 2ETMA 3LQ3A 3PJ3A 4IAAA 2HY0A 5IQAA 2XF0A 3ZRMA 4IB1A 3KB7A 3ORLA 4X2FA 4ZOGA 2UVXA 3F69A 1GZKA 3E88A 4QMMA 4EL9A 3VONA 5BVNA 2R3GA 4KINA 2YCRA 4FVQA 4YJQA 3HP2A 4C3PA 4PTEA 4H1JA 2J0IA 1BYGA 3ZSGA 3TEIA 4YU2A 4RJ4A 4FKOA 4QP2A 2P4IA 5HTCA 3KRRA 5IPJA 5K0KA 4JX3A 4YR8A 4IM3A