5AX9A

Crystal structure of the kinase domain of human traf2 and nck-interacting protein kinase in complex with compund 9
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
282
Chain Sequence
EIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TRAF2 and NCK-interacting protein kinase
publication title TNIK inhibition abrogates colorectal cancer stemness
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 282
sequence length 296
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ax9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ax9A01
1YHWA 5F9EA 3KGAA 4AGUA 2OZAB 4ZTSA 4MWHA 3ZRKA 1FINA 3AC5A 2ZJWA 4IB1A 3CY2A 1O9UA 4JIKA 3VBTA 4PUZA 5JRQA 2PTKA 3UZTA 3BI6A 3BYOA 5CENA 3QZFA 4NJ3A 4O82A 3FY2A 3BU5A 4MD7E 5L4QA 2PVMA 2WMUA 4U42A 5GHVA 2BRHA 2C6OA 2WTIA 3ZH8A 5EW9A 2UW9A 5E8TA 2IJMA 3Q60A 2F7XE 5HLPA 4B8LA 4YNEA 1M17A 5FWKK 5JQ5A 4B8MA 4C57A 3TIYA 4L52A 4BVUA 4M13A 4U9AA 4ZS4A 3PXRA 4GUBA 4YPSA 4RVTA 3RPYA 4PV0A 4U0IA 3UIBA 3W2PA 5CASA 5AP2A 3N4TA 3A7JA 1Y6BA 2IO6A 3G5DA 5FP6A 3GOKA 4ZJIA 4RJ6A 3FQSA 2OIQA 3F69A 4EC8A 5A4TA 2HCKA 3I7BA 3C5UA 3QRTA 1FMOE 3R2BA 5AP3A 1UWJA 4FEVA 4EH7A 2QOCA 3VS0A 3MN3A 4QP2A 2WMRA 2Z2WA 3RAIA 3JUHA 5JFSA 3FQEA 2UZDA 3JYAA 4B7TA 4PPBA 3ZSHA 4FTNA 5L6WL 4ZIMA 4IW0A 4UN0C 2QURA 2BRMA 3BYUA 2A27A 2IW9A 2WKMA 5AR3A 3FXZA 4ANSA 2IZSA 2X4ZA 5E7RA 2JDSA 2WFYA 3L8VA 3QTSA 2C3JA 3S95A 2VWZA 3EQFA 2YWVA 3P08A 4FIFA 4ZTLA 4QOXA 4ACDA 2HIWA 3WF6A 3W8QA 3H9RA 3DDQA 3L9MA 4HVDA 3R6XA 3O8UA 5AJQA 4UXLA 5LARA 4YR8A 3ZUUA 4K9YA 4MQ2A 5JFXA 3VHEA 4FK3A 4FSWA 2WMVA 3KF4A 2PU8A 4G34A 1QL6A 2UZOA 3CY3A 4R3RA 3EFWA 4CG8A 4I6BA 3PIXA 4HPTE 4IC7A 4CEGA 3A7HA 4YO6A 2HXQA 1LR4A 4M69A 4ZS0A 3T8OA 4AF3A 3VUKA 1DAYA 3D83A 3UGCA 3RVGA 3V5JA 5J1WA 4XRJA 2O63A 3FDNA 2C5OA 2QOOA 4K11A 4CV8A 5AWMA 4EOPA 4FG8A 5HU9A 2YLEA 4EOIA 5KBRA 2CNUA 1QCFA 5IA4A 5KNJA 4X0MA 4OTQA 3U55A 2OZAA 2VNWA 5EK7A 4JBQA 3PUPA 3FY0A 4IB0A 5M4FA 5E8VA 1BLXA 1IASA 4MX9A 4B9DA 4BCOA 3RKBA 4C33A 3FI3A 3S0OA 3VBYA 4RLLA 3KXMA 4R7BA 5BVNA 2VTNA 4NH1A 3I5ZA 4KKEA 4WHZA 3UQFA 3HMIA 4GCJA 3D7ZA 4U80A 3KK9A 5KHWA 3IDPA 1OM1A 4IADA 4DFNA 4M8TA 3MIAA 4FV9A 4EI4A 2B4SB 4QNYA 2IWIA 3U87A 3CD3A 2EXCX 3KEXA 4DGOA 2WGJA 1OPKA 5CALA 5FM3A 3Q53A 1APME 2W1CA 3QTXA 4O7WA 3ANRA 3CD8A 4RWLA 5J7HA 4BKZA 3MB6A 1H01A 2RFEA 1XWSA 3FI2A 5IEXA 1KUTA 4DTKA 3FMHA 4F65A 4ZSLA 4U41A 2P3GX 1ZOHA 1XHAA 4KIPA 4MK0A 2XIZA 3KMMA 4RGJA 3PLSA 1Y6AA 4M68A 2OXXA 4FTJA 1CSNA 5AMNA 5KMMA 3NX8A 4FT5A 4DF3A 3QHRA 3EN6A 4Z3VA 4ZLYA 3LIJA 4U79A 4WA9A 3UVRA 4LMUA 1LEZA 4DBXA 4JJRA 2NRUA 2XK3A 1B39A 5HE0A 3ZTXA 4KD1A 4MXOA 3NR9A 5EDRA 1T45A 4UMPA 3PE2A 3PSCA 4AUAA 3FXXA 5IA1A 3ZO3A 4M66A 1I09A 2C5YA 3PWYA 4NCTA 4PL3A 2SRCA 3SLSA 2BUJA 4AW1A 4FUYA 3W8LA 3ZM4A 4BCIA 4C3RA 3HUCA 4EH4A 4ZSEA 3EIDA 3PA3A 3QTIA 4R77A 1Q8WA 4FTLA 5D9HA 3LFNA 3IO7A 5FTOA 5IH4A 3BE9A 2VRXA 4P5QA 1UNGA 2JKMA 5J9LA 3ZO1A 1H07A 2Z7RA 2IZUA 4IX4A 4HJOA 4EH5A 1V1KA 2IVSA 3PXKA 4I41A 3MIYA 2PMOX 3CS9A 3ZS5A 2BCJA 4ANOA 4YBKA 4JAIA 5IQIA 2QU6A 4FL3A 3BLQA 4FEQA 5J87A 3WILA 3H3CA 5TR6A 5CAQA 4G6LA 4I21A 4JRNA 1MQ4A 2C0TA 2R3FA 3F9NA 4X2NA 3DGKA 4XG2A 3NYNA 4F1TA 1F3MC 5EHOA 2REIA 4TYHB 5HBJA 3KRRA 5HLWA 4QPMA 3QKMA 3PVWA 2XNMA 1Q99A 3E8CA 1SVEA 1VEBA 5KMKA 3JPVA 1ERKA 5BYZA 1O6KA 2O64A 3K3JA 1JKTA 3TDVA 2GS7A 5IA2A 3MPTA 4LV5A 2VUWA 3WBLA 4BDGA 5LJJA 3D15A 1Q5KA 4FVPA 1Z5MA 4TY1A 5L2IA 1VYZA 4QRCA 4AT3A 3PXZA 4RQKA 3A7GA 3HAMA 5AAGA 4GVJA 2UW6A 4QMMA 5AEPA 5IH6A 2QOLA 4ZZNA 1IAHA 5A54A 1OPJA 3UYSA 2EWAA 2VAGA 1GIHA 5DLSA 3D7TA 2JEDA 2YM6A 3AQVA 3PVGA 4JBVA 2VWVA 5DRDA 2YIRA 3DLZA 4HNIA 5F20A 3KRJA 4L68A 4RJ5A 4XG9A 4GK4A 3FLWA 4BTJA 1YXVA 3PE1A 4WBOA 5ETFA 2ZVAA 4A9RA 4C4JA 3S00A 3DNDA 3VO3A 4QMXA 5IDNA 3G15A 5FXQA 4OAUC 5EG3A 5EDQA 3NUNA 5ANOA 4YLLA 3G9LX 2RFNA 3V5PA 5ETAA 3LJ1A 4TWPA 3ANQA 4E3CA 4ORKA 4GFMA 5FLFA 4PY1A 3CTJA 1DI9A 1PXIA 2VX1A 4BDEA 4BHZA 3LFDA 5DT0A 2PZIA 3AC4A 4FKRA 5BVFA 3Q5ZA 3NIEA 2HZ0A 3QTUA 2PUIA 4PP7A 4FR4A 4LFIA 1XQZA 1NY3A 2QLQA 4MYGA 4U6RA 3FMNA 1PXKA 3UC4A 1REKA 4I4FA 2I0YA 4G9CA 4LQMA 4FVQA 3L8XA 3HP5A 2UZLA 4QYEA 1U54A 2RKUA 2R64A 4M67A 2BRGA 2O2UA 4BCHA 5AP0A 3D2KA 4XOZA 3H9FA 1J7LA 2XKCA 4GSBA 3DZOA 4IWPA 4OTDA 3RMFA 4EHVA 1PY5A 3OT8A 4NM5A 5AFVA 2BZIB 2IN6A 3JXWA 5L2TA 3NYXA 2LAVA 2VV9A 3KY2A 4H3BA 4R3CA 4EK8A 1UU9A 2WB8A 4LL5A 4PNIA 4FX3A 4ONAA 1YDRE 2DYLA 5IZFA 2EUFB 3ALNA 4HYSA 4AZWA 5AV4A 2UW0A 5LQFA 2FGIA 2E2BA 2H9VA 5HD4A 3NUAA 5KMJA 4TYHA 1HOWA 3EN7A 5KMLA 3LCTA 3BBTB 4GK3A 2OLCA 5ACKA 3UVPA 3FHRA 4Z7GA 3P4KA 5M08A 3MBLA 2I1MA 2VTQA 4YC6A 3P5KA 4FSMA 4FVRA 4EUUA 2CN5A 4HGTA 3TKUA 4O81A 3AMYA 3MVLA 2WTJA 5CI7A 5L8KA 3C4XA 3FKOA 1OUYA 2C6EA 2YEXA 3QXPA 3Q5IA 4WKQA 3IW7A 3F5GA 1NW1A 5HG9A 2PZPA 2YLFA 3LLTA 4OR5A 3RM6A 2YERA 5HO7A 1Y8YA 2CMWA 2PE2A 3MB7A 4CT1A 2CCHA 1K3AA 4AZEA 2E9OA 4O91A 4TWNA 2GFCA 4ZEGA 3OWKA 3AT2A 4NL0A 2X9FA 4YZDA 3WF8A 4FV4A 4AOIA 4OTWA 1CMKE 3QC4A 4CYJA 3BHTA 4UB7A 4C3FA 5CEKA 5IDPA 5C27A 4HGSA 5HE1A 5IQEA 2J6MA 4FIHA 3DZQA 4QMNA 3C0GA 4FGRA 4R1VA 3QRIA 5HE3A 5CXZA 5K5NA 4BCFA 1O6LA 3NNUA 4UBAA 2F57A 4LGDA 2OIDA 4WNKA 3LOKA 5EYCA 5KMNA 2B9FA 2UW5A 3MSSA 4GMYA 3GVUA 4IMYA 2JFLA 3BELA 4GIIA 4XOYA 2J90A 5H9BA 3UYTA 5CF5A 2W1GA 3E8DA 5LVNA 4J8NA 4L53A 2WD1A 3GQLA 5GIPE 5ICPA 3R83A 1IA8A 4RVKA 3TNWA 5ETIA 2BILB 2OJFE 3QCYA 4WT6A 3GC0A 3ORXA 3QKKA 4DC2A 2XVDA 4GEOA 5GZ9A 4FZDB 3GNIB 4KKGA 5AR7A 4BYIA 2QOQA 3EN5A 3ZLSA 4DHFA 3TM0A 4RIOA 4H1JA 4I6FA 4ZOGA 5EOLA 4KSPA 5B0XA 3RHKA 2WTKB 2GTNA 4BKJA 2R0IA 4KIKB 5D12A 3UQGA 3CPBA 4JG6A 4LRJA 3V51A 4BICA 3COHA 1KE7A 2JBPA 5CAUA 2VTTA 2PYWA 4D0XA 4ZTQA 3LJ2A 4O27B 1ZARA 2Y4IB 5LMBA 3WF7A 3O8PA 5IMEA 3KA0A 4GRBA 3ZXZA 4LYNA 3QHWA 3WYYA 2PMNX 3HV4A 4RVMA 4JNWA 1UU8A 2JKKA 3FZOA 4QNAA 3W55A 5AM6A 4ANMA 4C2WA 4YTCA 5CAOA 1Q61A 2UW8A 5G6VA 4IBMA 3TNIA 4BDDA 4TYEA 3ORTA 3KN6A 4AX8A 5DMZA 4IM2A 4PL4A 5FP5A 3Q4TA 2W1HA 1H28A 3OCTA 3PVBA 2QQ7A 4N6YA 1JSUA 4HCUA 5C03A 3F2RA 1OMWA 2XBJA 3A60A 4FTOA 1E1XA 4PPCA 3ZLWA 4L45A 4C34A 3UMWA 3FZSA 1SZMA 5M53A 3KFAA 3COKA 5AUUA 5BVOA 4EK5A 5CU0A 5EW8A 3V5TA 5E4HA 1ZYLA 4BI2A 3NWWA 5AP7A 2FYSA 5JZJA 4J8MA 4OTFA 5ANKA 4JOAA 4PTEA 2JITA 2OU7A 3OC1A 2DS1A 5TT7A 2BROA 4HZRA 3JY9A 3TT0A 4QMOA 5DT3A 5KO1A 1WCCA 3W1FA 4ASXA 4MQ1A 2FA2A 3LFFA 2PULA 4M84A 2G2FA 4LUEA 4BZNA 3B2TA 1OITA 2X8IA 4EWHA 4EEVA 3ORPA 3BEGA 2RGPA 4F6SA 4G3FA 3CCNA 5EKOA 3WI6A 3PJ1A 4RX5A 3QLFA 3Q9YA 4ZTHA 5IISA 2LGCA 3W32A 3W10A 5CEIA 2GHLA 1UNHA 3GC8A 4QT1A 3G2FA 4HVHA 4QYHA 3ID6C 4RRVA 2FH9A 3QQFA 3D2IA 2Z7SA 4DA5A 1R0PA 4BWKA 1OI9A 3C4CA 4EBWA 2XK9A 4TNDA 1IG1A 4A9TA 4ACGA 2AC3A 3O17A 2OH0E 5D7VA 1FVTA 5AR5A 1BI8A 2HW6A 1YKRA 3O50A 4WIHA 2XYUA 1JAMA 3C4FA 3FHIA 3GP0A 4M0ZA 3CTQA 1OZ1A 2PVRA 4LL0A 4NK9A 5EQYA 1PXJA 5BMSA 4FE2A 4LRMA 3MWUA 3FPQA 4D55A 1YHSA 4QP6A 2WIPA 3DKCA 4ACMA 3FZTA 2XJ2A 4J7BA 4D2VA 4BDFA 1KSWA 3R8UA 2UZVA 4E26A 5IG1A 2UZNA 3QQLA 4U5JA 4F6UA 1H0WA 5FDXA 3G6HA 2FB8A 3UIUA 3KVWA 5BPYA 2I40A 2A2AA 4DFZE 2GS6A 3KKVA 1W8CA 3LJ0A 1G8SA 3O7LB 4KIKA 4O0WA 5TF9A 5DR9A 2R7BA 2EU9A 2WTWA 4DCEA 1V0BA 4O0XA 2H96A 3BYVA 4IJ9A 2OSCA 3BHVA 1H0VA 3PIZA 4NTSA 4UEUA 4UXQA 5E92A 2QG5A 3R7VA 3VRZA 4RT7A 5LOHA 4UALA 5CU6A 4CV9A 4F9AA 4KS8A 3GUBA 2GS2A 2C5NA 3WOWA 3EWHA 1K2PA 2WPAA 4L44A 3I6WA 5FEQA 3UDBA 3GC7A 3GCUA 5IF1A 3W2RA 3BYSA 2XNBA 1Y91A 4RG0A 4RWJA 4J98A 4CT2A 5I9XA 2QOKA 4WSQA 4WRSA 1GIIA 4IQ6A 4WUAA 3W2CA 4F64A 2GQSA 2YFXA 3LCKA 5HZNA 5IA3A 3EN9A 4PWNA 3E8NA 1YOMA 2YJRA 4NTTA 4C58A 4UWBA 4U8ZA 5CF6A 1FMKA 2YAAA 2WXVA 4FSUA 4JIAA 4N6ZA 4X2FA 2OJGA 2UUEA 4M14A 3R9HA 3DLSA 4DGMA 4CFMA 4WOVA 3HRBA 3OW4A 3CIKA 5EHYA 3V6SA 3SAYA 1WBVA 2W5HA 4YSJA 4JS8A 3L8PA 4QMSA 1J1CA 3QD0A 4AFEA 4AZFA 3QQHA 4NYEA 3IONA 2ITOA 4BGGA 3RWQA 3QZHA 4A07A 2XCHA 2W5AA 2X7FA 1P5EA 4FV7A 2GNIA 3EB0A 4P7EA 2R0UA 3O51A 5KKRB 3DBDA 4O2ZA 3MESA 2BRNA 5DFPA 3I0QA 3H0ZA 4QQ5A 3R8PA 3TZ8A 4PDYA 3IOPA 5AX3A 1Y8GA 4DEIA 2QR7A 3I0OA 3WYXA 5HX8A 3RPVA 2V5QA 3KXHA 4BN1A 3RPSA 2VZ6A 1LP4A 2ITWA 1IEPA 1BMKA 2RFDA 3HV5A 3L9NA 4LV8A 1TKIA 2WELA 1STCE 2QNJA 4G5PA 3NCGA 3CGFA 1FVRA 4FI1A 4RSSA 2WHBA 3IOKA 4AA5A 4HGEA 2G1TA 2Y9QA 4UWCA 3R7OA 3RAKA 3ATSA 4UWYA 4P2KA 2UVYA 4V0GB 1VYWA 4BHNA 1RW8A 5A46A 3CQEA 4BGHA 5LVPA 5KZ0A 1ZOGA 5FUTA 1XBBA 4G16A 2XKEA 1QPCA 3UNJA 2ZM4A 2PZYA 5B7VA 5HGIA 2OFUA 3EYHA 3QTQA 5EM7A 4EJNA 4CQEA 3DQWA 2XB7A 4JQ7A 2BAKA 4BTMA 3P9JA 4MNFA 3D5UA 4FTKA 4BDHA 3BEAA 3MI9A 4RIYB 3RINA 5CT7A 3FSFA 2R3RA 4KKHA 4IVBA 2QOIA 3OCGA 1RJBA 4U81A 2F9GA 4FKJA 4DG0E 2R3MA 5AUWA 3F7WA 2R9SA 2HY0A 4EORA 2PVFA 4K0YA 4ZZOA 4OT5A 1P4OA 2EXEA 3MH1A 5I9YA 4DGLC 2NPQA 3ALOA 1WVXA 3C0HA 4FTCA 2IZTA 1Q62A 5IUIA 4IHPA 4AFJA 3NNXA 4PTCA 1FOTA 3HRFA 4TYJA 2XYNA 4H39A 5CSXA 4CSVA 2OIBA 2YN8A 4MXAA 5F94A 4Z55A 4PPAA 5HX6A 3R7YA 2WO6A 1E9HA 2RG6A 3CC6A 4ANQA 3LCDA 3MA3A 4ENYA 4FYOA 4CLJA 3LW0A 2F4JA 3UG2A 5FQDC 3DNEA 4FT0A 1RE8A 5A4QA 4FTTA 1WBNA 4MXXA 2O8YA 2PMIA 2OK1A 2ZYBA 4XV1A 5L6PA 3TG1A 2W06A 5IQDA 3HMMA 3CQWA 1UKIA 4DFXE 1GZNA 3TCPA 1YXXA 2JC6A 3PY3A 3QRJA 3R1SA 4AE6A 5AAEA 2WOUA 2F7EE 5CZHA 4IAZA 1YWVA 2UVXA 3P79A 4FV2A 4JQEA 2B0QA 2J0JA 1PXLA 2BRBA 4CKJA 1W98A 4MF0A 2X7OA 4TXCA 1OIRA 4Z7HA 3MFUA 2GU8A 2C6DA 2XMYA 4IM3A 4M15A 5EW3A 3ZLYA 2J5EA 3FMLA 3LZBA 4XH6A 2DWBA 5T3QA 4BZDA 4A7CA 4DEAA 3I81A 2C47A 3Q6UA 4JG7A 4R7HA 4Y72A 2ZM3A 5M44A 5C8MA 1HCLA 1ZAOA 2VN9A 4RVLA 4YGAA 5EHLA 3F3VA 3KXNA 5L2QA 4E4XA 5DYJA 2PVNA 4EK3A 1IRKA 3FC1X 4FKLA 3MH0A 5J5SA 1BL6A 3VQHA 1JPAA 2VTLA 4PMPA 3OROA 2VX0A 1QMZA 3TZ7A 4A06A 2AC5A 4MXZA 4X3FC 2YIQA 4A9SA 1MQBA 1YVJA 4RA5A 4Y85A 4YJOA 4LRKA 2OI4X 5CZIA 1U59A 3AD6A 4R1YA 3ACJA 4V0GA 3RNIA 3VF8A 2ITXA 5GZAA 4H05A 1ZMWA 1G3NA 3K54A 5HEZA 5FBOA 4HYUA 3LMHA 4CXAA 3P23A 4ITHA 4TTHB 3R8ZA 3ROYA 4ARKA 2WQNA 2JBOA 3QQJA 3VW8A 3ZXTA 3FKLA 2VTHA 2G2HA 3P78A 2A19B 2R5TA 3NUUA 4FKPA 4LGGA 5CF8A 2AUHA 3BBWA 4V04A 4RBLA 2WMAA 4EBVA 3NGAA 4AT5A 4BDIA 4RIYA 3S4QA 4EH9A 3OFMA 4FNYA 4YJQA 4QQJA 2XEZA 3QD2B 4DH1A 5CSHA 3HGKA 2WZJA 4GK2A 3ZEPA 4CCBA 4USDA 1FPUA 2CLQA 2FSTX 4GKIA 3SX9A 4IIRA 1K9AA 2YCSA 3AT4A 1OUKA 3A8XA 3E87A 3HP2A 3GFEA 4G6NA 4WNMA 4ACCA 4AW5A 4B4LA 3R8MA 4C4GA 4R78A 1H1RA 2NO3A 4GJ3A 2PUUA 2PL0A 1PYXA 3LQ8A 3MJ2A 3PRIA 4CYIA 2QC6A 4MBJA 3RWPA 4L42A 3NSZA 4TYIA 2OJ9A 4MXYA 4IZYA 4AA0A 2UZTA 2BZKB 2PVKA 3EZVA 4FSTA 3Q2JA 2HELA 1M7NA 5JZNA 1H8FA 3GFWA 4PMSA 2W4JA 3NUPA 4D2TA 3NCZA 5C4LA 1Q8UA 5HO6A 3PZHA 3OD6X 5AP6A 3PZEA 4G2FA 1JVPP 4WSYA 3DDPA 3KF7A 2HY81 4M7IA 2ESMA 4ZY4A 3LXLA 2QO9A 5IH5A 3DJ6A 5I5ZA 3TUCA 2BFXA 4USEA 1H1QA 3EL8A 5HNBA 3Q96A 3VHKA 2CCIA 3BPRA 4CRSA 2J50A 2HZNA 2ZDTA 3HX4A 3HMOA 1X8BA 3AC1A 4L9IA 2DUVA 1A48A 2BALA 4M97A 4WNOA 2XM9A 4TYGA 2OJIA 3VUIA 3QZGA 5BYYA 4ITJA 4FA2A 2XNEA 4EOSA 3W16A 4EOLA 2CKOA 3S2PA 1OL6A 3U6JA 5HESA 3V5QA 4BB4A 1JQHA 3R30A 2BTSA 4IE9A 2B54A 1IR3A 3GC9A 4ZK5A 5KBQA 4Y83A 2PE0A 3F66A 5A6OA 4PDPA 3BHHA 3RAHA 2IW6A 2PY3A 4Q5HA 4FV8A 2VTRA 1XH6A 3WZJA 2PE1A 4FIGA 3F6XA 5DA3A 5CVGA 1CTPE 5DEYA 2WMBA 3MW1A 1T46A 1QPJA 4ALVA 1OECA 3IPHA 2WQOA 4ID7A 4BBMA 3WF9A 4ZTRA 4BC6A 4GT5A 3PTGA 2JD5A 2HOGA 2ETMA 3DV3A 5CVFA 4Y8DA 5IA0A 5DRBA 3NYVA 4BWXA 4CD0A 4DLIA 4C4IA 1U5RA 3GENA 4BDKA 4IVDA 4AOTA 3CQUA 1M2RA 1ZMVA 3VJOA 3LHJA 1NVRA 3OWPA 4AGCA 3VS7A 3D7TB 2O3PA 3JVRA 5BVDA 3HDMA 3KRXA 3WZUA 4DG3E 4AAAA 3BV3A 3HECA 3ENHA 4WRGA 3TV6A 3EQBA 4DINA 2VO6A 4CFXA 2H6DA 3AD4A 4GW8A 4K33A 5J8IA 1PMUA 3ELJA 3NRMA 4RLKA 3DTWA 4FGBA 5I9ZA 2JIIA 3QF9A 2ITPA 3WF5A 2FSMX 5FG8A 3RTPA 3LXKA 3C1XA 5CSPA 4PP9A 4EHEA 4YBJA 3CEKA 4BCKA 3JY0A 1ZRZA 4RFZA 3TUDA 4CFUA 3HL7A 3D0EA 3BQRA 5CT0A 5FTQA 2QKWB 4XG3A 3GOPA 4PRJA 2IG7A 2C6IA 3VS4A 1U54B 1XR1A 3OXZA 4F7NA 3EKNA 5HNGA 3Q6WA 4O7TA 3FLSA 2PSQA 5CX9A 5IA5A 4JDJA 4G3DA 4UMTA 5K3YA 5M4CA 1AD5A 4BFMA 4DITA 4H3QA 3ZSGA 4OTIA 5CY3A 3MFRA 3HV3A 2VWWA 4C38A 3MH2A 3OBJA 4TWOA 2V7AA 4NIFB 2YITA 5CQUA 1W0XC 3BGZA 4RMZA 2XK8A 2XP2A 1FGKA 3TV4A 2W1IA 1Q8ZA 1YRPA 2ZAZA 3FLYA 5BQ0A 2ONLC 4BKYA 2ITUA 1PXNA 1WAKA 2R3LA 4B0GA 4YSMA 4XLVA 4K6ZA 3UIXA 3ZUTA 5I3OA 2OXDA 2C6MA 4GIHA 2QHMA 3EOCA 4U43A 4F63A 5AA9A 1FBNA 1PMEA 4K18A 2O0UA 2BIKB 3ZLXA 2BAQA 5CYIA 5T6KA 4BWPA 2A1AB 5L6OA 2R3PA 2UZWE 2J51A 2WAJA 2BFYA 4V01A 2V0DA 5F95A 5AUTA 3UQCA 3WIKA 2W1DA 3IQ7A 4FSNA 2HAKA 4JBOA 5G1XA 4FKIA 4XJ0A 2W05A 5DEWA 4W8DA 3VULA 3H4JA 4BDJA 4G31A 4U3YA 2ZB1A 3LXNA 3R1YA 4EH8A 3N4VA 4CZYB 1PMNA 3KL8A 3ZRMA 4CMTA 2QO7A 1R39A 2P33A 5M55A 4TPTA 4Q9ZA 2Z02A 3RI1A 3E62A 3NW5A 4YC8A 5HTCA 2UW4A 2C0IA 5IEYA 1R78A 4YZNA 4DT8A 4RC2A 3RM7A 2FVDA 5CXHA 5L3AA 4F1OA 4IX5A 3CJFA 2CPKE 3UO6A 4BZOA 3ERKA 3BCEA 5AV2A 4KB8A 3R0TA 5HIDA 3IGGA 4DH7A 2WTVA 3OCSA 1KV1A 2WU7A 3W2QA 4IFCA 3U9NA 2CGWA 3ZO2A 3PG1A 3ATTA 5ANJA 2ZMDA 3D14A 4XP2A 4C3PA 3A4PA 5EQEA 5IQGA 4IDVA 2G9XA 1Y57A 4U97A 5I3RA 4E73A 2ITVA 2WEVA 2JKQA 4EUTA 4F9YA 2Y8OA 5IUGA 4UX9A 2V55A 3UP7A 3UNKA 4QMUA 5FBNC 2W1EA 2YWPA 3E3PA 4OAVB 2W17A 4O38A 2QONA 3DXQA 1XH7A 4BL1A 5B2KA 1GAGA 4R6VA 4K77A 3UC3A 3PJCA 4C02A 4FICA 3BV2A 3FMJA 3O71A 4FKOA 4AN9A 3MTFA 1MRVA 3MH3A 4OTGA 4JR7A 2CKPA 3FBVA 4C4EA 3QTRA 4KRCA 3QUPA 5LMKC 2ETKA 4J97A 4O0TA 4RZWA 4IDTA 1TQPA 5DOSA 4BF2A 1OVEA 4OBOA 4W9WA 4D28A 4DH3A 5A4CA 5BNJA 3B8RA 4FSZA 3ZBXA 1KOBA 3NYOA 2XNPA 3CLYA 1UA2A 2J0LA 3OUKA 5HHWA 2OG8A 3MA6A 4FL1A 4NIFA 4Q5EA 5HG7A 3SRVA 3AGLA 1P14A 3VS1A 3WE4A 1CDKA 1ZZ2A 3UG1A 4I20A 4FKTA 4DEEA 1LEWA 4AT4A 4F9WA 5JEBA 2OXYA 2YDKA 4BCPA 2CGVA 3JS2A 3TUBA 3TACA 1ZYCA 4RX9A 3NAXA 1ZWSA 3FC2A 3QA0A 3QGYA 4KS7A 5CEOA 3DT1A 4FV5A 3N9XA 2DQ7X 1QPDA 4H58A 4RWKA 3R63A 2X8EA 4C4HA 4ALWA 4EQMA 5A4LA 3QX2A 1JKKA 5D7AA 5HVKA 4FF8A 4GG5A 4EHGA 4FKGA 3JR1A 3A4OX 2CGXA 4W4YA 3VWAA 3EFKA 1A06A 5IQBA 4OT6A 1U46A 5TE0A 3V8WA 3W2SA 4J95A 3IW8A 2RL5A 5GZ8A 1ND4A 3FMDA 1O6YA 4CGAA 4JDIA 4R8QA 1UVRA 1YHVA 3OEFX 2BZJA 1YW2A 3HA8A 4FZ7A 3PDTA 3Q4CA 3SVVA 3DKGA 3M42A 3OOGA 5KMOA 1M14A 3EH9A 3OS3A 2GMXA 2WTDA 2YM3A 4NSTA 4F08A 2ZV8A 1XJDA 3AT3A 2ERKA 3R7EA 5IKWA 2BHHA 2QCSA 1J7IA 4LOQA 1OBDA 2GNLA 3VIDA 5IQHA 4O21A 4PDOA 5E8YA 2I6LA 3IK3A 3HEGA 1BKXA 4I5MA 2BDJA 5AR2A 3DOGA 3QLGA 4NJDA 2A0CX 4MBIA 5HI2A 4S31A 3RJCA 4IAYA 1JWHA 3PSDA 4S2ZA 4XEYA 3PIYA 4NFMA 2Z7LA 3IW6A 2PMLX 4C4FA 3DB8A 1KWPA 1PW2A 2IVVA 3KREA 3VS6A 4U40A 3VS3A 3QWJA 4CFVA 5H3QA 3E88A 3C0IA 3ORIA 4UV0A 3SW4A 3FPMA 3TKIA 1Q3DA 4MD9E 2CDZA 3C7QA 1OIUA 4D2SA 4ACHA 3POZA 3OF0A 4FT3A 3O8TA 3OWJA 4GYGA 5CSVA 2JDTA 5JFWA 4IAAA 1NVSA 4II5A 4I23A 3CBLA 5EI8A 2ITZA 2R3GA 4XG8A 4ANBA 5L8JA 4RPVA 3VS2A 1KE8A 4AE9A 4TZRA 2C5XA 4FZAB 1XH8A 5EI2A 3DB6A 1M2PA 5A3XA 4FKWA 3GCQA 2ZOQA 3FL4A 3I1AA 4RIXA 2VTPA 2XKFA 3PJ3A 4R3PA 5HG8A 2NNWB 1GNGA 5L2WA 2R2PA 2B53A 2GDOA 3DFCB 3Q9ZA 1P4FA 3ZHPC 2YHVA 3LXPA 4I92A 4BDBA 5I0BA 3BYMA 5H8EA 5K0XA 1BL7A 2WMTA 2WMQA 4L6QA 3RK7A 3U51A 3F3UA 3FSKA 3UZRA 3F2NA 1RDQE 4D9UA 4S34A 3U6IA 3Q3BA 2NRYA 2UV2A 2V62A 2X2MA 3V01A 4Z16A 3DQXA 3R02A 3CKXA 4PDSA 3LQ5A 5IQCA 1Q41A 3QXOA 1OIQA 2BR1A 3BZ3A 4YHTA 2C3IB 2XIRA 2ZV9A 4DGNA 3C4ZA 3R00A 1DI8A 1YI4A 1YXTA 3QRKA 4G9RA 4DEGA 1M52A 3GU5A 4XV3A 4RC3A 4DTBA 5DT4A 3DCVA 3PP0A 4IWOA 4F7LA 5AV1A 3RALA 3DAKA 3PJ2A 5AUXA 3SXRA 2C5VA 5HE2A 4Y5HA 2W5BA 3TV7A 2PUNA 3FL5A 3R71A 4M12A 4DH5A 4FV6A 3L9PA 2W0JA 3AC3A 4O96A 4E8AA 4EYMA 4E5BA 2I7QA 5AIRA 1JLUE 4XG6A 3BHUA 5FD2A 1ZZLA 4U3ZA 4NUSA 3A2CA 4RC4A 3R9NA 1PXPA 2VTSA 4H36A 4HCTA 2C3KA 4FIIA 4CRLA 3DXNA 4X21A 2JFMA 3VN9A 4MBLA 3R7IA 3FAAA 3V5WA 4Y95A 3OTUA 4BCQA 1J3HA 3D9VA 4RZVA 4IVAA 4XP3A 3PFQA 4JAJA 3W2OA 5DWRA 1UV5A 2XRUA 3CXWA 2YDJA 3GU4A 4I6HA 4H1MA 5BVWA 3T3VA 4G6OA 3G6GA 3QCSA 3NPCA 3RCJA 4DG2E 4X3JA 1VZOA 3K5UA 3NNWA 4RFYA 3BU3A 2XIKA 3ETAA 3Q04A 2BTRA 4QP7A 2PWLA 2XM8A 1Q97A 2OFVA 3F3ZA 4L01A 2OICA 4FK6A 4IM0A 3BWFA 2OF2A 4XG4A 5HO8A 3RHXA 4S32A 4I94A 2E9PA 5D41A 2Z7QA 2W96B 4AP7A 3HV6A 3A7FA 4FEWA 4DFLA 4ASDA 4GVAA 4FSQA 4QP9A 5JQ8A 5DI1A 3ODZX 4QMTA 3O7LD 4GFGA 4OUCA 1UWHA 2RF9A 4KRDA 4XBRA 3MY1A 3SDJA 4BTFA 4LG4A 3M11A 3FYKX 3ZC5A 4MNEA 4FIEA 3QCQA 5FDPA 3E63A 4W9XA 3CP9A 2J0IA 3FLQA 3CTHA 4YP8A 3OOMA 5DH3A 5EQPA 5J79A 4EYJA 3ZO4A 3SA0A 4AACA 4YJUA 3RK9A 4Q9SA 4XLIA 5DG5A 1Z9XA 3NW6A 5JSMA 3NW7A 4R7IA 2GNGA 4YTIA 3F5UA 2VGOA 4FEXA 2VWYA 3VUDA 4K2RA 2VX3A 4FZFB 4G3CA 3I7CA 4IWQA 4QPSA 4ZAUA 4QMZA 4W4VA 5AM7A 4CLIA 4D2RA 4EK6A 2CJMA 2KULA 3PA5A 3U8WA 5E91A 3FMEA 1GZ8A 3DK6A 4F1MA 4JXFA 4ZJVA 3UBDA 2ITNA 4MEDA 1W82A 2R3NA 5A14A 2WNTA 4I22A 4I24A 2B52A 4JI9A 4ZTNA 1S9IA 4QMLA 4ASEA 5M07A 3Q32A 3ZCLA 4ZLZA 4Q2AA 4OBQA 3HNGA 3TNHA 1YWNA 4CMOA 4KIOA 4O0RA 2C3LA 4QP3A 2XIXA 1R0EA 2Y0AA 2YM5A 2CGUA 3C9WA 2X6DA 4DCAA 5B2MA 4CMUA 3WZKA 4D1XA 3EFJA 1W7HA 5D11A 5C8KA 3OWLA 4L7FA 5GJGA 5LVOA 2YABA 4O1PA 5C4KA 4D5KA 4OTRA 1F0QA 4LMNA 4W8EA 1L8TA 3C13A 2FSLX 5HKMA 5JH6A 4ZZMA 5KCVA 4FT7A 2Y4PA 5HTBA 1DM2A 5E8UA 4Y73A 4DGGA 4UYNA 4QTEA 3OXIA 3G33A 4YZBA 2PZRA 3DFAA 3DA6A 4AQCA 3IS5A 3P7CA 4UMUA 2R7IA 3DY7A 3WZDA 5HVYA 1HCKA 4QTAA 4YTHA 4FTRA 1H1WA 2X8DA 5JGDA 2CKQA 3ORLA 4O7VA 1M7QA 3NZ0A 4XRLA 5LWMA 1L3RE 3AC2A 4MWIA 3B2WA 2W7XA 3KN5A 1SNXA 4MXCA 3VBVA 2XUUA 5AP1A 4YJNA 1MUOA 2QLUA 3BE2A 5AUZA 4X3FB 4KUJA 3R04A 5JFVA 2CLXA 3TDWA 4G5JA 2P2IA 2PPQA 3GCSA 3II5A 4WG5A 4EOKA 4LUDA 4M0YA 2X2KA 4IWDA 3HV7A 5CVHA 4U45A 4IVCA 2JAMA 2XIYA 2WQEA 4R5SA 1YXUA 5KE0A 3T9IA 2G15A 5H2UA 3R8LA 1JSVA 2P2HA 2YIYA 3Q4ZA 4RJ7A 3MFSA 4I1ZA 4MF1A 4UY9A 5GJFA 4F70A 3BWJA 3BX5A 4C2VA 3QYZA 2ZMCA 3FZRA 3FI4A 2C6KA 3N4UA 1ZY5A 3UOJA 3TXOA 2E9UA 2WQMA 3K3IA 4JBPA 3EQGA 3Q2MA 5EYKA 3M2WA 4X2KA 2QHNA 4YJTA 5BUIA 4APPA 4O83A 4H3PA 4GUEA 2JIVA 3DBFA 3HLLA 1G5SA 4FEUA 4O2PA 5TKDA 4A9YA 1OL5A 2G2IA 2J2IB 2UW7A 3PJ8A 4JDHA 1LUFA 4EZ5A 2JDVA 1PHKA 1SNUA 5BX0A 1A9UA 4WD5A 1JSTA 2YCQA 3DJ7A 3KMUA 4ITIA 4MAOA 3GXLA 4HOKA 5AUYA 4L8MA 1WBWA 1XH4A 3GGFA 3OY1A 4EQCA 3R9RA 5HBEA 5ACBC 4MVFA 3AMBA 2BVAA 3CJGA 3KXXA 4HYHA 1GJOA 3U54A 3TL8A 5FEEA 3MJ1A 3PSBA 4F99A 3PXYA 3ROCA 2UVZA 5KKRC 4ZMFA 3IW5A 3IGOA 4UMQA 5IPJA 4L67A 1BX6A 2B9HA 2OO8X 3DPKA 4P90A 4O84A 3A8WA 4KAOA 1M2QA 5M51A 2Q83A 2BKKA 1URCA 2H34A 3MY5A 4O6EA 5LCKA 5M56A 1CKIA 2X4FA 4BBFA 1WBSA 2GSFA 4O0YA 5ANGA 3NVKI 2BPMA 2GFSA 3QRUA 5CSWA 4J1RA 5FXSA 2F2UA 2WEIA 4S33A 3MY0A 2R4BA 5HLNA 4HW7A 3WIGA 4WBBB 2X9EA 3FMKA 3FYJX 3OUNB 4WNPA 3EQDA 2HZ4A 4YZMA 3RGFA 2G01A 3F82A 2B1PA 3Q9WA 5K9IA 3HMPA 4ZLOA 4B99A 5CNNA 2PVJA 4F9BA 1WBOA 4XV2A 2R3IA 3BRBA 3T3UA 4A4XA 3H10A 3VRYA 5BUJA 3I6UA 4B6LA 3ITZA 1H24A 2C69A 3COMA 4QTDA 4EJ7A 4YU2A 3PY1A 2IZRA 4PMMA 4DFYA 4ZSGA 5J7BA 2XK6A 3ZC6A 2VWXA 1WFCA 3I5NA 4CKRA 5EH0A 3VUGA 4EQUA 4EOOA 4O1OA 4QMQA 5IMXA 4U44A 4X3FA 4QMPA 5BUEA 3TIZA 1NA7A 1OKZA 4EH3A 2VTMA 3OEZA 2QVSE 4C59A 4MTAA 3UJGA 3R21A 3LE6A 4XUFA 2RFSA 4PMTA 2C30A 4W4XA 5T68A 2XEYA 4EONA 4TW9A 1YI3A 4FG9A 3OW3A 1H27A 4MHAA 5ANIA 4ZSJA 1PF8A 3TJCA 5DR6A 3EMGA 3U6HA 2HYYA 3JVSA 5IQFA 3GB2A 4QTBA 3WE8A 4QO9A 2W1FA 4XNEA 3MDYA 2XNGA 4ERKA 4IACA 5DHJA 3GU8A 3RNYA 3TZ9A 4AWIA 3HYHA 4D4RA 4EKKA 4JG8A 3BHYA 2EB3A 3F3TA 5JRSA 3FWQA 4CFNA 4EC9A 4BIDA 3VBXA 4O86A 1KV2A 4X2GA 1F5QA 2WTCA 1XH5A 3TTJA 4YJVA 3E92A 1PRYA 5HBHA 3QL8A 4KIQA 2UZEA 4MH7A 2JIUA 3R9DA 4FBXA 1SVHA 2H8HA 4RX7A 3DAEA 2KTYA 2PZ5A 4YJPA 3FLNC 3I4BA 3REPA 3RZBA 4E7WA 4QP4A 4FNZA 1CKJA 3QX4A 5I9UA 4F7SA 3L8SA 1RQQA 4L3JA 2XK7A 2B55A 4AZVA 4IANA 5B2LA 3L1SA 5C26A 2YCFA 4PNKA 1IAJA 4Y46A 4D1ZA 3ULZA 4RFMA 1XBCA 4IEBA 5CLPA 4MKCA 3OBGA 4EL9A 2C6LA 4CFFA 3VF9A 3DJ5A 1ZYJA 4XG7A 5FEDA 4NU1A 4LI5A 2CSNA 4QYGA 5EM6A 2AYPA 2GNJA 3EL7A 4NW6A 1S9JA 1B6CB 2B9IA 2VTOA 4FYNA 4JR3A 4OGRA 2XNOA 2Y6MA 1JBPE 2C1BA 3QQUA 3R01A 3KXGA 4IZ5A 3NUSA 3R1QA 2QD9A 5AIKA 5DGZA 3R9OA 3U4UA 3ZUVA 3MVMA 4KBCA 4YC3A 2P0CA 5K5XA 3VW6A 3D94A 2FSOX 5FGKA 4EH6A 5CU4A 4I6QA 4DAWA 3IG7A 3AG9A 2QU5A 2J0MB 3H9OA 2B7AA 4EHZA 3D4QA 3CE3A 1H1PA 2C0OA 3QD4A 4E4MA 1P2AA 4Z9LA 4JQ8A 3KU2A 1SM2A 4WO5A 1XBAA 1KE6A 5GJDA 2CNQA 1R1WA 1ZYDA 2RIOA 5HG5A 3KCFA 1ZYSA 3ORNA 1H08A 3KVXA 3F88A 4GG7A 4TT7A 3ZM9A 4WG3A 4FTIA 4FV1A 1UNLA 2HK5A 3E64A 1U4DA 2QOHA 2WOTA 2XKDA 5E9EA 4USFA 1OPLA 3NDMA 3QFVA 4FUXA 2V22A 2I0VA 3PYYA 3HVCA 3PXQA 4CZUA 2ZM1A 4LM5A 4ALUA 1R3CA 3NLBA 3OY3A 4CZTA 4O0VA 3VJNA 4AN2A 4C62A 4JRVA 2R3KA 3EQHA 3ORMA 2X1NA 5TOZA 3GI3A 5AR4A 4CTBA 3D5WA 4IX6A 4ZMEA 4X6QC 3AD5A 5M4IA 5DBXA 1NXKA 2OW3A 3UO4A 2WIHA 4NCTC 4A9UA 4AGWA 4BIEA 4L3LA 4DTAA 3UMXA 5D10A 5BVKA 5AADA 2XBAA 1JOWB 2YCRA 3TI1A 3OHTA 3O2MA 3V8SA 1YI6A 3DBQA 2JLDA 2Y6OA 1J91A 5HOAA 4BGQA 2Q0BA 4IAKA 3VBQA 4D1SA 3O0GA 5DPVA 2BAJA 4BRXA 4BY9E 4I93A 3NVMB 4N70A 4RJ8A 1OB3A 4XYFA 3ZEWA 2ITQA 2GNFA 5C01A 3SW7A 3QU0A 5BYLA 3EQIA 2WMSA 2ACXA 4TL0A 4D4YA 5IQAA 4N4SA 2JAVA 4XMOA 3SRVB 5HD7A 4E4NA 3R2YA 4GU9A 1GY3A 2OZOA 1AGWA 1KE9A 3GCPA 3BGQA 3D5XA 4NM0A 3SOCA 4DH8A 3UO5A 3OZ6A 2X81A 1OGUA 3VUMA 5CWZA 4C7TA 4YZCA 4A4OA 4D5HA 3LFCA 4CKIA 4ZSAA 2VO0A 3MPMA 4DYMA 4O0UA 4QP1A 3LMGA 3POOA 2GQRA 2VO7A 4YTFA 3PP1A 1J1BA 4JL9A 2F7ZE 5J9YA 5I4NA 5DN3A 5HNIX 4RIWB 3RPOA 4L46A 4FKUA 4YHJA 2HZIA 4C37A 5E8XA 4DBNA 2XS0A 2BZHB 4HVSA 2X7GA 4NM3A 4NW5A 3G0FA 4BIBA 4CQGA 4NKSA 2VTAA 3CPCA 2ZV7A 2EXMA 4FSYA 4N0SA 5GINE 5HQ0A 2VD5A 2ONLA 4FTQA 3P7AA 3F5PA 5AP5A 3UP2A 2XF0A 1OL7A 4L7SA 4EOJA 4TN6A 3ACKA 3EN4A 1NVQA 4OTPA 5EYMA 4JVGA 4BDCA 4EOMA 4ZXTA 3ZBFA 4QMVA 3FXWA 4NEUA 3PG3A 5J5TA 3AXWA 5KMIA 3SD0A 4DEDA 3U9CA 1V0OA 3V5LA 1JKSA 2PHKA 5CEPA 2UW3A 3LKMA 3C50A 3KQ7A 2WQBA 3QBNA 1H1SA 4GS6A 3ZONA 5L8LA 3KRWA 2W99B 2Z60A 4UYAA 4F6WA 4V05A 4YUQA 1PMVA 1BYGA 3ZU7A 1Q24A 3DBCA 4D2WA 4ERWA 3CKWA 4F7JA 4DFBA 1JKLA 2BDFA 2XH5A 3DBEA 2O65A 5J9ZA 3LCSA 2BKZA 4KSQA 2PUPA 1WBTA 4I0SA 4CCUA 3QTWA 3VC4A 5K4IA 5CU2A 2PVYA 3QD3A 3R22A 3ZFYA 4C8BA 3KB7A 3K5VA 3QTZA 5CQWA 5CAVA 4D4SA 3H30A 5LWNA 3ODYX 3GT8A 2ITYA 2QOFA 4XP0A 4FT9A 3PRFA 4NKAA 5AAFA 4APCA 4YMJA 3RAWA 4OBPA 5ETCA 5CTPA 1UKHA 3FUPA 4FKVA 4QD6A 3P0MA 3QQGA 2J9MA 2E9VA 4KABA 4QTCA 4E6QA 3QKLA 4HPUE 2J7TA 4FC0A 1MP8A 3E7VA 3V04A 5C9CA 1SVGA 5EDPA 4G1WA 3LM0A 4IZAA 1TVOA 4K1BA 2ZV2A 4NWMA 3R8VA 4JX7A 4E93A 1GZOA 5DIAA 3OG7A 3UIMA 2A4LA 4RIXB 4XS2A 4HVIA 3A7IA 5M4UA 5IEVA 4BR3A 1BUHA 4PX6A 4CNHA 5IUHA 5CANA 2I0EA 3HMNA 5HCZA 4ANNA 4E6AA 4AGDA 3LQ3A 3FV8A 1YQJA 1OBGA 1OKYA 3QA8A 1MRYA 1WBPA 4TRLA 4EWQA 5CU3A 4BI1A 1URWA 3GBZA 3MGYA 3VNTA 1EH4A 4S30A 2VWUA 4BDAA 2GNHA 3UPXA 2VWIA 5JKGA 4D0WA 3PY0A 3DTCA 2W4OA 4PL5A 4BTKA 1BI7A 1DS5A 5BVEA 1SYKA 1FQ1B 3PPKA 3SV0A 4O7SA 3OVVA 3QQKA 3T9TA 5H8BA 1G8AA 4HCVA 3FZ1A 4L00A 5HVJA 4I0RA 2RG5A 5LVMA 5LMKA 4HYIA 3DU8A 2VNYA 4FTAA 5HIBA 4O7YA 4RIWA 2V7OA 4WG4A 5C8NA 4GYIA 1REJA 1ZXEA 2YIXA 3SOAA 1H26A 4O7ZA 3VQUA 4GFOA 1OL2A 3NS9A 3HUBA 4YHFA 5GIOE 5DE2A 3OMVA 5E8ZA 2EB2A 5ANEA 1GIJA 2UZBA 3MTLA 1YWRA 4YLKA 2X0GA 4HZSA 3ZSIA 3RBWA 3WARA 3IECA 4Y5QA 3EQRA 2EVAA 4FIJA 4M3QA 4XHKB 5EFQA 5K0KA 5TO8A 3UTOA 3TWJA 3TJDA 3NMUF 4IH8A 3FJQE 4EZ7A 5ITAA 4LOOA 3OT3A 4P4CA 3D5VA 3ZRLA 3N51A 1V0PA 3Q4UA 3Q52A 2GTMA 3E3BX 1PKGA 2P4IA 3QCXA 5FM2A 2X2LA 3W18A 2C1AA 3L9LA 3B8QA 3E8EA 3QC9A 4CTCA 4IJPA 2YAKA 3A99A 4ZJJA 3OP5A 1H4LA 2VGPA 4EH2A 2CHLA 3TN8A 5AR8A 3NNVA 1H00A 2XRWA 4EK4A 3GU6A 4HVGA 3PXFA 3TKHA 3SXSA 4D2PA 2QOBA 4DEHA 3O96A 4E6DA 3DXPA 2VTIA 3LFBA 3P1AA 5AV3A 1Z57A 4J53A 3SC1A 5CS6A 3WZEA 3EQPA 1UU3A 2F2CB 1E1VA 2R3HA 3EFLA 4IB5A 2O5KA 4IB3A 5AUVA 3R28A 3RCDA 1W83A 5EOBA 1ZOEA 3EZRA 2YM4A 3R73A 3UODA 4XV9A 3LFAA 3ZFXA 4FOCA 4O22A 4F09A 3EQCA 3G51A 4MNEB 3LLAA 3OTVA 3PPJA 1H25A 2VTJA 2JKOA 5L2SA 3FE3A 3LMIA 4DT9A 3AMAA 2GPHA 4WUNA 3SQQA 5BMMA 1ZMUA 1WZYA 4HNFA 3QAME 4IXPA 5JN2A 1OKVA 4F0IA 1KOAA 4O7NA 1YXSA 2ZB0A 1CKPA 3PA4A 4U7ZA 5DR2A 3ZOSA 2YA9A 5K4JA 3IKAA 1VJYA 3LCOA 4O7RA 4TNBA 4AW0A 2YISA 3NIZA 2XNNA 2YIWA 3KMWA 4ZP5A 2ITTA 3MPAA 5DVRA 3BKBA 4X2JA 4AW2A 4QQCA 3KC3A 1YDTE 4NFNA 3NUYA 4KBAA 3KCKA 4FOBA 2CN8A 3SG8A 3KRLA 2VWBA 3PLAE 2YM7A 5M57A 3DS6A 4JX3A 3UE4A 5J1VA 5KHXA 2J4ZA 1IA9A 3BGPA 2FUMA 3AGMA 3SHEA 2I0HA 2YDIA 3DAJA 3FLZA 2XZSA 3TZMA 3BIZA 4F0GA 4IFGA 3FZPA 5IU2A 4YZ9A 5KZIA 3BLRA 4YJRA 2QKRA 3HA6A 4BI0A 4BBEA 3MS9A 4G3GA 3OCBA 4E20A 2OBJA 4F9CA 3HDNA 3KXZA 2PK9A 4FKQA 4LGHA 4X6RA 4JT3A 4IX3A 2CNVA 2Y7JA 1YOJA 4G3EA 4EZ3A 4R5YA 3MFTA 3O23A 4GH2A 5JT2A 3QALE 4FTUA 4YPDA 3PVUA 1Q4LA 3ORKA 3QGWA 3UOHA 2BMCA 5E8WA 3C4WA 3TEIA 3KULB 2F49A 4TKSA 3GU7A 4E5AX 1Q8YA 2CKEA 4PQNA 2BHEA 1Q3WA 4JLCA 2X39A 4RQVA 4QYYA 3C5IA 3QYWA 3LAUA 3QZIA 4QMWA 4ENXA 4CFWA 3IW4A 2IPXA 4XX9A 4ZY5A 3ULIA 5JGBA 2QO2A 3I79A 2WMWA 5HTIA 4IAIA 4RA4A 3HKOA 2XA4A 2XJ0A 5ANDA 2C4GA 1I44A 3BU6A 3DKFA 3W33A 3P86A 2PVLA 2BIYA 2P55A 4BYJA 3OXTA 2J5FA 2HENA 1ZLTA 3SGCA 5HICA 4JDKA 5M09A 3QUDA 2WTKC 3CGOA 5CAPA 3F61A 3LFEA 3DKOA 4L43A 4L3PA 4BCGA 1B38A 2QR8A 3EJ1A 4J99A 1OIYA 2HWPA 2W4KA 2RSVA 3I60A 3F5XA 2Y4IC 3BLHA 3IDCA 3QUEA 4FNXA 4I5CA 4D58A 3FEGA 2QG7A 5D1JA 3VBWA 3M1SA 1FGIA 3FKNA 3ENMA 1UU7A 2ERZE 3KK8A 4BCNA 2FO0A 3C51A 3MVJA 1XO2B 4K8AA 5E1SA 3MV5A 3HZTA 4F0FA 4FODA 4ASZA 3GEQA 4UZDA 2HWOA 3TNQB 4KNBA 5E8SA 3SKCA 3CR0A 3HRCA 2GQGA 2J0KA 4GT3A 5C1QB 1OKWA 5EM8A 1PXOA 1DAWA 4IZ7A 4OTHA 1WVWA 3H0YA 3Q9XA 1YDSE 2ETRA 3UPZA 4LOPA 4CVAA 2W9ZB 4FTMA 4W4WA 2B9JA 2PVHA 2YJSA 5AX9A 4YO4A 3MYGA 5JK3A 5GNKA 2OGVA 5FTGA 4KA3A 5FRIA 1XH9A 1TQMA 2XJ1A 1WMKA 5CI6A 5HU3A 5AA8A 3AOXA 2GCDA 5A9UA 4GU6A 4AXAA 4E1ZA 1PYEA 1PJKA 1KE5A 2HXLA 4TWCA 4PF4A 3EYGA 4DLJA 4RJ3A 5F4NA 3PPZA 1XKKA 5JGAA 4OLIA 2IW8A 3DK3A 1GZKA 1PXMA 2YZAA 2WU6A 2C6TA 1TQIA 4C36A 3UOLA 5JMSA 3G9NA 3LFQA 3UNZA 4OW8A 4FNWA 1U5QA 4DN5A 5I9WA 3SG9A 4FL2A 5F1ZA 3ORZA 2R3QA 3P7BA 4P5ZA 4FG7A 2W9FB 3VVHA 1ZY4A 4ANLA 2OKRA 4ZTMA 4D4VA 3DK7A 2VU3A 2JDRA 5KUPA 2NP8A 3KULA 4KWPA 5EM5A 4I5HA 4CG9A 4EOQA 5A4EA 4E4LA 5CEQA 4EKLA 5A6NA 2E9NA 4KBKA 4FV3A 4YNOA 4G17A 5DNRA 3NEWA 3UZPA 2YZLA 3A62A 3EKKA 3U4WA 1QPEA 2XCKA 1YOLA 5E90A 4QQTA 2X6EA 4FZ6A 5H8GA 4KINA 4YLJA 4QP8A 4C35A 3RZFA 3ZDUA 4NZWB 4IC8A 1J7UA 2IVUA 3E5AA 3V3VA 3ZYAA 3PWDA 4D9TA 1W84A 3A61A 3THBA 3ZDIA 5M06A 4J52A 4IAFA 2Z8CA 3QWKA 4O0SA 3GCVA 4GV1A 4RJ4A 4GT4A 1AQ1A 3VUHA 4BCMA 4C0TA 3C4EA 4F4PA 1CM8A 4RX8A 5CF4A 4DE4A 4QYFA 2Q0NA 5EI6A 3LPBA 4RWIA 4N57A 2YACA 1JNKA 4O7LA 3G0EA 4AN3A 3ZMMA 5AP4A 3ZZWA 4QPAA 1MRUA 1PKDA 2BDWA 1VR2A 3R1NA 3UOKA 3V8TA 4FSRA 5LXMA 3HAVA 3VAPA 3VS5A 4E5WA 2C68A 3F7ZA 4MCVA 5FXRA 2QODA 3LVPA 5CEMA 4YJSA 3F2AA 3LFSA 4MD8E 3MVHA 4FMQA 4A4LA 2OF4A 1OL1A 3RPRA 2WMXA 4XCUA 3BQCA 2QI8A 3R7UA 4I4EA 4J71A 3COIA 4AS0A 1ATPE 1Q8TA 2UZUE 4AZSA 4BCJA 2JGZA 4ZY6A 2W1ZA 4FKSA 3GQIA 4XBUA 3ZZEA 3ZFMA 4DFUA 4I0TA 5CNOA 2VO3A 4AZTA 2GHGA 5LCJA 2JDOA 5EYDA 4I3ZA 3NAYA 4PTGA 2R3OA 3TTIA 3V6RA 4AG8A 2IVTA 3FI8A 3RP9A 2OH4A 5HCYA 2XK4A 3F3WA 1WVYA 5HIEA 1FVVA 3S1HA 4X7QA 5HORA 4C61A 3ET7A 4AU8A 5E1EA 5KX8A 3AC8A 5LMAA 3S3IA 2ZDUA 3VUTA 3NUXA 4QMYA 3FQHA 4NM7A 5LVLA 3CSVA 5HCXA 3LM5A 1LPUA 4O6LA 3G90X 4HGLA 4GL9A 4E6CA 2OJJA 4FV0A 3SXFA 5I9VA 2R3JA 3IDBA 4DEBA 3K2LA 2HW7A 1SMHA 5J95A 4M69B 1GOLA 2YM8A 4AOJA 2OWBA 4AA4A 4UMRA 4NT4A 4GJ2A 3RK5A 3EHAA 4J96A 1NT2A 3UVQA 3E7OA 3FMMA 4UZHA 2GHMA 4GKHA 3TNPC 3E93A 4YURA 5EKNA 4I5PA 5AV0A 3R7GA
chains in the Genus database with same CATH superfamily
1YHWA 5F9EA 3KGAA 4AGUA 2OZAB 4DDIA 4ZTSA 4MWHA 3ZRKA 1FINA 3AC5A 2ZJWA 4IB1A 3CY2A 1O9UA 4JIKA 3VBTA 4PUZA 5JRQA 2PTKA 3UZTA 3BI6A 3BYOA 5CENA 3QZFA 4NJ3A 4O82A 3FY2A 3BU5A 4MD7E 5L4QA 2PVMA 2WMUA 4U42A 5GHVA 2BRHA 2C6OA 2WTIA 3ZH8A 5EW9A 2UW9A 5E8TA 2IJMA 3Q60A 2F7XE 5HLPA 4B8LA 4YNEA 1M17A 5FWKK 5JQ5A 4B8MA 4C57A 3TIYA 4L52A 4BVUA 4M13A 4U9AA 4ZS4A 3PXRA 4GUBA 4YPSA 4RVTA 3RPYA 4PV0A 4U0IA 3UIBA 3W2PA 5CASA 5AP2A 3N4TA 3A7JA 1Y6BA 2IO6A 3G5DA 5FP6A 3GOKA 4ZJIA 4RJ6A 3FQSA 2OIQA 3F69A 4EC8A 5A4TA 2HCKA 3I7BA 3C5UA 3QRTA 1FMOE 3R2BA 5AP3A 1UWJA 3BL9A 4FEVA 4EH7A 2QOCA 1TZDA 3VS0A 3MN3A 4QP2A 2WMRA 2Z2WA 3RAIA 3JUHA 5JFSA 3FQEA 4AXFA 2UZDA 3JYAA 4AAYA 4B7TA 4PPBA 3ZSHA 4FTNA 5L6WL 4ZIMA 4IW0A 4UN0C 2QURA 2BRMA 3BYUA 2A27A 2IW9A 2WKMA 5AR3A 3FXZA 4ANSA 2IZSA 2X4ZA 5E7RA 2JDSA 2WFYA 3L8VA 3QTSA 2C3JA 3S95A 2VWZA 3EQFA 2YWVA 3P08A 4FIFA 4ZTLA 4QOXA 4ACDA 2HIWA 3WF6A 3W8QA 3H9RA 3DDQA 3L9MA 4HVDA 3R6XA 3O8UA 5AJQA 4UXLA 5LARA 4YR8A 3ZUUA 4K9YA 4MQ2A 5JFXA 3VHEA 4FK3A 4FSWA 2WMVA 3KF4A 2PU8A 4G34A 1QL6A 2UZOA 3CY3A 4R3RA 3EFWA 4CG8A 4I6BA 3PIXA 4HPTE 4IC7A 4CEGA 3A7HA 4YO6A 2HXQA 1LR4A 4M69A 4ZS0A 3T8OA 4AF3A 3VUKA 1DAYA 3D83A 3UGCA 3RVGA 3V5JA 5J1WA 4XRJA 2O63A 3FDNA 2C5OA 2QOOA 4K11A 4CV8A 5AWMA 4EOPA 1ST0A 1XMLA 4FG8A 5HU9A 2YLEA 4EOIA 5KBRA 2CNUA 1QCFA 5IA4A 5KNJA 4X0MA 4OTQA 3U55A 2OZAA 2VNWA 5EK7A 4JBQA 3PUPA 3FY0A 4IB0A 5M4FA 5E8VA 3W0RA 1BLXA 1IASA 4MX9A 4B9DA 4BCOA 3RKBA 4C33A 3FI3A 3S0OA 3VBYA 4RLLA 3KXMA 4R7BA 5BVNA 2VTNA 4NH1A 3I5ZA 4KKEA 4WHZA 3UQFA 3HMIA 4GCJA 3D7ZA 4U80A 3KK9A 5KHWA 3IDPA 1OM1A 4IADA 4DFNA 4M8TA 3MIAA 4FV9A 4EI4A 2B4SB 4QNYA 2IWIA 3U87A 3CD3A 2EXCX 3KEXA 4DGOA 2WGJA 1OPKA 5CALA 5FM3A 3Q53A 1APME 2W1CA 3QTXA 4O7WA 3ANRA 3CD8A 4RWLA 5J7HA 4BKZA 3MB6A 1H01A 2RFEA 1XWSA 3FI2A 5IEXA 1KUTA 4DTKA 3FMHA 4F65A 4ZSLA 4U41A 2P3GX 1ZOHA 1XHAA 4KIPA 4MK0A 2XIZA 3KMMA 4RGJA 3PLSA 1Y6AA 4M68A 2OXXA 4FTJA 1CSNA 5AMNA 5KMMA 3NX8A 4FT5A 4DF3A 3QHRA 3EN6A 4Z3VA 4ZLYA 3LIJA 4U79A 4WA9A 3UVRA 4LMUA 1LEZA 4DBXA 4JJRA 2NRUA 2XK3A 1B39A 5HE0A 3ZTXA 4KD1A 4MXOA 3NR9A 5EDRA 1T45A 4UMPA 3PE2A 3PSCA 4AUAA 3FXXA 5IA1A 3ZO3A 4M66A 3W0PA 1I09A 2C5YA 3PWYA 4NCTA 4PL3A 2SRCA 3SLSA 2BUJA 4AW1A 4FUYA 3W8LA 3ZM4A 4BCIA 4C3RA 3HUCA 4EH4A 4ZSEA 3EIDA 3PA3A 3QTIA 4R77A 1Q8WA 4FTLA 5D9HA 3LFNA 3IO7A 5FTOA 5IH4A 3BE9A 2VRXA 4P5QA 1UNGA 2JKMA 5J9LA 3ZO1A 1H07A 2Z7RA 2IZUA 4IX4A 4HJOA 4EH5A 1V1KA 2IVSA 3PXKA 4I41A 3MIYA 2PMOX 3CS9A 3ZS5A 2BCJA 4ANOA 4YBKA 4JAIA 5IQIA 2QU6A 4FL3A 3BLQA 4FEQA 5J87A 3AKKA 3WILA 3H3CA 5TR6A 3PUFC 5CAQA 4G6LA 4I21A 4JRNA 1MQ4A 2C0TA 2R3FA 3F9NA 4X2NA 3DGKA 4XG2A 3NYNA 4F1TA 1F3MC 5EHOA 2REIA 4TYHB 5HBJA 3KRRA 5HLWA 4QPMA 3QKMA 3PVWA 2XNMA 1Q99A 3E8CA 1SVEA 1VEBA 5KMKA 3JPVA 1ERKA 5BYZA 1O6KA 2O64A 3K3JA 1JKTA 3TDVA 2GS7A 5IA2A 3MPTA 4LV5A 2VUWA 3WBLA 4BDGA 5LJJA 3D15A 1Q5KA 4FVPA 1Z5MA 4TY1A 5L2IA 1VYZA 4QRCA 4AT3A 3PXZA 4RQKA 3A7GA 3W0SA 3HAMA 5AAGA 4GVJA 2UW6A 4QMMA 5AEPA 5IH6A 2QOLA 4ZZNA 1IAHA 5A54A 1OPJA 3UYSA 2EWAA 2VAGA 1GIHA 5DLSA 3D7TA 2JEDA 2YM6A 3AQVA 3PVGA 4JBVA 2VWVA 5DRDA 2YIRA 3DLZA 4HNIA 5F20A 3KRJA 4L68A 4RJ5A 4XG9A 4GK4A 3FLWA 4BTJA 1YXVA 3PE1A 4WBOA 5ETFA 2ZVAA 4A9RA 4C4JA 3S00A 3DNDA 3VO3A 4QMXA 5IDNA 3G15A 5FXQA 4OAUC 5EG3A 5EDQA 3NUNA 5ANOA 4YLLA 3G9LX 2RFNA 3V5PA 5ETAA 3LJ1A 4TWPA 3ANQA 4E3CA 4ORKA 4GFMA 5FLFA 4PY1A 3CTJA 1DI9A 1PXIA 2VX1A 4BDEA 4BHZA 3LFDA 5DT0A 2PZIA 3AC4A 4FKRA 5BVFA 3Q5ZA 3NIEA 2HZ0A 3QTUA 2PUIA 4PP7A 4FR4A 4LFIA 1XQZA 1NY3A 2QLQA 4MYGA 4U6RA 3FMNA 1PXKA 3UC4A 1REKA 4I4FA 2I0YA 4G9CA 4LQMA 4FVQA 3L8XA 3HP5A 2UZLA 4QYEA 1U54A 2RKUA 2R64A 4M67A 2BRGA 2O2UA 4BCHA 5AP0A 3D2KA 4XOZA 3H9FA 1J7LA 2XKCA 4GSBA 3DZOA 4IWPA 4OTDA 3RMFA 4EHVA 1PY5A 3OT8A 4NM5A 5AFVA 2BZIB 2IN6A 3JXWA 5L2TA 3NYXA 2LAVA 2VV9A 3KY2A 4H3BA 4R3CA 4EK8A 1UU9A 2WB8A 4LL5A 4PNIA 4FX3A 4ONAA 1YDRE 2DYLA 5IZFA 2EUFB 3ALNA 4HYSA 4AZWA 5AV4A 2UW0A 5LQFA 2FGIA 2E2BA 2H9VA 5HD4A 3NUAA 5KMJA 4TYHA 1HOWA 3EN7A 5KMLA 3LCTA 3BBTB 4GK3A 2OLCA 5ACKA 3UVPA 3FHRA 4Z7GA 3P4KA 5M08A 3MBLA 2I1MA 2VTQA 4YC6A 3P5KA 4FSMA 4FVRA 4EUUA 2CN5A 4HGTA 3TKUA 4O81A 3AMYA 3MVLA 2WTJA 5CI7A 5L8KA 3C4XA 3FKOA 1OUYA 2C6EA 2YEXA 3QXPA 3Q5IA 4WKQA 3IW7A 3F5GA 1NW1A 3BL7A 5HG9A 2PZPA 2YLFA 3LLTA 4OR5A 3RM6A 2YERA 5HO7A 1Y8YA 2CMWA 2PE2A 3MB7A 4CT1A 2CCHA 1K3AA 4AZEA 2E9OA 4O91A 4TWNA 2GFCA 4ZEGA 3OWKA 3AT2A 4NL0A 2X9FA 4YZDA 3WF8A 4FV4A 4AOIA 4OTWA 1CMKE 3QC4A 4CYJA 3BHTA 4UB7A 4C3FA 5CEKA 5IDPA 5C27A 4HGSA 5HE1A 5IQEA 2J6MA 4FIHA 3DZQA 4QMNA 3C0GA 4FGRA 4R1VA 3QRIA 5HE3A 5CXZA 5K5NA 4BCFA 1O6LA 3NNUA 4UBAA 2F57A 4LGDA 2OIDA 4WNKA 3LOKA 5EYCA 5KMNA 2B9FA 2UW5A 3MSSA 4GMYA 3GVUA 4IMYA 2JFLA 3BELA 4GIIA 4XOYA 2J90A 5H9BA 3UYTA 5CF5A 2W1GA 3E8DA 5LVNA 4J8NA 4L53A 2WD1A 3GQLA 5GIPE 5ICPA 3R83A 1IA8A 4RVKA 3TNWA 5ETIA 2BILB 2OJFE 3QCYA 4WT6A 3GC0A 3ORXA 3QKKA 4DC2A 2XVDA 4GEOA 5GZ9A 4FZDB 3GNIB 4KKGA 5AR7A 4BYIA 2QOQA 3EN5A 3ZLSA 4DHFA 3TMOA 3TM0A 4RIOA 4H1JA 4I6FA 4ZOGA 5EOLA 4KSPA 5B0XA 3RHKA 2WTKB 4O4BB 2GTNA 4BKJA 2R0IA 4KIKB 5D12A 3UQGA 3CPBA 4JG6A 4LRJA 3V51A 4BICA 3COHA 1KE7A 2JBPA 5CAUA 2VTTA 2PYWA 4D0XA 4ZTQA 3LJ2A 4O27B 1ZARA 2Y4IB 5LMBA 3WF7A 3O8PA 5IMEA 3KA0A 4GRBA 3ZXZA 4LYNA 3QHWA 3WYYA 2PMNX 3HV4A 4RVMA 4JNWA 1UU8A 2JKKA 3FZOA 4QNAA 3W55A 5AM6A 4ANMA 4C2WA 4YTCA 5CAOA 1Q61A 2UW8A 5G6VA 4IBMA 3TNIA 4BDDA 4TYEA 3ORTA 3KN6A 4AX8A 5DMZA 4IM2A 4PL4A 5FP5A 3Q4TA 2W1HA 1H28A 3OCTA 3PVBA 2QQ7A 4N6YA 1JSUA 4HCUA 5C03A 3F2RA 1OMWA 2XBJA 3A60A 4FTOA 1E1XA 4PPCA 3ZLWA 4L45A 4C34A 3UMWA 3FZSA 1SZMA 5M53A 3KFAA 3COKA 5AUUA 5BVOA 4EK5A 5CU0A 5EW8A 3V5TA 5E4HA 1ZYLA 4BI2A 3NWWA 5AP7A 2FYSA 5JZJA 4J8MA 4OTFA 5ANKA 4JOAA 4PTEA 2JITA 2OU7A 3OC1A 2DS1A 5TT7A 2BROA 4HZRA 3JY9A 3TT0A 4QMOA 5DT3A 5KO1A 1WCCA 3W1FA 4ASXA 4MQ1A 2FA2A 3LFFA 2PULA 4M84A 2G2FA 4LUEA 4BZNA 3B2TA 1OITA 2X8IA 4EWHA 4EEVA 3ORPA 3BEGA 2RGPA 4F6SA 4G3FA 3CCNA 5EKOA 3WI6A 3PJ1A 4RX5A 3QLFA 3Q9YA 4ZTHA 5IISA 2LGCA 3W32A 3W10A 5CEIA 2GHLA 1UNHA 3GC8A 4QT1A 3G2FA 4HVHA 4QYHA 3ID6C 4RRVA 4QEBA 2FH9A 3QQFA 3D2IA 2Z7SA 4DA5A 1R0PA 4BWKA 1OI9A 3C4CA 4EBWA 2XK9A 4TNDA 1IG1A 4A9TA 4ACGA 2AC3A 3O17A 2OH0E 5D7VA 1FVTA 5AR5A 1BI8A 2HW6A 1YKRA 3O50A 4WIHA 2XYUA 1JAMA 3C4FA 3FHIA 3GP0A 4M0ZA 4DHZA 3CTQA 1OZ1A 2PVRA 4LL0A 4NK9A 5EQYA 1PXJA 5BMSA 4FE2A 4LRMA 3MWUA 3FPQA 4D55A 1YHSA 4QP6A 2WIPA 3DKCA 4ACMA 3FZTA 2XJ2A 4J7BA 4D2VA 4BDFA 1KSWA 3R8UA 2UZVA 4E26A 5IG1A 2UZNA 3QQLA 3KIOC 4U5JA 4F6UA 1H0WA 5FDXA 3G6HA 2FB8A 3UIUA 3KVWA 5BPYA 2I40A 2A2AA 4DFZE 2GS6A 3KKVA 1W8CA 3LJ0A 1G8SA 3O7LB 4KIKA 4O0WA 5TF9A 5DR9A 2R7BA 2EU9A 2WTWA 4DCEA 1V0BA 4O0XA 2H96A 3BYVA 4IJ9A 2OSCA 3BHVA 1H0VA 3PIZA 4NTSA 4UEUA 4UXQA 5E92A 2QG5A 3R7VA 3VRZA 4RT7A 5LOHA 4UALA 5CU6A 4CV9A 4F9AA 4KS8A 3GUBA 2GS2A 3VONA 2XAMA 2C5NA 3WOWA 3EWHA 1K2PA 2WPAA 4L44A 3I6WA 5FEQA 3UDBA 3GC7A 3GCUA 5IF1A 3W2RA 3BYSA 2XNBA 1Y91A 4RG0A 4RWJA 4J98A 4CT2A 5I9XA 2QOKA 4WSQA 4WRSA 1GIIA 4IQ6A 4WUAA 3W2CA 4F64A 2GQSA 2YFXA 3LCKA 5HZNA 5IA3A 3EN9A 4PWNA 3E8NA 1YOMA 2YJRA 4NTTA 4C58A 4UWBA 4U8ZA 5CF6A 1FMKA 2YAAA 2WXVA 4FSUA 4JIAA 4N6ZA 4X2FA 2OJGA 2UUEA 4M14A 3R9HA 3DLSA 4DGMA 4CFMA 4WOVA 3HRBA 3OW4A 3CIKA 5EHYA 3V6SA 3SAYA 1WBVA 2W5HA 4YSJA 4JS8A 3L8PA 4QMSA 1J1CA 3QD0A 4AFEA 4AZFA 3QQHA 4NYEA 3IONA 2ITOA 4BGGA 3RWQA 3QZHA 4A07A 2XCHA 2W5AA 2X7FA 1P5EA 4FV7A 2GNIA 3EB0A 4P7EA 2R0UA 3O51A 5KKRB 3DBDA 4O2ZA 3MESA 2BRNA 5DFPA 3I0QA 3H0ZA 4QQ5A 3R8PA 3TZ8A 4PDYA 1OGYA 3IOPA 5AX3A 1Y8GA 4DEIA 2QR7A 3I0OA 3WYXA 5HX8A 1W2DA 2V5QA 3RPVA 3KXHA 4BN1A 3RPSA 2VZ6A 1LP4A 2ITWA 1IEPA 1BMKA 2RFDA 3HV5A 3L9NA 4LV8A 1TKIA 2WELA 1STCE 2QNJA 4G5PA 3NCGA 3CGFA 1FVRA 4FI1A 4RSSA 2WHBA 3IOKA 4AA5A 4HGEA 2G1TA 2Y9QA 4UWCA 3R7OA 3RAKA 3ATSA 4UWYA 4P2KA 2UVYA 4V0GB 1VYWA 4BHNA 1RW8A 5A46A 3CQEA 4BGHA 5LVPA 5KZ0A 1ZOGA 5FUTA 1XBBA 4G16A 2XKEA 1QPCA 3UNJA 2ZM4A 2PZYA 5B7VA 5HGIA 2OFUA 3EYHA 3QTQA 5EM7A 4EJNA 4CQEA 3DQWA 2XB7A 4JQ7A 2BAKA 4BTMA 3P9JA 4MNFA 3D5UA 4FTKA 4BDHA 3BEAA 3MI9A 4RIYB 3RINA 5CT7A 3FSFA 2R3RA 4KKHA 4FRFA 4IVBA 2QOIA 3OCGA 1RJBA 4U81A 2F9GA 4FKJA 4DG0E 2R3MA 5AUWA 3F7WA 2R9SA 2HY0A 4EORA 2PVFA 4K0YA 4ZZOA 4OT5A 1P4OA 2EXEA 3MH1A 5I9YA 4DGLC 2NPQA 3ALOA 1WVXA 3C0HA 4FTCA 2IZTA 1Q62A 5IUIA 4IHPA 4AFJA 3NNXA 4PTCA 1FOTA 3HRFA 4TYJA 2XYNA 4H39A 5CSXA 4CSVA 2OIBA 2YN8A 4MXAA 5F94A 4Z55A 4PPAA 5HX6A 3R7YA 2WO6A 1E9HA 2RG6A 3CC6A 4ANQA 3LCDA 3MA3A 4ENYA 4FYOA 4CLJA 3LW0A 2F4JA 3UG2A 1TFFA 5FQDC 3DNEA 4FT0A 1RE8A 5A4QA 4FTTA 1WBNA 4MXXA 2O8YA 2PMIA 2OK1A 2ZYBA 4XV1A 5L6PA 3TG1A 2W06A 5IQDA 3HMMA 3CQWA 1UKIA 4DFXE 1GZNA 3TCPA 1YXXA 2JC6A 3PY3A 3QRJA 3R1SA 4AE6A 5AAEA 2WOUA 2F7EE 5CZHA 4IAZA 1YWVA 2UVXA 3P79A 4FV2A 4JQEA 2B0QA 2J0JA 2ZFYA 1PXLA 2BRBA 4O4EA 4CKJA 1W98A 4MF0A 2X7OA 4TXCA 1OIRA 4Z7HA 3MFUA 2GU8A 2C6DA 2XMYA 4IM3A 4M15A 5EW3A 3ZLYA 2J5EA 3FMLA 3LZBA 4XH6A 2DWBA 5T3QA 4BZDA 4A7CA 4DEAA 3I81A 2C47A 3Q6UA 4JG7A 4R7HA 4Y72A 2ZM3A 5M44A 5C8MA 1HCLA 1ZAOA 2VN9A 4RVLA 4YGAA 5EHLA 3F3VA 3KXNA 5L2QA 4E4XA 5DYJA 2PVNA 4EK3A 1IRKA 3FC1X 4FKLA 3MH0A 5J5SA 1BL6A 3VQHA 1JPAA 2VTLA 4PMPA 3OROA 2VX0A 1QMZA 3TZ7A 4A06A 2AC5A 4MXZA 4X3FC 2YIQA 4A9SA 1MQBA 1YVJA 4RA5A 4Y85A 4YJOA 4LRKA 2OI4X 5CZIA 1U59A 3AD6A 4R1YA 3ACJA 4V0GA 3RNIA 3VF8A 2ITXA 5GZAA 4H05A 1ZMWA 1G3NA 3K54A 5HEZA 5FBOA 4HYUA 3LMHA 4CXAA 3P23A 4ITHA 4TTHB 3R8ZA 3ROYA 4ARKA 2WQNA 2JBOA 3QQJA 3VW8A 3ZXTA 3FKLA 2VTHA 2G2HA 3P78A 2A19B 2R5TA 3NUUA 4FKPA 4LGGA 5CF8A 2AUHA 3BBWA 4V04A 4RBLA 2WMAA 4EBVA 3NGAA 4AT5A 4BDIA 4RIYA 3S4QA 4EH9A 3OFMA 4FNYA 4YJQA 4QQJA 2XEZA 3QD2B 4DH1A 5CSHA 3HGKA 2WZJA 4GK2A 3ZEPA 4CCBA 4USDA 1FPUA 2CLQA 2FSTX 4GKIA 3SX9A 4IIRA 1K9AA 2YCSA 3AT4A 1OUKA 3A8XA 3E87A 3HP2A 3GFEA 4G6NA 4WNMA 4ACCA 4AW5A 4B4LA 3R8MA 4C4GA 4R78A 1H1RA 2NO3A 4GJ3A 3NFFB 2PUUA 2PL0A 1PYXA 3LQ8A 3MJ2A 3PRIA 4CYIA 2QC6A 4MBJA 3RWPA 4L42A 3NSZA 4TYIA 2OJ9A 4MXYA 4IZYA 4AA0A 2UZTA 2BZKB 2PVKA 3EZVA 4FSTA 3Q2JA 2HELA 1M7NA 5JZNA 1H8FA 3GFWA 4PMSA 2W4JA 3NUPA 4D2TA 3NCZA 5C4LA 1Q8UA 5HO6A 3PZHA 3OD6X 5AP6A 3PZEA 4G2FA 1JVPP 4WSYA 3DDPA 3KF7A 2HY81 4M7IA 2ESMA 4ZY4A 4LDTA 3LXLA 2QO9A 5IH5A 3DJ6A 5I5ZA 3TUCA 2BFXA 4USEA 1H1QA 3EL8A 5HNBA 3Q96A 3VHKA 2CCIA 3BPRA 4CRSA 2J50A 2HZNA 2ZDTA 3HX4A 3HMOA 1W2CA 1X8BA 3AC1A 4L9IA 2DUVA 1A48A 2BALA 4M97A 4WNOA 2XM9A 4TYGA 2OJIA 3VUIA 3QZGA 5BYYA 4ITJA 4FA2A 2XNEA 4EOSA 3W16A 4EOLA 2CKOA 3S2PA 1OL6A 3U6JA 5HESA 3V5QA 4BB4A 4QDVA 1JQHA 3R30A 2BTSA 4IE9A 2B54A 1IR3A 3GC9A 4ZK5A 5KBQA 4Y83A 2PE0A 3F66A 5A6OA 3UDSA 4PDPA 3BHHA 3RAHA 2IW6A 2PY3A 4Q5HA 4FV8A 2VTRA 1XH6A 3WZJA 2PE1A 4FIGA 3F6XA 5DA3A 4F78A 5CVGA 1CTPE 5DEYA 2WMBA 3MW1A 1T46A 1QPJA 4ALVA 1OECA 3IPHA 2WQOA 4ID7A 4BBMA 3WF9A 4ZTRA 4BC6A 4GT5A 3PTGA 2JD5A 2HOGA 2ETMA 3DV3A 5CVFA 4Y8DA 5IA0A 5DRBA 3NYVA 4BWXA 4CD0A 4DLIA 4C4IA 1U5RA 3GENA 4BDKA 4IVDA 4AOTA 3CQUA 1G8KA 1M2RA 1ZMVA 3VJOA 3LHJA 1NVRA 3OWPA 4AGCA 3VS7A 3D7TB 2O3PA 3JVRA 5BVDA 3HDMA 3KRXA 3WZUA 4DG3E 4AAAA 4MUQA 3BV3A 3HECA 3ENHA 4WRGA 3TV6A 3EQBA 4DINA 2VO6A 4CFXA 2H6DA 3AD4A 4GW8A 4K33A 5J8IA 1PMUA 3ELJA 3NRMA 4RLKA 3DTWA 4FGBA 5I9ZA 2JIIA 3QF9A 2ITPA 3WF5A 2FSMX 5FG8A 3RTPA 4AQKA 3LXKA 3C1XA 5CSPA 4PP9A 4EHEA 4YBJA 3CEKA 4BCKA 3JY0A 1ZRZA 4RFZA 3TUDA 3AKJA 4CFUA 3HL7A 3D0EA 3BQRA 5CT0A 5FTQA 4FJVA 2QKWB 4XG3A 3GOPA 4PRJA 2IG7A 2C6IA 3VS4A 1U54B 1XR1A 3OXZA 4F7NA 3EKNA 5HNGA 3Q6WA 4O7TA 3FLSA 2PSQA 5CX9A 5IA5A 4JDJA 4G3DA 4UMTA 5K3YA 5M4CA 1AD5A 4BFMA 4DITA 4H3QA 3ZSGA 4OTIA 5CY3A 3MFRA 3HV3A 2VWWA 4C38A 3MH2A 3OBJA 4TWOA 2V7AA 4NIFB 2YITA 5CQUA 1W0XC 3BGZA 4RMZA 2XK8A 2XP2A 1FGKA 3TV4A 2W1IA 1Q8ZA 1YRPA 2ZAZA 3FLYA 5BQ0A 2ONLC 4BKYA 2ITUA 1PXNA 1WAKA 2R3LA 4B0GA 4YSMA 3PFYA 4XLVA 4K6ZA 3UIXA 3ZUTA 5I3OA 2OXDA 2C6MA 4GIHA 2QHMA 3EOCA 4U43A 4F63A 5AA9A 1FBNA 1PMEA 4K18A 2O0UA 2BIKB 3ZLXA 2BAQA 5CYIA 5T6KA 4BWPA 2A1AB 5L6OA 2R3PA 2UZWE 2J51A 2WAJA 2BFYA 4V01A 2V0DA 5F95A 5AUTA 3UQCA 3WIKA 2W1DA 3IQ7A 4FSNA 2HAKA 4JBOA 5G1XA 4AXDA 4FKIA 4XJ0A 2W05A 5DEWA 4W8DA 3VULA 3H4JA 4BDJA 4G31A 4U3YA 2ZB1A 3LXNA 3R1YA 4EH8A 3N4VA 4CZYB 1PMNA 3KL8A 3ZRMA 4CMTA 2QO7A 1R39A 2P33A 5M55A 4TPTA 4Q9ZA 2Z02A 3RI1A 3E62A 3NW5A 4YC8A 5HTCA 2UW4A 2C0IA 5IEYA 1R78A 4YZNA 4DT8A 4RC2A 3RM7A 2FVDA 5CXHA 5L3AA 4F1OA 4IX5A 3CJFA 2CPKE 3UO6A 4BZOA 3ERKA 3BCEA 5AV2A 4KB8A 3R0TA 5HIDA 3IGGA 4DH7A 2WTVA 3OCSA 1KV1A 2WU7A 3W2QA 3W0QA 4IFCA 3U9NA 2CGWA 3ZO2A 3PG1A 3ATTA 5ANJA 2ZMDA 3D14A 4XP2A 4C3PA 3A4PA 5EQEA 5IQGA 4IDVA 2G9XA 1Y57A 4U97A 5I3RA 4E73A 2ITVA 2WEVA 2JKQA 4EUTA 4F9YA 2Y8OA 5IUGA 4UX9A 2V55A 3UP7A 3UNKA 4QMUA 5FBNC 2W1EA 2YWPA 3E3PA 4OAVB 2W17A 4O38A 2QONA 3DXQA 1XH7A 4BL1A 5B2KA 1GAGA 2XARA 4R6VA 4K77A 3UC3A 3PJCA 4C02A 4FICA 3BV2A 3FMJA 3O71A 4FKOA 4AN9A 3MTFA 1MRVA 3MH3A 4OTGA 4JR7A 2CKPA 3FBVA 4C4EA 3QTRA 4KRCA 3QUPA 5LMKC 2ETKA 4J97A 4O0TA 4RZWA 4IDTA 1TQPA 5DOSA 4BF2A 1OVEA 4OBOA 4W9WA 4D28A 4DH3A 5A4CA 5BNJA 3B8RA 4FSZA 3ZBXA 1KOBA 3NYOA 2XNPA 3CLYA 1UA2A 2J0LA 3OUKA 5HHWA 2OG8A 3MA6A 4FL1A 4NIFA 4Q5EA 5HG7A 3SRVA 3AGLA 1P14A 3VS1A 3WE4A 1CDKA 1ZZ2A 3UG1A 4I20A 4FKTA 4DEEA 1LEWA 4AT4A 4F9WA 5JEBA 2OXYA 2YDKA 4BCPA 2CGVA 3JS2A 1W2FA 3TUBA 3TACA 1ZYCA 4QDEA 4RX9A 3NAXA 1ZWSA 3FC2A 3QA0A 3QGYA 4KS7A 5CEOA 3DT1A 4FV5A 3N9XA 2DQ7X 1QPDA 4H58A 4RWKA 3R63A 2X8EA 4C4HA 4ALWA 4EQMA 5A4LA 3QX2A 1JKKA 5D7AA 5HVKA 4FF8A 4GG5A 4EHGA 4FKGA 3JR1A 3A4OX 2AQXA 2CGXA 4W4YA 3VWAA 3EFKA 1A06A 5IQBA 4OT6A 1U46A 5TE0A 3V8WA 3W2SA 4J95A 3IW8A 2RL5A 5GZ8A 1ND4A 3FMDA 1O6YA 4CGAA 4JDIA 4R8QA 1UVRA 1YHVA 3OEFX 2BZJA 1YW2A 3HA8A 4FZ7A 3PDTA 3W0NA 3Q4CA 3SVVA 3DKGA 3M42A 3OOGA 5KMOA 1M14A 3EH9A 3OS3A 2GMXA 2WTDA 2YM3A 4NSTA 4F08A 2ZV8A 1XJDA 3AT3A 2ERKA 3R7EA