5AX9A

Crystal structure of the kinase domain of human traf2 and nck-interacting protein kinase in complex with compund 9
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
282
Chain Sequence
EIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TNIK inhibition abrogates colorectal cancer stemness
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords TRAF2 and NCK-interacting protein kinase
total genus 86
structure length 282
sequence length 296
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ax9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ax9A01
2XK3A 2FGIA 4M13A 4JIKA 4YZBA 1CKPA 1KE6A 4OT6A 5EM8A 5HU3A 4I6HA 5CT7A 4NM5A 1PXJA 3SDJA 2OF4A 3CBLA 3RPRA 1I44A 1PRYA 4IVCA 3SXRA 3ELJA 3EOCA 1NVSA 2RFEA 4P2KA 2Z7RA 3ZZWA 4YNOA 3R9NA 5CF6A 1HCLA 2J2IB 2YM8A 3KB7A 5ACBC 3UMWA 2I7QA 3BKBA 3FKNA 5BMSA 5M44A 3F3VA 4FL2A 2WMTA 4JR3A 1M7QA 4FGBA 3VJNA 3CLYA 5I9ZA 3IS5A 5EK7A 1LEWA 2NP8A 4XG4A 4KRCA 2OXYA 4S30A 5CZIA 4FIHA 2ZJWA 5F9EA 3N4VA 4YHTA 4XNEA 2VWXA 4AN2A 2VX3A 5DYJA 3EL7A 5GZAA 2UZUE 2B1PA 2GNGA 1H1QA 4DBXA 3Q5ZA 3HDMA 3NSZA 5HE2A 4AUAA 2XBJA 3W16A 1OKZA 3OXZA 4KUJA 4FMQA 4HW7A 5I9XA 5L8JA 4EOJA 5E9EA 2C6DA 1YXUA 5DLSA 1M7NA 4J99A 3DGKA 1GY3A 4KIOA 2R3JA 2GPHA 3C9WA 3HAVA 1R0PA 2YA9A 5TO8A 3DY7A 4I6FA 5L6PA 3KA0A 3FI8A 3G2FA 3REPA 4J52A 3E93A 3Q9YA 3PJ2A 5L2IA 5L8LA 4ERKA 3HKOA 1VZOA 4IVDA 3THBA 2VU3A 4DCAA 3COHA 4TXCA 2HXLA 4U7ZA 3TN8A 4AX8A 4TT7A 3FZPA 3QGWA 4X3JA 5HHWA 4HGLA 3R8MA 5J1WA 2A2AA 2OKRA 3W2OA 3ENHA 3OZ6A 4L67A 4CQGA 4DG0E 4XOYA 2UZDA 2PTKA 5BNJA 3QRTA 3GVUA 5AAEA 2W9ZB 1OPLA 3EN6A 4L3PA 3EIDA 4C4FA 4CD0A 2RFNA 3NMUF 2YABA 4BIDA 3LFDA 2WTKC 3IKAA 4ZJJA 4G3FA 1VJYA 4QQCA 3EL8A 2I0YA 3R8LA 5JEBA 2W06A 2GU8A 2BIKB 4HPUE 2QOOA 2GFSA 4EH8A 4FV3A 3CKXA 3HECA 2W4KA 4CRLA 4HGTA 5LCKA 4BWXA 5C8NA 3R8VA 4JRVA 3RM7A 1KE7A 3D15A 5A4LA 5GJDA 2QVSE 4G3CA 4BTMA 1OITA 1U59A 4RJ5A 3NYVA 4LL0A 5ETFA 3W55A 3N4UA 4AGCA 1XH5A 3CPBA 3FQSA 3Q9WA 4X2FA 4IFGA 1YW2A 4NW5A 5G1XA 3KRRA 5CEIA 5C1QB 3LFAA 1QPDA 4UMQA 3P79A 5D7AA 1H26A 2PK9A 2WNTA 3BIZA 5DH3A 4FNYA 4G6NA 5AR8A 3FZRA 4ZSJA 4II5A 5BPYA 1AQ1A 3BZ3A 2X9EA 4FIIA 3MPTA 2HIWA 4O7NA 4C35A 3OOGA 2XCKA 4DHFA 3FEGA 4ITIA 2EXCX 4RX5A 2JFLA 2OSCA 3IECA 3QUPA 3GU5A 3V5QA 4D58A 5LVMA 3O8PA 4R3CA 4MBJA 5IQEA 3P9JA 3W2SA 3FYKX 4C59A 4QTEA 5KKRB 4RC2A 1QCFA 3ZUTA 4EH7A 2YIRA 3LCSA 2PZYA 3W1FA 5HQ0A 5TT7A 3AMYA 4QMZA 4G17A 4PNIA 3VC4A 4FZAB 4KBAA 4G3GA 4JOAA 5E8UA 3OY1A 4MX9A 2ZV2A 1XBBA 4O91A 2O64A 3H3CA 2B53A 2PE0A 2QC6A 5HBHA 2WU6A 4FBXA 3KY2A 3WOWA 2R7BA 5KMIA 5A3XA 2ZMCA 4OBQA 2J0LA 1U54A 4I92A 3MH1A 3W2RA 3SVVA 4U44A 1J7UA 3E3PA 4P7EA 5HESA 4CT1A 5K3YA 5CYIA 4GKIA 3UMXA 4DTAA 1GZOA 5TOZA 3SRVB 3GENA 4ZTNA 4JAJA 4NM0A 3C51A 3F88A 4JG6A 3ZLXA 3OXIA 4RSSA 3I5NA 1LR4A 4J53A 3R04A 4MNEB 3OY3A 3PPZA 2YCFA 4OAVB 2UZVA 4E6AA 5TKDA 2IO6A 2JKMA 3HLLA 3PIZA 4R6VA 4RFYA 4DBNA 2B0QA 4N4SA 5DT0A 2CGUA 4LMUA 3AG9A 1YXTA 2R7IA 2YHVA 1BL7A 3DK3A 4GFMA 4L45A 5CNNA 2X7OA 2G1TA 3KXGA 4B0GA 2B55A 3UIXA 5IH6A 4D2SA 3KKVA 2QG7A 3ZCLA 3NS9A 1PXOA 3C5UA 5E92A 3S95A 2X2MA 2XK4A 3BBWA 2J7TA 5AR2A 5E8SA 4E93A 2KULA 4V0GA 5B2LA 1OKWA 5CU3A 4NTTA 3EQBA 2Z8CA 4DITA 4H39A 4GUEA 3R83A 5EDRA 4K11A 4DINA 1JVPP 3NX8A 4XRLA 2VAGA 3BYVA 5F1ZA 4A4OA 4FGRA 2O65A 3F2NA 2QKWB 3KGAA 4FZ7A 4J7BA 5EDPA 4AOIA 4BKZA 1IG1A 5BVNA 3EB0A 3B8QA 2XBAA 3MGYA 4FV6A 5EM7A 5HO8A 4O7TA 2OFVA 4E6DA 5B7VA 3L8SA 3I7BA 4RWIA 4EHZA 4JDIA 2QLUA 3EKKA 2A1AB 2QOLA 3HRBA 4ZAUA 2OXDA 4TPTA 4NH1A 3SW7A 4C02A 2VWIA 3MFUA 1JOWB 2P0CA 4C38A 3PPJA 4XV9A 4D5KA 3NUXA 4QMXA 4XP2A 1RDQE 5JFXA 4X3FB 5IMXA 1WMKA 2QNJA 4RWKA 2I40A 3M11A 4LOOA 4QP9A 3WF6A 4H1MA 2C6TA 3LE6A 3A7FA 4CFMA 4ZJVA 4QP2A 3MH2A 3TDVA 4YPDA 2WMVA 3FXXA 4J8MA 2C30A 3OC1A 3N51A 4R7IA 1Q8YA 3ZBXA 4BHZA 4NL0A 4JDHA 4O96A 3LM0A 1PXIA 4JT3A 4PP7A 1W84A 2P4IA 4K0YA 3SA0A 3KF4A 4BDEA 3H9OA 4FV0A 3MB6A 2FO0A 3GCPA 3TV4A 3F5UA 3FE3A 4QMYA 4A9RA 5HD4A 4ZZOA 1ZOGA 2ZDTA 3RPVA 4G3DA 3PYYA 3I79A 3QFVA 4XH6A 5E7RA 1YHWA 5FGKA 2PMOX 4FODA 3DV3A 2B9JA 2J0IA 3RGFA 4D4RA 3R8PA 3F82A 4FTLA 4U3ZA 3U9NA 2YN8A 2YIQA 3HV3A 4AT3A 5CU0A 3SG8A 3RPOA 4IB0A 4KIKA 4RVTA 3PLSA 1MQBA 2BFYA 3IW6A 3MVMA 3T9IA 2FSMX 4OTGA 5IA5A 3VS3A 3HMMA 5DGZA 3I6UA 3DFAA 4ALVA 5A4EA 5AAFA 2JDRA 3E3BX 2XNGA 4O2PA 4HJOA 3D7TB 1OUKA 4JQEA 3CXWA 4AWIA 5KO1A 2YERA 3G90X 2F2UA 3POZA 3EN5A 5BVEA 3IPHA 3MFSA 5FM3A 3VQHA 3VUKA 3ZXZA 3CGFA 3NUSA 4GK4A 1JNKA 5C4LA 4FE2A 4JBQA 4K18A 4RIXB 5E8VA 5GINE 3QD0A 4TKSA 4U0IA 4ASZA 5BX0A 4BDDA 2CKPA 3LCOA 4FX3A 3HAMA 3SX9A 4RJ3A 3EZVA 3C4EA 4ASDA 4PPCA 3FMDA 1V0PA 2R3HA 4NKAA 3FQHA 5CEKA 2PE1A 3DA6A 5B0XA 3EMGA 3TKHA 4EUUA 5AV3A 4FG9A 5EQEA 4FSTA 3G33A 4R5SA 5IH5A 2BHHA 4APCA 5DRBA 4AS0A 4EC8A 2XK6A 3U6IA 3CE3A 2WGJA 3VF9A 4CZTA 5JFWA 2ZMDA 4DFYA 3F3ZA 2OH4A 5CF8A 2CCHA 4TWCA 4DGOA 4KBCA 1VR2A 1O6LA 3F3WA 3FC2A 4QPSA 1F0QA 3F61A 2C6OA 4C3RA 2CCIA 3ALOA 3P7BA 5G6VA 2GNJA 3QLFA 3KREA 4U6RA 2GNIA 3NNWA 3SV0A 2UW5A 2XNOA 4TYHA 4H1JA 4O22A 4UWYA 5CT0A 4CSVA 3BGQA 1OIRA 3GU4A 1O9UA 3PWDA 2VNWA 2VGPA 3DOGA 4GMYA 1A48A 3NCZA 3G15A 4BKJA 2PULA 1OM1A 4KNBA 5D1JA 2B52A 4NM3A 3DK6A 4UYAA 1UNLA 2BDWA 2PYWA 3ID6C 3TL8A 1CSNA 3BWFA 3A4PA 4Z55A 4QMOA 3JPVA 2BFXA 1FVVA 4AOJA 1H25A 3UBDA 4NIFB 4DEBA 4W9XA 4JL9A 4NCTA 3HMOA 5BYLA 2IZSA 4QMMA 5JN2A 4GG7A 2Y7JA 2NO3A 5AR7A 5HLPA 4WO5A 3VBQA 4LRKA 2ERZE 4MXOA 3GXLA 3C5IA 5AP0A 2V5QA 5FTQA 4O6EA 3D2IA 4O0VA 5CQUA 3L8VA 2BKZA 3B8RA 5ANIA 2RL5A 2WIHA 3QTQA 4IAIA 3HP2A 4CCBA 3OHTA 1DAYA 4ITJA 3ORKA 2OO8X 3IGOA 4MF1A 3FC1X 2VTSA 3UQGA 3IW7A 2I0EA 2C3IB 4WNPA 3QYZA 2Y9QA 5F20A 4CKIA 4UMTA 5CSPA 4DGNA 1MUOA 2EXEA 4A4LA 4W4XA 1PF8A 1UNHA 3ACKA 4JI9A 3OCTA 4YLKA 1JKKA 4YJSA 4MXCA 3H9RA 2XJ1A 2RSVA 4AACA 3BEAA 5HO7A 4KKGA 3ZRMA 4AZWA 4TW9A 5LCJA 1RJBA 3GC7A 4C8BA 5TF9A 2F7XE 2P33A 3ZFMA 1W0XC 3R8ZA 5JGAA 5E4HA 1YDSE 2AC3A 1G3NA 3ZHPC 4RFMA 4RIWA 2BIYA 2QR7A 5I9UA 5D12A 3LM5A 3QZIA 3UP7A 4RT7A 1W83A 4J96A 1FQ1B 3SAYA 4DH5A 2X8IA 3TV7A 2HENA 5CVHA 4BZNA 4I5HA 1BYGA 5LXMA 1URCA 2JAVA 3CPCA 2QU5A 2PUIA 3R7OA 3KN6A 4R3RA 5EOBA 3IDBA 3DXNA 3KMWA 2J0MB 2B9IA 4EH2A 4F7NA 2JDVA 3VBXA 1ZY5A 1M2PA 3R0TA 3AMAA 4ANSA 3O8TA 4FF8A 4FSRA 4EK3A 4YURA 2GQRA 3ZO4A 4DTBA 3MYGA 3PY3A 4C37A 3TT0A 5LJJA 3FSKA 4RJ8A 1ZOEA 4I20A 5C26A 4CV8A 4L43A 2PUNA 4FA2A 2YACA 4UZHA 5AIRA 4YSMA 4MD9E 1VYZA 4AZTA 5HORA 4L53A 5AUZA 4F9CA 2DUVA 1SNXA 4MVFA 4QMPA 4C33A 4F4PA 4LUDA 2H34A 5M09A 5BUEA 3S2PA 3ZSGA 2V7OA 3VF8A 2R4BA 3VS5A 4FZDB 4IWDA 4IXPA 5AV0A 5LOHA 3OT3A 1CKJA 3QCXA 4XG3A 4NSTA 2O2UA 4C7TA 2OH0E 5D7VA 3VHEA 1Q99A 4H3PA 2XNMA 3UVRA 4G16A 3OWPA 4X3FA 5AX9A 4AW2A 3Q2JA 3U4UA 3FYJX 3NRMA 1NT2A 4CFVA 5FQDC 2VO3A 4IHPA 5CENA 2QONA 3RAWA 4FEXA 4AT5A 3H0YA 4AGDA 4CVAA 4A06A 4AE9A 2J5FA 3H4JA 3NPCA 4DEAA 1JAMA 3GU6A 5GZ8A 4DFXE 2PY3A 3BQCA 3OTVA 3UVPA 3CY3A 5IKWA 5C27A 5CASA 5LMAA 1ZARA 4C2VA 5EI2A 3Q04A 2W7XA 3LFQA 3UO4A 5ICPA 4D1SA 4FEVA 5M08A 5CI7A 3R21A 2VGOA 4P90A 5DIAA 4ACGA 2FUMA 3BGPA 4ANBA 4FNXA 4AE6A 5DR6A 3UYTA 4A07A 4CEGA 3U55A 2GTMA 5DE2A 3NIEA 2PVKA 4O2ZA 3Q9ZA 3QYWA 4QQTA 4R1VA 4D4SA 3TM0A 2X6EA 5FM2A 5JT2A 2JIIA 3EQFA 4F65A 5AUVA 2YIWA 2Y6MA 5AA8A 4DT9A 5ANJA 4E7WA 1BLXA 3E8DA 3S1HA 4BGHA 4C4GA 4L3LA 2AC5A 3LFFA 5CEQA 3V6RA 3ORZA 1P14A 4E5BA 3QRJA 4DC2A 2YIXA 4MD8E 3G0EA 4BY9E 2VTNA 3G9LX 1IAJA 2CKQA 2WHBA 4I93A 3A60A 4AZFA 4QP8A 3JUHA 4HYHA 5JKGA 3E88A 4YZDA 2R3QA 4YTFA 4HVHA 1AGWA 3PFQA 4KKHA 3GQIA 2C69A 4RA4A 4RC4A 3NUYA 3C0HA 1W98A 1Z9XA 4AW0A 1MRVA 1PMNA 2CLXA 4M14A 3AXWA 3DB8A 4LUEA 4LGGA 2IVUA 3F2AA 3MVLA 1H00A 4FTQA 3R7IA 3TIYA 4ALWA 2G2IA 4D2RA 4AFEA 2Z7LA 3IW4A 4FNWA 4EOOA 3KFAA 2UW9A 3OEZA 4BCIA 3TNHA 4XOZA 4DLIA 5DR9A 2BRGA 3MSSA 4FVRA 4IAZA 5IDNA 5M55A 4M8TA 4M0YA 3DDQA 3VW6A 2CNVA 4NWMA 1IA8A 4FSUA 3AGLA 2ZB1A 4DE4A 1XBAA 5AFVA 1ZZ2A 2XS0A 2XYUA 3UOLA 3OOMA 5AV4A 3QZHA 2IN6A 2UZLA 3AQVA 4NTSA 4ACCA 4HPTE 4PX6A 5FEEA 3Q6WA 1KE8A 3FLQA 3DLZA 4EJ7A 2CKEA 2ITPA 2IZUA 3VULA 3EFWA 4BHNA 3RK7A 3QC4A 2RFSA 3ORTA 4FT9A 5BQ0A 4DEDA 2EU9A 2R5TA 1Y8YA 4FTMA 3KMUA 2BTRA 5H8GA 4BDBA 1WBSA 4TYEA 3AD6A 2G01A 5C8MA 3TIZA 4BFMA 4ZTQA 2H96A 3FZ1A 3EFLA 4P5ZA 1KV1A 2OZAB 4CGAA 4DFBA 3CR0A 3KMMA 4OTHA 4G5PA 4OGRA 4W4WA 3BYMA 3FJQE 4J71A 4MK0A 1WBPA 2XNNA 3Q3BA 2X4ZA 4O38A 3RK9A 5BVKA 5DPVA 2YCQA 3DS6A 1LEZA 4WRGA 4GV1A 2I0VA 3VUGA 1UU8A 3DZQA 1NXKA 2HW7A 5HG8A 4EHVA 4GS6A 4U45A 1ZMVA 3L8PA 4JIAA 3ZC5A 2ZM4A 1NVQA 2ZAZA 3HUBA 3UPZA 3PZHA 1J7LA 2ZM1A 1J3HA 3LJ2A 2OGVA 3LLTA 4CFFA 2JC6A 4M7IA 3ORLA 5AR5A 3TDWA 2FSTX 2Y4IB 1K9AA 5HE0A 4ZMEA 3BQRA 3O23A 2R3PA 3Q4CA 4FKTA 4QMVA 3R9HA 5IH4A 4YJPA 3EQCA 4RLKA 1RW8A 4YJNA 5KMOA 2ONLC 4Z9LA 1V0OA 2V0DA 3ORPA 4BIBA 3L9PA 4HYIA 1YXXA 4Z16A 4J98A 2ZB0A 3FLZA 3WE4A 4WSQA 3VS0A 3WF7A 3RWPA 3PG1A 3MY0A 5A4CA 1PHKA 2PL0A 3CTJA 5L2QA 5M57A 4ZTLA 4DLJA 2F9GA 3FLSA 3TZ7A 3HNGA 5IEXA 2YAAA 4GJ3A 3FLWA 4P5QA 5HCZA 3HX4A 3C0GA 3KK9A 4EOMA 5JFSA 3VJOA 4XCUA 4XBRA 2PU8A 2UZNA 3O0GA 1JWHA 4IM3A 4RQKA 2JEDA 5FTOA 2C6MA 2Z02A 3BGZA 4QMQA 3JVRA 2VUWA 5ITAA 4ANOA 4F09A 3QCQA 2R2PA 5DFPA 3VRYA 5IQFA 1RQQA 1SYKA 4PDPA 5LARA 4CG9A 4CT2A 4OUCA 3FHIA 3HMNA 3NUPA 3HV7A 1IRKA 3NDMA 3NIZA 3ANRA 4Y73A 4FC0A 2QO2A 3LQ8A 3F5XA 4EBVA 4FNZA 2WQNA 3QGYA 1MP8A 2BRBA 3C4CA 2GQGA 5A54A 4O0TA 3HVCA 5HKMA 3S4QA 4K77A 4LGHA 3FMKA 3NWWA 1UU9A 2GSFA 3DKGA 4GT4A 3WYXA 5J1VA 4AW1A 4PL4A 4B99A 3QTZA 4FKVA 2HZNA 2J9MA 3SOAA 2PZIA 4MBLA 4FUYA 4BDJA 4EK5A 1CKIA 3Q60A 5EW9A 5CEOA 4O0YA 4WSYA 4C58A 4GK3A 5JRSA 4TWOA 4E6QA 2O0UA 5AP5A 1R78A 4E4MA 2ITYA 4DT8A 3H10A 4O86A 3DLSA 3PJ3A 2CN5A 4JNWA 5M53A 3NNXA 4ZXTA 4CMTA 1ZXEA 4FKWA 2IW9A 4AGUA 4UBAA 4OTWA 4AF3A 1Z57A 5GJFA 1SVGA 4ZSEA 3FAAA 3MIYA 3PE1A 1XH6A 3P86A 2VTJA 3ZEWA 1H01A 2DWBA 1SZMA 3LZBA 4IZYA 4AZVA 4EZ5A 5A4QA 1Y57A 3NNUA 3FZSA 4EWQA 1M2QA 3TI1A 3BV3A 3E7OA 4WUAA 5E8TA 3DNDA 1A06A 2R64A 2XK8A 4ZJIA 3VQUA 5FEQA 5JRQA 2VX1A 5AR4A 5L2SA 1OBGA 4I5MA 3JYAA 2W4OA 1YQJA 2C1AA 5JGDA 5CTPA 1OKYA 1PXKA 1W8CA 3ETAA 3T3UA 3W2PA 4F6SA 3ZXTA 3MJ1A 4YJVA 2PVFA 4KRDA 2Y4PA 3MI9A 4YJRA 3DCVA 4FKLA 4JQ8A 4X3FC 1B39A 4F1MA 2C5OA 3KXXA 5J79A 3SGCA 2E9UA 3MA6A 4EWHA 4Q2AA 4UZDA 4X2GA 4ZY4A 3O7LB 3PIXA 4QYEA 3RVGA 3DAJA 4FI1A 3BHVA 1Q8TA 2GS6A 2WO6A 4Y5QA 5CXHA 5AV2A 2YLFA 3CEKA 3DDPA 2UZEA 3ANQA 2ERKA 2OIBA 4FG7A 3SHEA 3V51A 4DH8A 4AG8A 4HVDA 5IUHA 4BGQA 4IADA 4QRCA 3R9OA 3R9DA 3MVJA 4USEA 4WA9A 2PZ5A 3MV5A 2R3FA 4M69A 3UZPA 3A7JA 4OBPA 2OIQA 1YI3A 4CFUA 4FIEA 1OL2A 2H6DA 4O7YA 4XV2A 5CZHA 4FSWA 3PSCA 5J9LA 2XIZA 3KK8A 3PXZA 1PYXA 2IZRA 4PMSA 3R9RA 4H58A 4E26A 2BDJA 3AC3A 3AMBA 4WG5A 5ACKA 4AT4A 1OL6A 5I9WA 5HGIA 1OIYA 4BKYA 3RMFA 4CG8A 4QQJA 2XRUA 3TUCA 5EH0A 3R6XA 2OW3A 5EI6A 3S3IA 4D28A 3A99A 5CSHA 3FI4A 3LFEA 4LG4A 2W17A 4KB8A 5HE1A 1M14A 3V5JA 4B6LA 3QQHA 4DG3E 3BV2A 1GZNA 2EWAA 3DTCA 3GEQA 3UIBA 3KXNA 3FQEA 4W4VA 4I5PA 5EYCA 3RPSA 2J51A 4LMNA 3DJ7A 3UG1A 5T3QA 3IW8A 4PTGA 5KMJA 4XJ0A 2W5HA 2G9XA 4C4JA 4BDIA 3W18A 4QYGA 2PE2A 4CZYB 1YXSA 4UWCA 1QPJA 4GT3A 2YISA 3QCYA 2C5XA 4AZSA 4RZWA 2EB3A 4X6RA 3DU8A 1PXMA 3DNEA 2XYNA 3GC9A 4D2PA 4DFUA 2GNLA 2UW0A 4MWHA 3UODA 3HRCA 3TNWA 5K5NA 4IWQA 5J87A 4U42A 5AP6A 2VTHA 4O7SA 5EM6A 2BPMA 4OAUC 4KD1A 1WZYA 2W1FA 1OIUA 3B2TA 4EH9A 3HUCA 1JBPE 1YVJA 2XEYA 3DBCA 2ZV9A 3C4WA 3GFWA 3PRIA 1ZYDA 2C5YA 3HV4A 3OVVA 4JG7A 4MBIA 5BVFA 4H05A 4YMJA 1UKIA 2F7EE 2XIRA 3QKMA 3VBWA 3ZTXA 1ZRZA 2OZOA 3EQDA 3HEGA 3M42A 4EQMA 1XWSA 4EUTA 3UG2A 4YTHA 4DGMA 4YO4A 2X39A 2UZOA 4F7LA 4BCFA 3PA5A 1Q5KA 3A7GA 3KVXA 1FPUA 5M4UA 5AUYA 1H0WA 3HV6A 1B38A 3EN9A 4MF0A 2UW6A 3GB2A 5CLPA 4IW0A 2WB8A 3P7AA 2ITXA 4UMUA 1PXPA 2HWOA 3DPKA 3CP9A 2C6LA 4BB4A 1DAWA 4CLIA 5FEDA 1JKTA 4D0WA 5I9VA 4W4YA 3WI6A 2QQ7A 4EYJA 3IO7A 3FMNA 2OBJA 2UW7A 3KVWA 3ZUUA 4YSJA 3MBLA 1M17A 3MFTA 4QTCA 5CSXA 3FLYA 3OROA 4TNDA 3PVBA 4O7VA 1YXVA 2RGPA 3JY0A 4XRJA 3VBTA 3GT8A 2F57A 5HTIA 4CTCA 2R3LA 3U87A 4RVLA 3LQ5A 5DNRA 4M97A 4N0SA 3PP0A 5FP6A 2CGVA 4HGSA 3HV5A 2YDJA 4PQNA 4UX9A 4ZP5A 3KN5A 4BN1A 2W1GA 3F3UA 1H08A 2JIVA 4IIRA 3AC4A 2YWPA 1PMVA 2PZPA 5IQAA 4DEIA 4GCJA 2X8EA 2QURA 2X7FA 3COIA 3FUPA 3MW1A 4UYNA 2WKMA 2HZ4A 4XHKB 3K3JA 3AT3A 1Z5MA 5EFQA 3OUKA 4GU9A 4JX7A 3FMMA 4WD5A 1OGUA 3F5PA 3LXKA 4IWPA 3QTRA 4RIOA 3I81A 4GU6A 3QKLA 3OFMA 3ZBFA 4CNHA 5J9ZA 3ENMA 3ORXA 3R1SA 2PMIA 4L8MA 3DBQA 4KWPA 4ZSLA 3QTUA 1K2PA 4I0RA 4TYGA 2RFDA 2C3KA 2PVMA 5GZ9A 4FKIA 4PDYA 2OJJA 1H8FA 4RPVA 3ZSIA 3BELA 3MH3A 2FYSA 2BVAA 1Q24A 4RJ4A 3EQPA 4LYNA 1FGIA 3LJ1A 4XG6A 5AUTA 3VW8A 1P5EA 4M84A 4WHZA 3VS1A 4D2VA 4CKRA 2HYYA 5LVOA 1LPUA 3NUAA 4RZVA 2ZM3A 4UMRA 5AA9A 1OIQA 1BI8A 4Q9ZA 2E9VA 5HG7A 3PJ8A 4DFNA 3OW3A 2QU6A 2PWLA 4I6BA 2IPXA 1R3CA 3CJFA 1P4OA 3OW4A 4E3CA 1YOMA 1OPKA 4MKCA 4GVAA 1WBOA 3IDPA 4EONA 2JGZA 3G9NA 3LQ3A 4KS8A 3ZM9A 1XH4A 1ERKA 4JQ7A 3FPQA 5DMZA 5DN3A 4JXFA 2YDIA 4IC7A 4QP4A 2XK7A 5KMNA 4G1WA 3MH0A 3MWUA 3C4ZA 3IOPA 2IVTA 4OTRA 4L00A 1T46A 5D10A 5EM5A 4EYMA 5KZIA 4F6UA 1UA2A 1YOLA 2ZYBA 5FXSA 5CANA 3BYSA 3QTXA 3A2CA 5CX9A 3R7EA 4A9UA 5ANOA 2BHEA 2WOUA 4EOQA 4EEVA 2FSOX 4R7HA 2QD9A 4WUNA 2C1BA 2XA4A 1MRUA 1WFCA 2WQEA 2PHKA 3FLNC 3QBNA 4GVJA 4IZ5A 2ETRA 4V04A 4BYIA 4ZIMA 1PKDA 3ZRLA 2BCJA 4XYFA 3BPRA 5DEYA 3QTSA 3LAUA 4I6QA 4R77A 3OXTA 1GIHA 4IAAA 4GK2A 4QMLA 3TNIA 4BWPA 2J6MA 1OVEA 2YM4A 3A4OX 4JDKA 4LQMA 5D11A 5I0BA 2LAVA 4Y8DA 5CF5A 1WBTA 4GH2A 5FBNC 1UU7A 2JDSA 4O84A 4AAAA 2GNFA 4IWOA 4YBJA 4IAFA 5KBQA 3DQWA 2QHMA 5BUJA 3QXPA 5IEVA 4MAOA 2XZSA 1VYWA 5EHYA 3KRWA 1LP4A 4XBUA 4IANA 1FOTA 1Y6AA 2DS1A 5KZ0A 4BWKA 5CXZA 2UUEA 4A4XA 1ZYJA 4MCVA 3F6XA 3QLGA 4UY9A 4YGAA 3K2LA 5DR2A 3SQQA 3FL4A 1ZLTA 1DM2A 3E7VA 3ORIA 3ACJA 3PXRA 4YTIA 3EFKA 1UWHA 1O6YA 4MD7E 3AC8A 3R1NA 1KOAA 4WBOA 3I4BA 2WAJA 4DGGA 1DI9A 3CC6A 2YCRA 3KRJA 1NY3A 5ETIA 4D9UA 3ZYAA 4RWLA 4RJ7A 3F9NA 4OTPA 3VBVA 3VBYA 4DEHA 3Q52A 4XLIA 1JKLA 4D2TA 4F9YA 3UZTA 5HU9A 2VWZA 1FINA 4LM5A 5CALA 1BI7A 3ATSA 2VTPA 4QMWA 1OL1A 2XIXA 3V5WA 5EHOA 4QTDA 4ACMA 4E1ZA 4DFZE 3K5VA 4PTEA 4RJ6A 2XKFA 4PDSA 4ZOGA 4ORKA 5M4IA 1OUYA 3G6HA 4N6YA 3G6GA 4ID7A 4O0SA 2B4SB 3G0FA 2BZIB 2ITZA 5AJQA 4DN5A 1L3RE 2VWWA 2XKCA 4BL1A 5EW3A 3K5UA 4A9YA 4GYGA 5A46A 3WBLA 1A9UA 4FV4A 4O1OA 3I0OA 3R7UA 3TCPA 3NUNA 1GJOA 4RX9A 3GOKA 3MN3A 3U54A 4IX3A 3Q9XA 3V5PA 5HIEA 2WEIA 4UV0A 4WG4A 5CQWA 4HYUA 2RG5A 4IEBA 3NW6A 4U40A 4S34A 2EXMA 5JGBA 4FEWA 1F5QA 5T6KA 2JFMA 4RA5A 2W1IA 4NK9A 3G51A 3H9FA 4WOVA 2B54A 2WMXA 4YTCA 4YJTA 3M1SA 3RM6A 2WMWA 4BCOA 3O8UA 5J95A 4IX5A 1FVTA 3D5VA 4Z7HA 2IJMA 3ULIA 4ENXA 5HVYA 5HNIX 2OZAA 2J5EA 2YFXA 4W8DA 3ERKA 4EOIA 3U6JA 5KCVA 2WOTA 4O0UA 4QQ5A 4RVKA 5FP5A 4F0IA 4IBMA 3TNPC 4JJRA 4MNFA 3ROCA 1ZMWA 4TN6A 3W32A 4LV5A 4PP9A 2WTVA 4C0TA 2IVVA 3I5ZA 2R3MA 3UZRA 4FSZA 3COKA 2QI8A 4O6LA 3ZOSA 1MQ4A 3RHKA 3DXQA 4BBFA 4F1OA 3D14A 3Q4TA 2O63A 3V8SA 4MNEA 4W9WA 2JDOA 5GJGA 3AC5A 1IR3A 2GHGA 5HLNA 1HOWA 3F2RA 2EVAA 5KMMA 3U8WA 3R2YA 3SW4A 1PMEA 1H1PA 4HZRA 5AIKA 1H1RA 4Y83A 3DZOA 5KKRC 4C57A 4NJDA 4O81A 3ZC6A 3MY5A 3DTWA 3TKUA 1B6CB 3LHJA 3ZFYA 1PYEA 5K4IA 2VD5A 4FTRA 2WPAA 3OBGA 4FVPA 3V3VA 1YWRA 3MPAA 3VWAA 3C4FA 4BC6A 5E8YA 4M15A 1JSUA 3QQJA 4BCMA 4IC8A 4CXAA 2PVRA 3V04A 2YIYA 3ZLYA 1CM8A 1GOLA 4IAYA 5L2WA 1FVRA 2XNEA 4FKSA 5HLWA 4BCJA 5KNJA 2HELA 4JVGA 1JLUE 2VWVA 4IACA 4A7CA 4YHFA 3PWYA 2NRYA 3CTQA 4K33A 2G15A 3QX2A 4WKQA 5AMNA 3D5XA 5IMEA 2W1EA 1K3AA 5K0KA 4S2ZA 2I0HA 4F63A 3P5KA 5BVDA 3B2WA 2OXXA 1UNGA 5ANKA 1ZYSA 3OCSA 2ITQA 4NYEA 5AUUA 4IH8A 4EJNA 4JR7A 3EQRA 2R0IA 1UKHA 3WE8A 5HZNA 2VZ6A 5FUTA 3ZUVA 2IG7A 2JKKA 2C6IA 3DXPA 4ANNA 4IAKA 3KULA 5E90A 4GEOA 2V7AA 3FY0A 4ANMA 5FXQA 3RNYA 2W1HA 2W99B 3WIGA 4G6OA 3A8XA 2WEVA 3GU7A 1YWVA 3NCGA 1PW2A 3NZ0A 1NVRA 3EWHA 3P23A 4QTAA 4YZCA 3FL5A 3QAME 4NJ3A 4UB7A 4BCPA 4EKKA 4QMNA 1UU3A 4RBLA 4RMZA 4TYHB 5F95A 3DAKA 3UO6A 3JXWA 3PXKA 1WVXA 4AN3A 4F7JA 4FSQA 5GHVA 3BLHA 4G6LA 5L6OA 2XM9A 4E20A 4DG2E 2OK1A 2XJ0A 2PMLX 4IMYA 4EL9A 3V5TA 4X2KA 3LIJA 4KAOA 4QYYA 4MWIA 5FLFA 1KSWA 3UE4A 3UVQA 1OBDA 2JLDA 5DG5A 3RINA 4L6QA 2KTYA 3KC3A 5HVJA 3VS7A 2BZKB 4O7LA 1Y91A 1YHVA 4CLJA 5C8KA 3EQHA 4FV7A 3VUHA 1FMOE 2XVDA 5CEMA 3TWJA 5M51A 3QHRA 3QUDA 4LRJA 4YC3A 2O8YA 4USFA 2PUPA 3KULB 3GQLA 2XIKA 2OJGA 2XB7A 3QALE 5L2TA 4XG9A 1JKSA 2OU7A 2E9OA 4YP8A 3UC4A 1TQMA 4FTJA 2J0JA 3BLRA 1JPAA 2R3GA 2ITOA 2WMBA 4FV8A 4O83A 3EQIA 3QTWA 3R7YA 3DBEA 4ZTSA 5DRDA 3UQCA 3R22A 4ERWA 4R78A 4U3YA 4C3FA 3N9XA 3S0OA 2QOHA 3HMPA 3D94A 4E73A 5E91A 3RP9A 3UP2A 3OWKA 2YLEA 4I22A 3PUPA 3OS3A 4JS8A 3C0IA 3MDYA 2NNWB 2PVLA 3LXLA 2GNHA 4R1YA 3NVKI 2BRHA 4BF2A 2BALA 2QODA 4J8NA 3TJCA 2QLQA 2A0CX 4G34A 5FBOA 4AN9A 4MH7A 3OMVA 2PVNA 4IDTA 3R30A 4Y72A 3T9TA 3KEXA 5FRIA 4EOPA 4RIWB 2J50A 2Y4IC 3GCVA 4QYFA 5TE0A 2R3NA 2PZRA 4OTIA 1E9HA 5AEPA 5CAVA 4YPSA 5I9YA 3VNTA 3E8NA 1R39A 1ZYCA 3P1AA 2HCKA 3LFBA 3IDCA 4QPMA 1V0BA 4EZ3A 2X7GA 4K1BA 1XH9A 4WNOA 2HZ0A 4ITHA 4NM7A 4OTFA 1H28A 4RWJA 4BCKA 4D0XA 5H9BA 4IB5A 4YLJA 3OCBA 4LRMA 4ENYA 1WBVA 4M69B 3KXMA 2Z7SA 4EBWA 4F08A 5KHWA 5IPJA 5CU2A 3AC2A 1SNUA 4FT0A 5IG1A 2XMYA 4IQ6A 4QTBA 4HVIA 4IX4A 2VO7A 3IOKA 3QQLA 4RRVA 2UW8A 4BTJA 3R1YA 4IVBA 4U81A 4C36A 2G2FA 1H4LA 1HCKA 1ZMUA 3Q4UA 5K5XA 1QL6A 3BHYA 3GGFA 4CMOA 4I4FA 5HCYA 3I60A 4FT5A 2C0OA 3QCSA 5BYYA 3E8CA 4KIKB 5HIDA 5AWMA 3DAEA 2WTIA 4FV5A 2ZV7A 3CS9A 4F9BA 2QOCA 4NKSA 3SXFA 3CTHA 1QPEA 2WTCA 4XP0A 2BILB 3RALA 2CNQA 5HVKA 1H1WA 2VRXA 3C13A 3I1AA 4F70A 1ZZLA 4AOTA 5HTBA 4IZAA 4PL5A 4F1TA 4FKOA 2PVYA 4N70A 4CQEA 3RK5A 2CDZA 2X0GA 3VN9A 1QMZA 4WT6A 5IA2A 4BICA 5IEYA 3NYXA 2GHMA 4FTIA 3DFCB 3CY2A 4D2WA 3BU6A 2XP2A 3SKCA 4N57A 3NYNA 4YZMA 3QUEA 1V1KA 3R7VA 2C4GA 1ATPE 3HMIA 5EI8A 1FGKA 4AU8A 4QD6A 3HDNA 1RE8A 4TRLA 4YO6A 4ACHA 3CGOA 4G2FA 4DTKA 4F99A 3ORMA 5A4TA 4RIYB 4IB1A 1J1CA 2YZLA 4G31A 2JAMA 2JBOA 5CAQA 4LV8A 3SRVA 3QRIA 5AAGA 1Q8WA 4RFZA 5E1EA 3QQUA 2XKDA 4CTBA 4WBBB 4O7WA 3BU5A 2GS2A 2BUJA 1R1WA 3ODYX 3QL8A 2WU7A 2FH9A 1OL7A 2W5AA 2AYPA 3U51A 3QWJA 1PJKA 3CIKA 4PMTA 5LWNA 4O0RA 3PLAE 2C6KA 4GYIA 4IM2A 1Q97A 2CGWA 2HY0A 4QO9A 3TNQB 4G3EA 3CQEA 2C6EA 1KOBA 5H2UA 5J5SA 3TUBA 3BX5A 4RGJA 3BYOA 5HI2A 1TQPA 4U8ZA 4TNBA 3OF0A 3PG3A 2V22A 3BU3A 4D1ZA 4U97A 4LL5A 3S00A 4NZWB 2IZTA 3HP5A 5GIPE 2GDOA 4WG3A 2WIPA 4ANQA 4JBPA 4KA3A 4B9DA 5LMKA 2HZIA 4UN0C 4Q5EA 1XJDA 5CU6A 3WZKA 4B8MA 4NT4A 2R3OA 2O5KA 2RKUA 3MS9A 5CAPA 4KIPA 4O21A 5AM6A 1ZOHA 4PDOA 1TVOA 3EN4A 4PF4A 1ND4A 3VHKA 2C0IA 2OJFE 4L3JA 4O0WA 5CY3A 5GNKA 4C61A 5JSMA 3LKMA 4DH7A 3FI3A 2BAJA 2WTKB 4KKEA 4ALUA 3ZSHA 1U5RA 4JLCA 1SVEA 4L01A 4RC3A 4U43A 5FWKK 4YNEA 5BUIA 2QOQA 5FXRA 1OZ1A 5HX6A 3OCGA 3RZBA 5E8XA 1ZAOA 2I6LA 3GC8A 2E2BA 3IQ7A 2X2KA 2E9PA 4FYNA 3RJCA 2F2CB 4FTTA 3FBVA 3F7ZA 2F4JA 3COMA 4XS2A 4EI4A 5HX8A 4JRNA 4CFNA 1URWA 1H24A 4ZS4A 5B2KA 2HOGA 3MPMA 3ROYA 3HZTA 3O51A 2GFCA 4CYJA 4NU1A 5CS6A 4Z7GA 4ZLZA 5CNOA 4C62A 1QPCA 4C4EA 4X21A 4BCGA 4S32A 3D2KA 5EDQA 3PZEA 1NW1A 4I94A 5ANDA 5JZNA 3UGCA 4I0TA 4XG8A 3NLBA 2WMRA 4HVSA 3ZH8A 4FIGA 5CEPA 3LCTA 3NNVA 1P4FA 3FI2A 2A27A 3SC1A 4I4EA 3ZMMA 5HBJA 4FTUA 4KABA 4AQCA 2YITA 2W1CA 1XQZA 4KSPA 5EYKA 1XO2B 3BRBA 3AT4A 3BHTA 5M56A 4CFXA 3IG7A 3LXNA 3A7HA 3GBZA 4FL1A 4L68A 3L9MA 2ETKA 2W4JA 3LFSA 3PJ1A 4JAIA 4R3PA 1YWNA 4ZY6A 4KBKA 3RNIA 5CAUA 3LMGA 3PVUA 5JMSA 2R3KA 4NW6A 4BTFA 4I24A 2PVHA 4BDAA 1OI9A 3ULZA 4ZLYA 4HCVA 5H8EA 4ZZMA 1PKGA 2RG6A 4IDVA 4M12A 4ZY5A 2OLCA 4ONAA 5AP4A 4UWBA 1DS5A 4JDJA 4ZLOA 2YAKA 1SVHA 1PY5A 2QO9A 3DKFA 3UNJA 3O2MA 5M06A 4CKJA 2CKOA 4ZSAA 4ZTRA 2YM6A 3F66A 5CSWA 4APPA 3UPXA 1Q8ZA 4QMSA 4ASXA 3DJ6A 4YC8A 5AP2A 2XJ2A 2UW3A 4BDCA 5ETAA 1P2AA 4ZSGA 4FK3A 2P3GX 1WAKA 4TL0A 2B9FA 2XUUA 3EH9A 2OI4X 5DOSA 3UC3A 2OIDA 3ZO2A 3AOXA 4BZDA 2JDTA 1YI6A 2GHLA 1U46A 3R2BA 4RLLA 4O7RA 5EQPA 2O3PA 3DB6A 5HG5A 1BUHA 1LUFA 3D0EA 3BCEA 3NAXA 5KMLA 3BEGA 3WARA 2JD5A 3TG1A 3GU8A 3C7QA 4USDA 3L1SA 3Q96A 3W8QA 4QPAA 3CD3A 4GRBA 3GNIB 4HYSA 3EHAA 3NYOA 4RX8A 5FDXA 2X81A 2Z7QA 1OMWA 4R8QA 3TZ9A 3SG9A 2BRMA 1JSTA 3KL8A 3LCDA 3SOCA 4OLIA 4GW8A 1APME 2PUUA 5AP3A 4F9AA 3UTOA 1CTPE 2Y8OA 5AV1A 3FZTA 3AT2A 2WMUA 5I3OA 4X0MA 4V05A 3D4QA 4CMUA 5DWRA 3PY0A 2ZOQA 1Y6BA 4EHGA 1TQIA 3JS2A 5IA1A 5CF4A 2B9HA 4NFNA 4AA0A 2EUFB 3W2QA 3UOJA 1J7IA 2R3IA 3FV8A 3IK3A 3D5WA 5HBEA 2ACXA 4GUBA 1AD5A 4BCNA 4G5JA 1YDRE 5FG8A 2VTLA 3L8XA 5HO6A 1WCCA 4CV9A 2WXVA 1DI8A 1BL6A 3ALNA 4L52A 4ANLA 3E63A 4I23A 4XUFA 3LPBA 5LVLA 3NAYA 4O27B 3F5GA 3WIKA 4WNMA 3PDTA 4BIEA 2CJMA 2BROA 4GJ2A 3TKIA 5L3AA 4FZFB 4QP6A 5L6WL 3W8LA 1CMKE 4BDHA 4D5HA 3R71A 4XG7A 1H07A 3R00A 4UALA 1MRYA 5LVPA 3PPKA 4AA4A 3CCNA 5J5TA 3CD8A 4XMOA 1H27A 2XM8A 3GCQA 5HG9A 4DYMA 3LVPA 5KE0A 3ZS5A 3R63A 3LFCA 4FKUA 4B4LA 3E62A 3UO5A 3SXSA 3GUBA 5IQIA 2UVYA 2R0UA 4A9TA 4FR4A 4BTKA 4KIQA 3QA0A 4LGDA 4Q5HA 4DH3A 4X2NA 4L44A 5IF1A 1Q61A 3D83A 3FMEA 1YOJA 3F3TA 4QT1A 5C03A 3TZMA 3V01A 3RAHA 4B8LA 2WFYA 2QG5A 5IISA 4M67A 4M68A 3UQFA 2WELA 1PXNA 4HGEA 5L4QA 5ANGA 2HWPA 3GFEA 4W8EA 3MFRA 3OG7A 2ITUA 3PTGA 1YKRA 4C2WA 2UW4A 3UOHA 3ORNA 3EKNA 2CLQA 4TZRA 2WTJA 3EYHA 4H3QA 4FICA 3MB7A 4L9IA 3CJGA 3C4XA 3HYHA 3PA4A 3QTIA 4X2JA 3T8OA 4YC6A 3LMHA 4NCTC 5IQCA 4R5YA 3ZLWA 4BR3A 2GMXA 3Q2MA 3KRLA 5HD7A 3TV6A 4FEUA 4LI5A 4X7QA 5HOAA 4E4NA 1OPJA 2ZDUA 3TJDA 3LMIA 5F94A 1Q62A 1PXLA 4DGLC 2VTRA 4EHEA 5LMBA 4O82A 3PIYA 4BI0A 2YDKA 3FY2A 3H30A 4EORA 4MEDA 2BZJA 3HRFA 4XLVA 3Q4ZA 4GFGA 4QMTA 4MYGA 1STCE 3E8EA 1W7HA 5C9CA 4CFWA 5KMKA 2IWIA 3A7IA 2QOFA 4BRXA 2Q83A 4NEUA 3MJ2A 5EG3A 3EZRA 2W0JA 3BE9A 3A62A 3C50A 3FXWA 3JR1A 5KHXA 4L7SA 4BYJA 5BYZA 3OTUA 4ZTHA 5DBXA 2R3RA 4FV9A 4ZEGA 4BCQA 4FTKA 3EYGA 4BBEA 3HL7A 4IB3A 3QZGA 3I0QA 1CDKA 3O50A 4AP7A 3VS2A 4CCUA 3LCKA 2A19B 4EC9A 3E92A 2JKQA 3GI3A 3QHWA 4F0GA 3JVSA 2PSQA 4IVAA 1S9IA 4C3PA 1J91A 3PA3A 2BDFA 2ETMA 2ITWA 1UVRA 4YLLA 4KSQA 5AP1A 3QRUA 3WF9A 5CAOA 1S9JA 3FWQA 3QD4A 1ZY4A 3BLQA 4MXAA 2QHNA 2CSNA 5HEZA 4ZK5A 2HAKA 3VUDA 3ATTA 4C34A 4XP3A 4FZ6A 2OJIA 3D9VA 3F7WA 4ARKA 4D4YA 2REIA 2OG8A 4J97A 3AD5A 2JBPA 4FSMA 2QKRA 3UYSA 4QNYA 5EHLA 2IVSA 2C3JA 2VTMA 5DI1A 4HZSA 1Q3DA 4BDGA 1Q8UA 2F7ZE 2GTNA 2R9SA 5CSVA 3NEWA 3ZZEA 4D9TA 4C4IA 3KF7A 1UWJA 4U5JA 4CZUA 3FMJA 2HK5A 3VUMA 5F4NA 2Q0BA 4E5WA 5JFVA 1PMUA 1YDTE 4YUQA 3WZJA 5JQ8A 2BMCA 5IA3A 2QOKA 3GC0A 3QD2B 2JIUA 2V55A 2VN9A 2GQSA 4FL3A 3D5UA 3EN7A 4EH6A 4PRJA 3QQKA 2J0KA 1XBCA 4AA5A 5JQ5A 5LVNA 3LJ0A 4YBKA 5AADA 2WD1A 2F49A 3U9CA 4FOCA 1T45A 2W96B 3PRFA 1G5SA 3TXOA 5KUPA 4EK4A 2OFUA 3MTFA 2C5NA 3TZ8A 5LWMA 4PUZA 3ZU7A 1I09A 4QNAA 4PY1A 2CNUA 4IFCA 1Q41A 1KE5A 4DEEA 4I21A 4I3ZA 4K9YA 4YZNA 5IQHA 4FOBA 4EH3A 3PXQA 4PMPA 3UJGA 1KUTA 4FSYA 4RIYA 4HCUA 3RAIA 5A9UA 5I3RA 2VTTA 3CKWA 5J9YA 2W9FB 4QMUA 4HNFA 1SMHA 2GS7A 3FPMA 3K3IA 4CYIA 3ZO3A 4FKGA 4E8AA 1Q4LA 1L8TA 4OW8A 4FTCA 2IW6A 3O96A 4UXLA 3R8UA 3PE2A 2UVZA 2PVJA 1GIIA 2RF9A 1YHSA 2VNYA 2YM7A 2UZWE 3FDNA 3OWJA 4RX7A 3U6HA 5GIOE 1OECA 2ESMA 5AUXA 3QU0A 3FKOA 4ACDA 2RIOA 5H3QA 2QO7A 2X4FA 2BRNA 1Q3WA 4GIHA 5LQFA 2YM3A 2BTSA 1WBWA 3FSFA 5BMMA 1Y8GA 4DFLA 4ZTMA 3UDBA 5I4NA 3ZEPA 2YM5A 1TKIA 4MQ2A 2I1MA 3D7TA 2W05A 5CVFA 1NA7A 4J1RA 4GG5A 5KX8A 1JQHA 3HGKA 2WQBA 2CGXA 3LW0A 5I5ZA 3FKLA 4S31A 3V8TA 4RIXA 4Y46A 5D41A 3L9NA 4IM0A 3VO3A 4L7FA 4JBOA 2PMNX 3JY9A 3W10A 5FDPA 3A61A 4TYIA 4FTNA 2P2IA 2VO6A 4L42A 4FVQA 4DA5A 3RAKA 4TWPA 2X9FA 3ZONA 3WILA 3MA3A 4CRSA 5HTCA 1YI4A 4FKRA 3PP1A 1XKKA 3PSDA 4JX3A 4PMMA 4PPBA 1IA9A 3TACA 5IQDA 4N6ZA 4C4HA 3QC9A 5IUGA 5CVGA 1KWPA 3DK7A 4DF3A 4FT7A 2OICA 2WMSA 3ZFXA 3ZLSA 3OUNB 5M4CA 3QQFA 4YJOA 2JITA 4AW5A 4QYHA 5AP7A 4OTDA 1GZKA 3BHUA 3NW5A 4YHJA 4AZEA 4H3BA 3DKOA 5IUIA 2BAQA 3WZUA 4JBVA 2CMWA 4WIHA 5D9HA 3OEFX 5E8WA 4F6WA 5IQBA 2UZBA 4FIJA 1ZWSA 3QZFA 2C68A 1M52A 1BMKA 2XEZA 2XH5A 4YJUA 4TYJA 3AD4A 1VEBA 3LXPA 4FIFA 3TUDA 4IX6A 1W82A 4I1ZA 1IASA 2H8HA 4D1XA 5E1SA 3ITZA 2BZHB 3GCSA 4EZ7A 3OD6X 2XIYA 1WVYA 4D55A 4U79A 4XX9A 2H9VA 2WQOA 4IZ7A 4OBOA 2HY81 2XK9A 4HNIA 4K8AA 4Y95A 3UNZA 4FYOA 1OB3A 4PNKA 5K9IA 3DJ5A 5FTGA 4O0XA 2ITVA 1OL5A 3E64A 3UIUA 4FKQA 3QX4A 4E4LA 2OF2A 4RVMA 4S33A 3U4WA 3VVHA 3KCFA 3WZEA 2FA2A 4JG8A 3V8WA 2WTWA 4Q9SA 4RQVA 5HCXA 3H0ZA 1XR1A 4IJPA 3HA6A 5A14A 5C4KA 3AGMA 4MHAA 4AFJA 4FTAA 3NW7A 2QOBA 3WZDA 1JSVA 1J1BA 2DYLA 3IGGA 4OTQA 4GT5A 3OBJA 4XV3A 4GFOA 1U4DA 5AX3A 4ZZNA 4G9RA 3A8WA 4DEGA 2VV9A 5IQGA 2UV2A 5CWZA 3FMLA 3HA8A 5DT4A 4EQUA 5JK3A 5HIBA 3R1QA 4NUSA 4O7ZA 4TTHB 3FZOA 3ZO1A 1REKA 4M0ZA 4PL3A 5IA0A 1G8SA 4Z3VA 3ZDUA 3E5AA 3KXHA 4EH5A 5L8KA 3SD0A 5HICA 3DKCA 3V5LA 4D4VA 1R0EA 2CN8A 3PXFA 3RCDA 3MTLA 3RKBA 2VWBA 3R01A 4FV1A 4XEYA 2VWYA 4FK6A 3ZRKA 5HNBA 3CSVA 4FT3A 4EK8A 4DH1A 2VWUA 1E1VA 4I0SA 4WRSA 2UZTA 2YWVA 3RTPA 3O7LD 2E9NA 3NR9A 4PWNA 3FMHA 3MIAA 5TR6A 4NIFA 4YR8A 4ZS0A 5KBRA 2VX0A 3KQ7A 3O17A 4I5CA 3KU2A 5BVOA 3UNKA 1KE9A 4TWNA 3QKKA 2C5VA 2LGCA 4J95A 3KRXA 4X6QC 3ZDIA 5K0XA 4YZ9A 4A9SA 3ET7A 4FKJA 3TEIA 3TTIA 2BKKA 2HW6A 2Q0NA 1IEPA 5AM7A 4F7SA 3TTJA 2OWBA 4I41A 3PVGA 4IJ9A 5ANEA 2JKOA 3AC1A 3IONA 2X2LA 3R73A 1FMKA 3BBTB 1BX6A 1WVWA 5B2MA 3RZFA 5CI6A 2XRWA 3WF8A 1F3MC 5E8ZA 4EOSA 3R7GA 5JZJA 3Q5IA 4FTOA 5A6NA 4P4CA 4U41A 4EQCA 2C0TA 3DBDA 3R28A 5H8BA 3WF5A 5LMKC 2SRCA 4LOPA 1REJA 5EYMA 4U80A 4K6ZA 4G9CA 2VTIA 2XNBA 4KINA 4GSBA 2QR8A 3K54A 2NRUA 2YEXA 4ASEA 2ZV8A 5IA4A 3OWLA 1U5QA 4K2RA 3OT8A 4UMPA 3I7CA 3SLSA 3VRZA 5IZFA 4EKLA 1H0VA 2Y0AA 3CQUA 4F64A 5DT3A 4YJQA 5JH6A 4MXZA 4QP3A 4RG0A 2AUHA 2FSLX 1XH7A 4GIIA 3UOKA 2YZAA 3DBFA 4MXXA 4DCEA 3RBWA 4KS7A 3OP5A 4PPAA 3RCJA 4V01A 2GCDA 2WZJA 2W5BA 3P78A 1GIJA 3E87A 4XG2A 1XHAA 2FVDA 4ZMFA 1IAHA 3LOKA 1ZYLA 2C47A 2XKEA 2XF0A 3GCUA 3R02A 5J8IA 3MY1A 3QA8A 3VIDA 4NFMA 3KCKA 3DT1A 3GOPA 4PTCA 3VUIA 3QRKA 3BYUA 3G5DA 2BAKA 5K4JA 2WMAA 2W1ZA 4FSNA 2XNPA 2IW8A 4BI1A 4AGWA 1GZ8A 2B7AA 2EB2A 3BWJA 3V6SA 3VUTA 1U54B 3VS6A 2VTQA 3DQXA 4YU2A 3O71A 4EOKA 3MESA 5DA3A 4BBMA 4BGGA 1O6KA 2CHLA 5ETCA 3F69A 4O1PA 5DEWA 1G8AA 4QOXA 1SM2A 3MVHA 3ZM4A 5EYDA 3EFJA 5DHJA 5J7HA 3Q32A 3PJCA 5M07A 2FB8A 3RHXA 2XCHA 2VO0A 3Q6UA 3EJ1A 3QWKA 5FD2A 2NPQA 4FV2A 4FG8A 5T68A 1XH8A 3FXZA 3CQWA 2YCSA 4M3QA 3T3VA 5IU2A 4HVGA 5M4FA 4OR5A 3L9LA 2WQMA 3POOA 4UEUA 5EQYA 5HNGA 5EKOA 4BDKA 5DVRA 4BI2A 2J90A 2X8DA 3VAPA 1EH4A 5CU4A 3GP0A 3BI6A 4F0FA 3M2WA 4BZOA 2P2HA 4QP1A 5EW8A 4H36A 4BVUA 2PPQA 3UIMA 3RPYA 4PV0A 1GNGA 3PSBA 3VS4A 2A4LA 2V62A 4GKHA 1GAGA 3LLAA 4FUXA 3D7ZA 2C3LA 1BKXA 3NUUA 4EK6A 5EKNA 3FHRA 4XV1A 2CPKE 3C1XA 2QCSA 2Y6OA 4UXQA 4R7BA 3W2CA 1YRPA 3ODZX 2G2HA 5HE3A 3QF9A 2YJSA 1WBNA 3P0MA 1E1XA 3QQGA 2X6DA 4QP7A 2P55A 3P08A 4MXYA 4M66A 2WMQA 4MTAA 2OJ9A 4Y85A 2UVXA 2ITNA 3BE2A 4DAWA 3EQGA 3Q53A 4IE9A 5AUWA 2YJRA 2DQ7X 5IDPA 5AR3A 1OKVA 1UV5A 4F9WA 2HXQA 5BVWA 1M2RA 3I6WA 3NGAA 4HCTA 3P7CA 3RI1A 3PXYA 4TY1A 3WYYA 4E6CA 3RWQA 2X1NA 4L46A 4LFIA 3W33A 1X8BA 2ZVAA 2BR1A 2W1DA 2VTAA 2WTDA 2Z60A 4EOLA 3NVMB 4Y5HA 1H1SA 5A6OA 3PY1A 4FEQA 5C01A 4WNKA 2Z2WA 3LFNA 4LOQA 4U9AA 3N4TA 2ONLA 4OT5A 3PVWA 2ITTA 2QOIA 5EOLA 4BDFA 3QD3A 4E5AX 5J7BA 4FKPA 4B7TA 3BHHA 4AXAA 4E4XA 2VTOA 3KXZA 3II5A 4MQ1A 4GL9A 4HOKA 4V0GB 2J4ZA 4BCHA 3IW5A 1FBNA 4EH4A 1KV2A 3QXOA 3P4KA
chains in the Genus database with same CATH superfamily
2XK3A 2FGIA 4M13A 4JIKA 4YZBA 1CKPA 1KE6A 4OT6A 5EM8A 5HU3A 4I6HA 5CT7A 4NM5A 1PXJA 3SDJA 2OF4A 3CBLA 3RPRA 1I44A 1PRYA 4IVCA 3SXRA 3ELJA 3EOCA 1NVSA 2RFEA 4P2KA 2Z7RA 3ZZWA 4YNOA 3R9NA 5CF6A 1HCLA 2J2IB 2YM8A 3KB7A 5ACBC 3UMWA 2I7QA 3BKBA 3FKNA 4QDVA 5BMSA 5M44A 3F3VA 4FL2A 2WMTA 4JR3A 1M7QA 4FGBA 3VJNA 3CLYA 5I9ZA 3IS5A 5EK7A 1LEWA 2NP8A 4XG4A 4KRCA 2OXYA 4S30A 5CZIA 4FIHA 2ZJWA 5F9EA 3N4VA 4YHTA 3VONA 4XNEA 2VWXA 4AN2A 2VX3A 5DYJA 3EL7A 5GZAA 2UZUE 2B1PA 2GNGA 1H1QA 4DBXA 3Q5ZA 3HDMA 3NSZA 5HE2A 4AUAA 2XBJA 3W16A 1OKZA 3OXZA 4KUJA 1VLRA 4FMQA 4HW7A 5I9XA 5L8JA 4EOJA 5E9EA 2C6DA 1YXUA 5DLSA 4AAYA 1M7NA 4J99A 3DGKA 1GY3A 4KIOA 2R3JA 2GPHA 3C9WA 3HAVA 1R0PA 2YA9A 5TO8A 3DY7A 4I6FA 5L6PA 3KA0A 3FI8A 3G2FA 3REPA 4J52A 3E93A 3Q9YA 3PJ2A 5L2IA 5L8LA 4ERKA 3HKOA 1VZOA 4IVDA 3THBA 2VU3A 4DCAA 3COHA 4TXCA 2HXLA 4U7ZA 3TN8A 4AX8A 4TT7A 3FZPA 3QGWA 4X3JA 5HHWA 4HGLA 3R8MA 5J1WA 2A2AA 2OKRA 3W2OA 3ENHA 3OZ6A 4L67A 4CQGA 4DG0E 4XOYA 2UZDA 2PTKA 5BNJA 3QRTA 3GVUA 5AAEA 2W9ZB 1OPLA 3EN6A 4L3PA 3EIDA 4C4FA 4CD0A 2RFNA 3NMUF 2YABA 4BIDA 3LFDA 2WTKC 3IKAA 4ZJJA 4G3FA 1VJYA 4QQCA 3EL8A 2I0YA 3R8LA 5JEBA 2W06A 4BJJA 2GU8A 2BIKB 4HPUE 2QOOA 2GFSA 4EH8A 4FV3A 3CKXA 3HECA 2W4KA 4CRLA 4HGTA 5LCKA 4BWXA 5C8NA 3R8VA 4JRVA 3RM7A 1KE7A 3D15A 5A4LA 5GJDA 2QVSE 4G3CA 4BTMA 3UDTA 1OITA 1U59A 4RJ5A 3NYVA 4LL0A 5ETFA 3W55A 3N4UA 4AGCA 1XH5A 3CPBA 3FQSA 3Q9WA 4X2FA 4IFGA 1YW2A 4NW5A 5G1XA 3KRRA 5CEIA 5C1QB 3LFAA 1QPDA 4UMQA 3P79A 5D7AA 1H26A 2PK9A 2WNTA 3BIZA 5DH3A 4FNYA 4G6NA 5AR8A 3FZRA 4ZSJA 4II5A 5BPYA 1AQ1A 3BZ3A 2X9EA 4FIIA 3TMOA 3MPTA 2HIWA 4O7NA 4C35A 3OOGA 2AQXA 2XCKA 4DHFA 3FEGA 4ITIA 2EXCX 4RX5A 2JFLA 2OSCA 3IECA 3QUPA 3GU5A 3V5QA 4D58A 5LVMA 3PUFC 3O8PA 4R3CA 4MBJA 5IQEA 3P9JA 3W2SA 3FYKX 4C59A 4QTEA 5KKRB 4RC2A 1QCFA 3ZUTA 4EH7A 2YIRA 3LCSA 2PZYA 3W1FA 5HQ0A 5TT7A 3AMYA 4QMZA 4G17A 4PNIA 3VC4A 4FZAB 4KBAA 4G3GA 4JOAA 5E8UA 3OY1A 4MX9A 2ZV2A 1XBBA 4O91A 2O64A 3H3CA 2B53A 2PE0A 2QC6A 5HBHA 2WU6A 4FBXA 3KY2A 3WOWA 2R7BA 5KMIA 5A3XA 2ZMCA 4OBQA 2J0LA 1U54A 4I92A 3MH1A 3W2RA 3SVVA 4U44A 1J7UA 3E3PA 4P7EA 5HESA 4CT1A 5K3YA 5CYIA 4GKIA 3UMXA 4DTAA 1GZOA 5TOZA 3SRVB 3GENA 4ZTNA 4JAJA 4NM0A 3C51A 3F88A 4JG6A 3ZLXA 3OXIA 4RSSA 3I5NA 1LR4A 4J53A 3R04A 4MNEB 3OY3A 3PPZA 2YCFA 4OAVB 2UZVA 4E6AA 5TKDA 2IO6A 2JKMA 3HLLA 3PIZA 4R6VA 4RFYA 4DBNA 1ST0A 4N4SA 2B0QA 5DT0A 2CGUA 4LMUA 3AG9A 1YXTA 2R7IA 2YHVA 1BL7A 3DK3A 4GFMA 4L45A 5CNNA 2X7OA 2G1TA 3KXGA 4B0GA 2B55A 3UIXA 5IH6A 2XAMA 4D2SA 3KKVA 2QG7A 3NFFB 3ZCLA 3NS9A 1PXOA 3C5UA 5E92A 3S95A 2X2MA 2XK4A 3BBWA 2J7TA 5AR2A 5E8SA 4E93A 2KULA 4V0GA 5B2LA 1OKWA 5CU3A 4NTTA 3EQBA 2Z8CA 4DITA 4H39A 4GUEA 3R83A 5EDRA 4K11A 4DINA 1JVPP 3NX8A 4XRLA 2VAGA 3BYVA 5F1ZA 4A4OA 4FGRA 2O65A 3F2NA 2QKWB 3KGAA 4FZ7A 4J7BA 5EDPA 4AOIA 4BKZA 1IG1A 5BVNA 3EB0A 3B8QA 2XBAA 3MGYA 4FV6A 5EM7A 5HO8A 4O7TA 2OFVA 3UDSA 4E6DA 5B7VA 3L8SA 3I7BA 4RWIA 4EHZA 4O4FA 4JDIA 2QLUA 3EKKA 2A1AB 2QOLA 3HRBA 4ZAUA 2OXDA 4TPTA 4NH1A 3SW7A 4C02A 2VWIA 3MFUA 1JOWB 2P0CA 4C38A 3PPJA 4XV9A 4D5KA 3NUXA 4QMXA 4XP2A 1RDQE 5JFXA 4X3FB 5IMXA 1WMKA 2QNJA 4RWKA 2I40A 3M11A 4LOOA 4QP9A 3WF6A 4H1MA 2C6TA 3LE6A 3A7FA 4CFMA 4ZJVA 4QP2A 3MH2A 3TDVA 4YPDA 2WMVA 3FXXA 4J8MA 4MUQA 2C30A 3OC1A 3N51A 4R7IA 1Q8YA 3ZBXA 4BHZA 4NL0A 4JDHA 4O96A 3LM0A 1PXIA 4JT3A 4PP7A 1W84A 2P4IA 4K0YA 3SA0A 3KF4A 4BDEA 3H9OA 4FV0A 3MB6A 2FO0A 3GCPA 3TV4A 2XANA 3F5UA 3FE3A 4QMYA 4A9RA 5HD4A 4ZZOA 1ZOGA 2ZDTA 3RPVA 4G3DA 3PYYA 3I79A 3QFVA 4XH6A 5E7RA 1YHWA 5FGKA 2PMOX 4FODA 3DV3A 2B9JA 2J0IA 3RGFA 4D4RA 3R8PA 3F82A 4FTLA 4U3ZA 3U9NA 2YN8A 2YIQA 3HV3A 4AT3A 5CU0A 3SG8A 2NYAA 3RPOA 4IB0A 4KIKA 4RVTA 3PLSA 1MQBA 2BFYA 3IW6A 3MVMA 3T9IA 2FSMX 4OTGA 5IA5A 3VS3A 3HMMA 5DGZA 3I6UA 3DFAA 4ALVA 5A4EA 5AAFA 2JDRA 3E3BX 2XNGA 4O2PA 4HJOA 3D7TB 1OUKA 4JQEA 3CXWA 4AWIA 5KO1A 2YERA 3G90X 2F2UA 3POZA 3EN5A 5BVEA 3IPHA 3MFSA 5FM3A 3VQHA 3VUKA 3ZXZA 3CGFA 3NUSA 4GK4A 1JNKA 5C4LA 4FE2A 4JBQA 4K18A 4RIXB 5E8VA 5GINE 3QD0A 4TKSA 4U0IA 4ASZA 5BX0A 4BDDA 2CKPA 3LCOA 4FX3A 3HAMA 3SX9A 4RJ3A 3EZVA 3C4EA 4ASDA 4PPCA 3FMDA 1V0PA 2R3HA 4NKAA 3FQHA 5CEKA 2PE1A 3DA6A 5B0XA 3EMGA 3TKHA 4EUUA 5AV3A 4FG9A 5EQEA 4FSTA 3G33A 4R5SA 5IH5A 2BHHA 4APCA 5DRBA 4AS0A 4EC8A 2XK6A 3U6IA 3CE3A 2WGJA 3VF9A 4CZTA 5JFWA 2ZMDA 4DFYA 3F3ZA 2OH4A 5CF8A 2CCHA 4TWCA 4DGOA 4KBCA 1VR2A 1O6LA 3F3WA 3FC2A 4QPSA 1F0QA 3F61A 2C6OA 4C3RA 2CCIA 3ALOA 3P7BA 5G6VA 2GNJA 3QLFA 3KREA 4U6RA 2GNIA 3NNWA 3SV0A 2UW5A 2XNOA 4TYHA 4H1JA 4O22A 4UWYA 5CT0A 4CSVA 3BGQA 1OIRA 3GU4A 1O9UA 3PWDA 2VNWA 2VGPA 3DOGA 4GMYA 1A48A 3NCZA 3G15A 4BKJA 2PULA 1OM1A 4KNBA 5D1JA 2B52A 4NM3A 3DK6A 2A98A 4UYAA 1UNLA 2BDWA 2PYWA 3ID6C 3TL8A 1CSNA 3BWFA 3A4PA 4Z55A 4QMOA 3JPVA 2BFXA 1FVVA 4AOJA 1H25A 3UBDA 4NIFB 4DEBA 4W9XA 4JL9A 4NCTA 3HMOA 5BYLA 2IZSA 4QMMA 5JN2A 4GG7A 2XALA 2Y7JA 2NO3A 5AR7A 5HLPA 4WO5A 3VBQA 3BL7A 4LRKA 2ERZE 4MXOA 3GXLA 1TFFA 3C5IA 5AP0A 2V5QA 5FTQA 4O6EA 4F78A 3W0SA 3D2IA 4O0VA 5CQUA 3L8VA 2BKZA 3B8RA 5ANIA 2RL5A 2WIHA 3QTQA 4IAIA 3HP2A 4CCBA 3OHTA 1DAYA 4ITJA 3ORKA 2OO8X 3IGOA 4MF1A 3FC1X 2VTSA 3UQGA 3IW7A 2I0EA 2C3IB 4WNPA 3QYZA 2Y9QA 5F20A 4CKIA 4UMTA 5CSPA 4DGNA 1MUOA 2EXEA 4A4LA 4W4XA 1PF8A 1UNHA 3ACKA 4JI9A 3OCTA 4YLKA 1JKKA 4YJSA 4MXCA 3H9RA 2XJ1A 2RSVA 4AACA 3BEAA 5HO7A 4KKGA 3ZRMA 4AZWA 4TW9A 5LCJA 1RJBA 3GC7A 4C8BA 5TF9A 2F7XE 2P33A 3ZFMA 1W0XC 3R8ZA 5JGAA 5E4HA 1YDSE 2AC3A 1G3NA 3ZHPC 4RFMA 4RIWA 2BIYA 2QR7A 5I9UA 5D12A 3LM5A 3QZIA 3UP7A 4RT7A 1W83A 4J96A 1FQ1B 3SAYA 4DH5A 2X8IA 3TV7A 2HENA 5CVHA 4BZNA 4I5HA 1BYGA 5LXMA 1URCA 2JAVA 3CPCA 2QU5A 2PUIA 3R7OA 3KN6A 4R3RA 5EOBA 3IDBA 3DXNA 3KMWA 2J0MB 2B9IA 4EH2A 4F7NA 2JDVA 3VBXA 1ZY5A 1M2PA 3R0TA 3AMAA 4ANSA 3O8TA 4FF8A 4FSRA 4EK3A 4YURA 2GQRA 3ZO4A 4DTBA 3MYGA 3PY3A 4C37A 3TT0A 5LJJA 3FSKA 4RJ8A 1ZOEA 4I20A 5C26A 4CV8A 4L43A 2PUNA 4FA2A 3P5JC 2YACA 4UZHA 5AIRA 4YSMA 4MD9E 1VYZA 4AZTA 5HORA 4L53A 5AUZA 4F9CA 2DUVA 1SNXA 4LV7A 4MVFA 4QMPA 4C33A 4F4PA 4LUDA 2H34A 5M09A 5BUEA 3S2PA 3ZSGA 2V7OA 3VF8A 3W0NA 2R4BA 3VS5A 4FZDB 4IWDA 4IXPA 5AV0A 5LOHA 3OT3A 1CKJA 3QCXA 4XG3A 4NSTA 2O2UA 4C7TA 2OH0E 5D7VA 3VHEA 1Q99A 4H3PA 2XNMA 3UVRA 4G16A 3OWPA 4X3FA 5AX9A 4AW2A 3Q2JA 3U4UA 3FYJX 3NRMA 1NT2A 4CFVA 5FQDC 2XARA 2VO3A 4IHPA 5CENA 2QONA 3RAWA 4FEXA 4AT5A 3H0YA 4AGDA 4CVAA 4A06A 4AE9A 2J5FA 3H4JA 3NPCA 4DEAA 1JAMA 3GU6A 5GZ8A 4DFXE 2PY3A 3BQCA 3OTVA 3UVPA 3CY3A 5IKWA 5C27A 5CASA 1G8KA 5LMAA 1ZARA 4C2VA 5EI2A 3Q04A 2W7XA 3LFQA 3UO4A 5ICPA 4D1SA 4FEVA 5M08A 5CI7A 3R21A 2VGOA 4P90A 5DIAA 4ACGA 2FUMA 3BGPA 4ANBA 4FNXA 4AE6A 5DR6A 3UYTA 4A07A 4CEGA 3U55A 2GTMA 5DE2A 3NIEA 2PVKA 4O2ZA 3Q9ZA 3QYWA 4QQTA 4R1VA 4D4SA 3TM0A 2X6EA 5FM2A 5JT2A 3BL9A 2JIIA 3EQFA 4F65A 5AUVA 2YIWA 2Y6MA 5AA8A 4DT9A 5ANJA 4E7WA 1BLXA 3E8DA 3S1HA 4BGHA 4C4GA 4L3LA 2AC5A 3LFFA 5CEQA 3V6RA 3ORZA 1P14A 4E5BA 3QRJA 4LDTA 4DC2A 2YIXA 4MD8E 3G0EA 4BY9E 2VTNA 3G9LX 1IAJA 2CKQA 2WHBA 4I93A 3A60A 4AZFA 4QP8A 3JUHA 4HYHA 5JKGA 3E88A 4YZDA 2R3QA 4YTFA 4HVHA 1AGWA 3PFQA 4KKHA 3GQIA 2C69A 4RA4A 4RC4A 3NUYA 3C0HA 1W98A 1Z9XA 4AW0A 1MRVA 1PMNA 2CLXA 4M14A 3AXWA 3DB8A 4LUEA 1W2CA 4LGGA 2IVUA 3F2AA 3MVLA 1H00A 4FTQA 3R7IA 3TIYA 4ALWA 2G2IA 4D2RA 4AFEA 2Z7LA 3IW4A 4FNWA 4EOOA 3KFAA 2UW9A 3OEZA 4BCIA 4AXFA 3TNHA 4XOZA 4O4EA 4DLIA 5DR9A 2BRGA 3MSSA 4FVRA 4IAZA 5IDNA 5M55A 4M8TA 4M0YA 3DDQA 3VW6A 2CNVA 4NWMA 1IA8A 4FSUA 3AGLA 2ZB1A 4DE4A 1XBAA 5AFVA 1ZZ2A 2XS0A 2XYUA 3UOLA 3OOMA 5AV4A 3QZHA 2IN6A 2UZLA 3AQVA 4NTSA 4ACCA 4HPTE 4PX6A 5FEEA 3Q6WA 1KE8A 3FLQA 3DLZA 4EJ7A 2CKEA 2ITPA 2IZUA 3VULA 3EFWA 4BHNA 1G8JA 3RK7A 3QC4A 2RFSA 3ORTA 4FT9A 5BQ0A 4DEDA 2EU9A 2R5TA 1Y8YA 4FTMA 3KMUA 2BTRA 5H8GA 4BDBA 1WBSA 4TYEA 3AD6A 2G01A 5C8MA 3TIZA 4BFMA 4ZTQA 2H96A 3FZ1A 3EFLA 4P5ZA 1KV1A 2OZAB 4CGAA 4DFBA 3CR0A 3KMMA 4OTHA 4G5PA 4OGRA 4W4WA 4DHZA 3BYMA 3FJQE 4J71A 4MK0A 1WBPA 2XNNA 3Q3BA 2X4ZA 4O38A 3RK9A 5BVKA 5DPVA 2YCQA 3DS6A 1LEZA 4WRGA 4GV1A 2I0VA 3VUGA 1UU8A 3DZQA 1NXKA 2HW7A 5HG8A 4EHVA 4GS6A 4U45A 1ZMVA 3L8PA 4JIAA 3ZC5A 2ZM4A 1NVQA 2ZAZA 3HUBA 3UPZA 3PZHA 1J7LA 2ZM1A 1J3HA 2X0OA 3LJ2A 2OGVA 3LLTA 4CFFA 2JC6A 4M7IA 3ORLA 5AR5A 3TDWA 2FSTX 2Y4IB 1K9AA 5HE0A 4ZMEA 3BQRA 3O23A 2R3PA 3Q4CA 4FKTA 4QMVA 3R9HA 5IH4A 4YJPA 3EQCA 4RLKA 1RW8A 4YJNA 5KMOA 2ONLC 4Z9LA 1V0OA 2V0DA 3ORPA 4BIBA 3L9PA 4HYIA 1YXXA 4Z16A 4J98A 2ZB0A 3FLZA 3WE4A 4WSQA 3VS0A 3WF7A 3RWPA 3PG1A 3MY0A 5A4CA 1PHKA 2PL0A 3CTJA 5L2QA 5M57A 4ZTLA 4DLJA 2F9GA 3FLSA 3TZ7A 3HNGA 5IEXA 3ML1A 2YAAA 4GJ3A 3FLWA 4P5QA 5HCZA 3HX4A 3C0GA 3KK9A 4EOMA 5JFSA 3VJOA 4XCUA 4XBRA 2PU8A 2UZNA 3O0GA 1JWHA 4IM3A 4RQKA 2JEDA 5FTOA 2C6MA 2Z02A 3BGZA 4QMQA 3JVRA 2VUWA 5ITAA 4ANOA 4F09A 3QCQA 2R2PA 5DFPA 3VRYA 5IQFA 1RQQA 1SYKA 4PDPA 5LARA 4CG9A 4CT2A 4OUCA 3FHIA 4O4BB 3HMNA 3NUPA 3HV7A 1IRKA 3NDMA 3NIZA 3ANRA 4Y73A 4FC0A 2QO2A 3LQ8A 3F5XA 4EBVA 4FNZA 2WQNA 3QGYA 1MP8A 2BRBA 3C4CA 2GQGA 5A54A 4O0TA 3HVCA 5HKMA 3S4QA 4K77A 4LGHA 3FMKA 3NWWA 1UU9A 2GSFA 3DKGA 4GT4A 3WYXA 5J1VA 4AW1A 4PL4A 4B99A 3QTZA 4FKVA 2HZNA 2J9MA 3SOAA 2PZIA 4MBLA 4FUYA 4BDJA 4EK5A 1CKIA 3Q60A 5EW9A 5CEOA 4O0YA 4WSYA 4C58A 4GK3A 5JRSA 4TWOA 4E6QA 2O0UA 5AP5A 1R78A 4E4MA 2ITYA 4DT8A 3H10A 4O86A 3DLSA 3PJ3A 2CN5A 4JNWA 5M53A 3NNXA 4ZXTA 4CMTA 1ZXEA 4FKWA 2IW9A 4AGUA 4UBAA 4OTWA 4AF3A 1Z57A 5GJFA 1SVGA 4ZSEA 3FAAA 3MIYA 3PE1A 1XH6A 3P86A 2VTJA 3ZEWA 1H01A 2DWBA 1SZMA 3LZBA 4IZYA 4AZVA 4EZ5A 5A4QA 1Y57A 3NNUA 3FZSA 4EWQA 1M2QA 3TI1A 3BV3A 3E7OA 4WUAA 5E8TA 3DNDA 1A06A 2R64A 2XK8A 4ZJIA 3VQUA 5FEQA 5JRQA 2VX1A 5AR4A 5L2SA 1OBGA 4I5MA 3JYAA 2W4OA 1YQJA 2C1AA 5JGDA 5CTPA 1OKYA 1PXKA 1W8CA 3ETAA 3T3UA 3W2PA 4O4DA 3ZXTA 3MJ1A 4YJVA 4F6SA 2PVFA 4KRDA 2Y4PA 3MI9A 4YJRA 3DCVA 4FKLA 4JQ8A 4X3FC 1B39A 4F1MA 2C5OA 3KXXA 5J79A 3SGCA 2E9UA 3MA6A 4EWHA 4Q2AA 4UZDA 4X2GA 4ZY4A 3O7LB 3PIXA 4QYEA 3RVGA 3DAJA 4FI1A 3BHVA 1Q8TA 2GS6A 2WO6A 4Y5QA 5CXHA 5AV2A 2YLFA 3CEKA 3DDPA 2UZEA 3ANQA 2ERKA 2OIBA 4FG7A 3SHEA 3V51A 4DH8A 4AG8A 4HVDA 5IUHA 4BGQA 4IADA 4QRCA 3R9OA 3R9DA 3MVJA 4USEA 4WA9A 2PZ5A 3MV5A 2R3FA 4M69A 3UZPA 3A7JA 4OBPA 2OIQA 1YI3A 4CFUA 4FIEA 1OL2A 2H6DA 4O7YA 4XV2A 5CZHA 4FSWA 3PSCA 5J9LA 2XIZA 3KK8A 3PXZA 1PYXA 2IZRA 4PMSA 3R9RA 4H58A 4E26A 2BDJA 3AC3A 3AMBA 4WG5A 5ACKA 4AT4A 1OL6A 5I9WA 5HGIA 1OIYA 4BKYA 3RMFA 4CG8A 4QQJA 3W0QA 2XRUA 3TUCA 5EH0A 3R6XA 2OW3A 5EI6A 3S3IA 4D28A 3A99A 5CSHA 3FI4A 3LFEA 4LG4A 2W17A 4KB8A 5HE1A 1M14A 3V5JA 4B6LA 3QQHA 4DG3E 3BV2A 1GZNA 2EWAA 3DTCA 3GEQA 3UIBA 3KXNA 3FQEA 4W4VA 4I5PA 5EYCA 3RPSA 2J51A 4AQKA 4LMNA 3DJ7A 3UG1A 5T3QA 3IW8A 4PTGA 5KMJA 4XJ0A 2W5HA 2G9XA 4C4JA 4BDIA 3W18A 4QYGA 2PE2A 4CZYB 1YXSA 4UWCA 1QPJA 4GT3A 2YISA 3QCYA 2C5XA 4AZSA 4RZWA 2EB3A 4X6RA 3DU8A 1PXMA 3DNEA 2XYNA 3GC9A 4D2PA 4DFUA 2GNLA 2UW0A 4MWHA 3UODA 3HRCA 3TNWA 5K5NA 4IWQA 5J87A 4U42A 5AP6A 2VTHA 4O7SA 5EM6A 2BPMA 4OAUC 4KD1A 1WZYA 2W1FA 1OIUA 3B2TA 4EH9A 3HUCA 1JBPE 1YVJA 2XEYA 3DBCA 2ZV9A 3C4WA 3GFWA 3PRIA 1ZYDA 2C5YA 3HV4A 3OVVA 4JG7A 4MBIA 5BVFA 4H05A 4YMJA 1UKIA 2F7EE 2XIRA 3QKMA 3VBWA 3ZTXA 1ZRZA 3O5AA 2OZOA 3EQDA 3HEGA 3M42A 4EQMA 1XWSA 4EUTA 3UG2A 4YTHA 4DGMA 4YO4A 2X39A 2UZOA 4F7LA 4BCFA 3PA5A 1Q5KA 3A7GA 3KVXA 1FPUA 5M4UA 4QEBA 5AUYA 1H0WA 3HV6A 1B38A 3EN9A 4MF0A 2UW6A 3GB2A 5CLPA 4IW0A 2WB8A 3P7AA 2ITXA 4UMUA 1PXPA 2HWOA 3DPKA 3CP9A 2C6LA 4BB4A 1DAWA 4CLIA 5FEDA 1JKTA 4D0WA 5I9VA 4W4YA 3WI6A 2QQ7A 4EYJA 3IO7A 3FMNA 2OBJA 2UW7A 3KVWA 3ZUUA 4YSJA 3MBLA 1M17A 3MFTA 4QTCA 5CSXA 3FLYA 3OROA 3BLAA 4TNDA 3PVBA 4O7VA 1YXVA 2RGPA 3JY0A 4XRJA 3VBTA 3GT8A 2F57A 5HTIA 4CTCA 2R3LA 3U87A 4RVLA 3LQ5A 5DNRA 4M97A 4N0SA 3PP0A 5FP6A 2CGVA 4HGSA 3HV5A 2YDJA 4PQNA 4UX9A 4ZP5A 3KN5A 4BN1A 2W1GA 4AXDA 3F3UA 1H08A 2JIVA 4IIRA 3AC4A 2YWPA 1PMVA 2PZPA 5IQAA 4DEIA 4GCJA 2X8EA 2QURA 2X7FA 3COIA 3FUPA 3MW1A 4UYNA 2WKMA 2HZ4A 4XHKB 3K3JA 3AT3A 1Z5MA 5EFQA 3OUKA 4GU9A 4JX7A 3FMMA 4WD5A 1OGUA 3F5PA 3LXKA 4IWPA 3QTRA 4RIOA 3I81A 4GU6A 3QKLA 3OFMA 3ZBFA 4CNHA 5J9ZA 3ENMA 3ORXA 3R1SA 2PMIA 4L8MA 3DBQA 4KWPA 4ZSLA 3QTUA 1K2PA 4I0RA 4TYGA 2RFDA 2C3KA 2PVMA 5GZ9A 4FKIA 4PDYA 2IEWA 2OJJA 1H8FA 4RPVA 3ZSIA 3BELA 3MH3A 2FYSA 3W0MA 2BVAA 1Q24A 4RJ4A 3EQPA 4LYNA 1FGIA 3LJ1A 4XG6A 5AUTA 3VW8A 1P5EA 4M84A 4WHZA 3VS1A 4D2VA 2X0QA 2HYYA 4CKRA 5LVOA 1LPUA 3W0RA 3NUAA 4RZVA 2ZM3A 4UMRA 5AA9A 1OIQA 1BI8A 4Q9ZA 2E9VA 5HG7A 3PJ8A 4DFNA 3OW3A 2QU6A 2PWLA 4I6BA 2IPXA 2X0PA 1R3CA 3CJFA 1P4OA 3OW4A 4E3CA 1YOMA 1OPKA 4MKCA 4GVAA 1WBOA 3IDPA 4EONA 2JGZA 3G9NA 3LQ3A 4KS8A 3ZM9A 1XH4A 1ERKA 4JQ7A 3FPQA 5DMZA 5DN3A 4JXFA 2YDIA 4IC7A 4QP4A 2XK7A 5KMNA 4G1WA 3MH0A 3MWUA 3C4ZA 3IOPA 2IVTA 4OTRA 4L00A 1T46A 5D10A 5EM5A 4EYMA 5KZIA 4F6UA 1UA2A 1YOLA 2ZYBA 5FXSA 5CANA 3BYSA 3QTXA 3A2CA 5CX9A 3R7EA 4A9UA 5ANOA 2BHEA 2WOUA 4EOQA 4EEVA 2FSOX 4R7HA 2QD9A 4WUNA 2C1BA 2XA4A 1MRUA 1WFCA 2WQEA 2PHKA 3FLNC 3QBNA 4GVJA 4IZ5A 2ETRA 4V04A 4BYIA 4ZIMA 1PKDA 3ZRLA 2BCJA 4XYFA 3BPRA 5DEYA 4DDIA 3QTSA 3LAUA 4I6QA 4R77A 3OXTA 1GIHA 4IAAA 4GK2A 4QMLA 3TNIA 4BWPA 2J6MA 1OVEA 2YM4A 3A4OX 4JDKA 4LQMA 5D11A 5I0BA 2LAVA 4Y8DA 5CF5A 1WBTA 4GH2A 5FBNC 1UU7A 2JDSA 4O84A 4AAAA 2GNFA 4IWOA 4YBJA 4IAFA 5KBQA 3DQWA 2QHMA 5BUJA 3QXPA 5IEVA 4MAOA 2XZSA 1VYWA 5EHYA 3KRWA 1LP4A 4XBUA 4IANA 1FOTA 1Y6AA 2DS1A 5KZ0A 4BWKA 5CXZA 2UUEA 4A4XA 1ZYJA 4MCVA 4BJJB 3F6XA 3QLGA 4UY9A 4YGAA 3K2LA 5DR2A 3SQQA 3FL4A 1ZLTA 1DM2A 3E7VA 3ORIA 3ACJA 3PXRA 4YTIA 3EFKA 1UWHA 1O6YA 4MD7E 3AC8A 3R1NA 1KOAA 4WBOA 3I4BA 3TYKA 2WAJA 4DGGA 1DI9A 3CC6A 2YCRA 3KRJA 1NY3A 5ETIA 4D9UA 3ZYAA 4RWLA 4RJ7A 3F9NA 4OTPA 3VBVA 3VBYA 4DEHA 1ST4A 3Q52A 4XLIA 1JKLA 4D2TA 4F9YA 3UZTA 5HU9A 2ZFYA 2VWZA 1FINA 4LM5A 5CALA 1BI7A 3ATSA 2VTPA 4QMWA 1OL1A 2XIXA 3V5WA 5EHOA 4QTDA