5AX9A

Crystal structure of the kinase domain of human traf2 and nck-interacting protein kinase in complex with compund 9
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
296
structure length
282
Chain Sequence
EIDLSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAF2 and NCK-interacting protein kinase
publication title TNIK inhibition abrogates colorectal cancer stemness
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 282
sequence length 296
chains with identical sequence B, C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ax9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ax9A01
2QOKA 2CN5A 1FQ1B 2XIRA 2GTNA 3IW8A 1FVRA 3CIKA 5AAGA 5HNIX 3UZRA 1UU3A 2QONA 2OW3A 1BUHA 3S4QA 3Q6WA 3KC3A 4V0GB 3UOLA 4QO9A 2XJ0A 5C9CA 4R77A 4KKEA 2J90A 1WBTA 2QOBA 2EVAA 3QWKA 3CPCA 3JY9A 1SM2A 3MTLA 1UNGA 3PJ8A 2OLCA 2VN9A 3COIA 3FMJA 2XB7A 3QTRA 5HX8A 3VULA 1M2PA 4D2VA 3Q04A 4ZSGA 3OXIA 4YZNA 2YAKA 1A06A 3SHEA 2B4SB 4EZ3A 3LQ8A 2JAMA 1MRVA 3NIEA 2X2KA 4CD0A 2WO6A 3LFQA 3FMMA 4NM5A 4WSQA 1XJDA 4DH1A 3BWFA 3ORPA 4X2FA 2BRBA 3PLSA 4NSTA 4IB3A 4XBRA 4F65A 4HGTA 4KIKA 4GIIA 2VTSA 1TQMA 1FGIA 1E1VA 3TNWA 3MI9A 2HAKA 4FKJA 4U81A 2R0UA 3A2CA 2LGCA 3DK3A 1KE7A 2WMQA 3BU6A 3MB7A 3PZHA 4X3FA 5AA8A 3QBNA 5CEQA 4D5HA 2LAVA 4MBIA 3QTWA 4JDJA 1W7HA 4QP1A 4AP7A 4E6AA 4YSJA 5KCVA 3HZTA 3LCKA 3RK5A 5FUTA 4EBWA 4MYGA 3R1QA 3KF4A 4ASZA 4BCJA 5IQFA 3EFKA 2G2IA 5CAQA 5G1XA 3SOCA 2Z60A 1YHWA 4BFMA 4IXPA 3DTWA 3DDPA 2Q83A 4L3LA 5IA3A 2KULA 5T6KA 4PPCA 1ZOEA 2ERKA 2W1CA 3ETAA 2BUJA 2H8HA 2X9FA 2ZVAA 2PULA 4MCVA 3NNXA 3FMLA 1IR3A 3A7FA 5EI8A 5AUXA 3QUDA 3F2RA 3PPJA 3QKLA 3QZGA 4I0RA 3GENA 3PSCA 3U4UA 3R22A 4ANOA 4HVDA 4MBJA 4EH9A 3EFLA 3SGCA 4NU1A 3F6XA 2QOLA 2QURA 5E91A 3ZC6A 3QRUA 4ALUA 3D5UA 2ZM4A 1Z9XA 4J53A 5M4UA 4X3FC 5F94A 3RZFA 3P79A 2VWUA 3PZEA 3N4UA 1PXMA 3I0QA 1H26A 5JH6A 5ANKA 2R7BA 4EH2A 1G5SA 5H3QA 4BGQA 1WMKA 3G0EA 4X2JA 2CCHA 5FDPA 4WRGA 4AN3A 3OS3A 4PMSA 4C61A 5A4TA 3QZIA 4BDFA 5JMSA 2R3FA 3CD8A 3DBFA 4FSRA 3L9MA 1UU7A 5CNNA 3R73A 3QLFA 4O0XA 5I9UA 3KA0A 4JBPA 4YJTA 2C5VA 2WOUA 3FC2A 4BYIA 3DLSA 1OM1A 2P55A 2R2PA 3KVXA 3L8SA 4BCMA 3DNDA 3FMKA 4IE9A 3VHEA 4BI2A 2W17A 3W2SA 4UB7A 4O84A 3KCKA 4AF3A 1O9UA 3CGFA 2ITZA 3EQPA 2XJ2A 4F7JA 4CG9A 3F88A 1JSUA 2CJMA 4L00A 5FDXA 2HCKA 1WZYA 5FBOA 3IECA 2O8YA 1WBOA 2JGZA 4E3CA 2C68A 4AXAA 2CGVA 1R39A 1U59A 4GT4A 3WF8A 2DUVA 3RM7A 1QPEA 2P0CA 3TWJA 1XH8A 3BE2A 3VBVA 4G6LA 3DB6A 4OTWA 4AE9A 2ITQA 2WMBA 4FTTA 4BTJA 4JBQA 4UEUA 3SG9A 4YBJA 4AW2A 4YZCA 5BUEA 2E2BA 1P5EA 3QFVA 3LMHA 3DXPA 3JYAA 4I24A 3ORLA 1Q8TA 4GK3A 4LUDA 4IVCA 4D55A 2O65A 2PVMA 3BHVA 3KN6A 4LG4A 4AZFA 4BWXA 5FD2A 5FM2A 4G6OA 5HG7A 4U5JA 4Q2AA 2VTPA 3FE3A 5M57A 1W0XC 3R04A 4L7SA 4JVGA 5LCKA 1IAHA 3N51A 3TXOA 5EQYA 3OCGA 2WB8A 4NIFA 4QP3A 1ZZLA 3K2LA 4O6EA 3ULZA 4CG8A 4RPVA 3RNIA 4C7TA 2WELA 3ANQA 1IASA 1G8SA 3E3PA 3DV3A 3V5TA 5HU3A 2PVNA 3VUIA 3MH1A 3PFQA 4YMJA 1GIHA 4R6VA 4X6RA 2YM4A 2JKQA 4JG8A 4G31A 3VS6A 3GQLA 2WTKB 4GJ2A 4AWIA 3EFJA 4K18A 4Y5HA 4WSYA 4YZMA 2JFLA 5KZ0A 4JG7A 4CFFA 5I9XA 1RJBA 3HECA 3PJ1A 4IIRA 3VBTA 2JKKA 3E87A 3P9JA 3PG3A 3PIZA 4A7CA 5D7AA 3Q9XA 4D1XA 4E20A 4YU2A 2XK6A 4FZDB 3RHXA 4AOTA 5KUPA 4FZFB 5KMKA 4CFNA 5KMIA 4DFBA 4XUFA 2F49A 5CSXA 5HVJA 4WO5A 3R9NA 3OOGA 1UU8A 2W0JA 1O6KA 2IW6A 4PQNA 4XYFA 1MRUA 2JAVA 4GMYA 2PL0A 2RFEA 2WQBA 4XV9A 4PL5A 2WMXA 4UWBA 4AN2A 4B0GA 4QMQA 3OEFX 3TKUA 4FX3A 3DNEA 4HYIA 4FEXA 4O7WA 3SXFA 5CVHA 3IGOA 2YJSA 3BYUA 5EQPA 3KXGA 4AW0A 3LKMA 5ANOA 3SVVA 4FIJA 3KXHA 4ANNA 3LFFA 1NVSA 1PW2A 3DKOA 2QC6A 2G01A 2IZSA 4RRVA 4I94A 3COKA 1P4OA 2X2LA 4M97A 1U5QA 4Q5HA 3HKOA 1BKXA 4MTAA 3W33A 3RPOA 3GT8A 4FT9A 5A54A 3LM0A 4NYEA 4I5PA 2CNVA 4L42A 4M69A 3I79A 4YP8A 3DKCA 4WKQA 3BYVA 3EKKA 1BLXA 3WF9A 5E8WA 5A46A 4EOIA 1WBPA 3GBZA 2C0TA 5HIDA 3KRLA 4RWKA 2R9SA 4EH7A 2IWIA 4OTIA 2WMRA 1UVRA 3P7BA 1YI6A 3GOKA 3EHAA 5IEVA 4RLKA 5EW9A 3DGKA 1Q41A 3OUNB 1YXTA 2WTWA 3GCQA 3PJ3A 5JQ8A 2QOQA 4KWPA 4IB1A 5M53A 1Q62A 3A4PA 4OUCA 3RALA 4HNIA 2FB8A 3AC1A 3FL4A 4PTCA 2UUEA 1J1BA 4QTDA 1GZNA 4XV3A 4NCTC 4DCAA 4OT5A 5TR6A 2HW6A 1OL1A 3EQDA 1J7IA 4QOXA 3C13A 3NUSA 5HGIA 4RSSA 1XQZA 3R1SA 2YIWA 3WYXA 3DJ5A 4L7FA 3ZUUA 5KMJA 3EB0A 4BCNA 5J8IA 4EUTA 3R1NA 5HO7A 4DEIA 4QP9A 3HRFA 2DQ7X 5KBQA 2WQOA 3FZSA 3NYXA 4CSVA 4DT9A 5HE0A 4NM3A 4HVGA 5IMEA 3MW1A 4RA4A 4O0TA 2QR7A 2WIHA 2PU8A 4RIYB 2C6TA 3QD3A 4ZY4A 4X0MA 4Y73A 2XVDA 4CNHA 2UZBA 3QL8A 1PXNA 3Q4ZA 4F6UA 3GC0A 4HVIA 3LMIA 3HV4A 4F6WA 2QU5A 5HU9A 3LCOA 2PPQA 3GFWA 1OKVA 4ZJJA 2VWWA 4PDOA 1B38A 4U9AA 4PRJA 4KBCA 4ANLA 4B8MA 2GDOA 2VWZA 3PA4A 3VUMA 3GC8A 3FKOA 5E8YA 5C8MA 4EH3A 3JR1A 4F0FA 5L2QA 4E26A 4FUXA 1A48A 3MFUA 3UNZA 2B54A 4D2WA 4OBQA 2E9OA 3A4OX 4AA5A 4C3PA 2XM9A 2YJRA 5CQUA 4ZAUA 2IZUA 2JKOA 3VF9A 5AUTA 4O7YA 3MVHA 2W9FB 4V0GA 4CGAA 2YLEA 3TNHA 1BI7A 2RIOA 3KY2A 2RL5A 4O0WA 5AP3A 3H30A 4FSZA 3EN4A 3ZFMA 3UIBA 3WOWA 3RBWA 4Y5QA 3UP7A 4BYJA 4S30A 2JDSA 4IZ5A 3NGAA 3KEXA 5J95A 2XK4A 2OJIA 3ORXA 2WMWA 2XK9A 3FY2A 3RPRA 3MV5A 4ASDA 4MX9A 3RZBA 4M14A 4F99A 3SG8A 1M7QA 3GVUA 3VVHA 2XIZA 2B9HA 3QQLA 3UMWA 5M4CA 4IX4A 5CU4A 5B2LA 4FTNA 4L6QA 4UN0C 5EDRA 3COMA 4FV8A 3C51A 2UZUE 2F2UA 2QKWB 4FT0A 4R5YA 4ZK5A 4X2KA 4K8AA 4ACMA 5LMKA 4IANA 2QU6A 4LGHA 1YI4A 5C1QB 5CEMA 3CTJA 4W4VA 4IWDA 4AAAA 4JDKA 2ZAZA 3OZ6A 5D1JA 1FGKA 2VWBA 3MB6A 1DAYA 4EOLA 1E1XA 2Y8OA 4MNEA 3FXXA 4JXFA 4JR7A 4S33A 3FWQA 4XH6A 4QQJA 3LAUA 4UMQA 4QP8A 3U51A 3GCSA 5BYLA 3HV6A 4ZLZA 4WBBB 2VTRA 3SKCA 3V6SA 1MUOA 3S1HA 3QC9A 4DEGA 3A60A 5AP5A 3HMIA 2J0LA 2VTIA 4FV4A 5E1EA 4WIHA 2YDJA 3WZUA 5DBXA 5DPVA 2YISA 3I60A 5HVYA 4C33A 3PVUA 3QU0A 4TTHB 5CX9A 4QYHA 4BDGA 4R1YA 3Q4TA 4RBLA 5J9LA 3GU7A 4FL1A 4UBAA 5CF5A 5KHXA 4GKIA 2J4ZA 5HLNA 4KSPA 2PVYA 3TV7A 2IPXA 2VUWA 4XP3A 4J8MA 2FYSA 4GK4A 5CWZA 2OFVA 3RMFA 4O0VA 3VS1A 3QAME 5DMZA 3KKVA 4FSQA 4QMZA 4AFEA 4AFJA 1MQ4A 5AV4A 3UVRA 3R8PA 4ASEA 4C35A 5A6OA 4GH2A 1R0PA 5LMKC 4QNYA 5HEZA 1Z5MA 1P14A 4BZDA 4WNMA 3P7CA 5AV3A 4ACDA 4RMZA 3RGFA 3VQUA 3U6JA 1J91A 3PIYA 3R8ZA 5T68A 3Q52A 5AR5A 3PXZA 4C3RA 2H6DA 2W4JA 3O7LB 5EI2A 4AGWA 4K33A 1KE5A 2PE0A 4NZWB 4PWNA 4DGOA 1JVPP 2G15A 4FGRA 2PVKA 1YXSA 3DBEA 4EK5A 2JDTA 1ZYDA 4IAZA 5I0BA 3DJ6A 4CQEA 3FZRA 2GS7A 2VO0A 4OTFA 1JKLA 1M7NA 1XH7A 3DB8A 5IA4A 5LARA 1ATPE 3LFCA 4M13A 1PMEA 4KINA 3OY3A 4JT3A 5EFQA 5CXZA 1OL7A 3ATTA 3FLZA 3QRIA 4DGLC 4FKLA 5LMBA 4G2FA 3DXQA 4GFGA 4CT1A 5FGKA 3P5KA 3OD6X 4ASXA 4L67A 2ITUA 4OAVB 4H1JA 2NP8A 4RWJA 3VNTA 4ACCA 3FV8A 3G9LX 3H10A 3LQ5A 1NT2A 1H1QA 2OJJA 3LIJA 2O0UA 3RP9A 4R7HA 3SV0A 2BDFA 3TDWA 3LZBA 4C36A 3DFCB 4M67A 5I9WA 3MS9A 4K2RA 3NNVA 1OKZA 1QPDA 2FSLX 3QCYA 4NM0A 4Z16A 5KE0A 2W1DA 4RIXB 2C1BA 4TYHB 3K5VA 3EZVA 2VTLA 4IM3A 3W2OA 3T3UA 1FINA 4M84A 4LM5A 5G6VA 2R3QA 1JKSA 4F1OA 5D41A 5FXRA 5HNBA 4NJDA 5M51A 3PE1A 3BI6A 3ZSHA 3WZKA 5BUJA 5IH4A 4RQVA 3KULA 2W05A 2R3OA 2ZB1A 3FJQE 4X3JA 3BGZA 4OTHA 4AW1A 3VO3A 3NUXA 1NA7A 3UE4A 3NX8A 2VAGA 4IH8A 3ZFYA 1GOLA 5CALA 3V8WA 2X39A 4O27B 3WZEA 4KRCA 2I40A 3KGAA 1ZY4A 3F3UA 4M8TA 1FVVA 3HAVA 3AGMA 3ZLXA 2QHMA 3NNWA 4YNOA 3TI1A 3PYYA 1EH4A 2YHVA 5F9EA 3GCPA 4W4XA 5L8KA 1QCFA 2XNNA 2REIA 3P08A 4Y72A 2XNPA 3OT8A 3W2RA 3R7VA 4FIEA 2WQEA 1TQPA 5C01A 2W1HA 3UDBA 4EORA 3L9PA 2R3JA 1YWVA 4RWIA 3L8PA 3P7AA 1QL6A 3V8TA 5EW8A 1YOLA 5EG3A 2R64A 5DYJA 2J6MA 2HK5A 1ZLTA 2DWBA 4C4IA 2QVSE 5AP4A 3B2WA 3KFAA 5L3AA 4P5ZA 5KZIA 1P2AA 4P4CA 5EYKA 2EB2A 4GCJA 2GS6A 1ZZ2A 5JZJA 5IISA 3G51A 3GXLA 4AW5A 4H05A 4AQCA 2YIQA 2ONLC 2BFXA 5FXQA 2VRXA 4D9UA 2BZKB 4EOKA 3K5UA 3PVWA 4MHAA 4FL2A 3ACKA 2Z7QA 4GEOA 3E93A 3ZDIA 2QLQA 1GNGA 1W8CA 1WFCA 4TWNA 2X4FA 5HHWA 3VW6A 4O83A 3NYVA 3HA6A 4NUSA 4DLIA 4WD5A 2G2HA 5LVOA 1ZMUA 2QO7A 4IZAA 1XBBA 4S32A 3NVMB 4HGSA 2C6MA 4KS8A 3UPZA 5CVGA 4ZS0A 4KB8A 4KKHA 4RT7A 5GNKA 3NLBA 5JRQA 5TOZA 3VJOA 5EQEA 2A27A 4DCEA 5HCXA 3ENHA 1GAGA 3FYJX 4PV0A 2X2MA 5BVKA 3GC9A 4O2ZA 4IZ7A 4RVKA 1REKA 3GQIA 2JIIA 3V5PA 4CVAA 3DFAA 4A9SA 3RTPA 2VTJA 2BTSA 4A06A 4HCUA 4FKOA 4DEAA 2IZTA 1PKGA 4BKJA 3KRXA 4KSQA 2QOFA 3Q32A 4UYNA 5D12A 3RPSA 4CQGA 4EBVA 1H1PA 3MFSA 1LEWA 3D14A 4FTRA 5IQIA 4OTPA 2OU7A 3DKFA 3VS4A 4IVDA 4F4PA 4CMTA 4A9TA 2WPAA 3IQ7A 4KD1A 3VS7A 4B6LA 2XKDA 3MPMA 1I09A 4IWQA 4FKPA 4QQTA 4ITHA 4FV6A 5IG1A 4F7LA 2C1AA 2A1AB 4OW8A 1H00A 4FVPA 2RG5A 4F9BA 1Y6AA 2UZWE 4DA5A 2R3HA 4RIWA 5A4QA 4D0XA 3H9FA 2VWXA 3HAMA 2C6EA 4GVJA 4PTGA 5DOSA 4HVHA 3JVRA 4UALA 1KE6A 3W18A 3IDPA 4YJSA 4MVFA 4FYNA 2YM7A 3VS0A 3MSSA 5LWMA 3VRYA 4EHZA 3VUGA 4DH8A 4DEEA 4MAOA 2GNJA 5HBJA 5AM6A 5AEPA 1CMKE 4YNEA 5GZAA 5IQEA 3O8UA 3GB2A 3PPZA 4NW5A 4LV5A 5DR2A 5HCYA 4FE2A 5CS6A 3GEQA 4IVBA 2OJFE 5K5NA 4E7WA 3GC7A 4XG4A 4IVAA 4EWHA 2BRNA 2YCQA 4JQ8A 4EC9A 4DF3A 3QLGA 3FXWA 2C6KA 3QRKA 3DAJA 2A4LA 5AUYA 5DEWA 4I4FA 4APCA 4IDTA 2WXVA 2YAAA 3DZOA 4W9XA 3UYTA 4KUJA 1G8AA 2XIXA 4Y46A 4AZVA 4NTTA 5CLPA 4EL9A 2QLUA 4L3JA 4EKLA 4I1ZA 3E5AA 2GQSA 5L6PA 2KTYA 4RVLA 2YCRA 3E92A 5J9ZA 3NMUF 4CZTA 4E1ZA 5HZNA 4ERKA 3OVVA 5AP0A 4AGCA 1XBAA 3OCSA 4K11A 4UMUA 1LEZA 3C0HA 2XMYA 3Q6UA 2XUUA 3VBWA 1NXKA 4KKGA 2C6DA 4TKSA 4O2PA 4X2NA 4RA5A 3ZBXA 4EUUA 4JRNA 1YHSA 3AMYA 3R30A 3ZCLA 5BQ0A 2JDVA 1H0WA 1Y91A 1PY5A 3O23A 4M12A 5CI7A 2X7GA 5L6OA 1ZARA 3ELJA 3UG1A 4DFLA 4E4NA 3FLWA 3NNUA 4D28A 1OKWA 3VQHA 4FV9A 5CXHA 2W1EA 3H0ZA 3U87A 4GU9A 3R0TA 4TXCA 1ZRZA 3D0EA 3ROCA 3C4FA 5EYCA 3PRFA 1Q3DA 5ANDA 4BC6A 1VJYA 4FSUA 4FV7A 4RZVA 4YJRA 4EJNA 5BVOA 5J1WA 1JOWB 3QQGA 3FZOA 2W5AA 3D2KA 4EYJA 4TRLA 5AR4A 1R0EA 5IDNA 3CY2A 1OMWA 4NKSA 2O3PA 3FUPA 5AJQA 4AE6A 1HCLA 3HP2A 3W16A 1KWPA 4YO6A 3I0OA 5C27A 3ULIA 4U45A 3UODA 2XK7A 2B0QA 4NL0A 4IM2A 3PTGA 3U55A 3RHKA 3ZU7A 4ACHA 5JFWA 3VF8A 5JT2A 3VAPA 3OBGA 3QX2A 4EHGA 3TG1A 4I6QA 2XNEA 2YDIA 2XH5A 1YOJA 4USFA 3KMWA 3LVPA 4BWKA 2PMOX 3A7HA 2OJ9A 2EXEA 4OTRA 4RFYA 3HMMA 5LMAA 2Y9QA 5CZIA 3OY1A 4NT4A 3SD0A 4BN1A 2G2FA 5FRIA 5JSMA 5GIOE 3MFRA 3MH3A 4F1TA 4IZYA 4C0TA 2X7FA 3LE6A 3RM6A 3KXXA 4FC0A 1OPLA 2ETMA 2Z02A 5DT3A 3FMEA 3ZFXA 4BCFA 3T8OA 3QA0A 3CS9A 4EONA 3WF5A 2OXXA 4AX8A 1OZ1A 3BPRA 2QO9A 5FWKK 4ZMFA 3O50A 4R3RA 4S34A 5EHLA 3TT0A 2FVDA 2C5YA 3LOKA 4I6FA 4W9WA 3D83A 5AFVA 1Q99A 1XHAA 4HVSA 3UQGA 4GUBA 1SZMA 2OK1A 3DZQA 3MDYA 4CRSA 3IW6A 4G5JA 4EH5A 2CGUA 1YDTE 3RI1A 4ZY6A 2E9UA 2QODA 4FODA 1Q5KA 1UV5A 3F2NA 5FBNC 3ZH8A 2GNGA 4F0IA 5AUUA 1M2QA 1AD5A 3FMDA 4TW9A 2X6DA 3NYNA 4I22A 5ANJA 4DFXE 3SXSA 3W2QA 2BVAA 3UOJA 2UW9A 3UYSA 4BRXA 3LQ3A 4ZZMA 4DFYA 3TZ9A 3OWJA 3ALNA 3F3ZA 2GQRA 4FKSA 5HI2A 4FTMA 1WAKA 3LXPA 3GUBA 3UVPA 4R1VA 2AC5A 4NFMA 3C4XA 3V5LA 4RX5A 2IJMA 3CJFA 5CSPA 2RSVA 1YOMA 1OIYA 3UNKA 3GU6A 1OVEA 4FV5A 3F9NA 3A7IA 3EQHA 4QTAA 3TNIA 4PL3A 5DRDA 3W10A 3O17A 2YN8A 4CRLA 2YCFA 5HX6A 3ZM4A 3C5IA 3MPTA 1U46A 4QTBA 5AM7A 4XV1A 3T3VA 3DPKA 3IONA 3QTZA 1TKIA 3TZMA 4FIFA 5KNJA 1WBWA 5LVPA 3G15A 1V0BA 2YITA 2PMLX 3R9OA 4IAFA 2UZLA 3ZUVA 2VNWA 4KIOA 3QF9A 3T9TA 2WEIA 4GUEA 4I3ZA 3QUEA 2HOGA 3REPA 3AC5A 3D94A 2PVFA 4RFZA 3RCDA 4CTCA 2P2HA 3AG9A 3MN3A 3L8VA 1QPCA 2YCSA 3ORZA 4WG3A 4XLIA 4BR3A 3NDMA 4G1WA 5HE1A 2VTNA 2XM8A 4O7SA 4DGGA 4EI4A 4LRKA 4HJOA 3LFBA 1LPUA 4E8AA 4YJNA 3ITZA 4GV1A 4KBKA 2QQ7A 3HDNA 4I20A 4FK6A 4QRCA 4QMWA 4AT5A 3MY5A 5ICPA 3QCSA 4CCBA 1SNXA 5K9IA 5LWNA 4N4SA 4XG7A 3E8DA 4QYEA 3GP0A 4KNBA 4U8ZA 2F7ZE 2B53A 3UIXA 3VIDA 2UW5A 1DS5A 2HENA 2OXDA 2WTDA 2ZYBA 3FC1X 2OSCA 2CSNA 3A61A 3WI6A 3ZC5A 3ZLYA 2XKEA 2R3IA 5M06A 3CEKA 3OP5A 1H0VA 3ENMA 3QRTA 4KBAA 4LGGA 4H3BA 5IH5A 4C3FA 5IDPA 2WU6A 4QMVA 2QHNA 4G3EA 3V5WA 1R3CA 4L68A 5IA0A 2CCIA 3SRVA 2WZJA 3LJ1A 4IB5A 4IHPA 1PMUA 1H1SA 4XCUA 4HZRA 2AC3A 3I5ZA 3Q9WA 5B0XA 3QTQA 4DHFA 4FGBA 3BWJA 3PXQA 3PXKA 3LM5A 2C6IA 4E5AX 1YDRE 4KABA 3LCDA 4MD9E 4TWCA 4X7QA 5I9YA 3EQRA 4EOJA 4EHVA 3HRCA 5CEKA 3M11A 5CEPA 3M42A 3NR9A 4R7IA 4RJ8A 5AA9A 1FMOE 3L9NA 2JBPA 4I23A 1CTPE 5L8JA 1PXJA 3V01A 1V0OA 4M0ZA 2EXMA 4IWPA 4IB0A 4K77A 3EWHA 3F5PA 5B2KA 4BCOA 1DAWA 1H8FA 3F5GA 4I21A 3D9VA 4OT6A 4BVUA 1Y8YA 2JDOA 3IOPA 1M2RA 2XRWA 3QQKA 3QXOA 3R7GA 4UV0A 3W8QA 1JSTA 5CT7A 4B99A 5AADA 5IA2A 1JNKA 2ZV9A 1S9IA 3PWYA 4C37A 3ZXZA 2GFCA 4BTMA 2I0HA 1TQIA 3HA8A 1PXIA 3VS3A 4JX3A 2W7XA 3DBDA 4FTAA 2HWPA 4ITIA 4JQEA 4QYFA 3MY1A 2ETKA 4PMPA 3AT2A 4XLVA 4P5QA 3CJGA 5FEEA 1CDKA 5KKRC 4CXAA 4ZJVA 2R7IA 4RZWA 4FMQA 2ITVA 2VTTA 4MK0A 1J3HA 3AMBA 4JAIA 5AAFA 5LOHA 4JRVA 3R7UA 2E9VA 3SOAA 4S2ZA 3QZFA 3VWAA 2W5HA 1GJOA 4O0SA 1B6CB 4FTLA 4B4LA 1Q4LA 3R9RA 1ZMVA 4F7NA 2PMNX 1CKPA 3BU5A 2UZVA 4D1SA 1ZYLA 2GFSA 2CPKE 3UO6A 5IQBA 4BCIA 3EN9A 2JEDA 4HYHA 4QYYA 4NKAA 4BF2A 4CFWA 4WA9A 5I5ZA 4FNZA 3OC1A 3JPVA 2ZJWA 2OIQA 3MTFA 3TL8A 2HY81 3UVQA 3ZO2A 2VWIA 3L1SA 3LFDA 4P2KA 4M66A 2UW4A 1PXLA 4J99A 5DI1A 3DJ7A 2BKZA 2XBAA 4ITJA 2RFDA 4IC8A 4IACA 3VS2A 3S00A 4JR3A 2Y6MA 3QA8A 5C26A 4R8QA 2J50A 2J0KA 4BBFA 4BDJA 4QPMA 4CFMA 3EH9A 3NAYA 3AGLA 4MWIA 3ZLWA 3PE2A 1DM2A 5L6WL 2A2AA 3E8NA 2C3IB 3ORMA 4FVRA 2WTIA 4RWLA 5E8XA 5EHYA 4NTSA 4FG9A 5AUVA 4BDCA 1MQBA 3AC8A 4FEUA 3H9RA 1Q8UA 3O71A 2WMTA 2HZIA 1WBNA 3OOMA 4FA2A 4ORKA 4LOOA 5GZ9A 5A6NA 2C6LA 2GU8A 3NW6A 3G90X 2XEYA 4O82A 4CYIA 1W98A 4F9YA 5E8TA 1W84A 3VUKA 4OLIA 3FEGA 1OITA 5I4NA 4LOQA 3GU4A 1WVXA 4QTCA 4C4EA 4EK4A 3R2YA 4A4LA 3D7TA 4FICA 2VU3A 2QG5A 4QP4A 4AU8A 4FBXA 4XHKB 4O7VA 3F3VA 2VTAA 3PJCA 3FSKA 5EH0A 2ESMA 2JD5A 4YZDA 3H0YA 5DG5A 5H8BA 4E4LA 4D2RA 5HLWA 3R02A 4GKHA 4D2SA 2IG7A 3Q2JA 5HNGA 2PZRA 3KQ7A 1ZAOA 2F7XE 5HE3A 4WOVA 3WF6A 1CKIA 4AOIA 1F3MC 1NVQA 2Y4IC 2JFMA 2JLDA 2XKCA 2Q0NA 3I7CA 3I4BA 4ZTQA 2FH9A 3BGQA 2PE2A 2CKQA 3I81A 3A7JA 2VV9A 4L44A 5J9YA 3OROA 4FNXA 1GIJA 2OZAB 3CTHA 4LV8A 3CKWA 5CYIA 2GQGA 4WNKA 3DAKA 2C30A 3O8PA 4C02A 4O0YA 2OG8A 4U44A 2ZDTA 1UNHA 3IS5A 4BBMA 1WVYA 1YWNA 3E8CA 3PJ2A 4DG2E 4FIHA 4JAJA 4XG9A 5H9BA 4FTIA 4F1MA 1OL2A 3MWUA 5IKWA 4FEVA 3E3BX 3MH2A 2WMUA 2OH4A 2UW0A 2VTMA 5GJGA 3BHTA 5AP1A 4XBUA 4Z3VA 1JQHA 4YBKA 4FKRA 4J71A 2BAKA 3I7BA 3UP2A 4FOBA 2V55A 4GG5A 1H27A 3H3CA 1I44A 4MF1A 3IW5A 5E7RA 1MRYA 2FSMX 4ZTRA 3BRBA 5JZNA 2GNHA 2X8IA 3VHKA 4GYGA 5BVEA 1VYWA 2PK9A 2WIPA 4YGAA 4DG0E 4U40A 3IW4A 2FUMA 2C5NA 5IQDA 5C03A 5B7VA 5LVNA 4O21A 3PSBA 4Q9SA 5EDPA 4LQMA 4FV3A 4JIKA 5TO8A 4HOKA 4I5HA 5M55A 3R8MA 4TYEA 5HG8A 3UG2A 4D4RA 5CASA 2HXLA 3FI4A 4FV1A 2J5FA 3BCEA 2HW7A 2I1MA 2ITOA 4DLJA 1ZMWA 2BAQA 3CKXA 2DS1A 2OI4X 2W9ZB 3TV4A 2WMAA 4UWCA 4EQCA 4MKCA 4CKIA 5IA1A 2XYUA 4IFCA 4IC7A 1RQQA 5CNOA 3ZLSA 5J79A 3F66A 3NUAA 4TZRA 1GZOA 4WG4A 5E90A 4B8LA 3HDMA 3WBLA 3NWWA 3NCGA 5EM8A 2BR1A 3PDTA 2WTVA 1H07A 2BHEA 4W4YA 5FP6A 3TN8A 3PXRA 4QMTA 2GHMA 5HO8A 5I9ZA 2C47A 3KRRA 2ITWA 2F9GA 3P4KA 4A9RA 1RW8A 2NPQA 1W83A 2ZMDA 4OGRA 3P86A 3V5JA 4B9DA 2CLXA 4IX5A 1H1RA 3BQRA 3TTIA 3BHUA 3FLSA 4E4XA 3Q9YA 5IQHA 1KSWA 3EQCA 4PUZA 5IZFA 5CENA 4NM7A 1X8BA 3TUCA 5TKDA 3LXNA 3RJCA 5IUGA 3R28A 5A3XA 3KN5A 2H96A 4EOPA 4KIKB 4FG7A 4GT3A 5DFPA 1ZXEA 4EK3A 3R7YA 3H4JA 4ZZNA 4U6RA 4X3FB 3LXKA 2HY0A 3GOPA 1Q3WA 3U9NA 4DT8A 5TE0A 3ZO4A 3V51A 3BU3A 1M14A 2HZ4A 2W4OA 4JJRA 4M0YA 4NH1A 2YLFA 4IJPA 3EKNA 3HMNA 3LCTA 3UC3A 4RIOA 4FK3A 3QALE 1J1CA 2RFNA 3ZZWA 4BKZA 2WOTA 5F95A 3WE8A 3PWDA 4PMTA 3PP1A 1XH6A 4MD7E 4MXZA 4KIQA 3BX5A 5K4IA 2QOIA 2WD1A 4RC2A 1VYZA 3GU8A 4HW7A 4FSMA 2PZYA 2GCDA 1ZOGA 3EL8A 4RLLA 3UPXA 4AT4A 4ZJIA 5KO1A 1Q8ZA 3AQVA 3BLQA 4MXYA 4CFXA 4FZ7A 4BB4A 4BCKA 4TNDA 3ZTXA 2R3RA 2Y7JA 3S2PA 2JIVA 1LUFA 2VO3A 4HPTE 3EFWA 3GI3A 3R21A 4L9IA 5AR2A 5M56A 3MY0A 3IPHA 3FL5A 1IEPA 2BZIB 1PF8A 1OUKA 2BTRA 5D9HA 4G3FA 3QD0A 1OIUA 1RDQE 2ZM1A 1JLUE 4YC6A 4ZTNA 5AAEA 4FIGA 1YRPA 4L46A 4JX7A 3VC4A 1MP8A 4QMNA 3Q5ZA 1FPUA 3FHIA 4ZLYA 4EHEA 2BDJA 4N0SA 3KXMA 3VJNA 2AUHA 5LJJA 1XR1A 2QOCA 4KS7A 3SQQA 5C4KA 4A9YA 2R3KA 4TWOA 1OBDA 5ETAA 3R1YA 5HBEA 3G9NA 1JKKA 2YFXA 3SA0A 3QUPA 2Z7RA 4KAOA 2IW9A 4F70A 5CAVA 2G9XA 1T45A 3EYGA 3LLAA 4R78A 1ND4A 3ZRKA 3TKIA 4PL4A 3UZPA 2R3MA 1YXUA 1PRYA 1Y8GA 2CHLA 3LJ0A 3ZDUA 4XP0A 2BIKB 3D15A 5CY3A 3BBWA 4BDIA 2VO6A 3PXFA 3UO4A 3VUDA 5FTOA 2PYWA 3R7EA 3G6GA 1FOTA 4V05A 2XCKA 5ANEA 3C0GA 4JBVA 4NWMA 1JPAA 2IO6A 3EN6A 5AUZA 2XIYA 3DQXA 5E1SA 4AZWA 2PSQA 4Q5EA 1H1WA 3FSFA 1DI9A 1PXPA 5KMLA 4FYOA 2P3GX 1PYXA 3HVCA 3QCXA 4QMMA 2X0GA 3LFNA 2JDRA 3HRBA 3QTUA 4H36A 4NW6A 3KMMA 3JVSA 1JWHA 5A14A 2F2CB 3A99A 4JNWA 4ZXTA 3WF7A 4J8NA 4FT7A 4ONAA 3UQCA 1L8TA 5IQGA 1IA8A 4EWQA 4R3PA 5JFXA 1UKHA 2BRMA 5CEIA 2JKMA 3Q5IA 4IJ9A 4RFMA 4AA4A 5IF1A 5IUHA 4A4XA 3HV3A 4BKYA 4O7LA 2XNGA 3KXNA 3LXLA 1K9AA 4USDA 2WTKC 4IAAA 2YABA 2VD5A 3FKNA 3QC4A 5CF8A 2W96B 5M09A 4NIFB 3EL7A 4G6NA 4V01A 5HICA 5B2MA 3BEGA 4JIAA 4D5KA 4C57A 2UW7A 2VO7A 3RK9A 4IX6A 3UC4A 1WCCA 2OGVA 3U8WA 5IEXA 3LJ2A 3QRJA 4PDSA 3VW8A 4FSNA 3E7OA 4F0GA 3KL8A 4HCVA 2UW6A 3UO5A 4PTEA 3II5A 4FT5A 4ANQA 3F3WA 5LVMA 3C50A 3FZTA 4YLLA 4D2TA 4CLIA 4P90A 2WFYA 5HG9A 5JGDA 4J97A 5E8ZA 2NRYA 2PVLA 1NVRA 2QD9A 3OUKA 2OJGA 3N4TA 4RX8A 3SC1A 3ZS5A 4RC3A 1VR2A 5FEQA 1H25A 4QMYA 5EYDA 1CSNA 2ITNA 1U5RA 3BHHA 3QX4A 2FO0A 2V0DA 3DS6A 3ODYX 4O22A 5DT4A 4ZSLA 2P2IA 3D4QA 3WIGA 3N9XA 1YWRA 4EZ5A 3FLQA 4FTUA 4YC3A 1ZYJA 1KV1A 1WBVA 2HYYA 2UVZA 3DQWA 4RVMA 3HUBA 4CEGA 2VX3A 3D5VA 4RIYA 3ZONA 2WKMA 1XKKA 2WHBA 2WEVA 3AC4A 4G16A 4W4WA 5FLFA 3U9CA 5DN3A 3HX4A 4DH5A 1BX6A 2CNUA 3LCSA 2I0YA 5CI6A 5F1ZA 3F82A 2I6LA 3OWKA 4C62A 2C6OA 4CLJA 4O7NA 4QP6A 5AIRA 5EDQA 5GHVA 4TY1A 1STCE 2X1NA 5DE2A 3QTSA 2IVVA 4J96A 4QNAA 3RAIA 5ACBC 5AP6A 4CYJA 5KMOA 2NNWB 2CN8A 3LFEA 4PX6A 4RX9A 3QCQA 4C4JA 3ZHPC 3ANRA 1PMVA 4D0WA 2HIWA 3HGKA 4FKIA 2CKPA 2PUNA 2OZOA 5CTPA 3O7LD 2CKEA 3TIZA 4N70A 5IU2A 2OO8X 2NO3A 3CC6A 3PY0A 4TYJA 1APME 1JSVA 3CPBA 2HZNA 4EKKA 5M07A 3DK7A 4ZTMA 2R3LA 4J98A 5FQDC 3RWPA 1FBNA 2W5BA 1AQ1A 3BEAA 4O38A 3LLTA 3I6UA 2C4GA 4I6HA 3KREA 2C5XA 3SXRA 2OIBA 4TPTA 4AZTA 3PRIA 4MH7A 3FYKX 4R3CA 4IEBA 4O1PA 1UWJA 4YTHA 3MPAA 3PP0A 3ZUTA 3AC3A 5HO6A 3C4WA 1BL7A 5CAUA 2X81A 3FQSA 1K3AA 3FAAA 2I0EA 4DBXA 2VTOA 4GW8A 2JBOA 1H08A 4Y8DA 3EN5A 5DEYA 1SVHA 2YIYA 3S95A 4BDEA 3S0OA 3BLRA 3UTOA 2QR8A 3FPMA 3ZM9A 5K0KA 2XCHA 5T3QA 2W99B 4W8DA 2OKRA 4C2WA 3FI3A 4O0RA 2CLQA 3V3VA 4ID7A 4L53A 4LI5A 4NK9A 4OAUC 2YZAA 4P7EA 3UZTA 1NW1A 2BROA 2ZDUA 5CSVA 4D4VA 5DVRA 3ZSIA 4E5BA 2ERZE 5AP2A 4DC2A 4CT2A 5C8NA 1SYKA 3ZEWA 3PA3A 3ORTA 1K2PA 5E8VA 3WILA 4ZTHA 3F7ZA 3CP9A 2F7EE 2R4BA 3NPCA 4PDPA 3A8XA 4XNEA 2OXYA 4YO4A 4Z7GA 2IZRA 4H58A 4CMOA 3NUPA 2YM5A 4OTGA 4RJ6A 5JQ5A 4LYNA 4PP7A 5BX0A 4I0TA 4UXQA 4L43A 5CVFA 3SW4A 2QOOA 3MESA 5F4NA 4C59A 2CGWA 2IN6A 3VUHA 3EQBA 3B8QA 3O8TA 4WNPA 4UZDA 3AT4A 1KE8A 3QGWA 2ETRA 3DBCA 4IMYA 2RKUA 4HCTA 3D2IA 3KCFA 3WARA 4AN9A 4DFNA 4EEVA 4PNIA 1Z57A 4UYAA 3AMAA 3ZRLA 4XV2A 2Y0AA 1PJKA 3VBYA 5L8LA 2UVYA 4FG8A 4FT3A 4HYSA 4MNFA 4RG0A 5DNRA 4ACGA 4ENYA 5JFSA 4XG2A 4AOJA 4G17A 4I92A 4FNWA 2VGPA 3V5QA 4LMNA 3IG7A 4BIEA 3RAHA 2PUIA 3FLYA 2W4KA 3HUCA 2XEZA 5TF9A 4GU6A 5FM3A 1KUTA 1XH5A 2YM8A 5HG5A 2UW3A 3C0IA 4TWPA 1YXXA 1V1KA 3HYHA 3KB7A 5CT0A 5DT0A 2O64A 3KU2A 4M7IA 2YWPA 4G9RA 4E6CA 5CU6A 5FG8A 4ZSAA 3PUPA 5DR6A 3MIAA 2XF0A 3O2MA 2G1TA 4NJ3A 4TNBA 2VTQA 1A9UA 5IMXA 5L4QA 4DAWA 4IX3A 1YQJA 2I0VA 3R00A 3QKKA 3G2FA 4MNEB 3EQGA 1PHKA 4BCPA 4FIIA 4FVQA 2PVHA 3C4ZA 4I4EA 3I1AA 3SAYA 5AV1A 2C3LA 3PY1A 3RAKA 4EH8A 4F7SA 1GZKA 3TTJA 3TKHA 4A4OA 4AA0A 2YERA 1PMNA 3CE3A 3ACJA 2BPMA 2B52A 4YTFA 4G3GA 4BDDA 3Q3BA 4DEHA 5J5SA 1LP4A 2IVSA 2W1ZA 4UY9A 4LRJA 4F63A 3KVWA 3A8WA 3MBLA 5JGBA 1OECA 4E4MA 3OFMA 4NFNA 4JL9A 4ZS4A 2QI8A 4L01A 4Z55A 1IAJA 3E88A 3TZ7A 2CNQA 4GJ3A 4AGDA 2Z8CA 4EK6A 3AD5A 4MWHA 4BIBA 3IKAA 2NRUA 3EYHA 4RIXA 1T46A 1RE8A 2SRCA 2X8DA 3AT3A 4O1OA 4TYHA 3RK7A 4JBOA 3FBVA 2W1FA 3COHA 5HQ0A 3Q2MA 4KIPA 4ANBA 3VBXA 3RPYA 3WE4A 3W8LA 2HWOA 3Q53A 3AD4A 3PG1A 4Z7HA 1M17A 3OWLA 3MH0A 3NYOA 5HORA 2XS0A 2UW8A 5BVNA 3GCVA 4PP9A 3BIZA 5EHOA 3O51A 5CF4A 3CTQA 4D4YA 1ZOHA 2RFSA 4PMMA 4U41A 4H3QA 4DTKA 4EYMA 4QMXA 1O6LA 2BZJA 2PVRA 2J51A 4BZNA 3P0MA 4OTDA 5CAPA 3QD4A 3QD2B 3MVMA 3FI2A 5EM5A 3UMXA 2R3GA 4ZOGA 1URCA 4F9WA 5JGAA 2B9IA 5A9UA 3NEWA 2ITPA 3I5NA 3BV2A 3HP5A 5I9VA 3VBQA 5JFVA 1SMHA 4L8MA 1XWSA 5JRSA 4G9CA 4GYIA 2Q0BA 2BFYA 1XBCA 4YLJA 4AG8A 4X2GA 3BLHA 4D1ZA 2GNFA 3DAEA 3F5XA 3R8UA 4IW0A 3CGOA 4C8BA 3R9DA 3L8XA 4KA3A 3HMPA 3QQHA 5HE2A 4E6QA 2PUUA 1PXKA 4JDHA 1Y57A 4FR4A 1OI9A 5CF6A 2UVXA 4GT5A 3TM0A 4EQMA 4GFMA 4U79A 4EH4A 4K0YA 4DN5A 1V0PA 4O81A 4IDVA 2W1IA 3QWJA 2OICA 4YJQA 4BDKA 5KMMA 3FI8A 3ID6C 5IA5A 1JAMA 5KHWA 2QG7A 4YZ9A 2QO2A 1ZY5A 4FTOA 1H4LA 2PMIA 3Q9ZA 4O7RA 2C0OA 2UV2A 3IW7A 3ORIA 3PLAE 4WUAA 3HL7A 1U54B 2J0MB 3C4EA 5L2IA 3ZYAA 4FTKA 1VZOA 2P4IA 3R8VA 3KULB 3SLSA 5AR7A 2BCJA 2UZDA 5HIEA 2J2IB 5EM7A 3N4VA 1UNLA 3CD3A 3OW4A 1SNUA 2YIXA 4WNOA 4F9CA 4RVTA 4TT7A 5FTGA 4BDHA 4C34A 2Z7SA 4IFGA 5J87A 2WNTA 1QPJA 4WG5A 4ENXA 2FSTX 3IGGA 5HESA 3PXYA 5AWMA 4ALVA 5IQCA 4DINA 2BRHA 1OIRA 3OCTA 1ZYSA 4BBEA 3OG7A 4EK8A 3ET7A 5ANIA 5J1VA 4AZSA 3U6IA 4BY9E 4U3ZA 4F64A 3TV6A 2ZB0A 1UKIA 4F09A 4RX7A 2XZSA 3Q96A 4LRMA 3D5XA 4RQKA 4YUQA 2XK8A 4O0UA 3ZXTA 3PSDA 5F20A 5FXSA 4GL9A 4RJ5A 5AR8A 4XMOA 3R8LA 5AX3A 2QNJA 4ALWA 3OF0A 3RPVA 2VWVA 3ALOA 4NCTA 2OBJA 2C5OA 2C0IA 4IAYA 5HTBA 5GINE 2BILB 4QPSA 3TEIA 1R78A 3CR0A 3NS9A 5GJDA 4ZLOA 4YTCA 2X7OA 2BHHA 4LUEA 3V04A 5DHJA 1YI3A 5FTQA 3RCJA 4BWPA 1JBPE 5CEOA 1IA9A 3MJ1A 3ZOSA 3AD6A 3PY3A 1OPKA 2A19B 1GIIA 4K6ZA 4DEBA 3DK6A 5CAOA 3P1AA 2E9PA 4W8EA 1H24A 5CZHA 1OGUA 3RNYA 4QP2A 1SVGA 5LQFA 4F08A 4O7TA 2X9EA 5CQWA 3HV5A 5CU2A 1GZ8A 3PIXA 4WBOA 5E8UA 3PVGA 3WZJA 3CSVA 2XP2A 3ODZX 2ZV7A 4J1RA 1LR4A 2BMCA 4IAKA 4MEDA 4K9YA 5E8SA 4F9AA 3CQEA 2IW8A 4YJPA 4V04A 4GRBA 4AT3A 2P33A 3CQWA 4ERWA 1OL5A 4DTBA 4QMPA 3UOHA 4BHNA 3ORKA 4TL0A 1UU9A 4U0IA 5HIBA 4WUNA 5JK3A 3ATSA 3DXNA 2QKRA 4U7ZA 2IVTA 3B8RA 4U42A 2YWVA 3OCBA 1OB3A 5GJFA 1BL6A 2GNIA 3O0GA 5AR3A 4I93A 4YLKA 5A4CA 5K0XA 2WMSA 2XNOA 3C7QA 4EOSA 2J0JA 3QQFA 2V7AA 4WT6A 3UOKA 3FQEA 5HCZA 4YPSA 4JG6A 3NSZA 4BIDA 5E4HA 4PY1A 4APPA 3DCVA 3F7WA 4UMPA 1GY3A 2C3KA 4QMSA 1YVJA 1QMZA 3HNGA 4S31A 1KE9A 5M4IA 3MA3A 4RIWB 2GTMA 4JQ7A 3TJDA 2PVJA 4EOQA 3ROYA 1J7UA 1YW2A 3JS2A 1YKRA 1WBSA 4UZHA 3MYGA 3R7OA 3TNPC 2V62A 4LGDA 4EH6A 2V22A 5IH6A 3OWPA 3NUYA 4U80A 1O6YA 2OF4A 2WAJA 4XG3A 3ZO3A 4BI1A 4DH7A 4O96A 2X8EA 3W2PA 1ZWSA 3RKBA 5J5TA 2O63A 2GHLA 3LFAA 5M4FA 3BZ3A 3SDJA 3F3TA 5DR9A 5AIKA 3LMGA 1OBGA 3DBQA 4O6LA 2ACXA 3OMVA 2YACA 3E63A 4FNYA 5DRBA 4AACA 3QQJA 4ZTSA 1OUYA 2UZEA 4RJ7A 3K3IA 4XS2A 4OR5A 4FL3A 5HTCA 5KBRA 2EUFB 3NUNA 3QXPA 3FKLA 3P78A 4M3QA 4QT1A 4YSMA 5ANGA 3BV3A 2GPHA 2Y6OA 4H1MA 3BYSA 4H3PA 4X21A 4YR8A 3D5WA 4CV9A 2QOHA 2YM6A 2FGIA 4EOOA 4XP2A 4BTKA 1E9HA 2PHKA 4FKTA 1FVTA 3IO7A 2Z7LA 1OPJA 3SW7A 1VEBA 1YHVA 5H2UA 4DFZE 4QD6A 2BRGA 1REJA 5J7BA 3UJGA 4XX9A 4HNFA 2XRUA 2XNBA 4M15A 4R5SA 3GNIB 3CXWA 3K54A 3BBTB 5HKMA 4XEYA 4D9TA 2YA9A 2H34A 3UIMA 3MJ2A 4N6YA 2VZ6A 3KMUA 3VRZA 5BMSA 3MVLA 4IAIA 4J52A 2GHGA 2BALA 4PF4A 3TUDA 3POOA 3U6HA 4L45A 3CQUA 2E9NA 4FOCA 4HGEA 2HXQA 3KK8A 5AV0A 4BGHA 4DE4A 4UXLA 4AGUA 3FZ1A 1JKTA 4L3PA 3FMNA 1TVOA 3JUHA 4GIHA 3FDNA 4QQCA 3R71A 4YHJA 3IK3A 3KF7A 5HTIA 5HVKA 2V7OA 3UBDA 4JI9A 4OBPA 3C4CA 4J95A 4MBLA 4WRSA 4K1BA 5KX8A 1DI8A 3C1XA 3OTVA 5DGZA 3ZSGA 4Q9ZA 4USEA 1FMKA 2RG6A 5K3YA 4FEWA 2RGPA 4HPUE 5DIAA 4PDYA 3WIKA 3FHRA 1KOAA 4CCUA 1Y6BA 2AYPA 4JDIA 3ZO1A 5K5XA 4ZMEA 1KOBA 2WU7A 2PY3A 4QYGA 3FY0A 4E6DA 3FPQA 3T9IA 1Q8WA 3QTXA 4YPDA 2O2UA 3NRMA 2J9MA 2WMVA 3QZHA 2C69A 4XJ0A 5HLPA 5ACKA 1Q24A 3QGYA 2XKFA 1AGWA 4AZEA 2CMWA 3BQCA 3TACA 4EJ7A 3LHJA 4ZEGA 4XOZA 4MXOA 4IBMA 4IQ6A 4QTEA 2XK3A 5GZ8A 3W32A 4CMUA 4BCHA 4E5WA 4I6BA 2OFUA 2YIRA 3IDCA 3LPBA 2FA2A 5E92A 3DDQA 2YM3A 4FI1A 3VUTA 3G5DA 4X6QC 4N6ZA 2H9VA 3BYOA 4QQ5A 2HZ0A 4DYMA 3JXWA 5BMMA 2YEXA 4PPBA 4Y83A 4CFUA 5ETIA 4RGJA 5I3OA 4LOPA 4C58A 2YDKA 4FEQA 1Q8YA 3A62A 3ORNA 5A4EA 1NY3A 1H01A 4QP7A 1IRKA 3KK9A 4I0SA 5ETCA 3P23A 4CTBA 4DTAA 3HV7A 3TZ8A 2XIKA 3R2BA 4H39A 4AUAA 3DU8A 3PVBA 3OTUA 4FKQA 4HYUA 5BUIA 4YHFA 5AP7A 4ARKA 2F57A 5AUWA 4EC8A 5M44A 2B9JA 3FXZA 3ZEPA 3U4WA 2B1PA 3GFEA 1BMKA 2GNLA 3QQUA 2B7AA 4FV2A 4I5MA 2JITA 3F61A 4L52A 4ZP5A 1PYEA 5IQAA 3E64A 4UWYA 3TIYA 5EKOA 5GIPE 2BKKA 2JIUA 3GU5A 5CU3A 4DGMA 3EJ1A 4BCQA 4Y95A 3NVKI 3DKGA 2BAJA 5EM6A 2C3JA 2UZNA 4I5CA 2QCSA 1G3NA 1KV2A 2BDWA 1Q61A 5EOBA 4EOMA 4QPAA 2EWAA 4F6SA 4FV0A 5M08A 2VX1A 2ZM3A 4FSTA 5LVLA 1U4DA 5L2WA 2X4ZA 3BKBA 3C5UA 2I7QA 2WQMA 5H8GA 4C4GA 3QKMA 3FQHA 3M2WA 2UZOA 1OIQA 3OT3A 2CKOA 2Z2WA 3VN9A 3L9LA 2EB3A 5IEYA 1R1WA 2UZTA 4FTQA 2CDZA 3Q4UA 3SX9A 5AMNA 3I6WA 2GS2A 3EQFA 3BHYA 4IADA 4CV8A 4ZTLA 3UNJA 5I3RA 3ZZEA 3W55A 1F5QA 1U54A 4CZUA 3POZA 2VTHA 2ZV8A 5J7HA 2ONLA 2ZOQA 3QYWA 5A4LA 4AS0A 1Q97A 4LL5A 3CLYA 2WQNA 2R3NA 4HZSA 3WZDA 4E73A 2CGXA 3ZRMA 5ETFA 4XOYA 3PA5A 5C4LA 3AOXA 4IM0A 4KRDA 4WHZA 3ZMMA 3OBJA 4XRJA 4DITA 1CM8A 4C38A 3BYMA 3G0FA 2FSOX 4YTIA 4DBNA 3F5UA 2HELA 2RF9A 3TDVA 2XNMA 1ERKA 1OL6A 4FSYA 4FTCA 4G3CA 4GSBA 3NW7A 4MQ2A 3UIUA 3EIDA 5EYMA 3W1FA 4ZIMA 1P4FA 4QMUA 3S3IA 4J7BA 4YJOA 5CANA 1M52A 4GVAA 4JOAA 3G33A 3RWQA 3QTIA 2OWBA 2F4JA 2X6EA 3KRWA 3TUBA 1W82A 4B7TA 4YZBA 4DFUA 2WTJA 5TT7A 5JKGA 4FUYA 2PZPA 2V5QA 4CKRA 3OEZA 4CZYB 4DG3E 4YJUA 2WGJA 3EOCA 4BDAA 3MVJA 2OF2A 1BI8A 4GG7A 5ITAA 3UQFA 4MD8E 2XJ1A 2J0IA 4NEUA 2GSFA 3MGYA 5JN2A 4MF0A 3FZPA 2VNYA 4GK2A 5FEDA 2PUPA 4OBOA 1F0QA 4RJ3A 3F69A 5DWRA 4LFIA 4N57A 4R7BA 5DA3A 2PZ5A 3MIYA 5L2SA 4FKGA 4BTFA 1B39A 2B9FA 5AV2A 3C9WA 3CY3A 3NUUA 3NIZA 3SRVB 3QHRA 4D4SA 5KKRB 2PZIA 2XYNA 3Q4CA 3ERKA 3VS5A 3NZ0A 3R83A 3OXTA 4II5A 3DTCA 1CKJA 2XBJA 3F2AA 2R5TA 5BYZA 4G3DA 3R7IA 3O96A 4BI0A 5D10A 1YXVA 4I41A 4O86A 4BZOA 4BL1A 3OXZA 5EKNA 3DOGA 2EU9A 2YZLA 4U43A 4YURA 3R63A 2PWLA 4DH3A 4ZSJA 5EW3A 5CU0A 3QHWA 4D58A 3DT1A 2W1GA 3EZRA 4FZAB 4JLCA 4MXAA 3EQIA 4OTQA 4C2VA 2ZMCA 2ZV2A 4BDBA 3BE9A 3KRJA 2O5KA 4MXCA 3UGCA 4FSWA 3EMGA 3TJCA 1XH4A 5CSWA 3HMOA 1SVEA 4XG6A 4JS8A 4MQ1A 4D2PA 5DH3A 1UWHA 4UX9A 2R3PA 2ITXA 4BICA 4O7ZA 3NW5A 3G6HA 4GFOA 4MXXA 2VGOA 5HD4A 4LL0A 4CKJA 4LMUA 3NCZA 3B2TA 4Z9LA 1J7LA 4FF8A 4YC8A 4EQUA 3AC2A 3DA6A 3GCUA 3AXWA 5DLSA 1OKYA 3JY0A 4M69B 2VWYA 1H28A 4TYGA 4E93A 1S9JA 3W2CA 3LW0A 5BNJA 4FKVA 1ZYCA 4U3YA 4IWOA 2GMXA 5LCJA 3FLNC 3NAXA 3ZBFA 5HD7A 5EI6A 4YHTA 3IOKA 2PTKA 4UMRA 2OH0E 4ANMA 2VX0A 3H9OA 4RC4A 1BYGA 3HLLA 5HOAA 3V8SA 3KXZA 2ITYA 3E62A 4A07A 1L3RE 1HCKA 1HOWA 3E8EA 3QYZA 1XH9A 4Y85A 4BHZA 2ITTA 2IVUA 3OHTA 4FKWA 3CCNA 3WYYA 3THBA 5FP5A 3U54A 4CFVA 3R6XA 4O91A 2OZAA 2BIYA 4EZ7A 3DLZA 2W06A 3M1SA 2OIDA 4PNKA 2Y4IB 3PPKA 3MFTA 2DYLA 4A9UA 5H8EA 3RAWA 1IG1A 3RINA 5BPYA 1YDSE 4UMTA 4M68A 4DEDA 4ZZOA 3CBLA 5L2TA 5BVDA 3BELA 3Q60A 3K3JA 4C4HA 5JEBA 2JC6A 5D7VA 3MA6A 4ZSEA 5BYYA 4ZY5A 3V6RA 3DY7A 4TYIA 3IDBA 2XA4A 5E9EA 2R0IA 3BGPA 1UA2A 4G34A 5AX9A 4C4FA 4RJ4A 5C8KA 3LFSA 4FKUA 5BVWA 4DGNA 5D11A 2PE1A 3TCPA 3OW3A 5CSHA 5HBHA 4PPAA 4BCGA 2EXCX 1PKDA 3EN7A 5EOLA 3A7GA 4QMOA 4BGGA 3D7TB 3RVGA 3E7VA 3R9HA 5BVFA 2B55A 5LXMA 2J5EA 3GGFA 1XO2B 2J7TA 4G5PA 3TNQB 3FMHA 4XG8A 5EK7A 4XRLA 1PXOA 5IUIA 1WVWA 4GS6A 2BZHB 2WTCA 3R01A 4FTJA 4HGLA 4ANSA 2Y4PA 3D7ZA 4QMLA 4TN6A 5KMNA 2A0CX 4FZ6A 3HEGA 5IPJA 4U97A 4YJVA 5K4JA 1URWA
chains in the Genus database with same CATH superfamily
2QOKA 1OGYA 2CN5A 1FQ1B 2XIRA 2GTNA 3IW8A 1FVRA 3CIKA 5AAGA 5HNIX 3UZRA 1UU3A 2QONA 2OW3A 1BUHA 3S4QA 3Q6WA 3KC3A 4V0GB 3UOLA 4QO9A 2XJ0A 5C9CA 4R77A 4AXFA 4KKEA 2J90A 1WBTA 2QOBA 2EVAA 3QWKA 3CPCA 3JY9A 1SM2A 3MTLA 1UNGA 3PJ8A 2OLCA 2VN9A 3COIA 3FMJA 2XB7A 3QTRA 5HX8A 3VULA 1M2PA 4D2VA 3Q04A 4ZSGA 3OXIA 4YZNA 2YAKA 1A06A 3SHEA 2B4SB 4EZ3A 3LQ8A 2JAMA 1MRVA 3NIEA 2X2KA 4CD0A 2WO6A 3LFQA 3FMMA 4NM5A 4WSQA 1XJDA 1W2FA 4DH1A 3BWFA 3ORPA 4X2FA 2BRBA 3PLSA 4NSTA 4IB3A 4XBRA 4F65A 4HGTA 4KIKA 4GIIA 2VTSA 1TQMA 1FGIA 1E1VA 3TNWA 3MI9A 2HAKA 4FKJA 4U81A 2R0UA 3A2CA 2LGCA 3DK3A 1KE7A 2WMQA 3BU6A 3MB7A 3PZHA 4X3FA 5AA8A 3QBNA 5CEQA 4D5HA 2LAVA 4MBIA 3QTWA 4JDJA 1W7HA 4QP1A 4AP7A 4E6AA 4YSJA 5KCVA 3HZTA 3LCKA 3RK5A 5FUTA 4EBWA 4MYGA 3R1QA 3KF4A 4ASZA 4BCJA 5IQFA 3EFKA 2G2IA 5CAQA 5G1XA 3SOCA 2Z60A 1YHWA 4BFMA 4IXPA 3DTWA 3DDPA 2Q83A 4L3LA 5IA3A 2KULA 5T6KA 4PPCA 1ZOEA 2ERKA 2W1CA 3ETAA 2BUJA 2H8HA 2X9FA 2ZVAA 2PULA 4MCVA 3NNXA 3FMLA 1IR3A 3A7FA 5EI8A 5AUXA 3QUDA 3F2RA 3PPJA 3QKLA 3QZGA 4I0RA 3GENA 3PSCA 3U4UA 3R22A 4ANOA 4HVDA 4MBJA 4EH9A 3EFLA 3SGCA 4NU1A 3F6XA 2QOLA 2QURA 5E91A 3ZC6A 3QRUA 4ALUA 3D5UA 2ZM4A 1Z9XA 4J53A 5M4UA 4X3FC 5F94A 3RZFA 3P79A 2VWUA 3PZEA 3N4UA 1PXMA 3I0QA 1H26A 5JH6A 5ANKA 2R7BA 4EH2A 1G5SA 5H3QA 4BGQA 1WMKA 3G0EA 4X2JA 2CCHA 5FDPA 4LV7A 4WRGA 4AN3A 3OS3A 4PMSA 4C61A 5A4TA 3QZIA 4BDFA 5JMSA 2R3FA 3CD8A 3DBFA 4FSRA 3L9MA 1UU7A 5CNNA 3R73A 3QLFA 4O0XA 5I9UA 3KA0A 4JBPA 4YJTA 2C5VA 2WOUA 3FC2A 4BYIA 3DLSA 1OM1A 2P55A 2R2PA 3KVXA 3L8SA 4BCMA 3DNDA 3FMKA 4IE9A 3VHEA 4BI2A 2W17A 3W2SA 4UB7A 4O84A 3KCKA 4AF3A 1O9UA 3CGFA 2ITZA 3EQPA 2XJ2A 4F7JA 4CG9A 3F88A 1JSUA 2CJMA 4L00A 5FDXA 2HCKA 1WZYA 5FBOA 3IECA 3AKKA 2O8YA 1WBOA 2JGZA 4E3CA 2C68A 4AXAA 2CGVA 1R39A 1U59A 4GT4A 3WF8A 2DUVA 3RM7A 1QPEA 2P0CA 3TWJA 1XH8A 3BE2A 3VBVA 4G6LA 3DB6A 4OTWA 4AE9A 2ITQA 2WMBA 4FTTA 4BTJA 4JBQA 4UEUA 3SG9A 4YBJA 4AW2A 4YZCA 5BUEA 2E2BA 1P5EA 3QFVA 3LMHA 3DXPA 3JYAA 4I24A 3ORLA 1Q8TA 4GK3A 4LUDA 4IVCA 4D55A 2O65A 2PVMA 3BHVA 3KN6A 4LG4A 4AZFA 4BWXA 5FD2A 5FM2A 4G6OA 5HG7A 4U5JA 4Q2AA 2VTPA 3FE3A 5M57A 1W0XC 3R04A 4L7SA 4JVGA 5LCKA 1IAHA 3N51A 3TXOA 5EQYA 3OCGA 2WB8A 4NIFA 4QP3A 1ZZLA 3K2LA 4O6EA 3ULZA 4CG8A 4RPVA 3RNIA 4C7TA 2WELA 3ANQA 1IASA 1G8SA 3E3PA 3DV3A 3V5TA 5HU3A 2PVNA 3VUIA 3MH1A 3PFQA 4YMJA 1GIHA 4R6VA 4X6RA 2YM4A 2JKQA 4JG8A 4G31A 3VS6A 3GQLA 2WTKB 4GJ2A 4AWIA 3EFJA 4K18A 4Y5HA 4WSYA 4YZMA 2JFLA 5KZ0A 4JG7A 4CFFA 5I9XA 1RJBA 3HECA 3PJ1A 4IIRA 3VBTA 2JKKA 3E87A 3P9JA 3PG3A 3PIZA 4A7CA 5D7AA 3Q9XA 4D1XA 4E20A 4YU2A 2XK6A 4FZDB 3RHXA 4AOTA 5KUPA 4FZFB 5KMKA 4CFNA 5KMIA 4DFBA 4XUFA 2F49A 5CSXA 5HVJA 4WO5A 3R9NA 3OOGA 1UU8A 2W0JA 1O6KA 2IW6A 4PQNA 4XYFA 1MRUA 2JAVA 4GMYA 2PL0A 2RFEA 2WQBA 4XV9A 4PL5A 2WMXA 4UWBA 4AN2A 4B0GA 4QMQA 3OEFX 3TKUA 4FX3A 3DNEA 4HYIA 4FEXA 4O7WA 2XARA 3SXFA 5CVHA 3IGOA 2YJSA 3BYUA 5EQPA 3KXGA 4AW0A 3LKMA 5ANOA 3SVVA 4FIJA 3KXHA 4ANNA 3LFFA 1NVSA 1PW2A 3DKOA 2QC6A 2G01A 2IZSA 4RRVA 4I94A 3COKA 1P4OA 2X2LA 4M97A 1U5QA 4Q5HA 3HKOA 1BKXA 4MTAA 3W33A 3RPOA 3GT8A 4FT9A 5A54A 3LM0A 4NYEA 4I5PA 2CNVA 4L42A 4M69A 3I79A 4YP8A 3DKCA 4WKQA 3BYVA 3EKKA 1BLXA 3WF9A 5E8WA 5A46A 4EOIA 1WBPA 3GBZA 2C0TA 5HIDA 3KRLA 4RWKA 2R9SA 4EH7A 2IWIA 4OTIA 2WMRA 1UVRA 3P7BA 1YI6A 3GOKA 3EHAA 5IEVA 4RLKA 5EW9A 3DGKA 1Q41A 3OUNB 1YXTA 2WTWA 3GCQA 3PJ3A 5JQ8A 2QOQA 4KWPA 4IB1A 5M53A 1Q62A 3A4PA 4OUCA 3RALA 4HNIA 2FB8A 3AC1A 3FL4A 4PTCA 2UUEA 1J1BA 4QTDA 1GZNA 4XV3A 4NCTC 4DCAA 4OT5A 5TR6A 2HW6A 1OL1A 3EQDA 2X0QA 1J7IA 4QOXA 3C13A 3NUSA 5HGIA 4RSSA 1XQZA 3R1SA 2YIWA 3WYXA 3DJ5A 4L7FA 3ZUUA 5KMJA 3EB0A 4BCNA 5J8IA 4EUTA 3R1NA 5HO7A 4DEIA 4QP9A 3HRFA 2DQ7X 5KBQA 2WQOA 3FZSA 3NYXA 4CSVA 4DT9A 5HE0A 4NM3A 4HVGA 5IMEA 3MW1A 4RA4A 4O0TA 2QR7A 2WIHA 2PU8A 4RIYB 2C6TA 3QD3A 4ZY4A 4X0MA 4Y73A 2XVDA 4CNHA 2UZBA 3QL8A 1PXNA 3Q4ZA 4F6UA 3GC0A 4HVIA 3LMIA 3HV4A 4F6WA 2QU5A 5HU9A 3LCOA 2PPQA 3GFWA 1OKVA 4ZJJA 2VWWA 4PDOA 1B38A 4U9AA 3PUFC 4PRJA 4KBCA 4ANLA 4B8MA 2GDOA 2VWZA 3PA4A 3VUMA 3GC8A 3FKOA 1W2CA 5E8YA 5C8MA 4EH3A 4F0FA 3JR1A 5L2QA 4E26A 4FUXA 1A48A 3MFUA 3UNZA 2B54A 4D2WA 4OBQA 2E9OA 3A4OX 4AA5A 4C3PA 2XM9A 2YJRA 5CQUA 4ZAUA 2IZUA 2JKOA 3VF9A 5AUTA 4O7YA 3MVHA 4O4FA 2W9FB 4V0GA 4CGAA 2YLEA 3TNHA 1BI7A 2RIOA 3KY2A 2RL5A 4O0WA 5AP3A 3H30A 4FSZA 3EN4A 3ZFMA 3UIBA 3WOWA 3RBWA 4Y5QA 3UP7A 4BYJA 4S30A 2JDSA 4IZ5A 3NGAA 3KEXA 5J95A 2XK4A 2OJIA 4O4BB 3ORXA 2WMWA 2XK9A 3FY2A 3RPRA 3MV5A 4ASDA 4MX9A 3RZBA 4M14A 4F99A 3SG8A 1M7QA 3GVUA 3VVHA 2XIZA 2B9HA 3QQLA 3UMWA 5M4CA 4IX4A 5CU4A 5B2LA 4FTNA 4L6QA 4UN0C 5EDRA 3COMA 4FV8A 3C51A 2UZUE 2F2UA 2QKWB 4FT0A 4R5YA 4ZK5A 4X2KA 4K8AA 4ACMA 5LMKA 4IANA 2QU6A 4LGHA 1TFFA 1YI4A 5C1QB 5CEMA 3TYKA 3CTJA 4W4VA 4IWDA 4AAAA 4JDKA 2ZAZA 3OZ6A 5D1JA 1FGKA 2VWBA 3MB6A 1DAYA 4EOLA 1E1XA 2Y8OA 4MNEA 3FXXA 4JXFA 4JR7A 4S33A 3FWQA 4XH6A 4QQJA 3LAUA 4UMQA 4QP8A 3U51A 3GCSA 5BYLA 3HV6A 4ZLZA 4WBBB 2VTRA 3SKCA 3V6SA 1MUOA 3S1HA 3QC9A 4DEGA 3A60A 5AP5A 3HMIA 2J0LA 2VTIA 4FV4A 5E1EA 4WIHA 2YDJA 3WZUA 5DBXA 5DPVA 2YISA 3I60A 5HVYA 4C33A 3PVUA 3QU0A 4TTHB 5CX9A 4QYHA 4BDGA 4R1YA 3Q4TA 4RBLA 5J9LA 3GU7A 4FL1A 4UBAA 5CF5A 3NFGB 5KHXA 4GKIA 2J4ZA 5HLNA 4KSPA 2PVYA 3TV7A 2IPXA 2VUWA 4XP3A 4J8MA 2FYSA 4GK4A 5CWZA 2OFVA 3RMFA 4O0VA 3VS1A 3QAME 5DMZA 3KKVA 4FSQA 4QMZA 4AFEA 4AFJA 1MQ4A 5AV4A 3UVRA 3R8PA 4ASEA 4C35A 5A6OA 4GH2A 1R0PA 5LMKC 4QNYA 5HEZA 1Z5MA 1P14A 4BZDA 4WNMA 3P7CA 5AV3A 4ACDA 4RMZA 3RGFA 3VQUA 3U6JA 1J91A 3PIYA 3R8ZA 5T68A 3Q52A 5AR5A 3PXZA 3KIOC 4C3RA 2IEWA 2H6DA 2W4JA 3O7LB 5EI2A 4AGWA 4K33A 1KE5A 2PE0A 4NZWB 4PWNA 4DGOA 1JVPP 2G15A 4FGRA 2PVKA 1YXSA 3DBEA 4EK5A 2JDTA 1ZYDA 4IAZA 5I0BA 3DJ6A 4CQEA 3FZRA 2GS7A 2VO0A 4OTFA 1JKLA 1M7NA 1XH7A 3DB8A 5IA4A 5LARA 1ATPE 3LFCA 4M13A 1PMEA 4KINA 3OY3A 4JT3A 5EFQA 5CXZA 1OL7A 3ATTA 3FLZA 3QRIA 4DGLC 4FKLA 3UDSA 5LMBA 4G2FA 3DXQA 4GFGA 4CT1A 5FGKA 3P5KA 3OD6X 4ASXA 4L67A 2ITUA 4OAVB 2NYAA 4H1JA 2NP8A 4RWJA 3VNTA 1G8KA 4ACCA 3FV8A 3G9LX 3H10A 3LQ5A 1NT2A 1H1QA 2OJJA 3LIJA 2O0UA 3RP9A 4R7HA 3SV0A 2BDFA 3TDWA 3LZBA 4C36A 3DFCB 4M67A 5I9WA 3MS9A 4K2RA 3NNVA 1OKZA 1QPDA 2FSLX 3QCYA 4NM0A 4Z16A 5KE0A 2W1DA 4RIXB 2C1BA 4TYHB 3K5VA 3EZVA 2VTLA 4IM3A 3W2OA 3T3UA 1FINA 4M84A 4LM5A 5G6VA 2R3QA 1JKSA 4F1OA 5D41A 5FXRA 5HNBA 4NJDA 5M51A 3PE1A 3BI6A 3ZSHA 3WZKA 5BUJA 5IH4A 4RQVA 3KULA 2W05A 2R3OA 2ZB1A 3FJQE 4X3JA 3BGZA 4OTHA 4AW1A 3VO3A 3NUXA 1NA7A 3UE4A 3NX8A 2VAGA 4IH8A 3ZFYA 1GOLA 5CALA 3V8WA 2X39A 4O27B 3WZEA 4KRCA 2I40A 3KGAA 1ZY4A 3F3UA 4M8TA 1FVVA 3HAVA 3AGMA 3ZLXA 2QHMA 3NNWA 4YNOA 3TI1A 3PYYA 1EH4A 2YHVA 5F9EA 3GCPA 4W4XA 5L8KA 1QCFA 2XNNA 2REIA 3P08A 4Y72A 2XNPA 3OT8A 3W2RA 3R7VA 3W0QA 4FIEA 2WQEA 1TQPA 5C01A 2W1HA 3UDBA 4EORA 3L9PA 2R3JA 1YWVA 4RWIA 3L8PA 3P7AA 1QL6A 3V8TA 5EW8A 1YOLA 5EG3A 2R64A 5DYJA 2J6MA 2HK5A 1ZLTA 2DWBA 4C4IA 2QVSE 5AP4A 3B2WA 3KFAA 5L3AA 4P5ZA 5KZIA 1P2AA 4P4CA 5EYKA 2EB2A 4GCJA 2GS6A 1ZZ2A 5JZJA 5IISA 3G51A 3GXLA 4AW5A 4H05A 4AQCA 2YIQA 2ONLC 2BFXA 5FXQA 2VRXA 4D9UA 2BZKB 4EOKA 3K5UA 3PVWA 4MHAA 4FL2A 2X0PA 3ACKA 2Z7QA 4GEOA 3E93A 3ZDIA 2QLQA 1GNGA 1W8CA 1WFCA 4TWNA 2X4FA 5HHWA 3VW6A 4O83A 3NYVA 3HA6A 4NUSA 4DLIA 4WD5A 2G2HA 5LVOA 1ZMUA 2QO7A 4IZAA 1XBBA 4S32A 3NVMB 4HGSA 2C6MA 2AEGA 4KS8A 3UPZA 5CVGA 4ZS0A 4KB8A 4KKHA 4RT7A 2AQXA 5GNKA 3NLBA 5JRQA 5TOZA 3VJOA 5EQEA 2A27A 4DCEA 5HCXA 3ENHA 1GAGA 3FYJX 4PV0A 2X2MA 5BVKA 3GC9A 4O2ZA 4IZ7A 4RVKA 1REKA 3GQIA 2JIIA 3V5PA 4CVAA 3DFAA 4A9SA 3RTPA 2VTJA 2BTSA 4A06A 4HCUA 4FKOA 4DEAA 1ST4A 2IZTA 1PKGA 4BKJA 3KRXA 4KSQA 2QOFA 3Q32A 4UYNA 5D12A 3RPSA 3W0NA 4CQGA 4EBVA 1H1PA 3MFSA 1LEWA 3D14A 4FTRA 5IQIA 4OTPA 2OU7A 3DKFA 3VS4A 4IVDA 4F4PA 4CMTA 4A9TA 2WPAA 3IQ7A 4KD1A 3VS7A 4B6LA 2XKDA 3MPMA 1I09A 4IWQA 4FKPA 4QQTA 4ITHA 4FV6A 5IG1A 4F7LA 2C1AA 2A1AB 4OW8A 1H00A 4FVPA 2RG5A 4F9BA 1Y6AA 2UZWE 4DA5A 2R3HA 4RIWA 5A4QA 4D0XA 3H9FA 2VWXA 3HAMA 2C6EA 4GVJA 4PTGA 5DOSA 4HVHA 3JVRA 4UALA 1KE6A 3W18A 3IDPA 4YJSA 4MVFA 4FYNA 2YM7A 3VS0A 3MSSA 5LWMA 3VRYA 4EHZA 3VUGA 4DH8A 4DEEA 4MAOA 2GNJA 5HBJA 5AM6A 5AEPA 1CMKE 4YNEA 5GZAA 5IQEA 3O8UA 3GB2A 3PPZA 4NW5A 4LV5A 5DR2A 5HCYA 4FE2A 5CS6A 3GEQA 4IVBA 2OJFE 5K5NA 4E7WA 3GC7A 4XG4A 4IVAA 4EWHA 2BRNA 2YCQA 4JQ8A 4EC9A 4DF3A 3QLGA 3FXWA 2C6KA 3QRKA 3DAJA 2A4LA 5AUYA 5DEWA 4I4FA 4APCA 4IDTA 2WXVA 2YAAA 3DZOA 4W9XA 3UYTA 4KUJA 1G8AA 2XIXA 4Y46A 4AZVA 4NTTA 4BJJB 5CLPA 4EL9A 2QLUA 4L3JA 4EKLA 4I1ZA 3E5AA 2GQSA 5L6PA 2KTYA 2XAOA 4RVLA 2YCRA 3E92A 5J9ZA 3NMUF 4CZTA 4E1ZA 5HZNA 4ERKA 3OVVA 5AP0A 4AGCA 1XBAA 3OCSA 4K11A 4UMUA 1LEZA 3C0HA 2XMYA 3Q6UA 4MUQA 2XUUA 3VBWA 1NXKA 4KKGA 2C6DA 4TKSA 4O2PA 4X2NA 4RA5A 3ZBXA 4EUUA 4JRNA 1YHSA 3AMYA 3R30A 3ZCLA 5BQ0A 2JDVA 1H0WA 1Y91A 1PY5A 3O23A 4M12A 5CI7A 2X7GA 5L6OA 1ZARA 3ELJA 3UG1A 4DFLA 4E4NA 3FLWA 3NNUA 4D28A 1OKWA 3VQHA 4FV9A 5CXHA 2W1EA 3H0ZA 3U87A 4GU9A 3R0TA 4TXCA 1ZRZA 3D0EA 3ROCA 3C4FA 5EYCA 3PRFA 1Q3DA 5ANDA 4BC6A 1VJYA 4FSUA 4FV7A 4RZVA 4YJRA 4EJNA 5BVOA 5J1WA 1JOWB 3QQGA 3FZOA 2W5AA 3D2KA 4EYJA 4TRLA 5AR4A 1R0EA 5IDNA 3CY2A 1OMWA 4NKSA 2O3PA 3FUPA 5AJQA 4AE6A 1HCLA 3HP2A 3W16A 1KWPA 4YO6A 2XANA 3I0OA 5C27A 3ULIA 4U45A 3W0PA 3UODA 2XK7A 2B0QA 4NL0A 4IM2A 3PTGA 3U55A 3RHKA 3ZU7A 4ACHA 5JFWA 3VF8A 5JT2A 3VAPA 3OBGA 3QX2A 4EHGA 3TG1A 4I6QA 2XNEA 2YDIA 2XH5A 4FRFA 1YOJA 4USFA 3KMWA 3LVPA 4BWKA 2PMOX 3A7HA 2OJ9A 2EXEA 4OTRA 4RFYA 3HMMA 5LMAA 2Y9QA 5CZIA 3OY1A 4NT4A 3SD0A 4BN1A 2G2FA 5FRIA 5JSMA 5GIOE 3MFRA 3MH3A 4F1TA 4IZYA 4C0TA 2X7FA 3LE6A 3RM6A 3KXXA 4JMQA 4FC0A 1OPLA 2ETMA 2Z02A 5DT3A 3FMEA 3ZFXA 4BCFA 3T8OA 3QA0A 3CS9A 4EONA 3WF5A 2OXXA 4AX8A 4DHJA 1OZ1A 3BPRA 2QO9A 5FWKK 4ZMFA 3O50A 4R3RA 4S34A 5EHLA 3TT0A 2FVDA 2C5YA 3LOKA 4I6FA 4W9WA 3D83A 5AFVA 1Q99A 1XHAA 4HVSA 3UQGA 4GUBA 1SZMA 2OK1A 3DZQA 3MDYA 4CRSA 3IW6A 4G5JA 4EH5A 2CGUA 1YDTE 3RI1A 4ZY6A 2E9UA 2QODA 4FODA 1Q5KA 1UV5A 3F2NA 5FBNC 3ZH8A 2GNGA 4F0IA 5AUUA 1M2QA 1AD5A 3FMDA 4TW9A 2X6DA 3NYNA 4DDGA 4I22A 5ANJA 4DFXE 3SXSA 3W2QA 2BVAA 3UOJA 2UW9A 3UYSA 4BRXA 3LQ3A 4ZZMA 3NFFB 4DFYA 3TZ9A 3OWJA 3ALNA 3F3ZA 2GQRA 4FKSA 5HI2A 4FTMA 1WAKA 3LXPA 3GUBA 3UVPA 4R1VA 2AC5A 4NFMA 3C4XA 3V5LA 4RX5A 2IJMA 3CJFA 5CSPA 2RSVA 1YOMA 1OIYA 3UNKA 3GU6A 1OVEA 4FV5A 3F9NA 3A7IA 3EQHA 4QTAA 3TNIA 4PL3A 5DRDA 3W10A 3O17A 2YN8A 4CRLA 2YCFA 5HX6A 3ZM4A 3C5IA 3MPTA 1U46A 4QTBA 5AM7A 4XV1A 3T3VA 3DPKA 3IONA 3QTZA 1TKIA 3TZMA 4FIFA 5KNJA 1WBWA 5LVPA 3G15A 1V0BA 2YITA 2PMLX 3R9OA 4IAFA 2UZLA 3ZUVA 2VNWA 4KIOA 3QF9A 3T9TA 2WEIA 4GUEA 4I3ZA 3QUEA 2HOGA 3REPA 3AC5A 3D94A 2PVFA 4RFZA 3RCDA 4CTCA 2P2HA 3AG9A 3MN3A 3L8VA 1QPCA 2YCSA 3ORZA 4WG3A 4XLIA 4BR3A 3NDMA 4G1WA 5HE1A 2VTNA 2XM8A 4O7SA 4DGGA 4EI4A 4LRKA 4HJOA 3LFBA 1LPUA 4E8AA 1G8JA 4YJNA 3ITZA 4GV1A 4KBKA 3BL9A 2QQ7A 3HDNA 4I20A 4FK6A 4QRCA 4QMWA 4AT5A 3MY5A 5ICPA 3QCSA 4CCBA 1SNXA 5K9IA 5LWNA 4N4SA 4XG7A 3E8DA 4QYEA 3GP0A 4KNBA 4U8ZA 2F7ZE 2B53A 3UIXA 3VIDA 2UW5A 1DS5A 2HENA 2OXDA 2WTDA 2ZYBA 3FC1X 2OSCA 2CSNA 3A61A 3WI6A 3ZC5A 3ZLYA 2XKEA 2R3IA 5M06A 3CEKA 3OP5A 1H0VA 3ENMA 3QRTA 4KBAA 4LGGA 4H3BA 5IH5A 4C3FA 5IDPA 2WU6A 4QMVA 2QHNA 4G3EA 3V5WA 1R3CA 4L68A 5IA0A 2CCIA 3SRVA 2WZJA 3LJ1A 4IB5A 4IHPA 1PMUA 1H1SA 4XCUA 4HZRA 2AC3A 3I5ZA 3Q9WA 5B0XA 3QTQA 4DHFA 4FGBA 3BWJA 3PXQA 3PXKA 3LM5A 2C6IA 4E5AX 1YDRE 4KABA 3LCDA 4MD9E 4TWCA 4X7QA 5I9YA 2ZFYA 3EQRA 4EOJA 4EHVA 3HRCA 5CEKA 3M11A 5CEPA 3M42A 3NR9A 4R7IA 4RJ8A 5AA9A 1FMOE 3L9NA 2JBPA 4I23A 1CTPE 5L8JA 1PXJA 3V01A 1V0OA 4M0ZA 2EXMA 4IWPA 4IB0A 4K77A 3EWHA 3F5PA 5B2KA 4BCOA 1DAWA 1H8FA 3F5GA 4I21A 3D9VA 4OT6A 4BVUA 1Y8YA 2JDOA 3IOPA 1M2RA 2XRWA 3QQKA 3QXOA 3R7GA 4UV0A 3W8QA 1JSTA 5CT7A 4B99A 5AADA 5IA2A 1JNKA 2ZV9A 1S9IA 3PWYA 4C37A 3ZXZA 2GFCA 4BTMA 2I0HA 1TQIA 3HA8A 1PXIA 3VS3A 4JX3A 2W7XA 3DBDA 4FTAA 2HWPA 4ITIA 4JQEA 4QYFA 3MY1A 3VONA 2ETKA 4PMPA 3AT2A 4XLVA 4P5QA 3CJGA 5FEEA 1CDKA 5KKRC 4CXAA 4ZJVA 2R7IA 4RZWA 4FMQA 2ITVA 2VTTA 4MK0A 1J3HA 3AMBA 4JAIA 5AAFA 5LOHA 4JRVA 3R7UA 2E9VA 3SOAA 4S2ZA 3QZFA 3VWAA 2W5HA 1GJOA 4O0SA 1B6CB 4FTLA 4B4LA 1Q4LA 3R9RA 1ZMVA 4F7NA 2PMNX 1CKPA 3BU5A 2UZVA 4D1SA 1ZYLA 2GFSA 2CPKE 3UO6A 5IQBA 4BCIA 3EN9A 2JEDA 4HYHA 4QYYA 4NKAA 4BF2A 4CFWA 5BV3A 4WA9A 5I5ZA 4FNZA 3OC1A 3JPVA 2ZJWA 2OIQA 3MTFA 3TL8A 2HY81 3UVQA 3ZO2A 2VWIA 3L1SA 3LFDA 4P2KA 4M66A 2UW4A 1PXLA 4J99A 5DI1A 3DJ7A 2BKZA 2XBAA 4ITJA 3P5JC 2RFDA 4IC8A 4IACA 3VS2A 3S00A 4JR3A 2Y6MA 3QA8A 5C26A 4R8QA 2J50A 2J0KA 4BBFA 4BDJA 4QPMA 4CFMA 3EH9A 3NAYA 3AGLA 4MWIA 3ZLWA 3PE2A 1DM2A 5L6WL 2A2AA 3E8NA 2C3IB 3ORMA 4FVRA 2WTIA 4RWLA 5E8XA 5EHYA 4NTSA 4FG9A 5AUVA 4BDCA 1MQBA 4BJJA 3AC8A 4FEUA 3H9RA 1Q8UA 3O71A 2WMTA 2HZIA 1WBNA 3OOMA 4FA2A 4ORKA 4LOOA 5GZ9A 5A6NA 2C6LA 2GU8A 3NW6A 3G90X 2XEYA 4O82A 4CYIA 1W98A 4F9YA 5E8TA 1W84A 3VUKA 4OLIA 3FEGA 1OITA 5I4NA 4LOQA 3GU4A 1WVXA 4QTCA 4C4EA 4EK4A 3R2YA 4A4LA 3D7TA 4FICA 2VU3A 2QG5A 4QP4A 4AU8A 4FBXA 4XHKB 4O7VA 3F3VA 2VTAA 3PJCA 3FSKA 5EH0A 2ESMA 2JD5A 4YZDA 3H0YA 5DG5A 5H8BA 4E4LA 4D2RA 5HLWA 3R02A 4GKHA 4D2SA 4QEBA 2IG7A 3Q2JA 5HNGA 2PZRA 3KQ7A 1ZAOA 2F7XE 5HE3A 4WOVA 3WF6A 1CKIA 4AOIA 1F3MC 1NVQA 2Y4IC 2JFMA 2JLDA 2XKCA 2Q0NA 3I7CA 3I4BA 4ZTQA 2FH9A 3BGQA 2PE2A 2CKQA 3I81A 3A7JA 2VV9A 4L44A 2XALA 5J9YA 3OROA 4FNXA 1GIJA 2OZAB 3CTHA 4LV8A 3CKWA 5CYIA 2GQGA 4WNKA 3DAKA 2C30A 3O8PA 4C02A 4O0YA 2OG8A 4U44A 2ZDTA 1UNHA 3IS5A 4BBMA 1WVYA 1YWNA 3E8CA 3PJ2A 4DG2E 4FIHA 4JAJA 4XG9A 5H9BA 4FTIA 4F1MA 1OL2A 3MWUA 5IKWA 4FEVA 3UDZA 3E3BX 3MH2A 2WMUA 2OH4A 2UW0A 2VTMA 5GJGA 3BHTA 5AP1A 4XBUA 4Z3VA 1JQHA 4YBKA 3W0RA 4FKRA 4J71A 2BAKA 3I7BA 3UP2A 4FOBA 2V55A 4GG5A 1H27A 3H3CA 1I44A 4MF1A 3IW5A 5E7RA 1MRYA 2FSMX 4ZTRA 3BRBA 5JZNA 4DHIB 2GNHA 2X8IA 3VHKA 4GYGA 5BVEA 1VYWA