3LXKA

Structural and thermodynamic characterization of the tyk2 and jak3 kinase domains in complex with cp-690550 and cmp-6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
284
structure length
279
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 279
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lxkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lxkA01
4OTRA 3R30A 2UVYA 4PDOA 4E4MA 3GOPA 4EH9A 3P5KA 2GS2A 4E73A 3KMUA 2F57A 3D2KA 5FBNC 2H6DA 3P9JA 3OBGA 4L52A 1LEWA 1TQMA 4LRKA 4OGRA 4MF1A 4CFMA 3PZEA 2HW7A 1BL7A 2BFXA 3QZFA 3O8UA 2VO3A 3W10A 1NY3A 3ORIA 5HICA 2PYWA 2GDOA 4LOPA 4HNIA 4BTKA 4IB3A 2ZDTA 2ERZE 3AD5A 3IOPA 4ZJIA 2QG7A 2WMVA 1ZMUA 2WB8A 4AGCA 2GPHA 2P3GX 1DAWA 4PNIA 2QO2A 3LW0A 5CX9A 3PIYA 4YTFA 4BWPA 2QO9A 2JKQA 2XJ2A 5BYZA 4F09A 4AU8A 4O6EA 3MIYA 1JLUE 4L43A 4FEWA 5L2SA 4BI0A 2PMOX 3QGWA 4UALA 5HNBA 1E1VA 2J4ZA 3N4UA 4AS0A 4NW5A 2F7ZE 1YQJA 4ZJJA 3RWPA 4U44A 4F0IA 3FI4A 1B39A 4CCBA 3O7LB 4AAAA 4GCJA 4BCOA 3Q2MA 3PIXA 4P90A 1AD5A 4GFOA 2PZIA 5AAGA 3QGYA 3L9PA 4IWPA 4NJDA 2R9SA 4LFIA 4LMNA 2X7OA 5BMSA 2FH9A 2R3JA 5LVPA 4BDHA 4FTNA 4YPSA 5GZ8A 5CSHA 5E8YA 4PTEA 3RAHA 2PVRA 3HNGA 1SVGA 1H0VA 3H4JA 4TXCA 3VBTA 3PPKA 4ZK5A 5LMAA 3KMMA 5I9ZA 3ROCA 5IQFA 3S2PA 3UP2A 3TNPC 4RIXB 1XH4A 2DUVA 1TKIA 1YRPA 3FXWA 3RPSA 4AOJA 2UV2A 3RALA 3A7GA 2HELA 2IVTA 3WZEA 3ZCLA 2QURA 2VNWA 2ZM4A 3R8PA 3QRUA 5IMXA 2BIYA 4FKTA 1PKGA 2C3JA 4FT9A 5HO6A 4O86A 3U54A 2W1GA 3UQGA 5J7HA 1Y8GA 4QQCA 4FSNA 3R9HA 4ITJA 1SM2A 2EXMA 4OAVB 3PG1A 3QRKA 2VX3A 3NUUA 1H0WA 3GQIA 4ALUA 1MRUA 5LMBA 4U40A 3RM6A 5EM5A 1ZYCA 4M15A 4U80A 2A4LA 1VYZA 1YHWA 3OXIA 3RMFA 2WIHA 4BY9E 4KIOA 5A6OA 3G9LX 3G6GA 4F4PA 3NUAA 1H25A 4M3QA 3FZTA 4DEAA 3R7VA 5ETAA 3UQFA 3AC3A 3HV7A 4QMMA 4EOPA 4FV4A 2G15A 4Z9LA 2J5FA 4FTJA 3UGCA 1Y57A 4QTAA 3ULIA 4YZMA 1ZOGA 2IG7A 4FTAA 3UOLA 4BDKA 3OT3A 3O8TA 5IQHA 4GYGA 5HCXA 4QYFA 3PSCA 4G2FA 3QTWA 3CJFA 4FTMA 3VS0A 4D4YA 5IH4A 4HZSA 4AE9A 3NMUF 3JY9A 3NWWA 4XG8A 3V5PA 3NW7A 3D2IA 4L6QA 4R78A 4FEUA 3VS2A 5HO7A 1WCCA 1O6YA 3IOKA 3NW6A 5E8WA 3V6RA 3AGMA 3VS4A 4O7SA 4CYJA 3QC4A 2HWPA 2Y7JA 4W8DA 3ZRKA 5IISA 3D7ZA 3K3IA 4F65A 3OTVA 5CEIA 3Q9ZA 1KE6A 3KEXA 5CU4A 3VN9A 4XV9A 3MI9A 2BDJA 3NYXA 2R3FA 3U8WA 3N4TA 1ZRZA 5I3OA 3LFEA 4DLIA 4YHFA 2WKMA 2CGXA 1KE9A 5EW3A 4ZY6A 5TF9A 5JEBA 5TT7A 2R3OA 4O0YA 4BCGA 5T6KA 3SOCA 4I24A 3OEFX 5LVNA 4J52A 3BQRA 4CQEA 4U79A 3PY3A 2BMCA 2X4ZA 3ZZEA 2O8YA 2XKFA 3AD4A 2J0LA 1Q8WA 4GMYA 3DQWA 4O38A 4QP8A 4TNDA 2BDFA 3TM0A 2Y6OA 5IQDA 5JQ8A 5M07A 2XRWA 3VC4A 3JVSA 4UMRA 4I5MA 5HX6A 3C7QA 4UXQA 2HXLA 4O2ZA 1YOMA 1PXIA 3MTLA 4BICA 3FLNC 3PA3A 4W4VA 2BIKB 4FIJA 4IH8A 2BKKA 4IW0A 4E6CA 2XF0A 3BLQA 3GFEA 4ZS4A 4CGAA 4MBJA 3C50A 3FMLA 2C6KA 3K54A 5EDPA 3OTUA 4DAWA 4DFYA 3BGZA 3KC3A 2WQEA 3OY1A 5CNOA 4B9DA 2JIIA 2WEIA 4U0IA 4D55A 3IPHA 4IVAA 3IDBA 2VWYA 4L45A 1T46A 1H8FA 2PHKA 4XBRA 3W2OA 3WILA 3FLYA 5IA3A 2PUNA 3MVMA 3O71A 2ETMA 4C38A 1YDRE 1H01A 4KIQA 4TWPA 5TE0A 4FNWA 4WG3A 3CGFA 2C0IA 4FZ6A 4YLLA 4BYIA 4ZJVA 2PVHA 3AGLA 1S9JA 3QRTA 5ANDA 3W1FA 2WTWA 3QQLA 2BDWA 1R0EA 2P33A 3E92A 1STCE 4S30A 3NNXA 2YIWA 2A2AA 2YDKA 3TXOA 5HG9A 3KMWA 3BBWA 3PVWA 3SVVA 3ALNA 4BWXA 1OI9A 4ACMA 4YMJA 3QHRA 4O0VA 3LMIA 3S95A 5L8LA 2WTDA 2C6OA 4BC6A 4E3CA 2O5KA 4ZEGA 2E2BA 3U4WA 3CD8A 3KGAA 2CJMA 2JDVA 3RBWA 4G1WA 4AG8A 1PMVA 4BCJA 4HVSA 3BU3A 2C0OA 3ORTA 4CLJA 3DLZA 2JFLA 2A27A 4A4XA 1OGUA 3KXXA 5ANEA 3E3PA 1U5RA 3EIDA 3O23A 3D14A 4O7TA 4X6RA 5B2KA 2OO8X 4IB1A 4F08A 4Z16A 4EHVA 1UWHA 3HV3A 3OOGA 3PY1A 3RK5A 3MSSA 3UC4A 3DNDA 3W55A 2ITYA 2R7BA 3R01A 3ZSIA 3TG1A 3R7GA 4IFGA 4ZS0A 5FP6A 4S2ZA 4J96A 4GUEA 5I9XA 5IUIA 3OZ6A 4KBCA 3R7EA 1RQQA 4IB0A 5FBOA 3WIKA 5BUJA 5I4NA 3KCFA 3UC3A 2CGUA 3BHYA 1W0XC 1EH4A 4U6RA 3O17A 2WMUA 3FDNA 2BZHB 4E6DA 3POZA 5DG5A 1F5QA 3EQPA 3WZJA 4V05A 4JBQA 4G3FA 2BILB 3CCNA 4M97A 5HIDA 1M7QA 4DCAA 2VTPA 4QMVA 3FMJA 3LPBA 2XP2A 4GRBA 3QUPA 4IZ5A 5AUZA 3RZBA 4EQMA 2FO0A 4MWIA 4S32A 3R7UA 4YBKA 5AM6A 3ZONA 1SVEA 3R0TA 5CVFA 3H9FA 5CS6A 2V7AA 3B2WA 4QMZA 4GJ3A 5IKWA 3GU7A 3LLAA 2A1AB 1J7LA 4ZAUA 3R1QA 5A3XA 2VTRA 4DGOA 3FQHA 2QLUA 3QKMA 4CFVA 3U6HA 3PE1A 5D7AA 1YI4A 4ACHA 2YM7A 5IA1A 3E5AA 4XV3A 4KKEA 2C0TA 1KUTA 4G6NA 3MFRA 3BCEA 4AOTA 4YO6A 5FRIA 3VBQA 4KA3A 4R3RA 3U51A 3HDNA 3I4BA 1BMKA 4PY1A 2C30A 3DT1A 2JKMA 3FBVA 4M84A 4X21A 1O6LA 5C03A 2PY3A 4RFMA 1PRYA 3GOKA 4MNEA 1E9HA 3WI6A 1HCKA 1UU8A 1YXSA 5TR6A 5JH6A 5C4KA 5H9BA 3AC2A 1QPDA 4HPTE 5J1WA 3AC4A 2WHBA 5L4QA 5D12A 3BEGA 1PYEA 1YHSA 2YIXA 2G9XA 3ANQA 4QP9A 4X3FA 4XRLA 1H4LA 4NK9A 5B2MA 1BKXA 5M53A 2PMNX 4EWQA 3DA6A 3DAKA 5E1EA 1FOTA 4HCUA 2YIYA 4BL1A 2HZ4A 4YTHA 3UNKA 2J0IA 3ODZX 4FV3A 5CZHA 4QMNA 3RCJA 3UZTA 3L8XA 2XNOA 4RIWA 3LFQA 2IN6A 4RX7A 4QMYA 3D9VA 3E62A 4WSYA 3IW8A 2FGIA 3UIBA 4J8NA 4RZVA 4IAIA 3P4KA 4HGEA 5GJFA 4BCFA 5KUPA 4DT8A 4FK6A 1GY3A 2C5YA 2QOOA 5EH0A 4C02A 3DXQA 5CVGA 4JS8A 3TZ7A 3F3WA 4M69A 4BCKA 3ITZA 2C6IA 2VX1A 4WNMA 4XV2A 3UYTA 3BRBA 3DXPA 4IC7A 1V0OA 4W4WA 4PNKA 3OF0A 3MVHA 3WYYA 3IDPA 3G33A 2F7XE 4WUNA 1P4FA 2DS1A 4U81A 2QQ7A 4I6QA 2VWXA 5T68A 5AUUA 1XHAA 2P2HA 4GKIA 2QOCA 4NTTA 3NYNA 3QCXA 1FMKA 1K3AA 3VS5A 2YN8A 4PX6A 5EM7A 2OFUA 5AP6A 4ANSA 3EFLA 5CY3A 3KRRA 2JDSA 3VULA 5HU3A 2VO7A 4F6SA 3NAYA 3FZSA 3VF8A 4BHNA 3PSDA 2ESMA 4OTGA 2Z2WA 3W33A 2H9VA 2WO6A 4O91A 5IH5A 2UW8A 4N0SA 3WZDA 3BGPA 3BIZA 4YLJA 1AQ1A 3UIXA 1MP8A 3N9XA 3NEWA 4TW9A 4UWBA 3H9OA 4WIHA 3FKLA 4CZUA 3CBLA 5AP7A 5BVDA 2PVMA 4XBUA 2V5QA 2OXXA 5GNKA 4UMQA 3ZTXA 4R5SA 1X8BA 4MNEB 4ORKA 4EQCA 2LAVA 4L00A 1OKVA 1DI9A 1XR1A 4MH7A 4XG2A 3TNWA 4IZ7A 3GU4A 4LOOA 3DQXA 3A2CA 3COHA 2HENA 3ZSGA 3NIEA 4R6VA 5LCKA 1PXNA 4DEHA 1UNLA 2XNEA 4X3FB 4YURA 2ZV8A 1JSTA 4X2KA 4RQVA 5EI6A 4UMTA 3TZ9A 3ZC6A 4CCUA 5HI2A 3GXLA 4PUZA 5HCYA 1GOLA 5JSMA 3DJ5A 4E7WA 4A9SA 4A4OA 5DE2A 2OK1A 3TV4A 5DI1A 5AR3A 4RIWB 4D1SA 3HRCA 3TIYA 1OMWA 2OIBA 3MESA 4XNEA 3LOKA 4AN9A 4YUQA 3VW6A 4QMWA 2XKCA 4RJ5A 3C4CA 4DT9A 4I1ZA 5TO8A 1QPCA 3BV2A 4M69B 5DRDA 4DTBA 3E64A 4U42A 5KMKA 1SNXA 3HMIA 2CSNA 5K4JA 4F7JA 1XJDA 3BYUA 3H3CA 1OIYA 3I79A 4L44A 4FKGA 5IMEA 4FGRA 4BKJA 3LE6A 5IQBA 4AT3A 4CFWA 2J90A 1YWVA 2FSMX 4ZSAA 5H8EA 3UBDA 4IADA 2VTTA 5EM6A 4QTEA 2OXDA 4O83A 3CKXA 2QR8A 2ITTA 3I1AA 3FHRA 4DG0E 4RQKA 5F94A 5ANKA 1ATPE 2H8HA 1R0PA 4FV1A 2BRMA 4AGWA 4BKYA 3NIZA 4LV8A 2OIQA 2VWVA 3SW4A 4E20A 5M4IA 4E4XA 2B55A 3DBEA 4F6WA 3PLAE 1CTPE 2PUPA 4H05A 5D1JA 2XNMA 4ZMEA 4QMUA 3FQEA 3R1NA 2XK6A 3LCTA 5LCJA 4O0XA 4V01A 5HVKA 2B4SB 4FTUA 4AW1A 3IW5A 1B38A 4O96A 4K0YA 4ZY5A 2R3GA 1A06A 3Q5IA 2X2MA 2OI4X 4GS6A 4F7LA 4O7NA 4H58A 3FI2A 4DG2E 3KK8A 1ZXEA 4XUFA 2QONA 1WBNA 4KIKB 5E8VA 3D4QA 4HNFA 3UPZA 2QU5A 4X2GA 3V5QA 1OUYA 2WQMA 4EL9A 1ND4A 4C35A 4RFYA 2W5HA 4RLKA 3SV0A 4CFUA 3SOAA 3QALE 2X39A 5HESA 4EOQA 2W0JA 3FZRA 4TTHB 4XV1A 3F5UA 5BVEA 4S33A 5EHLA 2C3IB 1YWNA 3DZOA 4APCA 4B7TA 4EH7A 4YJQA 4MXOA 3UODA 4O82A 3ZLSA 4DEDA 1H26A 3I60A 3TV7A 4EZ3A 3FZOA 3AG9A 3FMNA 2B0QA 2DYLA 4O84A 2W17A 4EOIA 3ZFYA 1G8AA 3A7HA 4IIRA 1XBBA 3Q4CA 1JKTA 5CI6A 4BTJA 5DT0A 3EFJA 5EHOA 5FM3A 3W2CA 4GFMA 2C6DA 3FI3A 2QI8A 3QCYA 4ITHA 5AX3A 3MVLA 3LCSA 2W7XA 2BAQA 3Q6WA 3RPRA 3ZC5A 2GQRA 1W82A 2JITA 3CJGA 1YWRA 1GAGA 4PV0A 1RW8A 4KSQA 1BX6A 3UDBA 4XG4A 2ZM3A 3D5XA 4HYUA 4C33A 3OWKA 4DFZE 5J9YA 1BI8A 2OG8A 2RGPA 2ETRA 4WSQA 5HE1A 4OTDA 2RFDA 4C7TA 3R71A 2OZAA 4OAUC 3EQCA 3L9LA 4BCQA 2GNJA 4XRJA 4WHZA 4GV1A 4FSZA 3TV6A 3UP7A 1K2PA 3JUHA 4EH4A 5JT2A 1L3RE 3KXZA 5M55A 3R7OA 4IM2A 3S0OA 5CAQA 4K11A 2YM6A 4EH6A 5L2QA 4FKSA 4CZYB 3BLHA 3UIMA 4KUJA 4ALVA 4CMOA 3ZLYA 3I81A 3W2SA 4MAOA 1PW2A 4I0RA 4IM3A 3RP9A 4Y5QA 2R4BA 3U6IA 4IWQA 2W1IA 4M14A 5F9EA 1OL2A 2E9UA 4NKSA 5BX0A 4X6QC 2YJSA 4NJ3A 1M2QA 3G6HA 4FYOA 2QOQA 3FMKA 4I22A 2XNBA 4NUSA 3WBLA 3HYHA 3BYSA 4WNKA 1NXKA 4BHZA 1Q3WA 5EYMA 5GJGA 5KMOA 2R64A 3TUCA 1IAHA 2YCQA 4WOVA 1YI6A 2F2CB 3NUPA 4FIIA 3T9TA 3PJCA 5HX8A 2YAKA 2ZV2A 3QTSA 3EN6A 4ASDA 2RFNA 3TTJA 3A4OX 4C2VA 5A6NA 3OBJA 3NW5A 4U3YA 4D58A 1AGWA 3HGKA 3QF9A 4IXPA 2V7OA 3GU6A 3QKKA 4JDKA 5E92A 5JFVA 1J7UA 3LXKA 3BEAA 1R39A 5IEYA 4GT4A 2RSVA 5CEPA 5I9WA 1FPUA 3BHUA 3WF7A 3HRFA 4CKJA 3FL4A 3V8SA 2BAKA 1A9UA 1H1WA 4RRVA 1PXLA 1YXXA 2CKQA 5ANJA 2JIVA 2PUIA 1WAKA 3R8MA 2OZOA 2WAJA 3F88A 4GVJA 4MXYA 3AC1A 4NZWB 3UVPA 2XBAA 3T3UA 1W98A 4ACCA 4FKUA 1JBPE 1FVTA 1HCLA 2OJJA 5EHYA 4JR3A 3AC8A 5C1QB 3CQUA 2RIOA 3QXPA 2HIWA 4FTLA 3FL5A 2V22A 4BCHA 4WRSA 2YITA 4WRGA 1TQIA 4Q9ZA 3TCPA 2PVKA 3PIZA 2W1ZA 3BHHA 3EHAA 4RX5A 4RA4A 4OBQA 1OL1A 3UTOA 3DTWA 4K77A 4XLIA 5HEZA 2BALA 4Q5HA 4ZSEA 2UW6A 4PDYA 3ZS5A 4G9RA 3BX5A 4ACGA 4APPA 3CP9A 3T9IA 4I21A 2VAGA 3EYGA 4BBFA 5AAFA 1XBAA 3BI6A 4FSUA 4PWNA 4DTAA 4MD8E 4Q5EA 5EYKA 2BHHA 3C0GA 4FL3A 3K5VA 2GQGA 3CS9A 3E8NA 3OD6X 4L01A 4KS8A 3VS3A 5FEQA 3HUCA 3VS6A 4WO5A 3MY0A 1IAJA 2ITPA 1FBNA 5LXMA 4FIEA 1OM1A 3ZO2A 4FKIA 1SMHA 2WELA 4KAOA 4MF0A 4U3ZA 2JGZA 3CY3A 4L3JA 4W9WA 5AP2A 2ZYBA 4E8AA 2C4GA 2GFSA 2ITUA 1SVHA 4BDEA 3R9RA 5JRSA 4XG9A 1RJBA 4F7SA 3GCUA 1JKSA 2W9ZB 4QMLA 4DEEA 3EMGA 4HJOA 3LXNA 2GMXA 2YWPA 4RX8A 3NR9A 4UWYA 4N57A 5AUXA 3LFAA 5A4CA 2VV9A 3BE9A 3FI8A 4U9AA 1URWA 1YXVA 4DE4A 2J51A 4EUUA 2PZ5A 3PLSA 2BVAA 3HP5A 4FK3A 2OBJA 5I3RA 3BGQA 5HTBA 4AZWA 5IA4A 1Q8ZA 3F3VA 3ORKA 4JT3A 4BWKA 4FKRA 5ICPA 4FTCA 4M0YA 5K3YA 3S3IA 5A14A 4P2KA 2KULA 5HBHA 3QL8A 4HVHA 1VYWA 4F9CA 3QCQA 3W8LA 5C9CA 3UNZA 5CNNA 2VRXA 3IDCA 5CZIA 3PJ3A 3M11A 5AP0A 4BGGA 3V5JA 3N51A 2XM9A 3Q53A 3IW4A 2BUJA 3QQFA 2PE2A 2C6TA 3FPMA 4L46A 4B0GA 4D1ZA 5M4UA 2EUFB 3RCDA 2B9HA 4NCTA 2G01A 3EH9A 3KRLA 2W05A 3QFVA 4RVMA 3VF9A 4ZIMA 4AA0A 4J1RA 5K5XA 4FZDB 2X8EA 4QYGA 2W06A 3GCPA 5AM7A 4OT6A 3KN6A 3IK3A 2IW9A 4AZEA 1PXMA 3V3VA 4EK8A 2Y4IB 1M14A 3SRVA 3G0EA 5FLFA 5IZFA 4I5CA 2X8IA 4E93A 1GZNA 5BVOA 3TDWA 2UVZA 2ZMDA 3QD4A 4JBOA 4O7RA 4F9BA 1H1RA 3PJ8A 4BTMA 5CT0A 5DMZA 3KU2A 3QC9A 4HPUE 2XIKA 2HXQA 2XUUA 3E88A 2C47A 2IZUA 2BROA 3B2TA 3DGKA 4RJ4A 3HV5A 3K3JA 4UWCA 4DFXE 3MH3A 3Q4TA 4V0GB 3GCSA 2FSOX 4B99A 5EQEA 4H3QA 4L7FA 2C69A 2W1HA 1DAYA 4XLVA 1P4OA 2Z7LA 4PTCA 4D2RA 3FKNA 4UMUA 4FSMA 2WPAA 4FTRA 3MS9A 1H1QA 3KRWA 4UZHA 4D4RA 4ZTNA 3P79A 5FWKK 2X2KA 3A60A 2VTMA 5HU9A 2QHMA 4WBOA 2YZLA 4IVBA 2VZ6A 4MNFA 1G3NA 4L3LA 5CXHA 1YDSE 3SW7A 2OKRA 1XH5A 3BYVA 3II5A 5AV0A 2E9NA 3I5NA 3R22A 3AD6A 4QP4A 3BWFA 3GEQA 5HG7A 3FPQA 3VVHA 5M56A 3QTRA 4DITA 3FUPA 4M66A 2NRYA 2QHNA 3PSBA 4NFMA 3R9DA 3IGGA 4AE6A 3WZUA 3F3TA 4KBAA 5IG1A 4LQMA 5AP3A 3MY1A 4TT7A 5HNGA 3M42A 5HLNA 2XIZA 3LFBA 5CU2A 2W96B 1UU9A 3PVBA 3CR0A 2ZVAA 3FY0A 4GK4A 4JQ8A 4J7BA 3ODYX 3GC9A 3OEZA 4YLKA 3RPOA 1V0PA 2QKWB 3GU8A 4AW5A 3KK9A 2XK3A 3KXMA 4B8LA 3DDQA 4XH6A 3NNUA 3VQUA 4USEA 3ULZA 1NVSA 2B9FA 3FQSA 4QQJA 4O7LA 3ORPA 2CGVA 4YJVA 3V5WA 3U9NA 3GFWA 3SRVB 4EK3A 2BR1A 5FDXA 4FT7A 2XH5A 3KF7A 2OLCA 3CXWA 4CKRA 5IQGA 3GU5A 4FI1A 4FMQA 3PXRA 2YIRA 3GGFA 3IO7A 5BYLA 4BR3A 3Q9XA 4C62A 2AYPA 3RNIA 4BN1A 5AV2A 1FGIA 3TKIA 1P5EA 4WD5A 4NU1A 4C3RA 4TWCA 3QD3A 4A4LA 2VGPA 3A62A 4HYIA 4BIBA 4YTCA 2R2PA 5ACBC 4X3FC 3C13A 2J0JA 3OCSA 5L6OA 2WMTA 4N6YA 2YISA 4KIPA 4BKZA 1ZY4A 5JZNA 4X2FA 2YWVA 4EOOA 2R7IA 4WKQA 4BBMA 4U45A 5L2TA 4QQ5A 4BRXA 1REKA 1WFCA 4W9XA 3WIGA 4CSVA 4EKKA 1YI3A 2E9VA 4OTFA 1FMOE 4DBNA 3V04A 4E6AA 3PA4A 4U5JA 4FYNA 4C4EA 3NCZA 3QWJA 4ZLZA 2A19B 2VX0A 3VS1A 4BIEA 3R1YA 2O3PA 4BDJA 4ZXTA 4CEGA 2JEDA 4QYHA 1KV1A 5J95A 4FTIA 1UNHA 5GIPE 2RG6A 3KN5A 5DVRA 2J7TA 5CU3A 3CIKA 3NX8A 4D2SA 4RVKA 2UZUE 5CF5A 5EI2A 4EHEA 2UZEA 3HDMA 3JYAA 3R28A 2Z7RA 3IONA 3PJ1A 3FY2A 5CAUA 2JC6A 2VGOA 2FSLX 3HV4A 5IDNA 4NM0A 2PVNA 3OC1A 4LL0A 4CKIA 1JOWB 2VWZA 2UZLA 3KY2A 4EI4A 3JR1A 4AZFA 4X2JA 3PP1A 4GFGA 3E93A 4L9IA 2HYYA 3DJ7A 3DV3A 3F7ZA 3F9NA 5D7VA 4W4XA 4E5AX 1IG1A 2GS7A 1UWJA 2F49A 3GBZA 3ZU7A 3DBCA 1KE7A 4C34A 3HMNA 1KWPA 5L8JA 2WU6A 1J1BA 5E8ZA 3Q52A 4ENXA 2Y4PA 3NAXA 5K9IA 3EQHA 1ZOEA 3ERKA 3O7LD 3PXQA 2XNPA 2ZDUA 5JFWA 2GU8A 4MYGA 4F1TA 4FTOA 3VHKA 4RGJA 3ORXA 4RZWA 5A46A 3HKOA 4DC2A 2X6EA 3EB0A 4AT4A 5M51A 5M4CA 1OPLA 3QWKA 5DWRA 1FVRA 3BELA 1OL5A 4O7VA 5F4NA 2HCKA 4IX4A 3VUGA 1U4DA 2FSTX 2PE1A 2ZV9A 3C4FA 4EYMA 3I7BA 3D7TA 3R04A 3C9WA 3LFDA 5DN3A 4F0GA 4BIDA 3D15A 3Q96A 3R21A 3OROA 2R3KA 4RIXA 1IR3A 4RLLA 2YFXA 1WVXA 5G6VA 3ZO1A 2IZSA 2JD5A 4H3PA 4DTKA 3TL8A 3V51A 4O7WA 3P7CA 4UYAA 1GIIA 4D28A 3KXHA 3O2MA 4XJ0A 4PPBA 4QNAA 5DIAA 1LPUA 4ID7A 4EC8A 2ZJWA 4ZZMA 4FTTA 3W2RA 4D2VA 5BVNA 5BYYA 1VZOA 4U41A 4C4IA 3SG9A 4FT5A 4RJ8A 3EWHA 4L7SA 3ET7A 2VO0A 4UY9A 5LWNA 3OXZA 3A8XA 2W4OA 3HZTA 5AIKA 3C0IA 4DH8A 3R2YA 3QQKA 5IPJA 2PVLA 4OTWA 2XK4A 4MBLA 4AQCA 3EKKA 4YNOA 3G5DA 5E90A 3HMPA 1OPKA 1WBPA 5E4HA 3N4VA 3FSKA 4JAJA 3MJ1A 3D5VA 2B54A 4NM7A 3RHXA 4BCIA 5AA9A 4L42A 4YJTA 4HCTA 2JDRA 3JS2A 4EK4A 5BMMA 4RVTA 4U8ZA 4UXLA 4ANOA 1ZYSA 2QOBA 1W83A 2GHLA 2J0KA 3P08A 4TL0A 5DNRA 3NVKI 1PKDA 2IO6A 3OP5A 3OOMA 3V5TA 1OKYA 4DGMA 4AT5A 4L53A 5CEOA 4FNYA 3R7IA 4RJ7A 3GVUA 1QPJA 5D11A 4YJPA 2WTCA 3PXYA 3QA0A 4IVCA 4RIOA 5EOBA 3VJNA 1M17A 4CG8A 3R6XA 3CTJA 4RSSA 2WMAA 4WNOA 5EOLA 4EEVA 3F3ZA 2WOUA 2WQBA 2GCDA 3P0MA 5EM8A 2CKEA 5EI8A 5H3QA 5AUYA 2IW6A 3RAIA 3RK9A 3QUDA 3TTIA 4Q9SA 4EH3A 1G8SA 2Q83A 3F7WA 2JDOA 4RG0A 5HD7A 2UUEA 2W99B 5CXZA 2BHEA 4BYJA 1ZZ2A 1WBWA 3D7TB 3EJ1A 3A99A 2ZM1A 4QTCA 3QHWA 5CVHA 3CKWA 1S9IA 4IZAA 4KD1A 3Q60A 4LGHA 3MH0A 3ZDUA 3JY0A 3NS9A 4KNBA 2ERKA 4FUYA 4HOKA 4CMTA 5HG5A 4F64A 5CF6A 3WE8A 2WMSA 4JG7A 4FKJA 4D2PA 2WQNA 3C5IA 2GS6A 5FEEA 1L8TA 4C8BA 5EW9A 3UOHA 2PE0A 2X7FA 3IQ7A 3D5WA 4D0XA 3PXFA 4QPSA 3DAJA 4Z55A 1FVVA 2V55A 4ZZNA 4DA5A 4E1ZA 2Q0NA 5B2LA 1JWHA 1TVOA 3NNVA 2VD5A 4ZOGA 3TKHA 2VTQA 3GCVA 4EORA 2H96A 5KHXA 4M13A 5HORA 4PL3A 5KE0A 4XP0A 3HRBA 3OT8A 4UEUA 3ZDIA 2OICA 3ZBFA 3NNWA 5LJJA 4XG7A 5HTIA 2ZB1A 2I1MA 5HNIX 3TT0A 2VWIA 4JJRA 5ETFA 4PQNA 5A4QA 3LFFA 2DQ7X 2OWBA 3O0GA 4IX6A 4KS7A 4OLIA 4QTBA 3S4QA 3UNJA 3AMYA 2J0MB 3BQCA 3WF5A 3PPZA 2I40A 4HGLA 5JKGA 2QR7A 4FUXA 3LKMA 2RKUA 3DBQA 2BZJA 5BVFA 4O0RA 2ITXA 2YM3A 2WXVA 5J7BA 2Z60A 3TZ8A 3KFAA 1PXOA 3LXLA 2RF9A 3ZEPA 4TYIA 4EJNA 3KCKA 3LXPA 3DNEA 4PMMA 4YC3A 4P5QA 4M7IA 3DB8A 4YR8A 5CSVA 1XBCA 4YC8A 4D5KA 5AJQA 5BVKA 1XWSA 3NUYA 4FIFA 4H1JA 4LM5A 3QZHA 4EQUA 3QTZA 2HK5A 2UZTA 3VUHA 1Q24A 1XH9A 1P14A 2C68A 2JAVA 3QD0A 4IX5A 4XP3A 4YO4A 2FVDA 4EK6A 5HTCA 5LMKA 4H3BA 1BYGA 4YTIA 1PYXA 4AZVA 3GC8A 4YHTA 2VTLA 5H2UA 4EH8A 2EXEA 1IASA 3EYHA 4RT7A 4BDAA 4IAFA 4DHFA 4FZAB 3DY7A 4YP8A 4IAKA 4GSBA 3MYGA 3MW1A 1JKKA 4D2TA 4IANA 1OUKA 2QLQA 2X2LA 2X7GA 3I6WA 3SXSA 3WZKA 4NM5A 3UMWA 4RC3A 2WTVA 5CWZA 4PDSA 3IGOA 3KVWA 4BDIA 1JSUA 3QQJA 4G17A 4YJOA 5CENA 3CD3A 5BQ0A 2IPXA 4FSWA 4ANLA 1IA8A 4I93A 2YM4A 4JVGA 2X0GA 4ZLOA 4C4GA 4XOYA 4J53A 3HVCA 1OIQA 3Q9YA 1ZMVA 4XG6A 3RPVA 1Y8YA 5H8GA 3V6SA 5LVLA 1PMEA 3ELJA 2R5TA 3PJ2A 2WIPA 4CV9A 3EQIA 3G0FA 3R8ZA 4C58A 1CKIA 3TZMA 2CN5A 3NCGA 1LEZA 4O1OA 1OPJA 5BVWA 3AT3A 5HO8A 2WEVA 4C4FA 4TRLA 2PU8A 4HZRA 5JGAA 3EZRA 2KTYA 4QMTA 3NUXA 5AR8A 2XM8A 5L6PA 5FEDA 2NRUA 3W8QA 4E4LA 3UZRA 4B8MA 4QP3A 3MFTA 5HKMA 5AUWA 2YAAA 2XS0A 2PVFA 3G9NA 4IEBA 2XYNA 2HZIA 5BNJA 4ZSGA 5AFVA 1G5SA 1PJKA 2C5VA 5A4TA 4NT4A 3UYSA 4AFEA 5IH6A 4FSQA 3LCKA 1CM8A 2Y4IC 4JNWA 5E7RA 5FQDC 5LVOA 4J98A 5E8SA 2P2IA 5KKRB 2WZJA 2X9EA 3UE4A 4GW8A 3Q4ZA 4DCEA 3HAMA 2RL5A 1SZMA 3FZ1A 2YCSA 5DRBA 2CNQA 2X81A 2JAMA 3P7BA 4Y95A 2BTRA 4WT6A 4EWHA 1FQ1B 2CGWA 1ZAOA 4FVRA 4YJSA 1F0QA 3Q6UA 3KRJA 3A7FA 3RTPA 4ZMFA 4NW6A 2EU9A 4LRMA 4CG9A 1CKPA 2UW3A 5C26A 2I7QA 5CU6A 4DF3A 3C5UA 5FTQA 2C6MA 5GZAA 4FG7A 5JFSA 2I0EA 3ORNA 4DGGA 3C4XA 4MHAA 4F9AA 4LI5A 3BU5A 4MQ1A 2UZNA 3IS5A 4QT1A 5DH3A 2CCHA 1U54A 3K2LA 3FMDA 3QD2B 4O2PA 4QMPA 4C36A 4C57A 3G15A 3KREA 4GT3A 4PL5A 3E87A 1PXJA 5TKDA 4JIAA 3QRJA 3VRZA 2UW9A 3BYMA 3OVVA 5M4FA 4GG7A 4GU9A 2OXYA 2XB7A 3ATTA 4G3EA 3LQ3A 1QMZA 3HMMA 4K2RA 5GHVA 5CQUA 2BRNA 2WOTA 2GSFA 4TYGA 4XYFA 2YLEA 1WBVA 3QX4A 3LHJA 3R1SA 3C0HA 2F7EE 4UV0A 3RVGA 4DH1A 3MB7A 2XNNA 5FP5A 5ANIA 3VBWA 4DH5A 3EQRA 2XVDA 5KBRA 3PP0A 3KKVA 4TN6A 4DN5A 3Q5ZA 3JXWA 4JG6A 4YHJA 3WOWA 1KOAA 4OUCA 3CC6A 4DEBA 4PP7A 3U4UA 5CF8A 4GL9A 2UZDA 1V0BA 3Q2JA 2UW0A 3BU6A 4IB5A 2B1PA 2CLXA 4FT0A 4AACA 2RFSA 3PWYA 3DKOA 5BUIA 1CMKE 4FKPA 4CD0A 4XP2A 2BTSA 2YACA 1NA7A 3PYYA 1BL6A 3ZUVA 5CSXA 3C51A 1M7NA 2QC6A 2I0YA 3F2RA 1LR4A 5CEKA 3F2NA 3AMAA 4IDTA 4UN0C 4U7ZA 4OTIA 5KMNA 4MXXA 2IVUA 3I0QA 4G16A 4EC9A 5AWMA 5C27A 2CNUA 1NVRA 2Z7QA 4FKVA 5L2WA 5KMMA 4OBOA 4WA9A 4LG4A 2YIQA 3QBNA 4QMSA 4AGUA 4BDGA 3NPCA 3FYJX 2SRCA 1U5QA 3ORMA 2J50A 5KBQA 4AOIA 2XNGA 4FV9A 3FEGA 3CQEA 4Y46A 1M52A 3MWUA 4GG5A 4C3PA 5HQ0A 2PL0A 3EN9A 2VTAA 4JR7A 1H28A 2V0DA 1IEPA 4IAAA 4ZSLA 1P2AA 5T3QA 2ONLA 3FMMA 3UOJA 1Q61A 2BPMA 4YJNA 4LRJA 4BCMA 4NL0A 3VUTA 4C0TA 3F3UA 3MB6A 3W16A 4EH2A 3VJOA 3CPBA 5I9VA 3NRMA 5M06A 4JAIA 1MRYA 4R7HA 3VNTA 3L9NA 3EFWA 4MKCA 4ZTHA 2E9OA 1H08A 2W5BA 3TEIA 5KO1A 3REPA 4N6ZA 3QUEA 3VBVA 4FG8A 4D9UA 2FUMA 2OZAB 4PDPA 3UO4A 4ACDA 2P55A 2C3KA 4QPAA 5AR7A 2IVSA 3MGYA 4AP7A 2GQSA 4S34A 3PUPA 4BVUA 4FC0A 3BE2A 4D5HA 4ERWA 5CEMA 2REIA 4MWHA 4CYIA 5F1ZA 3HA6A 4NIFA 4O27B 3FLWA 3COKA 1HOWA 1H24A 2HZ0A 3ZO3A 3PA5A 4Y5HA 2ITVA 3NUSA 3OUKA 4L3PA 3FSFA 1R1WA 4B6LA 2PSQA 5ACKA 3K5UA 3MTFA 4RWKA 2B7AA 4IACA 4ITIA 2EVAA 4FZ7A 3SLSA 4XG3A 3ORLA 3EKNA 4NFNA 2R3IA 1YOJA 4CRSA 3FXZA 1H07A 2UZVA 1NW1A 1A48A 3DBDA 5C8MA 3RPYA 3C1XA 4H1MA 3EN7A 4ZTLA 3TJCA 5ETIA 4YGAA 4FVPA 3PFQA 2CDZA 3TNIA 4DGNA 5J5TA 1UNGA 3CTQA 4AF3A 4UZDA 3T8OA 1VEBA 2YA9A 4OR5A 2WMBA 3OWPA 5E8XA 1UU3A 3LM5A 5IQAA 5AA8A 1V1KA 4R8QA 4KSPA 4ZTRA 4Y73A 2W9FB 2X4FA 4KBKA 5D9HA 3ROYA 3DK7A 4ERKA 4O81A 2CCIA 5CAVA 3S00A 3FLQA 3O96A 1I44A 2W5AA 5JRQA 2YDJA 2VU3A 3R8UA 3NYVA 3V5LA 3DKFA 3LZBA 5M57A 2V62A 4CVAA 3LM0A 4MQ2A 5JK3A 3RGFA 4EHZA 4FSYA 5DT4A 3WYXA 5DEYA 5EW8A 4GIIA 4S31A 4IVDA 5L8KA 2XRUA 4U97A 2QG5A 2WGJA 5I9UA 5FXQA 1ZYDA 4FV0A 5CLPA 5DHJA 2B52A 4PRJA 3UG1A 4ZTMA 1NT2A 4FV7A 3F82A 3HX4A 4HYSA 3OCBA 4P4CA 3VHEA 1PMUA 4I6HA 4WBBB 3ZRLA 4E5WA 5KCVA 4FL2A 5EK7A 4YC6A 4XS2A 3TI1A 4CTCA 2XKEA 3QQUA 4GU6A 2B9JA 2BFYA 4F0FA 3BHTA 3V01A 2G1TA 2UW7A 5E91A 4JXFA 2VUWA 4FT3A 5DOSA 5I9YA 4I6BA 2QKRA 4NIFB 4AN3A 2YERA 1FGKA 2VNYA 3C4WA 4BDFA 4Z7HA 4LYNA 2VTHA 4EZ7A 1Y91A 3GENA 4FNXA 2O0UA 5CANA 2OIDA 3L8SA 2UW4A 3GNIB 2R3NA 4QOXA 2WTIA 3AXWA 5AUVA 1RDQE 4Z7GA 2VWWA 4R77A 3LJ0A 3MPTA 3UVQA 5EG3A 4GT5A 4IX3A 3RKBA 3OG7A 4YSMA 3SQQA 2QO7A 1OL6A 3BBTB 3E8CA 2BCJA 4RPVA 4F9WA 5M09A 4BI1A 1OITA 4O6LA 3P23A 3SXRA 2JBPA 5AP4A 5EFQA 5KNJA 2CKPA 2ZOQA 1R78A 5FM2A 3ZMMA 4LOQA 3KRXA 4KRDA 1R3CA 5DR6A 3BWJA 2IZTA 4II5A 4I4FA 5IDPA 4JDIA 3HA8A 1W7HA 2J5EA 4AZSA 3RINA 1BI7A 1YDTE 3BYOA 4QP2A 4DG3E 3RM7A 2XKDA 1M2PA 2CHLA 2XCHA 2Y6MA 3I0OA 3F2AA 1IA9A 2NNWB 4G5JA 5D10A 3OFMA 5ETCA 4ANMA 4PMPA 3OXTA 1LUFA 5LOHA 3ACJA 3O51A 4DH7A 5L3AA 2JDTA 5HE0A 5CQWA 3UO6A 1OVEA 2QOHA 4X7QA 3MBLA 3PVGA 5J9ZA 2UVXA 3ENMA 3L8PA 4GK3A 5JGDA 2JKKA 4USFA 3MV5A 2OJIA 2X8DA 2ACXA 2XEYA 3TUBA 2FB8A 2VN9A 4LUEA 2DWBA 4EONA 2W4JA 4FX3A 3Q04A 3QZIA 2W1DA 4WNPA 5CYIA 1WVYA 4D9TA 1ZOHA 2XJ0A 4ZLYA 4GEOA 4FODA 3MVJA 4IHPA 4G3CA 5HCZA 4BCNA 3CPCA 3AC5A 4F70A 2I0VA 4QP7A 4JRVA 3A4PA 4O22A 3IECA 2J9MA 4K6ZA 4TZRA 4FA2A 3VAPA 4BI2A 4R1VA 5E8TA 4F7NA 1GNGA 4EZ5A 4IJPA 5I0BA 1Q5KA 3LIJA 2XA4A 2WQOA 1TQPA 5DGZA 3HUBA 5E9EA 4AW0A 4C37A 4A7CA 4RWLA 3HECA 3AT4A 4R3CA 3UO5A 4IAZA 4EYJA 1ZZLA 2QOIA 3DFAA 3RI1A 4I0SA 4X2NA 2VTIA 3LJ1A 3EOCA 4I6FA 3DKGA 5EDRA 5FTOA 1J3HA 4O7YA 2UW5A 2I0HA 4PPAA 4A9UA 1BUHA 5DA3A 3OWLA 4FV5A 4BCPA 5J8IA 4BZOA 3SD0A 4XEYA 4IDVA 2WNTA 5J9LA 4JBVA 2EB2A 4JL9A 5FUTA 4H39A 3IW6A 2GHGA 5IEXA 2GTMA 2R3HA 2WTKB 4C4JA 5K0XA 3SHEA 4FZFB 4AUAA 4YU2A 4FF8A 4FICA 4JG8A 4GH2A 3LVPA 3FV8A 4YJUA 4JOAA 1JQHA 2OF2A 4G3GA 4JI9A 1YXUA 5FD2A 2PZPA 2YCRA 4IJ9A 5IA0A 4EHGA 1GJOA 2HY0A 5BUEA 2XJ1A 4QQTA 5FG8A 5E8UA 5HVJA 5HBEA 3LMGA 3FJQE 3QTQA 2EXCX 1H27A 2OSCA 2W1CA 4G3DA 1FINA 4I23A 2R3QA 4MX9A 4FE2A 5J79A 5HE2A 4CT2A 4CMUA 3QQHA 4FV6A 4TPTA 4L8MA 5DBXA 1YOLA 3F69A 1E1XA 1Z57A 3G51A 4F1OA 3MN3A 1GZOA 4DINA 1MQ4A 2ITQA 4ZTQA 4ZTSA 4AN2A 4RA5A 1OBGA 5LARA 1JKLA 2YZAA 4BTFA 5JN2A 2OGVA 1WBSA 5AX9A 4TYJA 2PULA 3UQCA 1KE5A 3A8WA 3ZRMA 2CKOA 4K33A 5AR2A 4PP9A 4FEVA 3CSVA 5DLSA 1CKJA 3R8LA 3U9CA 4RC4A 1ZYJA 4E6QA 4TWNA 3QTXA 3DU8A 4D4VA 4XMOA 5AUTA 1YHVA 5ANGA 5AV4A 4FKWA 4P5ZA 2OW3A 4IAYA 3AOXA 1VR2A 3M2WA 2ITZA 4QPMA 4N4SA 3OWJA 5FGKA 5GINE 5H8BA 2VWBA 4KKHA 3AMBA 3DS6A 3EQFA 3LFNA 4FVQA 4XX9A 2O64A 5HLPA 4BDDA 4D0WA 2IWIA 4A9YA 3R73A 2BRHA 4K9YA 4OW8A 4A9TA 3C4ZA 2Z02A 5CASA 4I5HA 1KSWA 3FC1X 5AMNA 3LAUA 4O21A 4YNEA 4AX8A 3DPKA 4Z3VA 3VBXA 1JSVA 1VJYA 3EZVA 4MEDA 3IG7A 3KULA 4UMPA 4IZYA 1H1PA 3IKAA 4ALWA 3UG2A 2B9IA 3DOGA 4J71A 4RWJA 3PRFA 3D83A 4M12A 4QP6A 5CU0A 4JIKA 3W2PA 2YHVA 2QU6A 1APME 1Q41A 3WF6A 3HMOA 5J87A 3Q32A 3G2FA 4NTSA 5KKRC 3FC2A 4Y83A 5IA2A 3HAVA 3PWDA 4EJ7A 3HP2A 3LJ2A 2XEZA 3NZ0A 3P78A 4CXAA 5HE3A 3WE4A 4BZDA 5FTGA 3DZQA 4QD6A 1OBDA 2GNLA 4IFCA 4LL5A 2OF4A 4NKAA 4RC2A 5LMKC 4ZZOA 3CE3A 1Z9XA 1OKZA 2PMLX 3E8DA 2J6MA 3MPAA 3OCGA 5L6WL 5ANOA 3QKLA 3DCVA 3ZH8A 4YZCA 3DB6A 3POOA 5CSWA 1BLXA 4F1MA 5KMJA 4ZSJA 4J95A 5HZNA 3F6XA 3LQ8A 4LV5A 3FYKX 2ITOA 5IUGA 2BKZA 3I6UA 2C5NA 5LWMA 3S1HA 1YW2A 5HIBA 4P7EA 3O8PA 4FSTA 1LP4A 2YABA 2QOKA 3GQLA 2XIRA 3HEGA 2W4KA 3QAME 4FG9A 3OS3A 4CRLA 4X0MA 2VTSA 4FTQA 2WD1A 2Y9QA 4ANBA 4ZP5A 5K0KA 3R00A 2O63A 1RE8A 2IJMA 3LCDA 1Q97A 3EN5A 3EQBA 3V8TA 3ZEWA 4EOLA 3SX9A 1SNUA 5G1XA 3FE3A 4YBJA 5KZ0A 3TACA 3ALOA 4A07A 3QTIA 4C2WA 1UV5A 2YJRA 3DJ6A 3GCQA 2OJGA 3JPVA 3EFKA 2XBJA 3QU0A 4IBMA 4B4LA 3Q3BA 4D4SA 3QLFA 3ZFMA 2OFVA 4TNBA 4QTDA 1XH8A 3IW7A 2X6DA 2ZAZA 4RBLA 4FNZA 4I41A 4I20A 5CAPA 5JGBA 3FZPA 2I6LA 4G5PA 4C61A 2CLQA 3H0ZA 5JQ5A 3KULB 4E26A 3HL7A 4KABA 1J7IA 4NYEA 3SG8A 3MA3A 3W18A 3WARA 2O65A 2ZMCA 4QRCA 3SAYA 1OECA 4O0UA 1PXPA 4IWOA 4G6OA 3ZYAA 3R9OA 2WFYA 1WBOA 3WF8A 4QMQA 2PVYA 3SXFA 4BBEA 2Q0BA 4C4HA 4FKQA 3RNYA 4HVIA 1QL6A 2ITWA 4TYHA 4IC8A 3MJ2A 1REJA 1MRVA 5K4IA 2R0UA 1Q8TA 1PMNA 5B7VA 3OUNB 3ZUTA 4RX9A 4CTBA 1WVWA 4YZDA 2PMIA 1ZWSA 3BLRA 2BZKB 2CN8A 3H0YA 2GTNA 1KV2A 3SC1A 3COIA 2XYUA 4AXAA 3FAAA 3W32A 4AZTA 4R7BA 3FLSA 4HYHA 2B53A 3CTHA 3ZHPC 3RWQA 4PPCA 2G2HA 4ASZA 2XK7A 4OBPA 4KWPA 1ZLTA 5B0XA 2GNHA 3H30A 5DPVA 4EOKA 4FIHA 2VTJA 3MY5A 2XIYA 2AUHA 3PXZA 2PZRA 4GUBA 2NPQA 4JRNA 4RFZA 4JBPA 3R02A 4TY1A 4ARKA 2PUUA 3ZFXA 1DI8A 1IRKA 4EH5A 2AC3A 4O0WA 3H9RA 4EOMA 3PZHA 1ERKA 2R3LA 4K18A 4A9RA 3NUNA 3MH1A 3BPRA 3JVRA 4L67A 3OY3A 4M0ZA 4M67A 5AP1A 4GYIA 4R5YA 5HG8A 4GVAA 3T3VA 3V8WA 3KVXA 4GK2A 3ZBXA 3OHTA 3FWQA 2PVJA 4FOCA 4FSRA 1UKHA 5IEVA 5KMIA 4JQEA 2XK9A 2EB3A 3MFUA 1URCA 4XOZA 5IQEA 4I0TA 2W1EA 1KE8A 4YZ9A 1U59A 3TDVA 4BZNA 4I94A 2C5XA 1WZYA 2ZV7A 1F3MC 2CNVA 5A54A 4J99A 3NSZA 1YXTA 5DR2A 5AV1A 3LFSA 5AR5A 1ZARA 3E7OA 3BHVA 1Y6BA 4MVFA 4HVDA 1Q8UA 4FR4A 4NH1A 1XKKA 4QMOA 4WG5A 4DFLA 3GT8A 1OIRA 2UZOA 3KA0A 4UX9A 4FEXA 2BAJA 1UU7A 3TNHA 2QVSE 2IW8A 3G90X 3UZPA 3F66A 2JBOA 3GI3A 4USDA 5EDQA 1KOBA 3UJGA 5HLWA 2Y0AA 5EKNA 3FXXA 3HLLA 3AT2A 3EQDA 3CGOA 3MIAA 4X3JA 3WF9A 3OW4A 2XZSA 3DK3A 3Q9WA 4RIYA 4UB7A 2CPKE 4TYHB 5CI7A 2UZBA 4W8EA 4TWOA 5DT3A 4E5BA 2HWOA 2YM5A 4YJRA 5CTPA 4FL1A 5ITAA 4KIKA 1T45A 2F9GA 3QA8A 3QQGA 4UYNA 3VQHA 4W4YA 2QD9A 5LVMA 3LFCA 1CDKA 3RAWA 3KB7A 4BGQA 4CFFA 5A4EA 3ZZWA 2JKOA 4CNHA 3KXNA 3VUKA 2OH0E 3VBYA 4CQGA 2ONLC 3CEKA 3GC0A 4I3ZA 4DH3A 1I09A 5EYCA 4K8AA 2YDIA 4EBWA 5EYDA 2VTNA 4MXAA 3UVRA 3QZGA 5EQPA 3PDTA 4R3PA 4JLCA 4KRCA 4D1XA 4HVGA 1CSNA 3PRIA 2WMXA 4ANQA 3R63A 3QX2A 3EL8A 3ZM4A 2P0CA 5AV3A 3ZLWA 4QO9A 4PF4A 1OL7A 4DBXA 3THBA 5DR9A 2NO3A 2HW6A 1XH7A 3QTUA 4KKGA 3ZXZA 2HY81 4Y72A 2WMWA 3ACKA 4F6UA 4K1BA 4JX3A 2A0CX 2GNGA 3NYOA 3U87A 3VUMA 3ATSA 4J8MA 3GUBA 3LQ5A 3SDJA 4QYEA 5AP5A 4F9YA 3TKUA 5LQFA 3ZUUA 4NM3A 3U6JA 3CQWA 5HGIA 3ZSHA 4R7IA 2ETKA 3E8EA 3KXGA 1OZ1A 5JFXA 3TIZA 3R2BA 3Q4UA 1Y6AA 4EUTA 3DLSA 4Q2AA 4LGDA 1XO2B 3B8QA 3ORZA 4PMTA 5KX8A 2BRGA 2YM8A 3PXKA 4I92A 2YCFA 2CMWA 2O2UA 2WTJA 3I7CA 5I5ZA 4ONAA 4AA4A 4BDCA 4H36A 4OTHA 3UMXA 3FMEA 4MXCA 3KQ7A 4IE9A 4UBAA 3R8VA 3PPJA 5F95A 2LGCA 3P7AA 4XHKB 4I4EA 3ZM9A 3R9NA 2C1BA 2R3PA 2XCKA 3L8VA 2VTOA 4CZTA 2VWUA 3P86A 4JDHA 4QYYA 5KMLA 3DTCA 3LCOA 2HZNA 1MQBA 4FGBA 4RIYB 4RWIA 5AEPA 4YSJA 3DDPA 3QYZA 1OIUA 1JVPP 1WMKA 2XIXA 3D0EA 3DXNA 2PTKA 2JIUA 4G9CA 2BZIB 4MTAA 3ANRA 2X9FA 4QP1A 3EL7A 3H10A 1O9UA 3F5GA 3E7VA 5EQYA 4FV2A 1PF8A 4MBIA 4QMXA 4TYEA 3KF4A 2PZYA 4FBXA 3SKCA 4BF2A 4DEGA 3C4EA 3GB2A 1Z5MA 4EBVA 4MXZA 3R7YA 3FHIA 4G6LA 3BKBA 3ENHA 3MDYA 2W1FA 5FXSA 4LMUA 4M8TA 5TOZA 2WU7A 2HOGA 1MUOA 4A06A 5DYJA 2RFEA 2WMRA 2E9PA 2R0IA 3MFSA 4OTPA 3VUIA 3F5PA 4C3FA 3DKCA 4OT5A 3ZLXA 4C59A 2PPQA 3O50A 4CLIA 5GIOE 2YEXA 1GZKA 2GHMA 4JQ7A 2BRBA 1J91A 2P4IA 4DEIA 4E4NA 5IUHA 1SYKA 2C5OA 4GIHA 1GZ8A 1ZYLA 5AIRA 5AAEA 2GFCA 3ID6C 3HV6A 5GJDA 4R1YA 1Q4LA 4HW7A 4AGDA 2R3RA 5CALA 3RJCA 4NCTC 2F4JA 1UVRA 1GIJA 4NSTA 4ENYA 3DFCB 3L9MA 3LLTA 4HGSA 3QRIA 5AR4A 4EKLA 3CY2A 3RZFA 3TJDA 3P1AA 4IQ6A 4MK0A 4O7ZA 1K9AA 2X1NA 3I5ZA 5AADA 4IM0A 1ZMWA 2JLDA 3MA6A 5IA5A 2FYSA 4I5PA 4DYMA 3UIUA 4MCVA 1PXKA 4AWIA 3VW8A 4RMZA 3TNQB 4FEQA 3SGCA 4JDJA 3ZXTA 4KINA 4ASXA 2C6EA 5CSPA 3PE2A 4NEUA 3PVUA 2UZWE 3EN4A 2Y8OA 5C8NA 4G31A 2IVVA 4RJ6A 5D41A 2OH4A 4DFUA 5FXRA 5JMSA 3VO3A 1YVJA 2AC5A 3TUDA 4Y8DA 4YZBA 3W2QA 1JPAA 2QOLA 4CT1A 2WTKC 4DFBA 5J1VA 4AFJA 4EOJA 5HHWA 2C1AA 3PY0A 4O0SA 2EWAA 3BZ3A 3PTGA 1W8CA 3RHKA 1M2RA 1OB3A 1U54B 4YZNA 5A9UA 4O1PA 3A61A 3RK7A 1DS5A 4O0TA 4Y85A 4AW2A 2YLFA 3VS7A 4XCUA 2C6LA 4HCVA 1QPEA 2QODA 4PL4A 4WG4A 2QOFA 2Z8CA 4J97A 1ZY5A 4CV8A 5HBJA 1JNKA 2R3MA 1GIHA 3GC7A 2GNIA 2IZRA 4ASEA 3NGAA 2G2IA 2XK8A 4DFNA 1H1SA 2GNFA 5BPYA 1PY5A 5M44A 3NLBA 5HD4A 4M68A 5K5NA 5C01A 2PWLA 5A4LA 5IQIA 3KL8A 2OJ9A 3VRYA 3ZOSA 4GKHA 1NVQA 3MPMA 3QYWA 5FDPA 1B6CB 1WBTA 3BV3A 1UKIA 5E1SA 5HOAA 5CEQA 3NDMA 3GP0A 3ETAA 1XQZA 3TN8A 5CF4A 3NVMB 5CT7A 4ZY4A 2Z7SA 5J5SA 3CLYA 2QNJA 3QLGA 3UOKA 4F63A 3VWAA 3VIDA 4DGLC 1Q99A 4EOSA 2XMYA 4RVLA 4CFNA 5IU2A 2RG5A 3SA0A 4OTQA 4DLJA 4FKLA 5EKOA 4FIGA 2JFMA 4V04A 5JZJA 4FV8A 4PTGA 3F5XA 3QCSA 5L2IA 2HAKA 3AQVA 3PG3A 3TWJA 4FKOA 3E3BX 1QCFA 5CAOA 4FTKA 4EK5A 1Q62A 1Q3DA 4RJ3A 3FKOA 4N70A 4PMSA 3RAKA 4ANNA 5C4LA 3D5UA 3E63A 2J2IB 3F61A 3M1SA 2ITNA 2PK9A 5DFPA 3R83A 2OJFE 5DEWA 5KZIA 3L1SA 3DK6A 1XH6A 1PHKA 2F2UA 2H34A 3MH2A 3B8RA 4IWDA 3A7JA 5HVYA 4CFXA 3LMHA 1O6KA 4BGHA 3DBFA 4BFMA 4MD7E 3VUDA 5IQCA 4U43A 2QCSA 2VO6A 3OW3A 4LGGA 3ZO4A 1YKRA 4GJ2A 3UPXA 4D2WA 3A7IA 4G34A 3OMVA 2C3LA 3OCTA 2OU7A 3QXOA 3FLZA 4HGTA 5KHWA 5HIEA 1UA2A 4V0GA 4WUAA 1DM2A 4JX7A 4KB8A 5F20A 4AA5A 4LUDA 2NP8A 5IF1A 3U55A 3COMA 4YPDA 4IMYA 5C8KA 4L68A 2WMQA 3DAEA 3EQGA 2FA2A 1H00A 4FOBA 2G2FA 4MD9E 4NWMA 2ZB0A 3D94A 1W84A 1U46A 3FMHA 4TKSA 5M08A 1OKWA 4QNYA 5GZ9A 1JAMA 4BDBA 4F99A 1J1CA 1Q8YA 4BB4A
chains in the Genus database with same CATH superfamily
4OTRA 3R30A 2UVYA 4PDOA 4E4MA 3GOPA 4EH9A 3P5KA 2GS2A 4E73A 3KMUA 2F57A 3D2KA 5FBNC 2H6DA 3P9JA 3OBGA 4L52A 1LEWA 1TQMA 4LRKA 4OGRA 4MF1A 4CFMA 3PZEA 2HW7A 1BL7A 2BFXA 3QZFA 3O8UA 2VO3A 3W10A 1NY3A 3ORIA 5HICA 2PYWA 2GDOA 4LOPA 4HNIA 4BTKA 4IB3A 2ZDTA 2ERZE 3AD5A 3IOPA 4ZJIA 2QG7A 2WMVA 1ZMUA 2WB8A 4AGCA 2GPHA 2P3GX 1DAWA 4PNIA 2QO2A 3LW0A 5CX9A 3PIYA 4YTFA 4BWPA 2QO9A 2JKQA 2XJ2A 5BYZA 4F09A 4AU8A 4O6EA 3MIYA 1JLUE 4L43A 4FEWA 5L2SA 4BI0A 2PMOX 3QGWA 4UALA 5HNBA 1E1VA 2J4ZA 3N4UA 4AS0A 4NW5A 2F7ZE 1YQJA 4ZJJA 3RWPA 4U44A 4F0IA 3FI4A 1B39A 4CCBA 3O7LB 4DDIA 4AAAA 4GCJA 4BCOA 3Q2MA 3PIXA 4P90A 1AD5A 4GFOA 2PZIA 5AAGA 3QGYA 3L9PA 4IWPA 4NJDA 2R9SA 4LFIA 4LMNA 2X7OA 5BMSA 2FH9A 2R3JA 5LVPA 4BDHA 4FTNA 4YPSA 5GZ8A 5CSHA 5E8YA 4PTEA 3RAHA 2IF8A 2PVRA 3HNGA 1SVGA 1H0VA 3H4JA 4TXCA 3VBTA 3PPKA 4ZK5A 5LMAA 3KMMA 5I9ZA 3ROCA 5IQFA 3S2PA 3UP2A 3TNPC 4RIXB 1XH4A 2DUVA 1TKIA 1YRPA 3FXWA 3RPSA 4AOJA 2UV2A 3RALA 3A7GA 2HELA 2IVTA 3WZEA 3ZCLA 2QURA 2VNWA 2ZM4A 3R8PA 3QRUA 5IMXA 2BIYA 4FKTA 1PKGA 2C3JA 4FT9A 5HO6A 4O86A 3U54A 2W1GA 3UQGA 5J7HA 1Y8GA 4QQCA 4FSNA 3R9HA 4ITJA 1SM2A 2EXMA 4OAVB 3PG1A 3QRKA 2VX3A 3NUUA 1H0WA 3GQIA 4ALUA 1MRUA 5LMBA 4U40A 3RM6A 5EM5A 1ZYCA 4M15A 4U80A 2A4LA 1VYZA 1YHWA 3OXIA 3RMFA 2WIHA 4BY9E 4KIOA 5A6OA 3G9LX 3G6GA 4F4PA 3NUAA 1H25A 4M3QA 3FZTA 4DEAA 3R7VA 5ETAA 3UQFA 3AC3A 3HV7A 4QMMA 4EOPA 1G8JA 4FV4A 2G15A 4Z9LA 2J5FA 4FTJA 3UGCA 1Y57A 4QTAA 3ULIA 4YZMA 1ZOGA 2IG7A 4FTAA 3UOLA 4BDKA 3OT3A 3O8TA 5IQHA 4GYGA 5HCXA 4QYFA 3PSCA 4G2FA 3QTWA 3CJFA 4FTMA 3VS0A 4D4YA 5IH4A 4HZSA 4AE9A 3NMUF 3JY9A 3NWWA 4XG8A 3V5PA 3NW7A 3D2IA 4L6QA 2XAMA 4FEUA 4R78A 3VS2A 5HO7A 1WCCA 1O6YA 3IOKA 3NW6A 5E8WA 4LDTA 3V6RA 3AGMA 3VS4A 4O7SA 4CYJA 3QC4A 2HWPA 2Y7JA 4W8DA 3ZRKA 5IISA 3D7ZA 3K3IA 4F65A 3OTVA 5CEIA 3Q9ZA 1KE6A 3KEXA 5CU4A 3VN9A 4XV9A 3MI9A 2BDJA 3NYXA 2R3FA 3U8WA 3N4TA 1ZRZA 5I3OA 3LFEA 4DLIA 4YHFA 2WKMA 2CGXA 1KE9A 5EW3A 4ZY6A 5TF9A 5JEBA 5TT7A 2R3OA 4O0YA 4BCGA 5T6KA 3SOCA 4I24A 3OEFX 5LVNA 4J52A 3BQRA 4CQEA 4U79A 3PY3A 2BMCA 2X4ZA 3ZZEA 2O8YA 2XKFA 3AD4A 2J0LA 1Q8WA 4GMYA 3DQWA 4O38A 4QP8A 4TNDA 2BDFA 3TM0A 2Y6OA 5IQDA 5JQ8A 5M07A 2XRWA 3VC4A 3JVSA 4UMRA 4I5MA 5HX6A 3C7QA 4UXQA 2HXLA 4O2ZA 1YOMA 1PXIA 3MTLA 4BICA 3FLNC 3PA3A 4W4VA 2BIKB 4FIJA 4IH8A 2BKKA 4IW0A 4E6CA 2XF0A 3BLQA 3GFEA 4ZS4A 4CGAA 4MBJA 3C50A 1TZDA 2C6KA 3FMLA 3K54A 5EDPA 3OTUA 4DAWA 4DFYA 3BGZA 3KC3A 2WQEA 3OY1A 5CNOA 4B9DA 2JIIA 2WEIA 4U0IA 4D55A 3IPHA 4IVAA 3IDBA 2VWYA 4L45A 1T46A 1H8FA 2PHKA 4XBRA 3W2OA 3WILA 3FLYA 5IA3A 2PUNA 3MVMA 3O71A 2ETMA 4C38A 1YDRE 1H01A 4KIQA 4TWPA 5TE0A 4FNWA 4WG3A 3CGFA 2C0IA 4FZ6A 4YLLA 4BYIA 4ZJVA 2PVHA 3AGLA 1S9JA 3QRTA 5ANDA 3W1FA 2WTWA 3QQLA 2BDWA 1R0EA 2P33A 3E92A 1STCE 4S30A 3NNXA 2YIWA 2A2AA 2YDKA 3TXOA 5HG9A 3KMWA 3BBWA 3PVWA 3SVVA 3ALNA 4BWXA 1OI9A 4ACMA 4YMJA 3QHRA 4O0VA 3LMIA 3S95A 5L8LA 2WTDA 2C6OA 4BC6A 4E3CA 2O5KA 4ZEGA 2E2BA 3U4WA 3CD8A 3KGAA 2CJMA 2JDVA 3RBWA 4G1WA 4AG8A 1PMVA 4BCJA 4HVSA 3BU3A 2C0OA 3ORTA 4CLJA 3DLZA 2JFLA 2A27A 4A4XA 1OGUA 3KXXA 5ANEA 3E3PA 1U5RA 3EIDA 3O23A 3D14A 4O7TA 4X6RA 5B2KA 2OO8X 4IB1A 4F08A 4Z16A 4EHVA 1UWHA 3HV3A 3OOGA 3PY1A 3RK5A 3MSSA 3UC4A 3DNDA 3W55A 2ITYA 2R7BA 3R01A 3ZSIA 3TG1A 3R7GA 4IFGA 4ZS0A 5FP6A 4S2ZA 4J96A 4GUEA 5I9XA 5IUIA 3OZ6A 4KBCA 3R7EA 1RQQA 4IB0A 5FBOA 3WIKA 5BUJA 5I4NA 3KCFA 3UC3A 2CGUA 3BHYA 1W0XC 1EH4A 4U6RA 3O17A 4QEBA 2WMUA 3FDNA 2BZHB 4E6DA 3POZA 5DG5A 1F5QA 3EQPA 3WZJA 4V05A 4JBQA 4G3FA 2BILB 3CCNA 4M97A 5HIDA 1M7QA 4DCAA 2VTPA 4QMVA 3FMJA 3LPBA 2XP2A 4GRBA 3QUPA 4IZ5A 5AUZA 3RZBA 4EQMA 2FO0A 4MWIA 4S32A 3R7UA 4YBKA 5AM6A 3ZONA 1SVEA 3R0TA 5CVFA 3H9FA 5CS6A 2V7AA 3B2WA 4QMZA 4GJ3A 5IKWA 3GU7A 3LLAA 2A1AB 1J7LA 4ZAUA 3R1QA 5A3XA 2VTRA 4DGOA 3FQHA 2QLUA 3QKMA 4CFVA 3U6HA 3PE1A 5D7AA 1YI4A 4ACHA 2YM7A 5IA1A 3E5AA 4XV3A 4KKEA 2C0TA 1KUTA 4G6NA 3MFRA 3BCEA 4AOTA 4YO6A 5FRIA 3VBQA 4KA3A 4R3RA 3U51A 3HDNA 3I4BA 1BMKA 4PY1A 2C30A 3DT1A 2JKMA 3FBVA 4M84A 4X21A 1O6LA 5C03A 2PY3A 4RFMA 1PRYA 3GOKA 4MNEA 1E9HA 3WI6A 1HCKA 1UU8A 1YXSA 5TR6A 5JH6A 5C4KA 5H9BA 3AC2A 1QPDA 4HPTE 5J1WA 3AC4A 2WHBA 5L4QA 5D12A 3BEGA 1PYEA 1YHSA 2YIXA 2G9XA 3ANQA 4QP9A 4X3FA 4XRLA 1H4LA 4NK9A 5B2MA 1BKXA 5M53A 2PMNX 4EWQA 3DA6A 3DAKA 5E1EA 1FOTA 4HCUA 2YIYA 4BL1A 2HZ4A 4YTHA 3UNKA 2J0IA 3ODZX 4FV3A 5CZHA 4QMNA 3RCJA 3UZTA 3UDTA 3L8XA 2XNOA 4RIWA 3LFQA 2IN6A 4RX7A 4QMYA 3D9VA 3E62A 4WSYA 3IW8A 2FGIA 3UIBA 4J8NA 4RZVA 4IAIA 3P4KA 4HGEA 5GJFA 4BCFA 5KUPA 4DT8A 4FK6A 1GY3A 2C5YA 2QOOA 5EH0A 4C02A 3DXQA 5CVGA 4JS8A 3TZ7A 3F3WA 4M69A 4BCKA 3ITZA 2C6IA 2VX1A 4WNMA 4XV2A 3UYTA 3BRBA 3DXPA 4IC7A 1V0OA 4W4WA 4PNKA 3OF0A 3MVHA 3WYYA 3IDPA 3G33A 2F7XE 4WUNA 1P4FA 2DS1A 4U81A 2QQ7A 4I6QA 2VWXA 5T68A 5AUUA 1XHAA 2P2HA 4GKIA 2QOCA 4NTTA 3NYNA 3QCXA 1FMKA 1K3AA 3VS5A 2YN8A 4PX6A 5EM7A 2OFUA 5AP6A 4ANSA 3EFLA 5CY3A 3KRRA 2JDSA 3VULA 5HU3A 2VO7A 4F6SA 3NAYA 3FZSA 3VF8A 4BHNA 3PSDA 2ESMA 4AXDA 4OTGA 2Z2WA 3W33A 2H9VA 2WO6A 4O91A 5IH5A 2UW8A 4N0SA 3WZDA 3BGPA 3BIZA 4YLJA 1AQ1A 3UIXA 1MP8A 3N9XA 3NEWA 4TW9A 4UWBA 3H9OA 4WIHA 3FKLA 4CZUA 3CBLA 5AP7A 5BVDA 2PVMA 4XBUA 2V5QA 2OXXA 5GNKA 4UMQA 3ZTXA 4R5SA 1X8BA 4MNEB 4ORKA 4EQCA 2LAVA 4L00A 1OKVA 1DI9A 1XR1A 4MH7A 4XG2A 3TNWA 4IZ7A 3GU4A 4LOOA 3DQXA 3A2CA 3COHA 2HENA 3ZSGA 3NIEA 4R6VA 5LCKA 1PXNA 4DEHA 1UNLA 2XNEA 4X3FB 4YURA 2ZV8A 1JSTA 4X2KA 4RQVA 5EI6A 4UMTA 3TZ9A 3ZC6A 4CCUA 5HI2A 3GXLA 4PUZA 5HCYA 1GOLA 5JSMA 3DJ5A 4E7WA 4A9SA 4A4OA 5DE2A 2OK1A 3TV4A 5DI1A 5AR3A 4RIWB 4D1SA 3HRCA 3TIYA 1OMWA 2OIBA 3MESA 4XNEA 3LOKA 4AN9A 4YUQA 3VW6A 4QMWA 2XKCA 4RJ5A 3C4CA 4DT9A 4I1ZA 5TO8A 1QPCA 3BV2A 4M69B 5DRDA 4DTBA 3E64A 4U42A 5KMKA 1SNXA 3HMIA 2CSNA 5K4JA 4F7JA 2XANA 1XJDA 3BYUA 3H3CA 1OIYA 3I79A 4L44A 4FKGA 5IMEA 4FGRA 4BKJA 3LE6A 4O4CA 4AT3A 1VLRA 5IQBA 4CFWA 2J90A 1YWVA 2FSMX 4ZSAA 5H8EA 3UBDA 4JMQA 4IADA 2VTTA 5EM6A 4QTEA 2OXDA 4O83A 3CKXA 2QR8A 2ITTA 3I1AA 3FHRA 4DG0E 4O4BB 4RQKA 5F94A 5ANKA 1ATPE 2H8HA 1R0PA 4FV1A 2BRMA 4AGWA 4BKYA 3NIZA 4LV8A 2OIQA 2VWVA 3SW4A 4E20A 5M4IA 4E4XA 2B55A 3DBEA 4F6WA 3PLAE 1CTPE 2PUPA 4H05A 5D1JA 2XNMA 4ZMEA 4QMUA 3FQEA 3R1NA 2XK6A 3LCTA 5LCJA 4O0XA 4V01A 5HVKA 2B4SB 4FTUA 4AW1A 3IW5A 1B38A 4O96A 4K0YA 4ZY5A 2R3GA 1A06A 3Q5IA 2X2MA 2OI4X 4GS6A 4F7LA 4O7NA 4H58A 3FI2A 4DG2E 2X0QA 1ZXEA 3KK8A 4XUFA 2QONA 1WBNA 4KIKB 5E8VA 3D4QA 4HNFA 3UPZA 2QU5A 4X2GA 3V5QA 1OUYA 2WQMA 4EL9A 1ND4A 4C35A 4RFYA 2W5HA 4RLKA 3SV0A 4CFUA 3SOAA 3QALE 2X39A 5HESA 4EOQA 2W0JA 3FZRA 4TTHB 4XV1A 3F5UA 5BVEA 4S33A 5EHLA 2C3IB 1YWNA 3DZOA 4APCA 4B7TA 4EH7A 4YJQA 4MXOA 3UODA 4O82A 3ZLSA 4DEDA 1H26A 3I60A 3TV7A 4EZ3A 3FZOA 3AG9A 3FMNA 2B0QA 2DYLA 4O84A 2W17A 4EOIA 3ZFYA 1G8AA 3A7HA 4IIRA 1XBBA 3Q4CA 1JKTA 5CI6A 4BTJA 5DT0A 3EFJA 5EHOA 5FM3A 3W2CA 4GFMA 2C6DA 3FI3A 2QI8A 3QCYA 4ITHA 5AX3A 3MVLA 3LCSA 2W7XA 2BAQA 3Q6WA 3RPRA 3ZC5A 2GQRA 4I6LA 1W82A 2JITA 3CJGA 1YWRA 1GAGA 4PV0A 1RW8A 4KSQA 1BX6A 3UDBA 4XG4A 2ZM3A 3D5XA 4HYUA 4C33A 3OWKA 4DFZE 5J9YA 1BI8A 2OG8A 2RGPA 2ETRA 4WSQA 5HE1A 4OTDA 2RFDA 4C7TA 3R71A 2OZAA 4OAUC 3EQCA 3L9LA 4BCQA 2GNJA 4XRJA 4WHZA 4GV1A 4FSZA 3TV6A 3UP7A 1K2PA 3JUHA 4EH4A 5JT2A 1L3RE 3KXZA 5M55A 3R7OA 4IM2A 3S0OA 5CAQA 4K11A 2YM6A 4EH6A 5L2QA 4FKSA 4CZYB 3BLHA 3UIMA 4KUJA 4ALVA 4CMOA 3ZLYA 3I81A 3W2SA 4MAOA 1PW2A 4I0RA 4IM3A 3RP9A 4Y5QA 2R4BA 3U6IA 4IWQA 2W1IA 4M14A 5F9EA 1OL2A 2E9UA 4NKSA 5BX0A 4X6QC 2YJSA 4NJ3A 1M2QA 3G6HA 4FYOA 2QOQA 3FMKA 4I22A 2XNBA 4NUSA 3WBLA 4QDEA 3HYHA 3BYSA 4WNKA 1NXKA 4BHZA 1Q3WA 1G8KA 5EYMA 5GJGA 5KMOA 2R64A 3TUCA 1IAHA 2YCQA 4WOVA 1YI6A 2F2CB 3NUPA 4FIIA 3T9TA 3PJCA 5HX8A 2YAKA 2ZV2A 3QTSA 3EN6A 4ASDA 2RFNA 3TTJA 3A4OX 4C2VA 5A6NA 3OBJA 3NW5A 4U3YA 4D58A 1AGWA 3HGKA 3QF9A 4IXPA 2V7OA 3GU6A 3QKKA 4JDKA 5E92A 5JFVA 1J7UA 4BJJA 3LXKA 3BEAA 1R39A 5IEYA 4GT4A 2RSVA 5CEPA 5I9WA 1FPUA 3BHUA 3WF7A 3HRFA 4CKJA 3FL4A 3V8SA 2BAKA 1A9UA 1H1WA 4RRVA 1PXLA 1YXXA 2CKQA 5ANJA 2JIVA 2PUIA 1WAKA 3R8MA 2OZOA 2WAJA 3F88A 4GVJA 4MXYA 3AC1A 4NZWB 3UVPA 2XBAA 3T3UA 1W98A 4ACCA 4FKUA 1JBPE 1FVTA 1HCLA 2OJJA 5EHYA 4JR3A 3AC8A 5C1QB 3CQUA 2RIOA 3QXPA 2HIWA 4FTLA 3FL5A 2V22A 4BCHA 4WRSA 2YITA 4WRGA 1TQIA 4Q9ZA 3TCPA 2PVKA 3PIZA 2W1ZA 3BHHA 3EHAA 4RX5A 4RA4A 4OBQA 1OL1A 3UTOA 3DTWA 4K77A 4XLIA 5HEZA 2BALA 4Q5HA 4ZSEA 2UW6A 4PDYA 3ZS5A 4G9RA 3BX5A 4ACGA 4APPA 3CP9A 3T9IA 4I21A 2VAGA 1ST4A 3EYGA 4BBFA 5AAFA 1XBAA 3BI6A 4FSUA 4PWNA 4DTAA 4MD8E 4Q5EA 5EYKA 2BHHA 3C0GA 4FL3A 3K5VA 2GQGA 3CS9A 3E8NA 3OD6X 4L01A 4KS8A 3VS3A 5FEQA 3HUCA 3VS6A 4WO5A 3MY0A 1IAJA 2ITPA 1FBNA 5LXMA 4FIEA 1OM1A 3ZO2A 4FKIA 1SMHA 2WELA 4KAOA 4MF0A 4U3ZA 2JGZA 3CY3A 4L3JA 4W9WA 5AP2A 2ZYBA 4E8AA 2C4GA 2GFSA 2ITUA 1SVHA 4BDEA 3R9RA 5JRSA 4XG9A 1RJBA 4F7SA 3GCUA 1JKSA 2W9ZB 4QMLA 4DEEA 3EMGA 4HJOA 3LXNA 2GMXA 2YWPA 4RX8A 3NR9A 4BJJB 4UWYA 4N57A 5AUXA 3LFAA 5A4CA 2VV9A 3BE9A 1OGYA 4U9AA 3FI8A 1URWA 1YXVA 4DE4A 2J51A 4EUUA 2PZ5A 3PLSA 2BVAA 3HP5A 4FK3A 2OBJA 5I3RA 3BGQA 5HTBA 4AZWA 5IA4A 1Q8ZA 3F3VA 3ORKA 4JT3A 4BWKA 4FKRA 5ICPA 4FTCA 4M0YA 5K3YA 3S3IA 5A14A 4P2KA 2KULA 5HBHA 3QL8A 4HVHA 1VYWA 4F9CA 3QCQA 3W8LA 5C9CA 3UNZA 5CNNA 2VRXA 3IDCA 5CZIA 3PJ3A 3M11A 5AP0A 4BGGA 3V5JA 3N51A 2XM9A 3Q53A 3IW4A 2BUJA 3QQFA 2PE2A 2C6TA 3FPMA 4L46A 4B0GA 4D1ZA 5M4UA 2EUFB 3RCDA 2B9HA 4NCTA 2G01A 3EH9A 3KRLA 2W05A 3QFVA 4RVMA 3VF9A 4ZIMA 4AA0A 4J1RA 4AXFA 5K5XA 4FZDB 2X8EA 4QYGA 2W06A 3GCPA 5AM7A 4OT6A 3KN6A 3IK3A 2IW9A 4AZEA 1PXMA 3V3VA 4EK8A 2Y4IB 1M14A 3SRVA 3G0EA 5FLFA 5IZFA 4I5CA 2X8IA 4E93A 1GZNA 3BL9A 5BVOA 3TDWA 2UVZA 2ZMDA 1XMLA 3QD4A 4JBOA 4O7RA 4F9BA 1H1RA 3PJ8A 4BTMA 5CT0A 5DMZA 3KU2A 3QC9A 4HPUE 2XIKA 2HXQA 2XUUA 3E88A 2C47A 2IZUA 2BROA 3B2TA 3DGKA 4RJ4A 3HV5A 3K3JA 4UWCA 4DFXE 3MH3A 3Q4TA 4DHIB 4V0GB 3GCSA 2FSOX 4B99A 5EQEA 4H3QA 4L7FA 2C69A 2W1HA 1DAYA 4XLVA 1P4OA 2Z7LA 4PTCA 4D2RA 3FKNA 4UMUA 4FSMA 3AKJA 2WPAA 4FTRA 3MS9A 1H1QA 3KRWA 4UZHA 4D4RA 4ZTNA 3P79A 5FWKK 2X2KA 3A60A 2VTMA 5HU9A 2QHMA 4WBOA 2YZLA 4IVBA 2VZ6A 4MNFA 1G3NA 4L3LA 5CXHA 1YDSE 3SW7A 3AKLA 2OKRA 1XH5A 3BYVA 3II5A 5AV0A 2E9NA 3I5NA 3R22A 3AD6A 4QP4A 3BWFA 3GEQA 5HG7A 3FPQA 3VVHA 5M56A 3QTRA 4DITA 3FUPA 4M66A 2NRYA 2QHNA 3PSBA 4NFMA 3R9DA 3IGGA 4AE6A 3WZUA 3F3TA 4KBAA 5IG1A 4LQMA 5AP3A 3MY1A 4TT7A 5HNGA 3M42A 5HLNA 3P5JC 2XIZA 3LFBA 5CU2A 2W96B 1UU9A 3PVBA 3CR0A 2ZVAA 3FY0A 4GK4A 4JQ8A 4J7BA 3ODYX 3GC9A 3OEZA 4YLKA 3RPOA 1V0PA 2QKWB 3GU8A 4AW5A 3KK9A 2XK3A 3KXMA 4B8LA 3DDQA 4XH6A 3NNUA 3VQUA 4USEA 3ULZA 1NVSA 5M08A 2B9FA 3FQSA 4QQJA 4O7LA 3ORPA 2CGVA 4YJVA 3V5WA 3U9NA 3GFWA 3SRVB 4EK3A 2BR1A 5FDXA 4FT7A 2XH5A 3KF7A 2OLCA 3CXWA 4CKRA 5IQGA 3GU5A 4FI1A 4FMQA 3PXRA 2YIRA 3GGFA 3IO7A 5BYLA 4BR3A 3Q9XA 4C62A 2AYPA 3RNIA 4BN1A 3W0NA 5AV2A 1FGIA 3TKIA 1P5EA 4WD5A 4NU1A 4C3RA 4TWCA 3QD3A 4A4LA 2VGPA 3A62A 4HYIA 4BIBA 4YTCA 2R2PA 5ACBC 4X3FC 3C13A 2J0JA 3OCSA 5L6OA 2WMTA 4N6YA 2YISA 4KIPA 4BKZA 1ZY4A 5JZNA 4X2FA 2YWVA 4EOOA 2R7IA 4WKQA 4BBMA 4U45A 5L2TA 4QQ5A 4BRXA 1REKA 1WFCA 4W9XA 3WIGA 4CSVA 4EKKA 1YI3A 2E9VA 4OTFA 1FMOE 4DBNA 3V04A 4E6AA 3PA4A 4U5JA 4FYNA 4C4EA 3NCZA 3QWJA 4ZLZA 2XARA 2A19B 2VX0A 3VS1A 4BIEA 3R1YA 1XMMA 2O3PA 4BDJA 4ZXTA 4CEGA 2JEDA 4QYHA 1KV1A 5J95A 4FTIA 1UNHA 1TFFA 5GIPE 2RG6A 3KN5A 5DVRA 2J7TA 5CU3A 3CIKA 3NX8A 4D2SA 4RVKA 2UZUE 5CF5A 5EI2A 4EHEA 2UZEA 3HDMA 3JYAA 3R28A 2Z7RA 3IONA 3PJ1A 3FY2A 5CAUA 2JC6A 2VGOA 2FSLX 3HV4A 5IDNA 4NM0A 2PVNA 3OC1A 4LL0A 4CKIA 1JOWB 2VWZA 2UZLA 3KY2A 4EI4A 3JR1A 4AZFA 4X2JA 3PP1A 4GFGA 3E93A 4L9IA 2HYYA 3DJ7A 3DV3A 3F7ZA 3F9NA 5D7VA 4W4XA 4E5AX 1IG1A 2GS7A 1UWJA 2F49A 2IEWA 3GBZA 3DBCA 1KE7A 3ZU7A 4C34A 3HMNA 1KWPA 5L8JA 2WU6A 1J1BA 5E8ZA 3Q52A 4ENXA 2Y4PA 3NAXA 5K9IA 3EQHA 1ZOEA 3ERKA 3O7LD 3PXQA 2XNPA 2ZDUA 5JFWA 2GU8A 4MYGA 4F1TA 4FTOA 3VHKA 4RGJA 3ORXA 4RZWA 5A46A 3HKOA 4DC2A 2X6EA 3EB0A 4AT4A 5M51A 5M4CA 1OPLA 3QWKA 5DWRA 1FVRA 3BELA 1OL5A 4FJVA 5F4NA 4O7VA 2HCKA 4IX4A 3VUGA 1U4DA 2FSTX 2PE1A 2ZV9A 3C4FA 4EYMA 3I7BA 3D7TA 3R04A 3C9WA 3LFDA 5DN3A 4F0GA 4BIDA 3D15A 3Q96A 3R21A 3OROA 2R3KA 4RIXA 1IR3A 4RLLA 2YFXA 1WVXA 5G6VA 3ZO1A 2IZSA 2JD5A 4H3PA 4DTKA 3TL8A 3V51A 4O7WA 3P7CA 4UYAA 1GIIA 4D28A 3KXHA 3O2MA 4XJ0A 4PPBA 4QNAA 5DIAA 1LPUA 4ID7A 4EC8A 2ZJWA 4ZZMA 4FTTA 3W2RA 4D2VA 5BVNA 5BYYA 1VZOA 4U41A 4C4IA 3SG9A 4FT5A 4RJ8A 3EWHA 4L7SA 3ET7A 2VO0A 4UY9A 5LWNA 3OXZA 3A8XA 2W4OA 3HZTA 5AIKA 3C0IA 4DH8A 3R2YA 3QQKA 5IPJA 2PVLA 4OTWA 2XK4A 4MBLA 4AQCA 3EKKA 4YNOA 3G5DA 5E90A 3HMPA 1OPKA 1WBPA 5E4HA 3N4VA 3FSKA 4JAJA 3MJ1A 3D5VA 2B54A 4NM7A 3RHXA 4BCIA 5AA9A 4L42A 4YJTA 4HCTA 2JDRA 3JS2A 4EK4A 5BMMA 4RVTA 4U8ZA 4UXLA 4ANOA 1ZYSA 2QOBA 1W83A 2GHLA 2J0KA 3P08A 4TL0A 5DNRA 3NVKI 1PKDA 2IO6A 3OP5A 3OOMA 3V5TA 1OKYA 2AEGA 4DGMA 4AT5A 4L53A 5CEOA 4FNYA 3R7IA 4RJ7A 3GVUA 1QPJA 5D11A 4YJPA 2WTCA 3PXYA 3QA0A 4IVCA 4RIOA 5EOBA 3VJNA 1M17A 4CG8A 3R6XA 3CTJA 4RSSA 2WMAA 4WNOA 5EOLA 4EEVA 3F3ZA 4DHZA 2WOUA 2WQBA 2GCDA 3P0MA 5EM8A 2CKEA 5EI8A 5H3QA 5AUYA 2IW6A 3RAIA 3RK9A 3QUDA 3TTIA 4Q9SA 4EH3A 1G8SA 2Q83A 3F7WA 2JDOA 4RG0A 5HD7A 2UUEA 2W99B 5CXZA 2BHEA 4BYJA 1ZZ2A 1WBWA 3D7TB 3EJ1A 3A99A 2ZM1A 4QTCA 3QHWA 5CVHA 3CKWA 1S9IA 4IZAA 4KD1A 3Q60A 4LGHA 3MH0A 3ZDUA 3JY0A 3NS9A 4KNBA 2ERKA 4FUYA 3VONA 4HOKA 4CMTA 5HG5A 4F64A 5CF6A 3WE8A 2WMSA 4JG7A 4FKJA 4D2PA 4AXCA 2WQNA 3C5IA 2GS6A 5FEEA 1L8TA 4C8BA 5EW9A 3UOHA 2PE0A 2X7FA 3IQ7A 3D5WA 4D0XA 3PXFA 4QPSA 3DAJA 4Z55A 1FVVA 2V55A 4ZZNA 4DA5A 4E1ZA 2Q0NA 5B2LA 1JWHA 1TVOA 3NNVA 2VD5A 4ZOGA 3TKHA 2VTQA 3GCVA 4EORA 2H96A 5KHXA 4M13A 5HORA 4PL3A 5KE0A 4XP0A 3HRBA 3OT8A 4UEUA 3ZDIA 2OICA 3ZBFA 3NNWA 5LJJA 4XG7A 5HTIA 2ZB1A 2I1MA 5HNIX 3TT0A 2VWIA 4JJRA 5ETFA 4PQNA 5A4QA 3LFFA 2DQ7X 2OWBA 3O0GA 4IX6A 4KS7A 4OLIA 4QTBA 3S4QA 3UNJA 3AMYA 2J0MB 3BQCA 3WF5A 3NFGB 3PPZA 2XAOA 2I40A 4HGLA 5JKGA 2QR7A 4FUXA 1ST0A