3LXKA

Structural and thermodynamic characterization of the tyk2 and jak3 kinase domains in complex with cp-690550 and cmp-6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
284
structure length
279
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK3
publication title Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 279
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lxkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lxkA01
3H9OA 2WEIA 2QNJA 3SC1A 4CMTA 3TTJA 1X8BA 1ZARA 3KC3A 4W4WA 3MIYA 1SMHA 1UU3A 3LHJA 4O6EA 5J7HA 5AA9A 1OPLA 2ZJWA 4Y85A 2GFCA 1VYWA 5DRBA 1M52A 3NEWA 4XOYA 4PMMA 5CT7A 2W1DA 5ANEA 2JAMA 2QONA 3C13A 3IGOA 3AMAA 2XNOA 4ZLOA 2OFVA 2VN9A 5EQEA 2R3RA 4I20A 5DNRA 2O63A 4GIIA 4RLKA 4D2TA 3L8PA 3ZO1A 3OROA 4FT5A 4RQKA 4AACA 4QT1A 1H1QA 4ZXTA 4G5JA 4AGCA 4BDGA 4PMTA 4F6WA 4USFA 4KWPA 2J6MA 3NNVA 2OWBA 4EJNA 3IGGA 3PE2A 3ODYX 5DN3A 4HPUE 3E5AA 3UOKA 3FI2A 4O7TA 2BVAA 3DGKA 5JRSA 4FTTA 2VWVA 4FV8A 3VO3A 5CTPA 3QRIA 4QMLA 5K4JA 1WAKA 4CZUA 4YJRA 4HGLA 4WA9A 4RJ5A 2ZB0A 1JOWB 2VGPA 3C9WA 1MRUA 3ZEWA 3U87A 3CKWA 2LGCA 5IDNA 2CKQA 1Q61A 2CLQA 2WQOA 3D7TA 3MTLA 4FTNA 4I0SA 5E91A 1GZOA 4ACDA 4HVHA 1R78A 2C3KA 3LM5A 4ASEA 4ZTMA 4F1OA 1ZOGA 2FSMX 4BTMA 2BRGA 2JEDA 4ANOA 2A4LA 4G16A 4E6CA 2JBOA 3DTWA 4JX3A 1XH9A 3RVGA 2X39A 3I6WA 3O17A 3W8QA 1B38A 4EHGA 3G9LX 2JLDA 4IX3A 5HESA 3UO6A 4B99A 5IQFA 4IMYA 5EHOA 2OF2A 3II5A 5I9WA 2IJMA 3KRRA 1M2QA 2VU3A 2UZDA 3S3IA 3PY0A 2J9MA 3KMMA 5K0KA 4IC7A 3Q4UA 3FBVA 4QPMA 3BV2A 1PXKA 5J5SA 3R83A 3W16A 2YDKA 3TXOA 4BDEA 3QU0A 5EYDA 5HE2A 4HZSA 4YZDA 5CWZA 1I09A 2WTKB 1BI8A 4QYGA 4UZHA 4B4LA 2VTRA 3PE1A 2XH5A 5GHVA 3T3UA 3EKKA 1PMNA 1OKVA 4LQMA 4MBIA 4O7LA 4OW8A 2E9UA 2XK3A 4NM7A 3OT3A 4MNFA 4TYHB 3THBA 3CXWA 3R9HA 3BYOA 3C51A 4UX9A 3I7CA 2QHNA 4RMZA 2X7GA 5HO8A 3RZFA 4BZNA 4EOPA 1OL1A 3AC3A 5DE2A 5CX9A 5JZNA 3KRXA 3BYMA 3PJ8A 1J3HA 4UMQA 3FY0A 3OWLA 5FM2A 3C50A 3MIAA 3EYGA 3Q3BA 4GVJA 2QOBA 3ZLXA 5CAQA 4V04A 1UWJA 2B54A 2ESMA 3G15A 4I22A 2J0JA 4AZWA 4BDIA 1YWVA 2NO3A 3U6JA 3ORZA 1ZY4A 2VTSA 4HYHA 2GQSA 4H3QA 5TR6A 3PVBA 1OECA 5AA8A 3OUKA 4CRLA 5DR6A 2PE0A 5LOHA 5FXSA 2WFYA 3QHWA 4AW5A 4PX6A 4YNEA 5AWMA 4Y95A 1U5QA 4XX9A 3DK7A 2OBJA 3NSZA 3R1NA 3NLBA 4KB8A 1VYZA 4YPSA 2VUWA 4ZAUA 1REJA 2V7AA 3FZPA 3ZRLA 5JH6A 3PSBA 2YAAA 3D2KA 3EN6A 4RC2A 4EH4A 4YJVA 4C33A 4D4SA 3EQIA 4KIKA 3QUDA 4L8MA 2F2UA 2WIPA 4DEEA 3KCKA 4G9CA 4NIFA 4DLIA 4O7ZA 2XMYA 2QO2A 3FI3A 3I1AA 1P4FA 3ULIA 5J9LA 4O0UA 4AZFA 1Q8TA 4AA4A 5J7BA 5JGAA 2SRCA 2IPXA 5CLPA 5HTIA 4WRGA 1KSWA 1YI3A 3ZTXA 3UQFA 3QTXA 2VTTA 3IECA 5LMAA 3AC4A 4QP7A 3OP5A 2W4JA 3W33A 3RZBA 3VS6A 3TACA 2IZTA 2WKMA 3T9TA 5A4CA 3P08A 4KRDA 3V5TA 5I0BA 2BHEA 2W05A 3N51A 2R7BA 4RIOA 3QTSA 2X7FA 4CCBA 5JGBA 4FEXA 1ZOEA 1ZYLA 4I0RA 4XLVA 5CSWA 4AE9A 3LCKA 5KMOA 1PW2A 2YM4A 5AP7A 5KE0A 5KMIA 3R2YA 5C01A 3RI1A 2C6IA 2BRBA 4N4SA 3O2MA 4EH8A 4ZSAA 3TNWA 4YUQA 3P78A 5AEPA 3ZLSA 4DITA 1H1PA 3TV4A 4ZP5A 4DG3E 4CZYB 1WBVA 4BBFA 2C3LA 3KXHA 3OBGA 4XG7A 4R6VA 5ACBC 3JR1A 3TWJA 2WOTA 3VWAA 5IA4A 3FEGA 3VF9A 4O84A 3SG8A 3VW6A 3W2SA 4IM2A 4YC3A 1CSNA 3CPBA 5IA2A 1PKGA 4BCFA 4GKIA 4AFEA 4RGJA 3F3TA 3LAUA 3H4JA 4RX7A 3EQPA 4EUUA 2JKQA 2YABA 2Y4IC 3NCZA 1R3CA 5IMEA 1ZLTA 2C1BA 2WTCA 4JAIA 3O71A 5C4LA 2CJMA 1ZMUA 3UODA 3OEFX 3QX4A 4IH8A 4GK3A 4PMSA 3RNYA 3VF8A 4BCNA 5CEOA 4ZS4A 5C8MA 3TUCA 3GU7A 2R3LA 2PVFA 3U8WA 3CD8A 4M67A 4BWXA 3UZRA 2PZYA 4C57A 1BUHA 3K3IA 4LUDA 5D9HA 4O0YA 4G34A 4GU6A 5CAOA 4K6ZA 2G2FA 2WTJA 3CKXA 1PJKA 3Q32A 4NKAA 5E8TA 2ZDTA 1T45A 4Q2AA 4U6RA 4WNKA 3DS6A 5HE3A 1FVRA 5IDPA 5CVFA 3VJNA 5LCKA 4F9BA 5FTOA 4D1SA 3AQVA 4CFXA 5F95A 2ACXA 2VWWA 3A7HA 2IW9A 3UC4A 3ZFXA 3KMUA 5JMSA 2CN8A 4CT1A 3JVRA 4RG0A 4TYGA 5E1EA 2HW7A 4RX8A 4N57A 4O6LA 4EBWA 2OLCA 4TKSA 2WZJA 3QLFA 1XKKA 3HP5A 4G3GA 1CTPE 1GNGA 2OZOA 4AE6A 4EK6A 4EHEA 4FKJA 4UEUA 5FD2A 4WIHA 2PK9A 1G3NA 3GI3A 3PZHA 3QQHA 3SKCA 3UIXA 1WMKA 4II5A 3S1HA 4I5PA 2CNQA 1GIJA 5JZJA 4C59A 4AA5A 1Y57A 2WU6A 2WNTA 3FE3A 3KK8A 3SV0A 4DGGA 1H08A 3OW3A 2HZ4A 4YTCA 4DEHA 1PRYA 2RFEA 3UOJA 4WKQA 2OU7A 5T68A 4QQJA 2VAGA 5AV1A 4X3FA 4LMUA 3HMNA 2XNEA 4JIKA 4OTPA 4ZEGA 2PZIA 4BCKA 1WVYA 4BZOA 4FEUA 2ERKA 4WSYA 4GFGA 5DHJA 5IQGA 4IAIA 3BV3A 5DWRA 4BWKA 3OC1A 1IA9A 3QD3A 1YHWA 3A7IA 2IO6A 4EK4A 2C5OA 4O21A 2Z02A 2I6LA 3DKOA 4IANA 1OL5A 2X6DA 4BCPA 4C3PA 3MS9A 4BYIA 5HD4A 3LZBA 1U46A 5HE1A 2YHVA 2E9PA 4U97A 3C4CA 4WG4A 4HCTA 5IA1A 4OTGA 2BAKA 3B8QA 4ZOGA 4JS8A 4O38A 4V0GB 3V8SA 3WBLA 4EONA 4QPSA 5LVMA 5IMXA 3WIGA 2UV2A 4HGTA 3V01A 3P1AA 4IWDA 3V8TA 2Y8OA 3BPRA 4HW7A 3LFBA 3GEQA 4WNPA 4DINA 4JOAA 3LPBA 5ANKA 4HVDA 1G8SA 3F66A 1H4LA 4FV1A 4NEUA 3MVHA 3ALNA 4IAYA 1OITA 2PZ5A 2CNUA 4IJPA 3BU5A 4GT5A 1F3MC 2PSQA 1BL6A 4QQTA 3FY2A 4EH6A 4NH1A 4X2NA 4GEOA 1SZMA 1YOLA 4U3YA 4FIGA 2R0UA 5DRDA 5FBNC 1E9HA 4QMWA 4XG9A 4I4FA 2WO6A 3LCOA 2XYUA 3ELJA 3Q9ZA 4L9IA 4AN9A 4TY1A 4U8ZA 3DFCB 2VGOA 2H8HA 4WO5A 2YIYA 5L2WA 4RIYB 5I9VA 5DIAA 4AUAA 3FKNA 4E93A 5B0XA 3M1SA 3V5JA 3Q4TA 4BHNA 5M57A 5CU3A 2BRHA 5CALA 3B8RA 2VTPA 1B39A 4XNEA 3BBTB 3DK6A 4I6HA 5M08A 2XB7A 4QMZA 2O2UA 4U43A 2C5YA 2OJJA 4C3FA 1K9AA 2WTWA 5F9EA 3FZOA 3HLLA 3NWWA 4NW5A 4U9AA 1H1RA 2P33A 1Q8WA 3EN4A 3FC1X 4W8DA 5I3RA 3FWQA 3FQEA 4YZCA 3KREA 5LMKC 2A2AA 3P79A 4C36A 4FI1A 4XG2A 4I5CA 4J98A 5E90A 3BQRA 3Q60A 4MXZA 4I3ZA 5E1SA 3KVWA 4ZTRA 5E8YA 5ANGA 4AOIA 1ZWSA 3TEIA 2BR1A 4YU2A 2NNWB 4PTEA 2GS6A 3BHUA 1G5SA 5HHWA 2BILB 1WCCA 4FG9A 4RIWA 2QOLA 3TIYA 1GZ8A 4KBKA 4DGOA 2BPMA 3O8PA 5LCJA 3MB6A 1ZZ2A 5EYKA 5BMMA 1XR1A 2HY0A 3ATSA 3CIKA 5E4HA 3Q4CA 4FTRA 2HWPA 2QG5A 3JY0A 3EQDA 3R73A 4RWIA 2HZ0A 3SXRA 3UE4A 3CGFA 4XRJA 4CV9A 4E20A 3C1XA 3BLRA 2XIYA 3QCYA 3CD3A 2R0IA 1P5EA 3UOLA 5AV2A 3TDVA 5HCYA 4BDHA 4O7WA 4LOOA 5M06A 4U81A 5DLSA 5DOSA 5J87A 4JQEA 3A4OX 3E3BX 2C6LA 4YHJA 3GUBA 2XNBA 4XYFA 3D5UA 4BCHA 3P86A 2FVDA 4FSMA 4AAAA 1BKXA 1E1XA 3D7ZA 5HTCA 3QZGA 2C6MA 3A8XA 4IBMA 4XV1A 3MV5A 1Y6AA 2GNLA 2HY81 3RAIA 1K2PA 5AUVA 3MBLA 3NNXA 4BTJA 2OF4A 4GK4A 1FVTA 3ERKA 1ZY5A 3Q52A 5CF4A 4JDJA 2X4ZA 4CFVA 3KRWA 2X0GA 4FOCA 1YQJA 4UXLA 5AR3A 3F5XA 3FMJA 4RIXB 3TT0A 1WFCA 3I0QA 4FTOA 2C6DA 3UVQA 3R28A 2C68A 4UB7A 2FO0A 2XIXA 2PMOX 4JVGA 3NZ0A 2NRYA 5EYCA 4F1MA 2UW3A 2YIRA 3F7ZA 3GCSA 4G3DA 3U4WA 4TL0A 5A6NA 2PZPA 4G6OA 4AT5A 3AXWA 3LCDA 3NW5A 5BYLA 3ZC5A 2UZEA 4YHFA 4E6DA 3WI6A 3NUXA 3H0YA 3NCGA 1YI4A 3G5DA 4GUBA 4MNEB 2GMXA 2XCHA 5D7AA 3IDBA 3REPA 5CVGA 5EKNA 3OOMA 3UO5A 4D4VA 3OY1A 5AUWA 5IKWA 4D1XA 1PYXA 3O51A 2GNGA 4FG8A 1FMKA 3FHRA 3CQWA 1JNKA 3QTZA 4ZSLA 3FI4A 4TWCA 3VUKA 4NJ3A 4ZJJA 4ANLA 4F9AA 3ORNA 3CY3A 2VX3A 3I5ZA 4IB0A 4R1YA 3S4QA 3L8SA 3GC7A 5CU2A 3RJCA 3PDTA 2XS0A 2A0CX 3E88A 3QRJA 3RINA 5IU2A 4XV3A 3KKVA 4D0XA 4RWJA 5FDPA 1W98A 3QQFA 4M69B 1GOLA 2QQ7A 3O96A 3PYYA 4IDVA 3ZOSA 3DBDA 2CSNA 4UYNA 3ZLYA 5CT0A 2VTHA 3AMBA 4BDBA 2WQBA 4G9RA 3MVMA 4FKOA 5KKRB 2QODA 5IEXA 4ERKA 3EKNA 2GSFA 5DT3A 3R9DA 4JNWA 3KF7A 1EH4A 3IOPA 3F3WA 4J52A 3BRBA 1R0PA 3QHRA 4ACCA 3CTQA 1J7LA 2O5KA 2PE1A 3OFMA 4RZVA 4FTLA 4NK9A 5AAFA 1SM2A 1UV5A 3RPRA 4GJ3A 3BYUA 4ZZMA 5ANDA 5ETFA 4FSNA 3T3VA 3L1SA 3WIKA 4ZTNA 3RWQA 1S9IA 1U4DA 4AF3A 4FX3A 4XS2A 5JQ5A 4R3CA 4AN2A 2A1AB 3MI9A 3PVGA 4BCMA 4KKEA 3HL7A 2PVKA 4MK0A 3LMIA 3BGQA 4FSWA 2VWXA 5TO8A 4HCVA 3Q4ZA 2W1FA 2ZYBA 4CVAA 4QMMA 4DT8A 3EFLA 2YM8A 4GFMA 1JQHA 2GDOA 4A4XA 4GG7A 2UZWE 4F7LA 4NU1A 4C58A 1KE6A 2C30A 4AGWA 3HUCA 3RK7A 4ALWA 3QRKA 4XOZA 3VBYA 3W1FA 4AOJA 3QKMA 4FSRA 3L8XA 5ANJA 2C3JA 3LXNA 3QUEA 1P14A 3IW7A 3JS2A 4GG5A 4NWMA 5G1XA 3FDNA 1QPCA 4FUXA 2EVAA 4D9TA 4C38A 5AUTA 2B9FA 3CCNA 3FQHA 4EI4A 3HV3A 3VVHA 1H26A 2VO3A 4O91A 5T3QA 4RJ3A 1W0XC 3BHTA 3MVJA 2FSLX 2W4OA 2PZRA 4AW2A 4L44A 2YFXA 2QO9A 4YO4A 4Y5QA 2W9ZB 5FRIA 2B53A 2UVZA 3AT3A 5E8ZA 4D4RA 5JFWA 3F61A 4FKPA 4NJDA 2G2IA 4DT9A 2Q0BA 5GZAA 4TWPA 3GU6A 4YBKA 4BKJA 4CQGA 1RJBA 3DXNA 3WF6A 5CNOA 3UP7A 1UU9A 2XJ2A 3NNUA 2R9SA 3POOA 4AGDA 5KX8A 2H6DA 4DEGA 5HLWA 4L00A 3E64A 5CSHA 2HELA 2XEZA 4RJ6A 3U9CA 2X1NA 4X21A 2FGIA 2ITZA 3ENMA 1TQMA 3ZMMA 5J9YA 3NVMB 2NRUA 2W1CA 4BIBA 5AAEA 4WBOA 5KO1A 4IB1A 2JIUA 5LMKA 2VO0A 2E9OA 3EIDA 3DZOA 4MX9A 3S0OA 2DUVA 5HIBA 1KV2A 1ZRZA 3F3VA 3VBTA 2VX0A 3FZ1A 4BDAA 4EHZA 4J96A 4M97A 5E8VA 4EK8A 2F7ZE 2VO6A 2ZV8A 4WD5A 3A60A 4E5AX 5JEBA 1MUOA 2ZDUA 1Q99A 3A7JA 4HVIA 2BIYA 2J90A 3UNJA 4YR8A 4E26A 2ZMCA 3QFVA 5C4KA 3GC0A 1TVOA 4AP7A 1YKRA 2XEYA 2YM7A 3EN7A 1H1WA 3TJCA 3SRVB 4J8MA 4TTHB 4ZMEA 3PXRA 4BN1A 3R02A 5IUHA 4D28A 2GHMA 1IA8A 5IQEA 4FE2A 1SYKA 2QR7A 4G6NA 3HKOA 4J95A 5JT2A 3P4KA 1K3AA 1FQ1B 5BQ0A 4LRJA 3EWHA 3V5QA 5HOAA 4D2RA 3L9LA 4FVQA 3E62A 2X81A 3DOGA 4JG8A 5J5TA 3N4TA 3A61A 4GFOA 4OBQA 1Z9XA 1FGIA 2CGVA 2PWLA 4TYEA 3DPKA 3FPMA 5ETCA 2PMIA 2YERA 4QNYA 3UVRA 2VV9A 4QP6A 3UPXA 4FIEA 4BCOA 2J0KA 5M4FA 5EFQA 5FWKK 3VS3A 4BGGA 5I9YA 2HIWA 4QQ5A 4QMNA 5K5XA 3U54A 2QKWB 5AV0A 3TNHA 4LV8A 3HV4A 5JGDA 5IH6A 4Z7GA 2F7EE 3O8UA 3BYSA 3LJ2A 3LMGA 3NYXA 1KWPA 1PXJA 4TYJA 4R78A 4BCJA 4FL3A 5ETAA 4L52A 4EYJA 1GAGA 3P23A 3D14A 3G51A 5E9EA 4JLCA 5JKGA 5DT4A 5HZNA 2R3NA 3VS0A 2ZV9A 5CSVA 4WHZA 4JR3A 5BUEA 2YITA 3ORTA 4KINA 2IVTA 4ACGA 4PMPA 4O82A 2E9NA 4P4CA 2VNWA 4WSQA 3ZSGA 3DY7A 1OL6A 4N6YA 3QC4A 4PP9A 5CNNA 4JT3A 5AV3A 3UNKA 2BIKB 1W82A 2W4KA 4CQEA 3BE9A 5HNIX 3VNTA 1GZKA 3QYZA 3LXPA 4M68A 4FA2A 4F1TA 4GYGA 3KMWA 3QTRA 4YLJA 4UMRA 1L8TA 3TV7A 2I1MA 3UG2A 3LFEA 4FMQA 4DH5A 4H58A 4K0YA 5A6OA 4PNIA 4BDFA 3DKCA 4BTFA 3ZSHA 2HAKA 3O7LD 4BYJA 4I23A 4YNOA 4TWNA 4O7SA 2ITXA 1YOJA 4PTCA 4WUNA 2C6TA 4AX8A 5J8IA 5FUTA 3D0EA 4F9WA 4LOPA 4JBOA 3ZO2A 1CKJA 2OSCA 4DBXA 3OTVA 2WD1A 1O6YA 1NVSA 4ZIMA 3T9IA 1BYGA 3C5IA 4RX5A 2Y6OA 1ZYDA 5AAGA 2JITA 2ZM3A 2B4SB 1NY3A 2GQGA 2PVYA 3FZSA 3PY3A 4FT0A 1PMVA 3OZ6A 3PY1A 1LUFA 4D5KA 3W2RA 3I4BA 4ZSGA 5CQWA 5AX9A 3Q5ZA 5HX8A 4GRBA 2PUUA 2XNGA 3GU4A 4BHZA 2WMSA 3R7UA 2YEXA 3IDCA 3VBWA 2UW4A 2PVHA 5C26A 3VHEA 5M53A 4M15A 4EOOA 2JDVA 2Z2WA 1WVWA 4EOJA 3FMDA 3QD4A 4IVDA 3C0GA 4X3FC 2V62A 3R1QA 4HGSA 2VNYA 3W2OA 4ZTLA 4RFYA 3BYVA 2ZVAA 2DS1A 3G6HA 3EYHA 4R3RA 3FL5A 4ORKA 4FV5A 5HG9A 5AUXA 3F69A 4Z16A 5AR2A 3EH9A 1J91A 3ZM9A 5M56A 3QC9A 1Z5MA 3R7OA 3R7YA 4DG2E 5IQHA 4HYSA 4O7NA 1XWSA 2YDIA 3QQJA 2RGPA 3QGYA 3TI1A 4IE9A 2GS2A 1IEPA 2CN5A 5AR8A 2LAVA 4O0TA 4PPAA 2VTQA 3F88A 4FKUA 4L45A 4UN0C 3VBXA 1M17A 2I0VA 4X3JA 4K9YA 3I7BA 1QPDA 3NUSA 3EQHA 1PYEA 2C3IB 2H96A 3A8WA 2C5VA 2A19B 3EQBA 3BIZA 4JBQA 5FGKA 3UP2A 2OZAA 1ZZLA 2WMBA 3LFNA 2W99B 3LM0A 3NDMA 3PIYA 4IVAA 4QP4A 4V05A 2WXVA 3ANRA 4GH2A 3W10A 4IX6A 4XUFA 3QQKA 4RRVA 2R3OA 4AT4A 2XKFA 1JSTA 5TOZA 4F9CA 1YXTA 4ANMA 4YZNA 2VD5A 5KMMA 2BDWA 5ETIA 5K3YA 2OJ9A 3D7TB 3OY3A 5IA3A 4NL0A 1WBPA 4PWNA 4DC2A 3DLSA 1GZNA 5GIPE 2R3QA 3ULZA 4OAUC 1U54A 2UW6A 5D41A 4KSQA 2W17A 3QALE 3LXKA 4RVMA 1CMKE 4A06A 3VULA 3HEGA 5H8BA 3LW0A 3BWJA 3HMMA 3TNPC 5AM7A 4BVUA 3Q5IA 3NNWA 1IAJA 2XP2A 4HYUA 4JJRA 1DI8A 4K33A 4BDKA 4OTIA 4DH3A 5HNBA 3E3PA 3U51A 4BL1A 3DJ7A 3GP0A 4O0WA 1OUYA 4CFFA 2YZLA 3K5UA 1PXMA 3COKA 2RFSA 3OHTA 4KA3A 4XP2A 2YCRA 4CKJA 3QRUA 4OTHA 1AGWA 3RGFA 3RNIA 3PRFA 4MQ2A 5GJFA 1CKPA 4RVTA 3TM0A 1FVVA 2YLFA 3FSKA 4AS0A 4FT9A 2R2PA 1OKWA 2KTYA 4HJOA 5H9BA 4AG8A 3NMUF 3GFEA 3QTQA 4DEBA 1JKSA 4IAAA 4IADA 4JG7A 3RK5A 3ZFYA 4LGHA 4F09A 5CXZA 2FH9A 3E8CA 4O1OA 4ZZNA 2B52A 3HAMA 4FYNA 2GFSA 4F0IA 2JDTA 4BI0A 1R1WA 2HK5A 2CKOA 2Z7SA 4FUYA 4IIRA 3ZU7A 3LFFA 5CAPA 5KUPA 1MRYA 1OIQA 1DAWA 2UZVA 3QXPA 3ACKA 5FTGA 4DA5A 4MXOA 3HZTA 2R3PA 2XK8A 4QYFA 1OL2A 1UWHA 4NCTC 4XV2A 2PUPA 3FXXA 4FVRA 3ALOA 4LGGA 4EQCA 3RAKA 2NPQA 2W1ZA 2YISA 3CTJA 4EC8A 2XIRA 3C5UA 5F1ZA 3DV3A 3KXNA 2QOKA 3P5KA 3V5WA 3WE4A 3R8VA 4I4EA 4DHFA 4MXXA 1V1KA 3NIEA 4RC3A 1OIRA 1Q3WA 1E1VA 4FZFB 5F20A 4CLIA 3A99A 4QP9A 4QYEA 4FODA 5K4IA 4KIKB 3ZLWA 2PHKA 4I24A 2XBJA 4XP3A 4WT6A 4DYMA 3N9XA 2V55A 4NIFB 2VTJA 2EXMA 4LRMA 3RPSA 4JBPA 3C4WA 4U44A 1XBBA 2ZM1A 4WOVA 2AC3A 4QMOA 5B2KA 5DBXA 2YN8A 1FGKA 2C0IA 2P3GX 2R3IA 3QD0A 5AP6A 3GNIB 2X8IA 5FQDC 3SD0A 1XBAA 3O23A 4K18A 1PXLA 4HCUA 1P2AA 3RM7A 4UMTA 3EJ1A 4CXAA 1YOMA 3L8VA 2XK9A 2R64A 5EH0A 2WMAA 3HA6A 2DQ7X 3AGLA 4FKVA 3PUPA 3NW6A 3ID6C 3CJFA 4L43A 3RPYA 4EZ7A 2GNIA 3KB7A 4M3QA 5E8UA 5E8SA 3VUTA 1F0QA 2G2HA 4BI2A 1KE8A 3PSCA 1PXPA 3D5XA 4FEQA 5E8WA 4D2PA 3ORMA 3PVUA 4NM5A 4QMVA 3VS4A 3U55A 3FMMA 2G1TA 5BX0A 1Q8UA 4QMTA 3OWJA 4HYIA 1APME 3QUPA 5GZ8A 3E93A 4ZS0A 4C37A 3GCPA 1OUKA 3OF0A 4XBRA 2HWOA 2JFMA 4YJUA 4X2GA 4X0MA 3AD5A 3QCSA 2IWIA 4QYYA 3IONA 3DKGA 5LXMA 2CKEA 3QA8A 1XBCA 1LR4A 2XVDA 2ITOA 1U59A 4MQ1A 5HU9A 3SHEA 3HRCA 4QMQA 2IZSA 2VTIA 4L3PA 1W7HA 4IQ6A 5FDXA 3BX5A 3QTWA 2W1EA 5GJGA 4DN5A 5J9ZA 4ANSA 1QPJA 4ZLYA 4XBUA 3DA6A 4I5MA 3FMKA 4ZJIA 2JKOA 2JBPA 3D9VA 4M13A 4KIPA 3CR0A 4XEYA 5K9IA 5FXQA 1KE5A 4CCUA 4FIHA 5HE0A 3F6XA 4EORA 5BNJA 3NPCA 3LFQA 2BKZA 3IO7A 3R1YA 2X2MA 5EQPA 4H39A 5K0XA 2JKMA 2WMVA 4KD1A 5HLPA 5IUIA 4BTKA 2QOCA 4JL9A 3DAKA 4AZEA 2XK4A 3GQIA 2W96B 4CFUA 4UY9A 4CD0A 4E4MA 5CANA 4UZDA 4IZYA 4E5BA 4EQUA 4DGNA 4PF4A 4FBXA 4AXAA 4J71A 4R7BA 3E8EA 1OVEA 2ZM4A 2PVNA 2XIZA 2Z60A 3RBWA 3CEKA 3HA8A 3VS5A 4NUSA 4AU8A 3RP9A 2HW6A 3D15A 3AT4A 4C02A 4OTQA 5CY3A 1FMOE 4U79A 1ZMVA 2YCQA 5HEZA 3LLTA 1WBOA 2HENA 2Z7LA 4CG9A 2VX1A 2WMQA 1ND4A 2ZV2A 4GT4A 4PDSA 2EB2A 3C0IA 4FGBA 2BZKB 4FKWA 5IPJA 3G2FA 5LARA 5LVLA 5IISA 2C0TA 2VRXA 1BL7A 2VWIA 3TN8A 4BDDA 4R7HA 4C3RA 5I5ZA 3EMGA 5EW3A 4PL3A 4XV9A 3KFAA 4AFJA 4E4LA 3SA0A 1PMUA 3LFDA 5LVOA 4ZTSA 5IQIA 1V0OA 2BZJA 3QCQA 3OXTA 4W9WA 3VUMA 4DFUA 5EHLA 3ETAA 3KCFA 5KMNA 2QO7A 3D2IA 4QPAA 3RMFA 4C4EA 3WF7A 5LWMA 4X3FB 3P0MA 2XZSA 5EM5A 3UMWA 5AMNA 4F7SA 4JI9A 2J2IB 2UZBA 4DFZE 5FG8A 3NS9A 2IZRA 3QQUA 5DEWA 3U9NA 3MN3A 3I81A 4RJ8A 4R3PA 1MQBA 1Q4LA 2YIXA 3NYNA 3R2BA 3R7GA 4QRCA 3UJGA 3F5PA 3AD4A 4K77A 5AJQA 2YM3A 4E8AA 3KVXA 4BC6A 2EU9A 4ID7A 2X9EA 2PVJA 1JAMA 3L9PA 4FICA 1CDKA 1NVQA 5CAVA 3JYAA 4FSZA 1ZYSA 2XNNA 2PU8A 2HOGA 5IH5A 4NM3A 3BHYA 4MXAA 4WNOA 4AW0A 4ASZA 4L7FA 1MRVA 2HXLA 4Y73A 2C5NA 3UNZA 3PTGA 3IOKA 4MD9E 4OTRA 2XKDA 3D94A 2W5BA 2R3GA 4QMSA 3IQ7A 4FL2A 4R5SA 1Y8YA 5CEMA 5KMLA 1RW8A 3CSVA 2GTMA 2QURA 2ONLA 3E7OA 1YI6A 3G90X 5I3OA 3NGAA 2PY3A 4AN3A 5C03A 5M4UA 3OUNB 5ITAA 3FHIA 3QWJA 4FF8A 2C0OA 3OBJA 4ZY4A 4JG6A 4M66A 2QVSE 5CEIA 5JFVA 4FTJA 4ZTHA 4GSBA 1T46A 2CCHA 3AC5A 5EKOA 2CKPA 3TJDA 2QR8A 3AD6A 3LOKA 4IAFA 3ATTA 2WPAA 4TWOA 1YRPA 5EDQA 3W2CA 5EDRA 2WHBA 3PIZA 3QD2B 4FTMA 1NXKA 1ZYJA 3LE6A 3WE8A 5IEYA 4NFNA 4M8TA 4C4FA 2BTRA 3I0OA 3F7WA 2FUMA 2PVLA 5AM6A 3DAEA 5EW8A 3KY2A 2I7QA 3GC8A 4CNHA 2Y4PA 4TZRA 2QLUA 4EOSA 1SVHA 4PPCA 2ITVA 1FBNA 3R7IA 2VZ6A 3S00A 4NCTA 1TQIA 3QZFA 4QTCA 4FIFA 4IVBA 4AZSA 2X4FA 3KXZA 5L3AA 5L8LA 1VZOA 2RSVA 5FEDA 2GTNA 4XRLA 1M2RA 3V5PA 2RFNA 5HO6A 4EH5A 2HCKA 4RIWB 4F64A 4JRNA 4TPTA 1Y6BA 1IG1A 1OKZA 4AGUA 4CT2A 5EOBA 4G3EA 3KK9A 3PXKA 4LL0A 3HMPA 5CU6A 4DFXE 5FLFA 2O64A 2BDFA 4RLLA 3UIMA 2VTOA 2IVVA 2X8DA 3D5WA 4IEBA 2QOOA 2YCFA 3LFCA 3ZH8A 3ZZEA 3TL8A 5I9XA 1VR2A 2F57A 4AT3A 2A27A 5GJDA 4C4HA 1H25A 4MH7A 3KU2A 1OMWA 3MY1A 4B8MA 2ETKA 2YM6A 4H36A 2G15A 5BVDA 3SGCA 4QTBA 4BGQA 1OM1A 1YW2A 4LMNA 1BX6A 4O1PA 2P0CA 3DXQA 4FGRA 3FMLA 4CFWA 4H05A 3VS2A 4DCAA 4QTAA 4IW0A 2EUFB 2CPKE 5JQ8A 4D55A 5J79A 1UVRA 3OMVA 3FLQA 3F3UA 2QOQA 4O0RA 3I6UA 3EFKA 1A06A 3K54A 4FIJA 4O7YA 3S95A 4MXYA 5IA0A 4CYJA 4Q9ZA 1XQZA 2ITUA 1V0PA 2JIVA 3GB2A 3M2WA 2JFLA 5JFXA 4EH9A 4BKYA 1GIIA 2O8YA 3HMOA 3SX9A 4XG6A 3OXIA 4ZSEA 3ROCA 4G3CA 3R8UA 4S30A 4L67A 4ZY5A 2QCSA 4DE4A 4X2FA 4YZ9A 3OW4A 2IN6A 3BGPA 3RWPA 3TUDA 3VBVA 2Y4IB 4TYIA 5CAUA 5HD7A 2CLXA 3KEXA 4ACHA 5JK3A 4Y5HA 4KRCA 4CRSA 5L2QA 4FKLA 4DBNA 1YXXA 1OBDA 4DTKA 4CZTA 3KULA 3QTUA 3RTPA 4QP8A 3MA6A 3MVLA 2GPHA 4RJ4A 4OR5A 4U40A 3DBQA 1AD5A 3ZBFA 5AP1A 1ZYCA 1G8AA 5FM3A 3FSFA 4FKQA 1JBPE 3DLZA 4R8QA 4G6LA 4IX4A 3ET7A 4H1MA 2QOIA 4X2JA 3HP2A 2FA2A 2QOHA 2XF0A 4I0TA 5DR2A 5AX3A 4PUZA 2E9VA 4UXQA 5G6VA 2J50A 3QQLA 4QP2A 4EEVA 2AUHA 4IFCA 3ZXTA 3PPJA 4IAKA 2WTKC 3PP0A 4D2WA 4EBVA 2PUNA 4I5HA 5L8JA 5B2LA 3R21A 3VIDA 4X6RA 1OPJA 3TZ8A 3UYTA 4E4XA 4YTFA 2ZB1A 3ODZX 3QKKA 3RCJA 2PE2A 5LQFA 1J7UA 4YURA 3SDJA 5L8KA 4O27B 3FZTA 3V3VA 1WBWA 5HICA 5KCVA 2R3HA 4OBOA 2E2BA 4GL9A 4U7ZA 3VQUA 4FKSA 3BEGA 3FZRA 5IEVA 1IASA 3DXPA 4O81A 3HRBA 4BBEA 1F5QA 4A4LA 2B9IA 4X6QC 4B0GA 3AG9A 4FEVA 2IVSA 2IG7A 4NKSA 3MB7A 5AUUA 5A4QA 4APPA 2QLQA 4IVCA 5FEEA 4RC4A 3LCTA 2XJ0A 4NT4A 5KMJA 1QPEA 3DB8A 3HVCA 4E7WA 4DGMA 5HVYA 2X6EA 3BKBA 4F6UA 1LPUA 4HPTE 3MGYA 1CKIA 4MAOA 2G9XA 3E87A 3SW7A 4O22A 5HIDA 3PVWA 1XH5A 2RG5A 3IW5A 3SXSA 4G17A 3BBWA 3UGCA 4QTEA 3B2WA 3BQCA 4FNWA 2PMNX 4U80A 2HZNA 5I9ZA 3GFWA 4MVFA 2HYYA 4GCJA 5BVWA 2GNFA 5CF8A 4XG8A 5CYIA 4DH1A 3BCEA 3AMYA 4L3JA 4EOMA 3VUDA 3FAAA 3DNEA 4J7BA 4IB3A 5HVKA 2QU6A 3QF9A 4MD8E 4Y46A 2B9HA 2ITTA 2W1IA 3FUPA 1M14A 1ZXEA 4XP0A 4F9YA 2Y7JA 2V7OA 5IH4A 4A9RA 3W2QA 3OCTA 3FXZA 1ERKA 3F2AA 3ZDUA 4XH6A 3UTOA 2B55A 4P7EA 5JRQA 1A9UA 1AQ1A 3DDQA 5H8GA 3IG7A 2UVYA 2BDJA 2WGJA 4C0TA 2ZOQA 4JQ8A 4F65A 1I44A 4JRVA 4BRXA 3QZHA 3GVUA 2OXYA 2XIKA 2W06A 3RPVA 3ZYAA 4J99A 2PL0A 4S34A 3CPCA 3PJ2A 3PXYA 2OG8A 4IJ9A 2UZNA 2VTMA 4EKKA 5BVNA 3F3ZA 3JXWA 3NUYA 4IACA 2VTLA 4J97A 2PYWA 4YC6A 3LQ3A 4WBBB 4IZ7A 1DI9A 3MA3A 4BBMA 3H9RA 2YLEA 3CE3A 3W32A 2F2CB 2RG6A 1OPKA 5A54A 5E8XA 4TT7A 3VAPA 2CDZA 3F9NA 3VQHA 4BFMA 4LYNA 2CMWA 3WZKA 4I94A 3LLAA 4LG4A 4HGEA 4EC9A 1OZ1A 4APCA 4O83A 2I0EA 4TNBA 2GCDA 4IWOA 3MDYA 3R8ZA 2WU7A 3QTIA 5HBHA 3KRLA 4WNMA 5CXHA 4FEWA 4CGAA 3Q9YA 4UALA 3PJ1A 3TKIA 5DVRA 3OTUA 4F7JA 2F49A 4Z55A 3MH3A 3Q6WA 4YZBA 4RT7A 3ZS5A 4O7VA 2BTSA 4YP8A 4D9UA 3EZRA 5D11A 4JXFA 4EUTA 3L9NA 3L9MA 4J1RA 5D10A 4EOIA 4FT3A 3VS7A 2QHMA 2OJFE 3GT8A 4U41A 5EDPA 3M42A 4KSPA 5DR9A 4ZTQA 4LGDA 4TXCA 4D0WA 4TNDA 2B1PA 4R77A 5TF9A 3TTIA 3TNQB 1Q97A 2Y0AA 3H10A 1UNLA 4KIOA 3ZO3A 1WZYA 3Q6UA 3KN6A 4BDJA 1PMEA 2UW8A 2V22A 3OVVA 3PA5A 5CEQA 5AIRA 4U45A 4S31A 5FBOA 3KN5A 5M4IA 3PRIA 3R9OA 3R71A 4U3ZA 4BICA 3ACJA 3FMNA 2WMUA 3ORIA 4JBVA 5A14A 1JKTA 2NP8A 4EOKA 2W1GA 3EQFA 2H34A 2ZMDA 4N0SA 4DG0E 4BGHA 3I79A 4JX7A 4E6QA 2R3KA 3V04A 5CS6A 4YLKA 1RDQE 4U42A 4YPDA 3SAYA 3BZ3A 5EOLA 3RHXA 3KQ7A 4BDCA 4DH7A 2F4JA 2CGUA 3GENA 3HGKA 3ORPA 4KBCA 5AP3A 3TZ9A 4LRKA 4F7NA 5M4CA 4KBAA 4F63A 5HU3A 2J4ZA 4B9DA 2BFYA 3F2RA 3ANQA 1W8CA 2VWUA 3OCSA 5HORA 5KZIA 4KKGA 2P2IA 1CM8A 3IW4A 5A3XA 4CLJA 4RSSA 4NSTA 3COHA 4I92A 3DQXA 2W7XA 1YDSE 3RAHA 4AQCA 3HDNA 5I4NA 3QXOA 4R1VA 3NAXA 4PY1A 5TKDA 5DPVA 4JDHA 3LQ5A 4G3FA 5EHYA 1HOWA 4CSVA 2C47A 3CP9A 4GVAA 4PRJA 4FTIA 4CTCA 3QGWA 4RJ7A 3BWFA 4DEDA 1PKDA 1Q8YA 3DBFA 5A4LA 4U0IA 2EWAA 2XRUA 3H0ZA 3AOXA 4ONAA 3D4QA 2FSOX 3W2PA 4F99A 4ZK5A 4HVGA 3DBCA 4GYIA 1B6CB 3IK3A 4F6SA 3VN9A 4KKHA 4M0YA 3IS5A 1OIUA 3C7QA 4ZY6A 4I1ZA 5ICPA 3GBZA 4ZSJA 2C6EA 4PTGA 5KBRA 2UVXA 3OWPA 3GXLA 4XMOA 3RM6A 4A9SA 4IM0A 3VS1A 5KMKA 1XH8A 4IZAA 4ZMFA 1LEZA 3R04A 2VTNA 4GJ2A 4OTWA 1V0BA 3FXWA 5CSXA 5AP5A 4CMUA 4CTBA 2X2LA 3GOPA 4DLJA 5KNJA 4FNYA 5AUZA 1H01A 3EFWA 3ZFMA 2OIBA 4MWIA 5BUIA 5LJJA 4XG4A 4D4YA 4MCVA 3H3CA 3CQUA 4C62A 5ACKA 3C4ZA 4I93A 1YVJA 3FPQA 1SVEA 1XHAA 2UZOA 1H27A 3CS9A 4QO9A 4TYHA 4NZWB 1O9UA 3WZEA 1ZAOA 3CLYA 3N4UA 4LM5A 4OT6A 4DF3A 3ZZWA 4FL1A 3QBNA 4AA0A 3SQQA 4EH2A 4ACMA 4BY9E 2JGZA 4P90A 3AGMA 2C6KA 3QRTA 1UNHA 3ZUTA 4OUCA 5BYZA 3PZEA 4O7RA 2JKKA 2DYLA 2I0YA 2J5FA 3AC2A 2EB3A 5F4NA 5CSPA 2YIWA 3RK9A 3CQEA 4NFMA 4RWKA 4FSYA 1H8FA 3DAJA 3HECA 1HCLA 2ITNA 2RF9A 3COIA 3E8DA 3MWUA 4FG7A 4C4IA 2Q83A 4MWHA 4M7IA 4UYAA 4S33A 4J53A 3FKLA 1DS5A 2UZLA 3BU3A 2BUJA 4IX5A 5EM7A 3FLNC 1OIYA 3PXFA 3TKHA 5JN2A 3OT8A 2RFDA 3LKMA 5LWNA 3DJ5A 2C69A 2VWYA 5CQUA 4ITJA 5HI2A 2X9FA 2YJSA 3VJOA 1WVXA 3LCSA 2ONLC 2YCSA 4EK3A 3NYOA 2PVRA 4EH7A 1GY3A 4FC0A 3UQCA 3DB6A 2OZAB 4OAVB 3NUAA 1Q8ZA 4UBAA 1H24A 2FB8A 3PPKA 1IR3A 1YHVA 2RL5A 2JC6A 3P7CA 2WOUA 3ZCLA 4K11A 3BEAA 5A4TA 2R7IA 5BVEA 3FLYA 4RA4A 4K2RA 2YAKA 3NR9A 4YTIA 1GIHA 3DNDA 3FLWA 4CEGA 1KOAA 1PXNA 4YSJA 2XM9A 4W4YA 3G0EA 4C2VA 2XCKA 3EQCA 2OI4X 2P4IA 3MESA 1NVRA 3Q9WA 4JR7A 1UNGA 3MFTA 2WQNA 4HZRA 4QOXA 3ORKA 4XJ0A 5FP6A 3VHKA 1U54B 4FV3A 4P5ZA 3BLQA 3GGFA 5D1JA 4YJQA 1WBNA 4L01A 4L46A 3PPZA 1NT2A 4QMUA 4ALVA 3ZHPC 4H3PA 3ZEPA 4EZ5A 3EQGA 5GNKA 3QAME 3FYJX 3Q9XA 4IM3A 3RKBA 5M07A 2WB8A 3QQGA 4IWPA 3OD6X 4P5QA 4Q5HA 5IA5A 4E73A 1IRKA 3DFAA 4N70A 4C4JA 4GKHA 3ITZA 4I41A 5DT0A 4YJOA 3KA0A 5CENA 1A48A 1XO2B 3ZUVA 3BE2A 2KULA 3LQ8A 3MJ2A 4HOKA 4W4XA 1DM2A 4FV2A 3EN5A 4KUJA 4BWPA 4AZVA 2Z7QA 1ZMWA 2PVMA 2CGWA 3HV6A 3ZM4A 5E7RA 2C6OA 1L3RE 4Z9LA 4L53A 3PG3A 4GIHA 4BB4A 4D5HA 5A9UA 3KXGA 1XH4A 4OLIA 1Y8GA 4IZ5A 3WYXA 2BKKA 4GMYA 5GIOE 2OXXA 3RHKA 1TKIA 3ZC6A 4H3BA 2CGXA 3WF8A 4ANNA 4MBJA 3GCUA 2WAJA 1J7IA 3T8OA 1URWA 2ITPA 2QOFA 4M84A 4WRSA 3KXMA 2WMTA 3EZVA 3MTFA 4O0XA 4RVLA 2WMXA 4IFGA 2XA4A 3JY9A 5M44A 3NW7A 1OL7A 3GU5A 1H28A 2PUIA 3A7GA 4Q9SA 4QMXA 4UWBA 5CU4A 4BCQA 1LEWA 3QLGA 1NA7A 2G01A 4RPVA 3Q2JA 3TZMA 5DFPA 2OO8X 4GUEA 3VW8A 3V51A 3KF4A 4BI1A 4DCEA 5KKRC 3IW6A 5IQDA 1YDRE 2BCJA 3H9FA 4I6QA 2OIDA 3EL7A 3R0TA 5B2MA 2OH4A 3R63A 3PLSA 4ASDA 2YA9A 5M55A 3E7VA 5IUGA 3U6HA 3TDWA 4HNIA 2BFXA 4O96A 4EYMA 5CF5A 4EL9A 3JUHA 2YZAA 1U5RA 2PTKA 2YM5A 2O0UA 4YTHA 3N4VA 2PPQA 3ORXA 5FP5A 3UPZA 2GU8A 4G31A 3A2CA 4Z7HA 4YC8A 5KBQA 4MEDA 5HVJA 3GC9A 4JDKA 4DEAA 4DEIA 3GQLA 5CEKA 2XRWA 4S32A 3TCPA 1STCE 3PXZA 4GS6A 4MF1A 4CYIA 4E3CA 3SG9A 3PA4A 3G0FA 3POZA 3E63A 1PXIA 2UUEA 4MD7E 5AIKA 3NVKI 1QMZA 3R7VA 3HDMA 4GU9A 4MKCA 3MYGA 2XUUA 2C4GA 1FPUA 4CMOA 3E92A 4L3LA 3HMIA 4OBPA 3EQRA 3IDPA 3O7LB 3D83A 3ZO4A 5IQBA 3AC8A 4K1BA 1J1BA 4MF0A 3UVPA 4GV1A 4KABA 1URCA 4V0GA 3R8PA 5CF6A 5IF1A 3NUUA 4EJ7A 3DDPA 3LXLA 3V6SA 1LP4A 1JKLA 1KV1A 1M7QA 2UW5A 3MY0A 5ANOA 1Q5KA 5AUYA 2F7XE 1MQ4A 5CZIA 4YBJA 4ANQA 3PFQA 4I6FA 4PL4A 3Q04A 1NW1A 2WMWA 4MHAA 2CHLA 5GZ9A 5BPYA 4BKZA 2QG7A 4DFYA 4Y83A 2W0JA 3P7BA 3PSDA 4FKRA 5DMZA 3CTHA 5EM8A 2OGVA 5CI7A 2GHGA 5M09A 5D7VA 1XH7A 3R9NA 3I5NA 3NAYA 3PIXA 4CV8A 3SVVA 3WF9A 1OB3A 1M7NA 4RIYA 3MFRA 3WZDA 3MPTA 5BVFA 3PWYA 4IXPA 4WG3A 3W8LA 3DK3A 1RQQA 4RA5A 4IAZA 4ITHA 2GS7A 4R7IA 3UG1A 3LIJA 4P2KA 2Z7RA 4MTAA 4FSTA 4FTUA 4RWLA 5LVNA 2B0QA 4FV7A 1BMKA 4FTKA 2J51A 3K5VA 4C7TA 2XKEA 1O6KA 3UIBA 2GQRA 3NX8A 2CCIA 4EZ3A 3FI8A 3OXZA 2BRMA 1DAYA 2OICA 4QYHA 3IKAA 3EL8A 4FKIA 5L2TA 3UZPA 1H07A 1PHKA 4O86A 2WEVA 5C8KA 1SNXA 2R3JA 4O0SA 4TW9A 3R9RA 4EWHA 3DT1A 4FV6A 4FZAB 5AV4A 4FNZA 1PXOA 1O6LA 5BVKA 4BF2A 3A4PA 3FKOA 4FZ7A 3VRZA 2XK7A 4YJPA 3FLSA 3MH0A 5C9CA 5CEPA 2BAJA 1OGUA 3CC6A 3HRFA 2AC5A 2Y6MA 4C4GA 4FOBA 4RBLA 4DTBA 2OH0E 1R39A 3MFUA 4KS7A 5KZ0A 2FSTX 3QKLA 4H1JA 4KAOA 3QL8A 5EI6A 3S2PA 2XJ1A 4NW6A 4A9TA 4YLLA 5HG7A 1PF8A 4KS8A 3BLHA 4TRLA 4G1WA 1FOTA 4DFNA 2DWBA 5A4EA 5AP0A 2JDOA 2Q0NA 3LVPA 4FKGA 4DFLA 3HNGA 5LVPA 2W1HA 3E8NA 4DAWA 4XHKB 3ENHA 2J5EA 3FQSA 4E6AA 4EOLA 1UU8A 3LJ1A 3ROYA 5HCXA 3KRJA 4FVPA 4LL5A 5J95A 3LFSA 3LFAA 4FNXA 2PULA 3G33A 3PLAE 3OCGA 4HNFA 4JIAA 4USEA 5IQAA 3NUPA 5D12A 4X7QA 2BRNA 4Q5EA 4X2KA 4F0GA 2QU5A 4RIXA 1HCKA 5DGZA 5EQYA 4Y72A 4UMPA 2FYSA 2IZUA 1ATPE 4F08A 5K5NA 4NYEA 3M11A 4UV0A 5C27A 3SLSA 2ITQA 5CU0A 2Z8CA 3ORLA 4A9YA 3VUHA 3TNIA 3KGAA 3RAWA 3K3JA 4YJSA 1XH6A 2J0IA 4ARKA 5AR5A 2OXDA 3VC4A 5BMSA 2H9VA 5EK7A 3UYSA 4BZDA 2IW8A 4QP1A 3UOHA 2YIQA 4MNEA 2J7TA 3DQWA 5ANIA 4C8BA 4PDYA 3PWDA 2WIHA 5KHXA 1Z57A 3Q96A 2YWVA 4FZ6A 2W5HA 1YXUA 3R1SA 4ENYA 3DJ6A 3EFJA 2RIOA 3OS3A 4GT3A 4C35A 5HO7A 3CY2A 2UW7A 2YWPA 3COMA 3HV7A 4FTQA 4HVSA 3K2LA 5HCZA 4BCIA 5HIEA 2VWBA 5IG1A 4BIEA 3MFSA 5AR7A 5H3QA 4RZWA 2C5XA 3H30A 1M2PA 1FINA 2V5QA 2WQMA 2IVUA 2I0HA 3QYWA 1R0EA 4PPBA 4Y8DA 3ZUUA 5IQCA 3TIZA 4W4VA 4QD6A 2O65A 3KXXA 1GJOA 1J1CA 2BZHB 2XNMA 3MSSA 3WZUA 4M69A 5F94A 3ZDIA 3F5GA 2GHLA 2R5TA 5H8EA 1UKHA 1UA2A 4LUEA 4FZDB 4KNBA 5KHWA 4Z3VA 3SW4A 5HBJA 2WTVA 4CKIA 3MH1A 2B7AA 4PP7A 3GU8A 3LMHA 4IDTA 1JKKA 4PL5A 5DH3A 2HXQA 5EYMA 1WBSA 5DA3A 1KE9A 2PMLX 3MPAA 5L4QA 1OI9A 5BVOA 2QI8A 2BZIB 4OT5A 3VBQA 3R30A 4D2VA 3DKFA 2I40A 4RFMA 4EKLA 5FTQA 3ZXZA 4D1ZA 1OBGA 3BU6A 4QP3A 4NTSA 1SVGA 1Q3DA 3F82A 4FV9A 5HX6A 1QCFA 5LMBA 2HZIA 2WELA 2J0LA 2X8EA 2XKCA 2YACA 3VUIA 1REKA 2WTDA 3P7AA 5CZHA 5DG5A 4DGLC 3EOCA 2P55A 3PP1A 5IZFA 3DTCA 4GK2A 3A7FA 4D58A 5HKMA 2ETRA 3F2NA 4EK5A 1H00A 2XYNA 4M0ZA 2UW0A 3DCVA 1XJDA 4IC8A 5J1WA 4N6ZA 5AP4A 4FTCA 4J8NA 4LI5A 2BALA 3SXFA 4OTDA 3WYYA 3JVSA 3RPOA 3V8WA 4LFIA 3TUBA 3EN9A 4W9XA 4XCUA 2UZTA 3IW8A 4JQ7A 4C61A 1PY5A 2ITWA 3WARA 5JFSA 3BELA 3DBEA 4FK6A 4W8EA 3R00A 3FLZA 4FV4A 2ERZE 3MW1A 2BROA 2ETMA 2GNJA 5HBEA 4JAJA 3WF5A 2ZV7A 1S9JA 2VWZA 3R8LA 4A7CA 3F5UA 2QD9A 1WBTA 3JPVA 3OCBA 4WUAA 4GW8A 5AR4A 4EWQA 3P9JA 2WTIA 2OK1A 3PXQA 4PQNA 4QQCA 4PV0A 3NRMA 4LV5A 3UC3A 4AOTA 4AZTA 3R01A 4CFNA 3NIZA 4ALUA 3GOKA 3VRYA 1KUTA 3DZQA 5EI2A 4O0VA 3WZJA 3D5VA 3TG1A 2P2HA 2RKUA 4KIQA 3NYVA 4AWIA 4FSUA 4XLIA 4YJTA 1YHSA 2OJIA 3G9NA 4EHVA 4ENXA 5EW9A 2C1AA 3FL4A 2WQEA 4EOQA 3TZ7A 3FMEA 4MYGA 3KULB 4FKTA 4I21A 2JDRA 2OKRA 3VUGA 3ZBXA 4OTFA 4C2WA 5HG8A 4DH8A 1YWNA 2BHHA 3HYHA 1QL6A 1BI7A 2XNPA 4ITIA 2OFUA 4L7SA 5EG3A 3UO4A 4LOQA 3LJ0A 1JWHA 4QMYA 3U6IA 1JLUE 1MP8A 4CG8A 1W84A 2W9FB 3GCVA 5GINE 1Q24A 3V5LA 4E1ZA 4ZLZA 4YGAA 2EXEA 1IAHA 4L6QA 4UWYA 2JAVA 3O0GA 4DTAA 4M14A 5HGIA 3Q53A 3SOAA 3CGOA 4ASXA 4E5WA 3WOWA 5HLNA 3NUNA 3PJCA 3SRVA 4YZMA 2X7OA 4FR4A 4ZJVA 2VO7A 3UMXA 4F0FA 3IPHA 4IB5A 1VEBA 1P4OA 3FMHA 2XM8A 4O2PA 5CVHA 4FK3A 4YSMA 2V0DA 5BYYA 1Q41A 4MXCA 3UQGA 1UKIA 3EB0A 4RQVA 3U4UA 3C4EA 4QTDA 3A62A 2OW3A 4FYOA 4A9UA 2W5AA 4L42A 3ZONA 5HQ0A 4FIIA 5FXRA 3V6RA 1Y91A 4TN6A 2OIQA 3RCDA 2QC6A 2J0MB 2QKRA 4NM0A 4ERWA 3C4FA 2AYPA 3R22A 2JDSA 3PA3A 2GNHA 4PDPA 3CBLA 4RX9A 2IW6A 4L68A 4USDA 4I6BA 3R8MA 4IHPA 4AW1A 5C1QB 3C4XA 3R6XA 3ZRMA 4G2FA 4E4NA 4YO6A 2UZUE 4RFZA 4XG3A 1JVPP 2JD5A 3PJ3A 2B9JA 4CFMA 1RE8A 4PDOA 5T6KA 3UZTA 2YDJA 1H1SA 1OKYA 4B7TA 2R4BA 4DFBA 5A46A 4BR3A 3HV5A 4WG5A 2JIIA 3MPMA 3HUBA 4JDIA 3TKUA 1W83A 2X2KA 3B2TA 4V01A 4CKRA 2F9GA 3BHVA 4IWQA 3C0HA 2ITYA 5M51A 2R3MA 3ZRKA 5L6WL 3MH2A 1H0VA 4FV0A 3TV6A 3EHAA 1JSUA 3Q2MA 1YDTE 3FV8A 3KL8A 5E92A 1H0WA 5DEYA 5CASA 5C8NA 4R5YA 5H2UA 4F70A 5L2SA 1JSVA 3QA0A 5HNGA 4A4OA 3MY5A 4UWCA 3SOCA 3OWKA 5JSMA 3ZSIA 2UW9A 4F4PA 5TE0A 3FJQE 5L2IA 1UU7A 4EH3A 1VJYA 2XK6A 3RALA 1YXVA 4OGRA 4YJNA 5L6PA 4FT7A 3G6GA 4U5JA 4K8AA 4RVKA 3OOGA 4M12A 5AP2A 5CI6A 1Q62A 4MBLA 4ZZOA 5FEQA 2CNVA 4A07A 4PNKA 3OEZA 2O3PA 4S2ZA 3OG7A 3R7EA 5DI1A 5AADA 3HX4A 1JPAA 4YMJA 5DYJA 3GCQA 3QZIA 2R3FA 3DU8A 3PG1A 3QX2A 4NTTA 4O2ZA 1KE7A 2EXCX 3WILA 4QMPA 1TQPA 2REIA 4QNAA 2WMRA 3UIUA 5I9UA 2YJRA 5J1VA 2Y9QA 2XBAA 4B6LA 3CJGA 4ANBA 5BUJA 4FSQA 1YWRA 3QCXA 5EI8A 2BMCA 5TT7A 3W55A 5L6OA 3AC1A 3AT2A 3O8TA 3UDBA 3BHHA 3BI6A 3QWKA 4D2SA 4UMUA 1KOBA 3FC2A 3O50A 4C34A 3FYKX 5HG5A 4BCGA 2VTAA 3UBDA 2ZAZA 5AFVA 4G5PA 4BIDA 4FTAA 4EQMA 2BAQA 5HTBA 5B7VA 4YHTA 3HAVA 2OJGA 1SNUA 3W18A 3I60A 1ZOHA 1YXSA 3BGZA 4B8LA 1BLXA 5EM6A 3MJ1A
chains in the Genus database with same CATH superfamily
3H9OA 2WEIA 2QNJA 3SC1A 4CMTA 3TTJA 1X8BA 1ZARA 3KC3A 4W4WA 3MIYA 1SMHA 1UU3A 3LHJA 4O6EA 5J7HA 5AA9A 1OPLA 2ZJWA 4Y85A 2GFCA 1VYWA 5DRBA 1M52A 3NEWA 4XOYA 4PMMA 5CT7A 2W1DA 5ANEA 2JAMA 2QONA 3C13A 3IGOA 3AMAA 2XNOA 4ZLOA 2OFVA 2VN9A 5EQEA 2R3RA 4I20A 5DNRA 2O63A 4GIIA 4RLKA 4D2TA 3L8PA 3ZO1A 3OROA 4FT5A 4RQKA 4AACA 4QT1A 1H1QA 4ZXTA 4G5JA 4AGCA 4BDGA 4PMTA 4F6WA 4USFA 4KWPA 2J6MA 3NNVA 2OWBA 4EJNA 3IGGA 3PE2A 3ODYX 5DN3A 4HPUE 3E5AA 3UOKA 3FI2A 4O7TA 2BVAA 3DGKA 5JRSA 4FTTA 2VWVA 4FV8A 3VO3A 5CTPA 3QRIA 4QMLA 5K4JA 1WAKA 4CZUA 4YJRA 4HGLA 4WA9A 4RJ5A 2ZB0A 1JOWB 2VGPA 3C9WA 1MRUA 3ZEWA 3U87A 3CKWA 2LGCA 5IDNA 2CKQA 1Q61A 2CLQA 2WQOA 3D7TA 3MTLA 4FTNA 4I0SA 5E91A 1GZOA 4ACDA 4HVHA 1R78A 2C3KA 3LM5A 4ASEA 4ZTMA 4F1OA 1ZOGA 2FSMX 4BTMA 2BRGA 2JEDA 4ANOA 2A4LA 4G16A 4E6CA 2JBOA 3DTWA 4JX3A 1XH9A 3RVGA 2X39A 3I6WA 3O17A 3W8QA 1B38A 4EHGA 3G9LX 2JLDA 4IX3A 5HESA 3UO6A 4B99A 5IQFA 4IMYA 5EHOA 2OF2A 3II5A 5I9WA 2IJMA 3KRRA 1M2QA 2VU3A 3AKLA 2UZDA 3S3IA 3PY0A 2J9MA 3KMMA 5K0KA 4IC7A 3Q4UA 3FBVA 1W2FA 4QPMA 3BV2A 1PXKA 5J5SA 3R83A 3W16A 2YDKA 3TXOA 4AAYA 4BDEA 3QU0A 5EYDA 5HE2A 4HZSA 4YZDA 5CWZA 1I09A 1ST0A 2WTKB 1BI8A 4QYGA 4UZHA 4B4LA 3W0PA 2VTRA 3PE1A 2XH5A 5GHVA 3T3UA 3EKKA 1PMNA 1OKVA 4LQMA 4MBIA 4O7LA 4OW8A 2E9UA 2XK3A 4NM7A 3OT3A 4MNFA 4TYHB 3THBA 3CXWA 3R9HA 3BYOA 3C51A 4UX9A 3I7CA 2QHNA 4RMZA 2X7GA 5HO8A 3RZFA 4BZNA 4EOPA 1OL1A 3W0QA 3AC3A 5DE2A 5CX9A 5JZNA 3KRXA 3BYMA 3PJ8A 1J3HA 4UMQA 3FY0A 3OWLA 5FM2A 3C50A 3MIAA 3EYGA 3Q3BA 4GVJA 2QOBA 3ZLXA 5CAQA 4V04A 1UWJA 2B54A 2ESMA 3G15A 4I22A 2J0JA 4AZWA 4BDIA 1YWVA 2NO3A 3U6JA 3ORZA 1ZY4A 2VTSA 4HYHA 2GQSA 4H3QA 5TR6A 3PVBA 1OECA 5AA8A 3OUKA 4CRLA 5DR6A 2PE0A 5LOHA 5FXSA 2WFYA 3QHWA 4AW5A 4PX6A 4YNEA 5AWMA 4Y95A 1U5QA 4XX9A 3DK7A 2OBJA 3NSZA 3R1NA 3NLBA 4KB8A 1VYZA 4YPSA 2VUWA 4ZAUA 1REJA 2V7AA 3FZPA 3ZRLA 5JH6A 3PSBA 2YAAA 3D2KA 3EN6A 4RC2A 4EH4A 4YJVA 4C33A 4D4SA 3EQIA 4KIKA 3QUDA 4L8MA 2F2UA 2WIPA 4DEEA 3KCKA 4G9CA 4NIFA 4DLIA 4O7ZA 2XMYA 2QO2A 3FI3A 3I1AA 1P4FA 3ULIA 5J9LA 4O0UA 4AZFA 1Q8TA 4AA4A 5J7BA 5JGAA 2SRCA 2IPXA 5CLPA 5HTIA 4WRGA 1KSWA 1YI3A 3ZTXA 3UQFA 3QTXA 2VTTA 3IECA 5LMAA 3AC4A 4QP7A 3OP5A 2W4JA 3W33A 3RZBA 3VS6A 3TACA 2IZTA 2WKMA 3T9TA 5A4CA 3P08A 4KRDA 3V5TA 5I0BA 2BHEA 2W05A 3N51A 2R7BA 4RIOA 3QTSA 2X7FA 4CCBA 5JGBA 4FEXA 1ZOEA 1ZYLA 4I0RA 4XLVA 5CSWA 4AE9A 3LCKA 5KMOA 1PW2A 2YM4A 5AP7A 5KE0A 5KMIA 3R2YA 5C01A 3RI1A 2C6IA 2BRBA 4N4SA 3O2MA 4EH8A 4ZSAA 3TNWA 4YUQA 3P78A 5AEPA 3ZLSA 4DITA 1H1PA 3TV4A 4ZP5A 4DG3E 4CZYB 1WBVA 4BBFA 4LDTA 2C3LA 3KXHA 3OBGA 4XG7A 4R6VA 5ACBC 3JR1A 3TWJA 2WOTA 3VWAA 5IA4A 3FEGA 3VF9A 4O84A 3SG8A 3VW6A 3W2SA 4IM2A 4YC3A 1CSNA 3CPBA 3AKJA 5IA2A 1PKGA 4BCFA 4GKIA 4AFEA 4RGJA 3F3TA 3LAUA 3H4JA 4RX7A 3EQPA 4EUUA 2JKQA 2YABA 2Y4IC 3NCZA 1R3CA 5IMEA 1ZLTA 2C1BA 2WTCA 4JAIA 3O71A 5C4LA 2CJMA 1ZMUA 3UODA 3OEFX 3QX4A 4IH8A 4GK3A 4PMSA 3RNYA 3VF8A 4BCNA 5CEOA 4JMQA 4ZS4A 5C8MA 3TUCA 3GU7A 2R3LA 2PVFA 3U8WA 3CD8A 4M67A 4BWXA 3UZRA 2PZYA 4C57A 1BUHA 3K3IA 4LUDA 5D9HA 4O0YA 4G34A 4GU6A 5CAOA 4K6ZA 2G2FA 2WTJA 3CKXA 1PJKA 3Q32A 4NKAA 5E8TA 2ZDTA 1T45A 4Q2AA 4U6RA 4WNKA 3DS6A 5HE3A 1FVRA 2XAOA 5IDPA 5CVFA 3VJNA 5LCKA 4F9BA 5FTOA 4D1SA 3AQVA 4CFXA 5F95A 2ACXA 2VWWA 3A7HA 2IW9A 3UC4A 3ZFXA 3KMUA 5JMSA 2CN8A 4CT1A 3JVRA 4RG0A 4TYGA 5E1EA 2HW7A 4RX8A 4N57A 4O6LA 4EBWA 2OLCA 3P5JC 4TKSA 2WZJA 3QLFA 1XKKA 3HP5A 4G3GA 1CTPE 1GNGA 2OZOA 4AE6A 4EK6A 4EHEA 4FKJA 4UEUA 5FD2A 4WIHA 2PK9A 1G3NA 3GI3A 3PZHA 3QQHA 3SKCA 3UIXA 1WMKA 2XALA 4II5A 3S1HA 4I5PA 2CNQA 1GIJA 5JZJA 4C59A 4AA5A 1Y57A 2WU6A 2WNTA 3FE3A 3KK8A 3SV0A 1G8KA 4DGGA 1H08A 3OW3A 2HZ4A 4YTCA 4DEHA 1PRYA 2RFEA 3UOJA 4WKQA 2OU7A 5T68A 4QQJA 2VAGA 5AV1A 4X3FA 4LMUA 3HMNA 2XNEA 4JIKA 4OTPA 4ZEGA 2PZIA 4BCKA 1WVYA 4BZOA 4AXFA 4FEUA 2ERKA 4WSYA 4GFGA 4O4FA 5DHJA 5IQGA 4AXCA 4IAIA 3BV3A 5DWRA 4BWKA 3OC1A 1IA9A 1VLRA 3QD3A 1YHWA 3A7IA 2IO6A 4EK4A 2C5OA 4O21A 2Z02A 2I6LA 3DKOA 4IANA 1OL5A 2X6DA 4BCPA 4C3PA 3MS9A 4BYIA 5HD4A 3LZBA 1U46A 5HE1A 2YHVA 2E9PA 4U97A 3C4CA 4WG4A 4HCTA 5IA1A 4OTGA 2BAKA 3B8QA 4ZOGA 4JS8A 4O38A 4V0GB 3V8SA 3WBLA 4EONA 4QPSA 5LVMA 5IMXA 3WIGA 2UV2A 4HGTA 3V01A 3P1AA 4IWDA 3V8TA 2Y8OA 3BPRA 4HW7A 3LFBA 3GEQA 4WNPA 4DINA 4JOAA 3LPBA 5ANKA 4HVDA 1G8SA 3F66A 1H4LA 4FV1A 4NEUA 3MVHA 3ALNA 4IAYA 1OITA 2PZ5A 2CNUA 4IJPA 3BU5A 4GT5A 1F3MC 2PSQA 1BL6A 4QQTA 3FY2A 4EH6A 4NH1A 4X2NA 4GEOA 1SZMA 1YOLA 4U3YA 4FIGA 2R0UA 5DRDA 5FBNC 1E9HA 4QMWA 4XG9A 3ML1A 4I4FA 2WO6A 3LCOA 2XYUA 3ELJA 3Q9ZA 4L9IA 4AN9A 4TY1A 4U8ZA 3DFCB 2VGOA 2H8HA 4WO5A 2YIYA 5L2WA 4RIYB 5I9VA 5DIAA 4AUAA 3FKNA 4E93A 5B0XA 3M1SA 3V5JA 3Q4TA 4BHNA 5M57A 5CU3A 2BRHA 5CALA 3B8RA 2VTPA 1B39A 4XNEA 3BBTB 3DK6A 4I6HA 2NYAA 5M08A 2XB7A 4QMZA 2O2UA 4U43A 2C5YA 2OJJA 4C3FA 1K9AA 4O4BB 2WTWA 5F9EA 3FZOA 3HLLA 3NWWA 4NW5A 4U9AA 1H1RA 2P33A 1Q8WA 3EN4A 3FC1X 4W8DA 5I3RA 3FWQA 3FQEA 4YZCA 3KREA 5LMKC 2A2AA 3P79A 4C36A 4FI1A 4XG2A 4I5CA 4J98A 5E90A 3BQRA 3Q60A 4MXZA 4I3ZA 5E1SA 3KVWA 4ZTRA 5E8YA 5ANGA 4AOIA 1ZWSA 3TEIA 2BR1A 4YU2A 2NNWB 4PTEA 2GS6A 3BHUA 1G5SA 5HHWA 2BILB 1WCCA 4FG9A 4RIWA 2QOLA 3TIYA 1GZ8A 4KBKA 4DGOA 2BPMA 3O8PA 5LCJA 3MB6A 1ZZ2A 5EYKA 5BMMA 1XR1A 2HY0A 3ATSA 3CIKA 5E4HA 3Q4CA 4FTRA 2HWPA 2QG5A 3JY0A 3EQDA 3R73A 4RWIA 2HZ0A 3SXRA 3UE4A 3CGFA 4XRJA 4CV9A 4E20A 3C1XA 3BLRA 2XIYA 3QCYA 3CD3A 2R0IA 1P5EA 3UOLA 1W2DA 5AV2A 3TDVA 5HCYA 4BDHA 4O7WA 4LOOA 5M06A 4U81A 5DLSA 5DOSA 5J87A 4JQEA 3A4OX 3E3BX 2C6LA 4YHJA 3GUBA 2XNBA 4XYFA 3D5UA 4BCHA 3P86A 2FVDA 4FSMA 4AAAA 1BKXA 1E1XA 3D7ZA 4BJJB 5HTCA 3QZGA 2C6MA 3A8XA 4IBMA 4XV1A 3MV5A 1Y6AA 2GNLA 2HY81 3RAIA 1K2PA 5AUVA 3MBLA 3NNXA 4BTJA 2OF4A 4GK4A 1FVTA 3ERKA 1ZY5A 3Q52A 5CF4A 4JDJA 2X4ZA 4CFVA 3KRWA 2X0GA 4FOCA 1YQJA 4UXLA 5AR3A 3F5XA 3FMJA 4RIXB 3TT0A 1WFCA 3I0QA 4FTOA 2C6DA 3UVQA 3R28A 2C68A 4UB7A 2FO0A 2XIXA 2PMOX 4JVGA 3NZ0A 2NRYA 5EYCA 4F1MA 2UW3A 2YIRA 3F7ZA 3GCSA 4G3DA 3U4WA 4TL0A 5A6NA 2PZPA 4G6OA 4AT5A 3AXWA 3LCDA 3NW5A 5BYLA 3ZC5A 2UZEA 4YHFA 4E6DA 3WI6A 3NUXA 3H0YA 3NCGA 1YI4A 3G5DA 4GUBA 4MNEB 2GMXA 2XCHA 5D7AA 3IDBA 3REPA 5CVGA 5EKNA 3OOMA 3UO5A 4D4VA 3OY1A 5AUWA 5IKWA 4D1XA 1PYXA 3O51A 2GNGA 4FG8A 1FMKA 3FHRA 1JNKA 3CQWA 3QTZA 4ZSLA 3FI4A 4TWCA 3VUKA 4NJ3A 4ZJJA 4ANLA 4F9AA 3ORNA 3CY3A 2VX3A 3I5ZA 4IB0A 4R1YA 3S4QA 3L8SA 3GC7A 5CU2A 2X0PA 3RJCA 2ZFYA 1W2CA 2XS0A 3PDTA 2A0CX 3E88A 3QRJA 3RINA 5IU2A 4XV3A 3KKVA 4D0XA 4RWJA 5FDPA 1W98A 3QQFA 4M69B 1GOLA 2QQ7A 3O96A 3PYYA 4IDVA 3ZOSA 3DBDA 2CSNA 4UYNA 3ZLYA 5CT0A 2VTHA 3AMBA 4BDBA 2WQBA 4G9RA 3MVMA 4FKOA 5KKRB 2QODA 5IEXA 4ERKA 3EKNA 2GSFA 5DT3A 3R9DA 4JNWA 3KF7A 1EH4A 3IOPA 3F3WA 4J52A 3BRBA 1R0PA 3QHRA 4ACCA 3CTQA 1J7LA 2O5KA 2PE1A 3OFMA 4RZVA 4FTLA 4NK9A 5AAFA 1SM2A 1UV5A 3RPRA 1TFFA 4GJ3A 3BYUA 4ZZMA 5ANDA 5ETFA 4FSNA 3T3VA 3L1SA 3WIKA 4ZTNA 3RWQA 1S9IA 3AKKA 1U4DA 4AF3A 4FX3A 4XS2A 5JQ5A 4R3CA 4AN2A 2A1AB 3MI9A 3PVGA 4BCMA 4KKEA 3HL7A 2PVKA 4MK0A 3LMIA 3BGQA 4FSWA 2VWXA 5TO8A 4HCVA 3Q4ZA 2W1FA 2ZYBA 4CVAA 4QMMA 4DT8A 3EFLA 2YM8A 4GFMA 1JQHA 2GDOA 4A4XA 4GG7A 2UZWE 4F7LA 4NU1A 4C58A 1KE6A 2C30A 4AGWA 3HUCA 3RK7A 4ALWA 3QRKA 4XOZA 3VBYA 3W1FA 4AOJA 3QKMA 2X0QA 4FSRA 3L8XA 5ANJA 2C3JA 3LXNA 3QUEA 1P14A 3IW7A 3JS2A 4GG5A 4NWMA 5G1XA 3FDNA 1QPCA 4FUXA 2EVAA 4D9TA 4C38A 5AUTA 2B9FA 3CCNA 3FQHA 4EI4A 3HV3A 3VVHA 1H26A 2VO3A 4O91A 1TZDA 5T3QA 4RJ3A 1W0XC 3BHTA 3MVJA 2FSLX 2W4OA 2PZRA 4AW2A 4L44A 2YFXA 4F78A 2QO9A 4YO4A 4Y5QA 2W9ZB 5FRIA 2B53A 2UVZA 3AT3A 5E8ZA 4D4RA 5JFWA 3F61A 4FKPA 4NJDA 2G2IA 4DT9A 2Q0BA 5GZAA 4TWPA 3GU6A 4YBKA 4BKJA 4CQGA 2XAMA 1RJBA 3DXNA 3WF6A 5CNOA 3UP7A 1UU9A 2XJ2A 3NNUA 2R9SA 3POOA 4AGDA 5KX8A 2H6DA 4DEGA 5HLWA 4L00A 3E64A 5CSHA 2HELA 2XEZA 4RJ6A 3U9CA 2X1NA 4X21A 2FGIA 2ITZA 3ENMA 1TQMA 3ZMMA 5J9YA 3NVMB 2NRUA 2W1CA 4BIBA 5AAEA 4WBOA 5KO1A 4IB1A 2JIUA 5LMKA 2VO0A 2E9OA 3EIDA 3DZOA 4MX9A 3S0OA 2DUVA 5HIBA 1KV2A 1ZRZA 3F3VA 3VBTA 2VX0A 3FZ1A 4BDAA 4EHZA 4J96A 4M97A 5E8VA 4EK8A 2F7ZE 2VO6A 2ZV8A 4WD5A 3A60A 4E5AX 5JEBA 1MUOA 2ZDUA 1Q99A 3A7JA 4HVIA 2BIYA 2J90A 3UNJA 4YR8A 4E26A 2ZMCA 3QFVA 5C4KA 3GC0A 1TVOA 4AP7A 1YKRA 2XEYA 2YM7A 3EN7A 1H1WA 3TJCA 3SRVB 4J8MA 4TTHB 4ZMEA 3PXRA 4BN1A 3R02A 5IUHA 4D28A 2GHMA 1IA8A 5IQEA 4FE2A 1SYKA 2QR7A 4G6NA 3HKOA 4J95A 5JT2A 3P4KA 3BLAA 1K3AA 1FQ1B 5BQ0A 4LRJA 3EWHA 3V5QA 5HOAA 4D2RA 3L9LA 4FVQA 3E62A 2X81A 3DOGA 4JG8A 5J5TA 3N4TA 3A61A 4GFOA 4OBQA 1Z9XA 1FGIA 2CGVA 2PWLA 4TYEA 3DPKA 3FPMA 5ETCA 2PMIA 2YERA 4QNYA 3UVRA 2VV9A 4QP6A 3UPXA 4FIEA 4BCOA 2J0KA 5M4FA 5EFQA 5FWKK 3VS3A 4BGGA 5I9YA 2HIWA 4QQ5A 4QDVA 4QMNA 5K5XA 3U54A 2QKWB 5AV0A 3TNHA 4LV8A 3HV4A 5JGDA 5IH6A 4Z7GA 2F7EE 3O8UA 3BYSA 3LJ2A 3LMGA 3NYXA 1KWPA 1PXJA 4TYJA 4R78A 4BCJA 4FL3A 5ETAA 4L52A 4EYJA 1GAGA 3P23A 3D14A 3G51A 5E9EA 4JLCA 5JKGA 5DT4A 5HZNA 2R3NA 3VS0A 2ZV9A 5CSVA 4WHZA 4JR3A 5BUEA 2YITA 3ORTA 4KINA 2IVTA 4ACGA 4PMPA 4O82A 2E9NA 4P4CA 2VNWA 4WSQA 3ZSGA 3DY7A 1OL6A 4N6YA 3QC4A 4PP9A 5CNNA 4JT3A 5AV3A 3UNKA 2BIKB 1W82A 2W4KA 4CQEA 3BE9A 5HNIX 3VNTA 1GZKA 3QYZA 3VONA 3LXPA 4M68A 4FA2A 4F1TA 4GYGA 3KMWA 3QTRA 4YLJA 4UMRA 1L8TA 3TV7A 2I1MA 3UG2A 3LFEA 4FMQA 3W0OA 4DH5A 4H58A 4K0YA 5A6OA 4PNIA 4BDFA 3DKCA 4BTFA 3ZSHA 2HAKA 3O7LD 4BYJA 4I23A 4YNOA 4TWNA 4O7SA 2ITXA 1YOJA 4PTCA 4WUNA 2C6TA 4AX8A 5J8IA 5FUTA 3D0EA 4F9WA 4LOPA 4JBOA 1XMLA 3ZO2A 1CKJA 2OSCA 4DBXA 3OTVA 2WD1A 1O6YA 1NVSA 4ZIMA 3T9IA 1BYGA 3W0NA 3C5IA 4RX5A 2Y6OA 1ZYDA 5AAGA 2JITA 2ZM3A 2B4SB 1NY3A 2GQGA 2PVYA 3FZSA 3PY3A 4FT0A 1PMVA 3OZ6A 3PY1A 1LUFA 4D5KA 3W2RA 3I4BA 4ZSGA 5CQWA 5AX9A 3Q5ZA 5HX8A 4GRBA 2PUUA 2XNGA 3GU4A 4BHZA 2WMSA 3R7UA 2YEXA 3IDCA 3VBWA 2UW4A 2PVHA 5C26A 3VHEA 5M53A 4M15A 4EOOA 2JDVA 2Z2WA 1WVWA 4EOJA 3FMDA 3QD4A 4IVDA 3C0GA 4X3FC 2V62A 3R1QA 4HGSA 2VNYA 3W2OA 4ZTLA 4RFYA 3BYVA 2ZVAA 4DDIA 2DS1A 3G6HA 3EYHA 4R3RA 3FL5A 4ORKA 4FV5A 5HG9A 5AUXA 3F69A 4Z16A 5AR2A 3EH9A 1J91A 3ZM9A 5M56A 3QC9A 1Z5MA 3R7OA 3R7YA 4DG2E 5IQHA 4HYSA 4O7NA 1XWSA 2YDIA 3QQJA 2RGPA 3QGYA 3TI1A 4IE9A 2GS2A 1IEPA 2CN5A 5AR8A 2LAVA 4O0TA 4PPAA 2VTQA 3F88A 4FKUA 4L45A 4UN0C 3VBXA 1M17A 2I0VA 4X3JA 4K9YA 3I7BA 1QPDA 3NUSA 3EQHA 1PYEA 2C3IB 2H96A 3A8WA 2C5VA 2A19B 3EQBA 3BIZA 4JBQA 5FGKA 3UP2A 2OZAA 1ZZLA 2WMBA 3LFNA 2W99B 3LM0A 3NDMA 3PIYA 4IVAA 4QP4A 4V05A 2WXVA 3ANRA 4GH2A 3W10A 4IX6A 4XUFA 3QQKA 4RRVA 2R3OA 4AT4A 2XKFA 1JSTA 5TOZA 4F9CA 1YXTA 4ANMA 4YZNA 2VD5A 5KMMA 2BDWA 5ETIA 5K3YA 2OJ9A 3D7TB 3OY3A 5IA3A 4NL0A 1WBPA 4DHIB 4PWNA 4DC2A 3DLSA 1GZNA 5GIPE 1XMMA 2R3QA 3ULZA 4OAUC 1U54A 4DDGA 2UW6A 3W0RA 3BL9A 5D41A 4KSQA 2W17A 3QALE 1OGYA 3LXKA 4RVMA 1CMKE 4A06A 3VULA 3HEGA 5H8BA 3LW0A 3BWJA 3HMMA 3TNPC 5AM7A 4BVUA 3Q5IA 3NNWA 1IAJA 2XP2A 4HYUA 4JJRA 1DI8A 4K33A 4BDKA 4OTIA 4DH3A 5HNBA 3E3PA 3U51A 4BL1A 3DJ7A 3GP0A 4O0WA 1OUYA 4CFFA 2YZLA 3K5UA 1PXMA 3COKA 2RFSA 3OHTA 4KA3A 4XP2A 2YCRA 4CKJA 3QRUA 4OTHA 1AGWA 3RGFA 3RNIA 3PRFA 4MQ2A 5GJFA 1CKPA 4RVTA 3TM0A 1FVVA 2YLFA 3FSKA 4AS0A 4FT9A 2R2PA 1OKWA 2KTYA 4HJOA 5H9BA 4AG8A 3NMUF 3GFEA 3QTQA 4DEBA 1JKSA 4IAAA 4IADA 4JG7A 3RK5A 3ZFYA 4LGHA 4F09A 5CXZA 2FH9A 3E8CA 4O1OA 4ZZNA 2B52A 3HAMA 4FYNA 2GFSA 4F0IA 2JDTA 4BI0A 1R1WA 2HK5A 2CKOA 2Z7SA 4FUYA 4IIRA 3ZU7A 3LFFA 5CAPA 5KUPA 1MRYA 1OIQA 1DAWA 2UZVA 3QXPA 3ACKA 5FTGA 4DA5A 4MXOA 3HZTA 2R3PA 2XK8A 4QYFA 1OL2A 1UWHA 4NCTC 4XV2A 2PUPA 3FXXA 4FVRA 3ALOA 4LGGA 4EQCA 3RAKA 2NPQA 2W1ZA 2YISA 3CTJA 4EC8A 2XIRA 3C5UA 5F1ZA 3DV3A 3KXNA 2QOKA 3P5KA 3V5WA 3WE4A 3R8VA 4I4EA 4DHFA 4MXXA 1V1KA 3NIEA 4RC3A 1OIRA 4O4CA 1Q3WA 1E1VA 4FZFB 5F20A 4CLIA 3A99A 4QP9A 4QYEA 4FODA 5K4IA 4KIKB 3ZLWA 2PHKA 4I24A 2XBJA 4XP3A 4WT6A 4DYMA 3N9XA 2V55A 4NIFB 2VTJA 2EXMA 4LRMA 3RPSA 4JBPA 3C4WA 4U44A 1XBBA 2ZM1A 4WOVA 2AC3A 4QMOA 5B2KA 5DBXA 2YN8A 1FGKA 2C0IA 2P3GX 2R3IA 3QD0A 5AP6A 3GNIB 2X8IA 5FQDC 3TYKA 3SD0A 1XBAA 3O23A 4K18A 1PXLA 4HCUA 1P2AA 3RM7A 4UMTA 3EJ1A 4CXAA 1YOMA 3L8VA 2XK9A 2R64A 5EH0A 2WMAA 3HA6A 2DQ7X 3AGLA 4FKVA 3PUPA 3NW6A 3ID6C 3CJFA 4L43A 3RPYA 4EZ7A 2GNIA 3KB7A 4M3QA 5E8UA 5E8SA 3VUTA 1F0QA 2G2HA 4BI2A 1KE8A 3PSCA 1PXPA 3D5XA 4FEQA 5E8WA 4D2PA 3ORMA 3PVUA 4NM5A 4QMVA 3VS4A 3U55A 3FMMA 2G1TA 5BX0A 1Q8UA 4QMTA 3OWJA 4HYIA 1APME 3QUPA 5GZ8A 3E93A 4ZS0A 4C37A 3GCPA 1OUKA 3OF0A 4XBRA 2HWOA 2JFMA 4YJUA 4X2GA 4X0MA 3AD5A 3QCSA 2IWIA 4QYYA 3IONA 3DKGA 5LXMA 2CKEA 3QA8A 1XBCA 1LR4A 2XVDA 2ITOA 1U59A 4MQ1A 5HU9A 3SHEA 3HRCA 4QMQA 2IZSA 2VTIA 4L3PA 1W7HA 4IQ6A 5FDXA 3BX5A 3QTWA 2W1EA 5GJGA 4DN5A 5J9ZA 4ANSA 1QPJA 4ZLYA 4XBUA 3DA6A 4I5MA 3FMKA 4ZJIA 2JKOA 2JBPA 3D9VA 4M13A 4KIPA 3CR0A 4XEYA 5K9IA 5FXQA 1KE5A 4CCUA 4FIHA 5HE0A 3F6XA 4EORA 5BNJA 3NPCA 3LFQA 2BKZA 3IO7A 3R1YA 2X2MA 5EQPA 4H39A 5K0XA 2JKMA 2WMVA 4KD1A 5HLPA 5IUIA 4BTKA 2QOCA 4JL9A 3DAKA 4AZEA 2XK4A 3GQIA 2W96B 4CFUA 4UY9A 4CD0A 4E4MA 5CANA 4UZDA 4IZYA 4E5BA 4EQUA 4DGNA 4PF4A 4FBXA 4AXAA 4J71A 4R7BA 3E8EA 1OVEA 2ZM4A 2PVNA 2XIZA 2Z60A 3RBWA 3CEKA 3HA8A 3TMOA 3VS5A 4NUSA 4AU8A 3RP9A 2HW6A 3D15A 3AT4A 4C02A 4OTQA 5CY3A 1FMOE 4U79A 1ZMVA 2YCQA 5HEZA 3LLTA 1WBOA 2HENA 2Z7LA 4CG9A 2VX1A 2WMQA 1ND4A 2ZV2A 4GT4A 4PDSA 2EB2A 3C0IA 4FGBA 2BZKB 4FKWA 5IPJA 3G2FA 5LARA 5LVLA 5IISA 2C0TA 2VRXA 1BL7A 2VWIA 3TN8A 4BDDA 4R7HA 4C3RA 5I5ZA 3EMGA 5EW3A 4PL3A 4XV9A 3KFAA 4AFJA 4E4LA 3SA0A 1PMUA 3LFDA 5LVOA 4ZTSA 5IQIA 1V0OA 2BZJA 3QCQA 3OXTA 4W9WA 3VUMA 4DFUA 5EHLA 3ETAA 3KCFA 5KMNA 2QO7A 3D2IA 4QPAA 2X0OA 3RMFA 4C4EA 3WF7A 5LWMA 4X3FB 3P0MA 2XZSA 5EM5A 3UMWA 5AMNA 4F7SA 4JI9A 2J2IB 2UZBA 4DFZE 5FG8A 3NS9A 2IZRA 3QQUA 5DEWA 3U9NA 3MN3A 3I81A 4RJ8A 4R3PA 1MQBA 1Q4LA 2YIXA 3NYNA 3R2BA 3R7GA 4QRCA 3UJGA 3F5PA 3AD4A 4FJVA 4K77A 5AJQA 2YM3A 4E8AA 3KVXA 4BC6A 2EU9A 4ID7A 2X9EA 2PVJA 1JAMA 3L9PA 4FICA 1CDKA 1NVQA 5CAVA 3JYAA 4FSZA 1ZYSA 2XNNA 2PU8A 2HOGA 5IH5A 4NM3A 3BHYA 4MXAA 4WNOA 4AW0A 4ASZA 4L7FA 1MRVA