3LXKA

Structural and thermodynamic characterization of the tyk2 and jak3 kinase domains in complex with cp-690550 and cmp-6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
284
structure length
279
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 279
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lxkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lxkA01
4FKUA 4I0TA 3ZMMA 3VUTA 4F09A 1FGIA 2WQOA 4PL5A 4RWKA 4F9AA 3FXXA 2WU6A 3V3VA 4GSBA 2UW3A 4YC6A 4ZZOA 3C4EA 3SDJA 1OUYA 4CFVA 3FKLA 2FH9A 1Q8YA 5CNOA 5CT7A 4IFCA 4BBEA 1OL2A 3UQGA 2QVSE 5IQBA 2ITQA 3SD0A 5HIBA 2I0HA 2BPMA 4DEDA 3DCVA 3RK9A 5BUIA 1YXTA 3LPBA 4NW6A 3V5JA 4O0UA 4ZK5A 2CGUA 3C51A 4I5PA 3AQVA 2X8IA 2XVDA 3QD4A 3QKMA 3F5UA 2KTYA 5CTPA 2W1EA 4BCPA 3PZEA 4BICA 4CTCA 4DH7A 4DFXE 3LMHA 5AAFA 4XP2A 4RVMA 3A8XA 3AMAA 3RPVA 4AXAA 1YRPA 4RPVA 4ALWA 4D55A 4GCJA 5KX8A 4J1RA 3IS5A 3JY9A 4YSJA 1ZMUA 2IVVA 1UU3A 1UV5A 2ZJWA 3E3BX 5J9YA 2GQGA 3E93A 3OBGA 3L8SA 4XG7A 5D7VA 3UQCA 4K2RA 4E6QA 4FSYA 4V01A 4F0GA 2JBOA 3VS4A 4EH5A 3M1SA 4YJVA 5AEPA 5CALA 2E9UA 3RAWA 3FZSA 4IZ5A 2CGVA 3AMBA 1RJBA 4G17A 4W8DA 3BZ3A 3W2RA 3ZFYA 3RAKA 5HG9A 3Q9WA 2JGZA 3BEGA 4GJ3A 5EG3A 4HCTA 4WRGA 1BI7A 4DFNA 2PL0A 3UZTA 5BVKA 1WBVA 2PMNX 3HV4A 5IUHA 4R3CA 4BBFA 3DKOA 4MVFA 4I21A 4EOOA 3D7TA 4NSTA 4F6WA 3WF5A 4Y5HA 4L45A 2UW6A 4YNEA 2R3JA 2R3OA 4HGSA 1F3MC 2PVNA 3BCEA 3R83A 3V5WA 4JDJA 3ZM4A 3ZUVA 2OWBA 4BTJA 3W8LA 5I9ZA 4BIBA 4B4LA 3NDMA 2OXXA 4IJ9A 4WRSA 3TZ8A 2GNIA 2GNGA 2XA4A 2FB8A 1XKKA 2W06A 3DU8A 4OLIA 3SAYA 4QYEA 3UQFA 2WTIA 4HCUA 4BDHA 3V8SA 4F99A 1XJDA 2UZDA 2WTDA 3TCPA 5FRIA 3SKCA 3QL8A 4ZMEA 2ZM3A 4U8ZA 3MY5A 4G1WA 3N4UA 2XBJA 1V0PA 4NUSA 3VO3A 4EOQA 3MVLA 2XIXA 5DT3A 4YZCA 3FLYA 4PDSA 3LHJA 3O2MA 2XB7A 4IC7A 4X2JA 4ZSGA 5FWKK 5J9ZA 2Y0AA 4QD6A 4RJ8A 5CF4A 5A6OA 4GVJA 3RZBA 1YXUA 4QTCA 4BDIA 4ZXTA 1OKVA 3FLZA 4C7TA 4F1MA 4PF4A 5L2QA 4U0IA 3F3UA 5I9YA 3RHKA 4I5CA 4KAOA 5M53A 4C8BA 2EXCX 3WBLA 1BL7A 1T46A 3OXTA 3UVQA 4AZWA 1ZYJA 4RQVA 5HO6A 5ACKA 3D15A 4AGDA 2PVFA 5HE1A 5D7AA 2OH0E 1W82A 2AC3A 5IF1A 1PYXA 4CSVA 3H0YA 3P86A 1TQIA 3IDPA 1Q8WA 5EH0A 2EU9A 4XG9A 3V5PA 2QR7A 2H8HA 3G51A 2XBAA 3RK7A 4HVIA 2WPAA 4HOKA 5I9XA 4UWCA 2YM8A 1SZMA 1Y91A 2XEYA 1WMKA 2BAKA 3FC2A 3TJDA 3SW7A 3EQBA 2W1HA 4FTMA 4ZTQA 2XKFA 1REKA 4GYGA 4K8AA 4O0TA 2P33A 5I3RA 1Y6BA 3EQFA 4GT4A 4QYYA 4HYHA 2JKMA 4AOJA 2R3MA 4QMQA 2V0DA 5HOAA 2CLXA 2F2UA 4EH2A 2ZMCA 2FO0A 4I23A 4O27B 2ITZA 3ROCA 1S9IA 4NL0A 5EKNA 2X0GA 5HBJA 3BGZA 3OT3A 2WIPA 2W9ZB 5H9BA 3ZLXA 2PPQA 4Q2AA 3RAHA 3FL4A 2UW0A 4AZVA 5EM5A 3TN8A 3HLLA 3DFCB 4AN3A 3MVMA 2C3IB 4Y72A 2J50A 1IAHA 3EOCA 3BHUA 1E1XA 2QOQA 4I20A 3GVUA 3TNWA 3EKKA 4E6AA 1NVQA 3NLBA 4RJ7A 3V04A 4IWQA 3PXZA 4LRMA 4FGRA 1FVTA 4IB0A 4CT2A 5FEEA 1ZYLA 2IJMA 2R0IA 3BPRA 3PA4A 3MESA 2HAKA 3ORLA 5C8NA 2O5KA 4MXYA 4A4LA 4C33A 3A62A 4AW1A 2W1GA 3R00A 1UNLA 4AQCA 2JDRA 2W4OA 2UZLA 3FMEA 5HCXA 1Z9XA 3AT3A 3COHA 3RNIA 4C0TA 3I0OA 4O96A 5GJGA 4AE9A 2RGPA 2GHLA 2JFLA 2YIYA 3IK3A 2XM9A 3LZBA 2IZTA 4NW5A 2QR8A 2WAJA 4I5MA 3FE3A 3HA8A 3JS2A 5ANKA 3UNJA 1YI3A 4JJRA 2LAVA 4B0GA 4JR3A 3UJGA 4DA5A 4XMOA 1FMKA 1NXKA 3PIXA 4FT7A 1RE8A 2X7GA 2YDJA 3P5KA 5K4IA 3COIA 3PJ2A 4H3BA 3M11A 2XUUA 5BQ0A 4XCUA 4Y85A 5AAGA 3II5A 4IIRA 2W1CA 1Q3WA 1VEBA 5EW3A 3OY3A 3R22A 4GK2A 3TV7A 4FTAA 4AT4A 5JMSA 3FKNA 4GT3A 5GIOE 2J2IB 3EFJA 4RC3A 5HEZA 5KKRC 1WBNA 5BVOA 3MS9A 3HA6A 3G15A 3HP2A 4O7VA 3SC1A 2PZRA 2ZV7A 3QX4A 5DT0A 3ZOSA 2CGXA 2CPKE 5BVDA 3TUBA 4EQCA 4A9RA 3W2PA 4L6QA 2X2MA 5L3AA 3VJOA 4JBVA 5IG1A 3VQHA 1UNHA 3PIZA 3R6XA 5IH6A 2PUPA 4CT1A 3SHEA 3PVBA 3ZO3A 1DAWA 4M69A 3SXFA 3IOPA 1O9UA 2BAQA 2XIYA 2UZOA 3B8QA 3QQJA 3WYYA 1QCFA 5KE0A 4X3FB 2BRMA 4EKKA 4DFUA 3Q4UA 3UOLA 5DFPA 4MAOA 2IWIA 5IA3A 1ZYDA 2P0CA 3BLHA 3HAMA 3PE2A 3ANQA 4EC8A 4NKSA 5FD2A 4ONAA 4RG0A 3HMOA 4EK4A 3QHRA 2YDIA 4QTAA 5CU6A 5EI8A 4WUNA 3GP0A 3O0GA 4DTAA 5C4KA 2GFSA 3ULIA 4ZTMA 4LOOA 4ZSLA 4S30A 4UWYA 3KMMA 4AT5A 2C47A 2GHMA 2IW8A 5CAPA 3FV8A 3R8VA 3DXQA 3UMXA 4L3JA 2Z7SA 2SRCA 2VN9A 5JGDA 4FNZA 1OKWA 4GKIA 3WIGA 1M2PA 5HTBA 3VS5A 3FZPA 2GS7A 4X0MA 4MTAA 4F6SA 1J91A 2J5EA 3PXRA 3MV5A 4RIXA 4E4LA 1UWJA 2J5FA 3BYSA 3KC3A 4MBJA 2P3GX 3MFRA 5AA9A 1GZKA 3MY1A 3QC4A 5TOZA 3ZO2A 3KKVA 2FSTX 4JRVA 1ZLTA 4IAYA 3OWJA 4R3RA 5A4TA 4CKIA 1ZYCA 2OJGA 4BBMA 1WFCA 4I4FA 2JKKA 4MD7E 2YZAA 4CFUA 5M4IA 4JQ8A 4AA4A 3SXRA 4L43A 3DAEA 3LLTA 2BHHA 4GUEA 3V01A 1CKJA 1Q24A 4IZ7A 5AM6A 4RC4A 3BWJA 4FKSA 3HL7A 1OECA 1W83A 2IZRA 3K54A 4YTHA 2ZMDA 3GNIB 4EHZA 5CU0A 2XKEA 3AT4A 4WIHA 4FKIA 2UVYA 2QO2A 3GI3A 3V5LA 3E64A 3SRVB 3KMWA 4DITA 3GU7A 2Z8CA 2ITWA 3FMLA 4GVAA 2Y6OA 4C3PA 5H8BA 2B4SB 3OCBA 4G5JA 2GNJA 1FINA 4RFYA 2IZUA 4XH6A 4YLLA 4YTIA 5IQFA 5DHJA 1YWRA 2VNYA 1S9JA 1XBAA 2QQ7A 3ORZA 3ZBFA 2PVHA 3QXPA 5KMMA 4AG8A 4HVSA 5CAOA 1K9AA 4L7FA 3FI4A 5K5XA 2GS2A 2JBPA 4NK9A 4IX3A 2GSFA 1V0BA 2XNGA 5J1WA 2UW9A 5CEIA 5IH4A 3FQSA 3SOCA 1PMVA 3R1NA 4JS8A 3PTGA 5HTCA 5FP6A 4I1ZA 3SXSA 4Y8DA 5A14A 4WSYA 2W05A 3OWLA 3W2OA 1Q41A 4BGQA 4UV0A 4WG5A 1W84A 1PKGA 4BRXA 3ORKA 1IRKA 3D2KA 3PVWA 4M0ZA 3PJ8A 5K3YA 1H1PA 3OUNB 4USDA 2YAKA 4FSQA 2EXMA 2HXQA 2PTKA 2QG5A 3HV5A 3K3JA 2R64A 4I3ZA 4MEDA 5CASA 5HIEA 3FQHA 4E5BA 1ATPE 1G8AA 4K33A 3P1AA 1M2QA 2C1BA 1BMKA 2UW7A 4DEBA 4BCKA 3LXNA 4EOSA 2B53A 3B8RA 4K77A 3QTRA 4G5PA 4L42A 2I0YA 4CGAA 1MRVA 4QMXA 4B8LA 4MX9A 4YZDA 3KL8A 4M67A 3EFKA 3MBLA 2HYYA 2C68A 3ORXA 1R0EA 4PPBA 3WOWA 1APME 3NNXA 1LP4A 5CS6A 1WCCA 3DBEA 4UYNA 3RPYA 4AZFA 1J1BA 2CN8A 2G2IA 3A7JA 4NM3A 5E8TA 3VUKA 2BTRA 4FV4A 2BMCA 4QNYA 3NNWA 5AR5A 4E8AA 3QGWA 2EVAA 4KBCA 1YHVA 4UEUA 4FVQA 4C02A 4L52A 4C2WA 5AR3A 3ZZWA 5IA2A 3MVJA 2WMWA 2UZBA 1WBOA 1Q8ZA 4K6ZA 2YABA 3LFDA 4Z9LA 4BDBA 4HZSA 3RJCA 2VX1A 4DGOA 2OZOA 3VUGA 4FKOA 3CY2A 1IEPA 3FUPA 1ZAOA 3LMGA 3NYNA 5FLFA 4IDVA 1IR3A 3R0TA 4N70A 4HVHA 1AQ1A 4CKRA 4L01A 4NIFA 2WOTA 3Q9XA 3DXPA 2FYSA 3F5XA 2BKZA 3UC4A 2O8YA 4M13A 3OY1A 4PDPA 3P08A 4O38A 3E8CA 4EH4A 3TUDA 4D4YA 4DGMA 3VIDA 4L3PA 3PXKA 5CQWA 3POOA 2WQEA 4O0SA 5BNJA 4R7HA 3TZ9A 4O0XA 2VO3A 3L9PA 4G3GA 4GFGA 3THBA 4CFXA 3NUAA 4Z3VA 4APCA 3C13A 4D2PA 4EH7A 3NCGA 3BQCA 3FMDA 2XNEA 3PUPA 3UOJA 3VS3A 5F4NA 3QGYA 1URCA 2Y7JA 1URWA 4DCAA 2QU5A 3P9JA 2B1PA 2J0JA 3KULA 5E8WA 4PQNA 4FSWA 3ITZA 5CVFA 1H0WA 3RM6A 4O2ZA 4CLIA 4HNIA 3QRIA 4DN5A 4TL0A 1H0VA 4Z7HA 5FDPA 3OOMA 1JVPP 4FK3A 5IA5A 2PUNA 1VR2A 3F2NA 1H28A 4J8NA 3WZJA 5BX0A 5JT2A 4FV8A 4IADA 5ETAA 5EDRA 1FOTA 2O3PA 4BIDA 3MB7A 2WTKC 3BU6A 4AW5A 4CV9A 4EOLA 5L8KA 4I93A 4EUUA 4QMLA 4CFWA 3LCSA 2YZLA 3L8XA 4JIKA 3F7ZA 4UMUA 4FF8A 4FYNA 2BRHA 3O8UA 4RBLA 5A46A 2GU8A 3HUBA 5D41A 3BE9A 3TEIA 1WVXA 2HWOA 4IB3A 5GZ8A 2PZPA 4BR3A 1ZOHA 1IG1A 2R3QA 4XJ0A 5IQDA 3V8TA 4S33A 2V5QA 4JL9A 4MNEB 5D11A 5TR6A 2BZJA 4H39A 2W5HA 2WQMA 4CMOA 2PZ5A 3E87A 3EHAA 3HV7A 5EHOA 3EQPA 3VUMA 2UZUE 3C7QA 3Q32A 5HBEA 1R0PA 3QKLA 5CENA 4U9AA 2W5BA 5LXMA 3AC8A 3F7WA 1YWVA 1OUKA 2UW8A 3NIZA 4R5YA 4I0SA 2HOGA 2RIOA 4YZNA 4JX7A 4EBWA 3DJ6A 2ITOA 3PG3A 2VAGA 4ZJVA 4X2KA 2BKKA 4GG7A 5L6PA 3I6WA 5I9VA 4FV3A 2BDJA 3TKHA 3ZFMA 5HQ0A 2V22A 4FVRA 4C2VA 1PMEA 3V5TA 2OXDA 1X8BA 4KWPA 2J4ZA 3MSSA 1ZOEA 4QOXA 5DRBA 3Q4TA 4Z16A 1ZY5A 5KUPA 3GC8A 5CSHA 4S31A 3R7OA 2XKDA 2BZHB 2QO7A 4D58A 3I6UA 2HZ0A 3R1YA 4P7EA 5J7BA 1DAYA 5E1SA 3TV6A 4WHZA 4XP3A 4BDAA 4EHVA 1IA8A 4KS7A 3A8WA 3OT8A 1G5SA 1OL7A 2ONLC 2R4BA 4FT5A 2VGOA 3E7VA 4YZ9A 4YO6A 3H30A 3IW8A 2H9VA 2VTRA 4BTFA 3EWHA 1I44A 2VWZA 3A7IA 1YWNA 4G3EA 4HNFA 2JIIA 3PPZA 3BIZA 4W4WA 4WO5A 2OFUA 4FIIA 3Q60A 4L7SA 4YZBA 4DGGA 5BVNA 4FE2A 2PHKA 3WZKA 3L9NA 3ALOA 4M97A 4XEYA 3ZM9A 3TTJA 4O81A 3K5VA 4FOBA 5GZ9A 3UVPA 3FWQA 4HGEA 3PRIA 3DS6A 3FXZA 1M2RA 3GCSA 1PXLA 5AP4A 3HMNA 4A9UA 3DV3A 2HWPA 4N6YA 2JD5A 4QP1A 3H4JA 3ELJA 4XRLA 4LRJA 5EYKA 2CNQA 4U81A 3OFMA 2YCRA 4GJ2A 4FIEA 5CZHA 5IQEA 3BKBA 2VRXA 3AD6A 5E7RA 2C0OA 1UU9A 4NCTA 2VWIA 2F7EE 3CTJA 3U87A 4PTEA 4AFJA 4FL1A 5DT4A 1OPJA 4MQ2A 2JC6A 3TKIA 3O71A 3E92A 4Q5HA 2R3FA 3MY0A 4LUDA 2JFMA 4DLJA 1KE9A 3EN5A 4R8QA 4YJOA 3U6HA 4FVPA 3BYUA 2RFDA 3R9HA 1UU7A 2WD1A 3IDCA 4X21A 2WMUA 4FSMA 3BHVA 2OF4A 1WBWA 4UZDA 5DIAA 2ZDTA 3CLYA 4PP9A 4TNDA 4X3JA 4ZSEA 2UW5A 4AA5A 3L9LA 5J1VA 3EZVA 4MH7A 4EJ7A 5C4LA 3HP5A 5M4CA 2PMOX 1MQ4A 3PPKA 2QOOA 4I5HA 4TWOA 5JEBA 1HCKA 4HW7A 3E7OA 1LPUA 3CQEA 3DTWA 3VJNA 5EYCA 3PP1A 5KHWA 4JBPA 3MDYA 3Q96A 4XYFA 1ZZLA 4QMTA 4RFMA 2FUMA 5H8EA 2O63A 5HBHA 3VN9A 4E73A 5IU2A 4EZ3A 1OIQA 4KKHA 4MXCA 4AZSA 4DTKA 4R7BA 4BDFA 3QLFA 5A3XA 4HGLA 3LIJA 1YW2A 4AGWA 3G5DA 5LVLA 2ITYA 5IH5A 2UW4A 4N6ZA 4YJUA 2B55A 4QP9A 5AMNA 3V6RA 4RC2A 5BVEA 4H1MA 4FTQA 3I0QA 3F2AA 4EQUA 4ID7A 1U46A 3VUDA 4AFEA 2BFXA 4A4OA 1PJKA 4C4JA 4V0GA 2O2UA 4TPTA 5CSPA 3MIYA 2XIKA 1TQMA 3F2RA 1YI6A 3MJ2A 1H25A 4A4XA 2YCSA 2XMYA 3W1FA 2OH4A 1WBPA 2QD9A 4WG4A 5L2SA 3SG9A 2RSVA 4C58A 2X8DA 3HZTA 3KXXA 4II5A 4ZZMA 3HKOA 3DB6A 3DOGA 3KRXA 1HOWA 5HVYA 4IM2A 4C34A 4MKCA 5CZIA 4O2PA 3RALA 2J9MA 4YUQA 5CYIA 3FLSA 2NRYA 3NAXA 4KD1A 2YACA 4LV5A 1WAKA 2OIQA 3IW4A 2VTIA 3H3CA 1BLXA 3TNHA 2KULA 4CRSA 4MXXA 3UVRA 3UC3A 3FQEA 3CBLA 3FMHA 4AUAA 1R78A 5H3QA 5E8UA 4C4EA 3H9OA 4E5WA 3SVVA 1JKTA 2IVUA 3B2WA 4S34A 1JPAA 2YIRA 5KO1A 2WTKB 5L8LA 2Y9QA 3QKKA 5FXRA 4RJ4A 2ESMA 3TZMA 4BKYA 3G0FA 1W8CA 4EJNA 4NM7A 4DEEA 4RIWB 5HU9A 3D0EA 3DBFA 3VBTA 4LYNA 3KVXA 3AT2A 2G01A 4EOMA 4P5ZA 4H58A 3PP0A 2QOIA 4FGBA 4TYIA 4ZS0A 5HCZA 4AAAA 4F7LA 3TI1A 3D2IA 3EQDA 3VC4A 2BROA 3MH1A 3DJ7A 3SW4A 4NKAA 4PMMA 3R73A 4CNHA 4ZTNA 4CRLA 2IG7A 3ALNA 5L2IA 3IKAA 5HVJA 5BYLA 3I5NA 4G16A 5M55A 3SLSA 1GIJA 3QALE 5AA8A 5K4JA 2YFXA 2C5OA 5E91A 5T6KA 5AUUA 3ANRA 4BCMA 2W99B 2XNNA 2QOKA 3LAUA 3UPZA 1DI8A 2XP2A 3IOKA 4O7LA 1CDKA 4YURA 4K11A 5DI1A 4CMUA 2BFYA 3FLNC 4FZAB 2WB8A 2YCFA 3QQLA 2BALA 4WOVA 3VWAA 2C5NA 3QU0A 4K9YA 2BHEA 2CHLA 3Q6UA 4CG9A 4IZAA 3EQRA 4EWHA 3CJGA 4EYMA 4DT8A 3AC3A 1PMNA 3AC1A 2XK6A 2QCSA 2VO7A 4XLVA 4KRDA 5DGZA 2X7OA 5EM8A 3T9IA 3QTUA 5HIDA 4N4SA 2XIRA 3NSZA 2YIWA 4MF1A 4ERKA 4K1BA 3ORTA 2C6MA 5C03A 3KQ7A 2Q0NA 3F66A 4FTTA 2R7BA 2YCQA 1O6LA 4GIIA 3I7CA 4G6OA 4XOYA 5CAQA 1VJYA 3DA6A 2NNWB 5IQGA 5ANGA 1OL6A 4O0RA 2ZVAA 3FLWA 3ENHA 4YLKA 2B0QA 3K3IA 2P2HA 4I6QA 5E8VA 4J97A 4FEQA 5ETIA 4UX9A 2GTMA 1ZMVA 3B2TA 5AR8A 5KMIA 3TKUA 4MYGA 2X2LA 3ATTA 2XNBA 4RLKA 3ZRLA 4A9TA 4BWXA 3SQQA 5E1EA 5CEPA 4ZTRA 1J3HA 2ERKA 5E4HA 4KA3A 3LCTA 1K3AA 2B9FA 5LVOA 2IPXA 5LVMA 2A27A 1U59A 2XEZA 2BZIB 5EQPA 5HCYA 2VTAA 1PXNA 4CV8A 3BHTA 3N51A 3PXFA 5ICPA 5LARA 4OR5A 5JFWA 5LMKA 3ZUUA 2V55A 1NVSA 1JSTA 3FMNA 4LGDA 3Q6WA 4M7IA 3PSDA 3QZGA 3R7YA 4D2SA 4EH9A 5EM6A 3CTQA 3LJ0A 3QD2B 5LWNA 5HZNA 5AV3A 3ZBXA 4TNBA 5G6VA 5EQYA 2WKMA 5DR2A 4HZRA 4ZJJA 2VTTA 4A07A 4PX6A 2ZB1A 2P4IA 4E4MA 3EN4A 4AGUA 2R7IA 2OW3A 3F88A 2JIVA 3W32A 4H3QA 2XKCA 3DZOA 4FTCA 5HO7A 3MYGA 3R8MA 4MCVA 1JSUA 5C9CA 4FUXA 5EI2A 1CKPA 3GT8A 3L8PA 4C38A 3NVMB 4XG8A 3R7VA 1P4FA 4EL9A 5K5NA 4OT6A 5KMNA 1MP8A 1ZRZA 1H27A 4RT7A 4D4SA 1A48A 3H9RA 4JXFA 5FXQA 3F3VA 3R30A 3FPMA 4I6HA 4YBJA 5FQDC 3EQCA 1J1CA 2JDVA 4CTBA 4U3ZA 4R6VA 1YDTE 1Q8UA 2VWXA 3CKWA 3KVWA 2YDKA 2VTMA 3R9DA 2UZNA 1YDSE 2E9PA 3TACA 5DOSA 3NEWA 4O0WA 4MWIA 4YHFA 4RIXB 4RGJA 2VNWA 5CXHA 2ITNA 3QRUA 3H0ZA 3R9OA 1FQ1B 5EDQA 4BL1A 3WI6A 4OAVB 2OFVA 3LW0A 2WOUA 2RG5A 2C5XA 4O21A 4XOZA 4DG0E 4ZTSA 1CM8A 4G2FA 4JDIA 4BDDA 5IEYA 3QTIA 4J96A 4QMYA 3VULA 2G1TA 4I92A 4IZYA 5AP0A 3ZLSA 3R28A 4IJPA 5AUVA 1NT2A 5C01A 4F9BA 2W17A 4HYSA 4WNOA 4BCIA 1UU8A 1GZNA 1B39A 3EFLA 3WIKA 2WTCA 2X4FA 3PYYA 3HMPA 4ZTHA 3OBJA 2BCJA 3HDNA 4HPUE 5I9UA 5D12A 5CEOA 5DNRA 4FUYA 4IVDA 5L4QA 5DEWA 3BBTB 2ONLA 2HZNA 2Z7QA 2A19B 4RA4A 2W96B 2GPHA 3JYAA 3ZHPC 3EL7A 4DEHA 2XYNA 4U97A 1JLUE 3BU5A 1P5EA 4FV2A 5AIRA 5FTOA 2X39A 4F9YA 1B6CB 2C5YA 3QYWA 2JAVA 3ZS5A 4O7RA 5AFVA 5GNKA 4HVGA 2OJ9A 3PVUA 5EFQA 2YJSA 5AP2A 2ITUA 3CGOA 4AW2A 3CR0A 3JVSA 3ULZA 5F1ZA 4BCJA 2QOLA 4ARKA 3FI8A 3UG2A 4FSRA 4KRCA 3MFTA 2PU8A 5CLPA 1JKLA 3OCSA 1TVOA 4MWHA 4FTLA 3D7ZA 4QYFA 2WMBA 3D94A 4EK6A 3UGCA 5L2TA 4BFMA 5HICA 2WMRA 2CNUA 3LCKA 3BV2A 3U8WA 3DKFA 3TIZA 2OU7A 4CVAA 3ZDIA 5J95A 4X2GA 1PKDA 4XRJA 3UMWA 2CDZA 4TY1A 3OHTA 4HVDA 3QCQA 3Q5ZA 3QQUA 4U7ZA 3IG7A 2YM5A 3IDBA 4CXAA 4XLIA 3OCTA 4WNPA 4LFIA 2OZAA 4F9CA 3LMIA 4GT5A 5B0XA 1PF8A 3DK6A 2C6TA 3V6SA 4YTCA 5FTGA 4ASXA 1AD5A 5B2MA 4NCTC 2Q83A 3F5GA 2XJ1A 5AM7A 3VBVA 4EOJA 1KUTA 2UZVA 2C0IA 3ZCLA 5AR4A 2VZ6A 2OXYA 3VUHA 2B9IA 2G15A 2V7OA 2YIXA 4P5QA 4ERWA 4W9XA 3EB0A 4EOIA 4QNAA 3KXZA 3VS7A 4WA9A 4FG8A 3MA3A 4O84A 5HNGA 2GTNA 4RX9A 4M8TA 3R2BA 2VTSA 5ANJA 5JQ5A 4O82A 3NUXA 1BUHA 4FIHA 4R78A 1OBDA 3I1AA 3GCUA 2PMIA 3TV4A 3F3TA 5CI6A 3GC7A 4X2NA 4Y83A 3R2YA 4CFNA 4AZTA 1QL6A 5BVFA 1QPDA 3O8PA 2HIWA 2CKOA 2R3HA 3BHYA 4EK5A 1JKSA 5IDNA 4IVAA 3UO5A 4QP3A 2R3IA 2IW9A 4RIOA 4EORA 2CKEA 2QOFA 4R3PA 4QYGA 5AUZA 2OIDA 4FKVA 2RKUA 4F0FA 5CU2A 4PNKA 4DAWA 2YERA 3AGLA 3T3VA 3EIDA 3W55A 4NWMA 5LVNA 1FGKA 5DG5A 3PWYA 2X2KA 3GEQA 5K9IA 1QPCA 2WFYA 1XH4A 2J51A 1UA2A 3DJ5A 1UVRA 4FKWA 4U40A 1QMZA 3KCKA 3HV3A 3VF9A 3CIKA 5EW8A 2ZV9A 3QZFA 2Y6MA 4ITJA 2C6LA 3PXQA 4FIFA 3VF8A 1YKRA 4FIJA 5FEQA 4BZOA 5KMOA 1EH4A 5HESA 4LMUA 3ZONA 1XH9A 4XV9A 2XNPA 4LGGA 5F94A 4A7CA 3QA0A 3WZEA 3RWPA 4TZRA 3O8TA 4NM5A 3V5QA 4F9WA 5EYDA 2YISA 3SGCA 4ANQA 4TYGA 3COMA 2YITA 4UWBA 3C5IA 2ITVA 2BIKB 4ACHA 4NH1A 2NPQA 4J99A 3NUSA 4IWOA 5GJDA 4F4PA 5FUTA 4KNBA 3VNTA 2ZDUA 1TKIA 2QI8A 4GIHA 4L44A 1XH7A 3OTVA 2PUIA 4FI1A 4DINA 3C0HA 1U54A 3ET7A 5AUTA 2BRGA 4Y95A 3SA0A 1O6YA 3AGMA 4PWNA 3EN7A 5TKDA 2ZYBA 2JKOA 4LQMA 2XJ0A 3KRLA 3LJ1A 2C6DA 5HGIA 3D5VA 3CEKA 4FTIA 1BYGA 1RDQE 3BRBA 4BCQA 3BV3A 4KIKB 2VTJA 2YLFA 4J98A 5DMZA 4G6NA 3W16A 5C27A 4ZSJA 3GB2A 3QUEA 4YBKA 5FTQA 2VWWA 3DKCA 1U5RA 4C57A 4C37A 4IC8A 3UNZA 1YDRE 3D5UA 4UALA 4GRBA 4FODA 4NZWB 2Y4IC 4QP7A 2XRUA 4TYEA 3UDBA 3VBWA 5HNBA 5A9UA 1OGUA 2Z7LA 5B7VA 3HAVA 4RIYB 2WMQA 5EYMA 4YPDA 4IAKA 5ETFA 4KBKA 4ENXA 4NYEA 3GUBA 3EFWA 4BDEA 4B8MA 1OKYA 4L00A 4RJ5A 3IGOA 4RWLA 4O86A 2WGJA 3U9NA 2E9OA 2W5AA 5AV2A 4QMZA 4KSQA 5DA3A 3RTPA 3HUCA 4YC3A 4I94A 3BHHA 3DKGA 3POZA 4FSNA 3TNPC 1VYWA 2C3KA 3JXWA 4ANLA 3KXHA 4D2RA 3OEZA 5IPJA 3E8NA 2BUJA 4FMQA 4DEGA 5I5ZA 3L8VA 3WF9A 3PJ1A 5BMMA 4BCHA 4XNEA 2CKPA 3R02A 4YR8A 2YM3A 1UKHA 2AYPA 2ZV8A 2C4GA 2OSCA 2XF0A 3PE1A 4FKGA 4FKLA 3MTLA 2QKRA 1OZ1A 1P4OA 4IACA 3EQHA 4UMTA 3G0EA 4PMPA 4GUBA 4IVBA 2W4KA 4X6RA 4FKPA 2QU6A 2GFCA 2Y8OA 5JK3A 2P2IA 4V05A 5AWMA 2OBJA 3PJ3A 4E1ZA 3G6GA 4LOQA 3KK8A 2O0UA 4BWPA 1PXJA 4APPA 3M2WA 4Z7GA 3ORNA 1AGWA 5KKRB 4OAUC 4CG8A 1FBNA 1KOAA 3S4QA 5LMBA 3OW3A 1REJA 4OTQA 5FBNC 3HMIA 4BZDA 4CZTA 4ITIA 3UZRA 2H6DA 1IAJA 1BI8A 3C4WA 2WTWA 2CMWA 1NW1A 4IAZA 3NW5A 4FEUA 4IVCA 3RZFA 1VZOA 3R7GA 4G6LA 1PXIA 2PE1A 4PMTA 4XV3A 1Y8YA 4EZ7A 5HLWA 4DTBA 4XG6A 4OGRA 3R8PA 4IAAA 2OJJA 2Z7RA 2OG8A 2Z2WA 3VUIA 1QPJA 1H01A 4EH3A 3MWUA 1BKXA 4GW8A 4OBQA 4UMPA 2QOCA 4YHTA 2ACXA 4BCOA 4D0XA 2A2AA 3MA6A 3PLSA 3PIYA 5M06A 3O7LD 4RZWA 4FA2A 1GZOA 4FT9A 3DZQA 3PA3A 1BX6A 1PHKA 2PVRA 3FMMA 2JITA 3UZPA 4OBPA 3A2CA 4QQCA 3FJQE 3FHIA 3NRMA 3TG1A 3LQ5A 4ANMA 4D1XA 3N4TA 3JR1A 4QTEA 4QMNA 3LE6A 4DFBA 4JIAA 4BN1A 3PY3A 3FI3A 4P2KA 4YTFA 2HW6A 5JFXA 5F20A 1H1SA 5KZIA 2QNJA 4U3YA 4RLLA 2A0CX 5B2LA 4IX6A 5LMKC 3SRVA 4KIQA 3R01A 3DNDA 2JDOA 3LFQA 4F7JA 3HRBA 5DYJA 1M52A 3QX2A 3OROA 4EZ5A 2WTJA 2XK9A 4N0SA 3KCFA 2GDOA 5HG8A 5HLPA 1JSVA 1WZYA 3QTSA 4G3FA 3O50A 4PDOA 3T8OA 4DH3A 5M07A 4MHAA 4ZJIA 4UN0C 4YZMA 2A1AB 4RQKA 5K0XA 3LCDA 5DN3A 3U51A 5TF9A 3HRCA 4CZYB 2HK5A 3BE2A 3DTCA 4YSMA 1PMUA 3PZHA 4USEA 2UVZA 4ZTLA 3Q3BA 3C9WA 4J7BA 4BI1A 4DHFA 3R1SA 2UZWE 1G8SA 1GIIA 3AC5A 1OL1A 4HYIA 3DFAA 3IQ7A 3OW4A 3PPJA 4TYHB 3CPBA 2J6MA 3W2QA 1H8FA 4M3QA 5IUGA 5IA1A 3DAJA 3AD4A 4QMOA 4GEOA 5HU3A 3A7FA 3EQIA 3DDPA 4G9RA 5ANIA 1ZYSA 3AMYA 4FKRA 3JY0A 4KKEA 3FZ1A 3KRJA 2W1FA 1YOJA 4GK3A 3UOKA 5AJQA 2HY0A 3QTWA 1WBTA 4V0GB 4JAIA 1T45A 4BCFA 3LFAA 1Q97A 4D1SA 3U55A 3WILA 4BY9E 2QLUA 1KWPA 3L9MA 5KBQA 5HG7A 4KINA 3CC6A 4IDTA 2R3NA 3G9LX 2GHGA 3FXWA 3I81A 2DUVA 3Q9ZA 1NVRA 2C69A 3IW6A 4LGHA 2AC5A 2OKRA 3BQRA 3CD8A 4G3DA 5ITAA 1KV1A 4M14A 4B9DA 4CCBA 3H9FA 3MB6A 3C0IA 3SV0A 1Q3DA 2ETRA 3PWDA 3ZEPA 4M12A 5M51A 3R04A 4CLJA 2FGIA 3QUPA 1FVVA 3RVGA 3ZU7A 2QLQA 4BDCA 5M44A 1E9HA 4AU8A 4BTMA 1P2AA 3JUHA 3QRTA 3LFEA 3H10A 3VQUA 3PJCA 5FGKA 5AV4A 3OWKA 3PSBA 1OMWA 4FICA 4FNXA 4FL2A 3ID6C 4JNWA 4FTUA 1YXXA 4BKJA 2BZKB 2OF2A 3WF7A 3QQGA 3UE4A 5DLSA 4DYMA 3ODZX 2PK9A 1OKZA 2EWAA 3DBDA 5KNJA 1MQBA 4FX3A 1I09A 4FZ7A 4C35A 3D4QA 3RKBA 3GBZA 4ANBA 4U41A 4UY9A 3BELA 4OTWA 4WBOA 5J8IA 2DS1A 3C4ZA 3MH0A 4DBNA 4ZLOA 5AIKA 4ZMFA 2C6KA 3PY0A 5DRDA 5IQHA 3GCVA 3NYOA 3P23A 4JQ7A 3E8EA 2WELA 2YJRA 4J53A 5I9WA 5C26A 4ZIMA 4FSZA 4FTJA 3ORIA 3VBQA 2C6OA 4E4XA 4GKHA 3PFQA 5LCJA 3BEAA 2QONA 1ZY4A 2XK7A 1OM1A 2QKWB 2PUUA 4FNWA 3CP9A 5HVKA 1WBSA 1E1VA 3FAAA 5E8ZA 1F5QA 1FVRA 4QTBA 4FK6A 4JBQA 5CU3A 3GOPA 5CNNA 3UIBA 5KZ0A 4O91A 4E26A 5LCKA 3E5AA 3A4PA 4BHNA 5F9EA 5J79A 3PY1A 5LQFA 2W7XA 3C4CA 3D7TB 1CSNA 4BDGA 2UZEA 2X9EA 4ASDA 2XCKA 3D14A 2B9JA 3R8LA 2ZOQA 1NA7A 3BYOA 2HXLA 3MN3A 1Q4LA 4G34A 5AV0A 4ZY5A 5TT7A 2VD5A 4IH8A 4DLIA 4FL3A 4OT5A 4I6FA 4QPSA 2GNFA 5ANDA 4EOKA 3HNGA 5IA4A 4YJPA 3TZ7A 5KMJA 1YOMA 5K0KA 2R2PA 3HDMA 1J7LA 4B6LA 3F9NA 5DPVA 4DFZE 4AOIA 5HLNA 4BTKA 4CEGA 2NRUA 2X1NA 5M57A 4R77A 4F7NA 5BUJA 1P14A 2BVAA 2E9VA 2YM7A 3QC9A 4LG4A 4EYJA 4JVGA 4ZLZA 5E8SA 4F1OA 5F95A 1HCLA 4LUEA 4QMVA 4J52A 3FZRA 4QMPA 3LFSA 3GFEA 5HG5A 4C4FA 5CQUA 3GGFA 1KOBA 2JEDA 4YJQA 2ETMA 5LMAA 3OC1A 2OLCA 4RX5A 2XM8A 2GNLA 4G9CA 4CD0A 2VTNA 5J87A 4V04A 4JAJA 1L8TA 1OB3A 2V7AA 1Y6AA 4ZSAA 2RG6A 2VO6A 3A7HA 4Q9SA 2WEVA 4CFFA 4OTRA 2WQBA 3VHKA 5CF6A 1U5QA 3W33A 3ACJA 2WMVA 2VTOA 4JG8A 4AWIA 3I60A 3O96A 3A7GA 4LL0A 3NS9A 3QTQA 4X2FA 3GC9A 4XV2A 1XWSA 4E4NA 4NT4A 3KK9A 5EHYA 3R7UA 4ZP5A 4CCUA 4RZVA 3VW6A 2YLEA 4FV0A 4DBXA 4E93A 2CCIA 4PDYA 3TM0A 4IX5A 3MVHA 4L67A 3VAPA 5JZJA 4D5HA 3ORMA 3CD3A 4OTHA 3M42A 3QQHA 1H1RA 2Z60A 5C8KA 5CAVA 3OP5A 3FC1X 3RPOA 4ALVA 3LFBA 4MQ1A 3OZ6A 1FMOE 4EHEA 3EN9A 3TDWA 1JQHA 2QC6A 2O65A 3MFSA 1JKKA 4EK3A 1DI9A 4AX8A 4J8MA 3K5UA 3TJCA 4IAFA 3IGGA 4UXLA 5J5TA 4U42A 4LM5A 3S3IA 4MXOA 4FSTA 1H00A 4IBMA 5FDXA 2I1MA 3RPSA 2REIA 4DFYA 3EL8A 4ALUA 4J71A 4QQTA 4TYJA 3KRRA 3F82A 2E2BA 3EH9A 1GY3A 5T3QA 2PE0A 1UNGA 3LM0A 4EBVA 4YNOA 3D83A 3NYVA 4AZEA 4EHGA 3ZSGA 3NPCA 3DDQA 1GOLA 3W8QA 2C6EA 2PZIA 3UBDA 4U80A 4ACGA 3OXIA 4F08A 1SNXA 1XH6A 3QRJA 4YMJA 3QBNA 4I0RA 5GJFA 3RINA 3U6IA 4XX9A 4O6EA 2HZIA 4BF2A 3OTUA 4FYOA 4PL4A 3CE3A 2A4LA 3HX4A 4EONA 3I4BA 4IQ6A 4UYAA 3P4KA 1ZWSA 3R8ZA 1MRYA 2VGPA 4U79A 3LXPA 3NNVA 4FT3A 5J7HA 1JWHA 3KXNA 5KMLA 3UP7A 4BVUA 5GHVA 3LXLA 4E6CA 1KE8A 3BGPA 3P7BA 5AX9A 3QHWA 3R63A 2ITTA 3AD5A 4L68A 1XBCA 4IWDA 4XUFA 4Y73A 3Q4CA 2VO0A 4Q9ZA 1LEWA 2GS6A 2ZM4A 2NP8A 3CSVA 4JRNA 4QO9A 3TDVA 3KA0A 5GIPE 4KSPA 2C0TA 3R8UA 3LFCA 3MPAA 3W10A 3WE4A 1Y57A 5HE3A 3DQXA 1V1KA 3JVRA 3OD6X 4PRJA 4DCEA 5A4QA 5IMXA 3VW8A 4D2WA 4BI2A 4RJ6A 4QQ5A 4TW9A 3HRFA 4X3FC 3CTHA 2G9XA 3AC4A 1KSWA 3FSKA 2X7FA 4EH8A 2F49A 4NTSA 4FZDB 4CQEA 3MIAA 5HD4A 3V8WA 3OXZA 2C5VA 3P7CA 1Q99A 3F5PA 3QLGA 4MF0A 3FLQA 3NVKI 1ZARA 3QFVA 3S95A 4C61A 4HJOA 2CNVA 4FZ6A 5CF8A 4AW0A 2IO6A 4WNMA 4OW8A 3S2PA 4ORKA 2OO8X 2GNHA 1UKIA 4TXCA 3NR9A 3TUCA 4FTKA 4XP0A 5EOBA 4O7YA 3ROYA 2I40A 4TWPA 2OK1A 3P0MA 4H3PA 3FZTA 1W0XC 2XYUA 3GCQA 3GU6A 1OBGA 4TWNA 4EUTA 3RK5A 1SM2A 1RQQA 1SVGA 3LFNA 4LI5A 3RPRA 4S2ZA 4C3RA 4QP4A 4ANNA 1QPEA 4UXQA 3HECA 3LQ8A 4OTFA 4OTDA 3EN6A 3QQKA 2BILB 5CXZA 3U9CA 3QWKA 2W1ZA 2EB2A 4PTCA 4TN6A 4WG3A 2PVMA 4YJRA 4M0YA 4XG4A 4AA0A 4C4HA 4FC0A 3EKNA 1PXPA 3PVGA 4M69B 2QOHA 3NMUF 3GC0A 5CX9A 5IUIA 2OZAB 2ERZE 3NUPA 1GNGA 4B99A 1XH5A 3DB8A 2OI4X 3F3WA 3UOHA 2ETKA 5A4EA 5JGBA 3EYGA 4JDHA 5CVGA 2JAMA 2XH5A 2X8EA 4JDKA 1KV2A 3QQFA 4ZY6A 4IM3A 4NM0A 3RM7A 5C1QB 4MNFA 3SOAA 3LLAA 3RCJA 4EEVA 4ACMA 1DS5A 4OTIA 3WE8A 1OIUA 3MPTA 5AUYA 3S0OA 3MI9A 1DM2A 1KE7A 1ERKA 2R3KA 4KIPA 5AR7A 3TTIA 1JOWB 4KIOA 2QOBA 3C0GA 4D4VA 5L2WA 4O7SA 4U5JA 3NUYA 4CZUA 3NUNA 3R7EA 2QG7A 4IMYA 3UIXA 3COKA 3R9NA 2B52A 4FTOA 3C4FA 4I6BA 4MBIA 3OOGA 3QTXA 4GL9A 4MXZA 2VU3A 2YN8A 5E90A 3UYSA 5AP6A 1WVYA 3Q9YA 3BYVA 3PSCA 4IANA 1J7IA 4EWQA 2B54A 2PZYA 2PY3A 4U43A 4E3CA 2I6LA 3IW7A 3OEFX 1JNKA 3DLSA 5EM7A 3FHRA 4FG7A 3FYKX 4RIWA 4UZHA 5FP5A 4PP7A 3QWJA 1CTPE 4ZOGA 4QMMA 1OITA 1H07A 2WU7A 5HE2A 4JX3A 1XQZA 1GAGA 5AP1A 5EK7A 5HO8A 4A06A 4CYIA 3QD0A 2BTSA 4IFGA 2GQRA 4IXPA 2PVKA 4YGAA 2VV9A 3OUKA 3PXYA 3QCXA 3SX9A 2J0KA 3EQGA 3ERKA 3S1HA 5ACBC 3VS2A 4FEVA 1GZ8A 1J7UA 3UODA 3IONA 1ZZ2A 5FBOA 4A9SA 2F57A 2ITPA 4HPTE 2R3PA 2R0UA 2J7TA 3DPKA 1Q5KA 3MH2A 5DWRA 3MW1A 5HX6A 3E63A 3BU3A 5HE0A 3RMFA 3W2CA 3KY2A 3BX5A 4QPMA 2XRWA 3NZ0A 4PV0A 3FBVA 1RW8A 1Z57A 4RVLA 5JH6A 3KN6A 5JQ8A 5HNIX 4EK8A 3MPMA 2IZSA 1M17A 5C8MA 5JFSA 2EXEA 3ATSA 4L53A 2OJIA 1LUFA 4NU1A 4BYJA 4NTTA 4QMUA 4TWCA 4MXAA 4PUZA 4NJ3A 3BYMA 4PPCA 1JBPE 3CQWA 5I3OA 5M4UA 2PVLA 4JLCA 3R1QA 3U54A 2JDTA 3I7BA 3CQUA 5FM2A 4YJSA 1U54B 1R1WA 5EHLA 1H4LA 5HORA 3N9XA 4B7TA 3PLAE 1IASA 5BPYA 4K18A 4O1PA 3ZO1A 5IA0A 4CYJA 5B2KA 3PA5A 4Y46A 4D9UA 1XR1A 2WZJA 1Q61A 2LGCA 2XS0A 4YU2A 5IQIA 2CLQA 3PG1A 2R5TA 1V0OA 2OJFE 3BI6A 4TRLA 1SVHA 3QA8A 3CJFA 4FOCA 4MD9E 3F3ZA 3TNIA 4G31A 3IW5A 1PXOA 2V62A 1YXSA 2QHMA 4AN2A 2YM6A 2CGWA 3TNQB 3NAYA 4OTGA 3FL5A 2F7ZE 3R7IA 5IDPA 4P90A 3N4VA 2GCDA 1XH8A 3DGKA 4RSSA 3WZDA 3NX8A 3KXGA 3C50A 2HCKA 4ZZNA 2YM4A 4KB8A 5KBRA 4QP2A 4Z55A 2JIUA 4XBRA 3C1XA 4GU6A 3RI1A 2YWPA 3KN5A 3QXOA 3T3UA 3ZUTA 4F0IA 2J0MB 2WMSA 4YP8A 4GFOA 1KE5A 2C3LA 1OPKA 2VX3A 3BLQA 4EI4A 2WMXA 4WNKA 2UVXA 1H1WA 1XHAA 3LJ2A 4FR4A 1SVEA 5CY3A 2EUFB 2QURA 4AACA 3HVCA 5E92A 4ASEA 4H05A 2DQ7X 3NCZA 4BC6A 3QCSA 4FBXA 5BMSA 5TO8A 3GU4A 1YHWA 4UMRA 3TL8A 2I7QA 4YHJA 5E8YA 3G2FA 2ZV2A 3O23A 1PXMA 5EDPA 4BCNA 1GIHA 5G1XA 1O6KA 5DE2A 2JDSA 2X4ZA 4I22A 2C6IA 3A60A 3ZO4A 3ORPA 1LR4A 4ANSA 4N57A 2XK8A 2CKQA 3VRZA 2OIBA 5DVRA 4W4XA 2O64A 3LFFA 3FY2A 3PDTA 2X81A 3RBWA 3UIUA 3A4OX 4LMNA 3ODYX 4NIFB 4ZAUA 4USFA 2YIQA 4QTDA 4R1VA 4EKLA 2BDWA 3CPCA 2HY81 4RX7A 4WUAA 2PWLA 3P78A 3EYHA 4O7TA 4HGTA 4AN9A 3QYZA 1NY3A 1OPLA 4EOPA 2GQSA 4DT9A 3LVPA 2WHBA 1XBBA 4G3CA 5AR2A 4ACCA 3R71A 2CN5A 1M7NA 3EJ1A 4BGHA 4IB1A 4MK0A 3D9VA 4M15A 4C36A 4FV9A 4W4VA 2FSLX 4FTRA 1UWHA 1YOLA 4MD8E 4D5KA 4DH1A 4ENYA 2HENA 4BCGA 4GK4A 3KULB 5JKGA 4UBAA 2Q0BA 5AP3A 1W7HA 2FSMX 4L46A 4AOTA 4NJDA 2BRNA 3HV6A 5CSVA 2EB3A 2P55A 3GCPA 4IE9A 5A54A 5FXSA 5DH3A 1ND4A 5CT0A 3Q04A 2I0EA 4BYIA 5I0BA 5IKWA 3AXWA 2XNMA 2YA9A 4DGLC 1OIYA 4LL5A 4C4GA 5FM3A 4QQJA 4F6UA 4LRKA 2VTPA 3AC2A 3O7LB 3ZLYA 3WYXA 4PMSA 5JRQA 4F70A 4AGCA 4F64A 4DEIA 2VTQA 4F65A 4BWKA 4WKQA 4MBLA 4FTNA 3D5XA 3I5ZA 5BVWA 3WF6A 3NIEA 3MFUA 3UG1A 4FEXA 3FDNA 5IQAA 2J0IA 1SNUA 3ZLWA 2XCHA 3Q5IA 4QPAA 5D9HA 4D2TA 2BIYA 3MJ1A 2DYLA 4FKQA 4AT3A 3A61A 4GG5A 3ZFXA 5J5SA 2AUHA 3LCOA 4JQEA 1ZMWA 1KE6A 3ZRMA 1STCE 4DE4A 3DLZA 2WXVA 4IB5A 5A6NA 2RFSA 5FG8A 4L3LA 5HI2A 4M66A 1IA9A 2F9GA 4FV7A 3ZZEA 2YHVA 1YVJA 2VUWA 3KB7A 3OWPA 2IVSA 3ZTXA 2WTVA 4O7WA 5IZFA 5M4FA 3EZRA 3DK3A 5BYZA 3RHXA 4XG2A 1M7QA 2HZ4A 3QAME 2X6DA 4OTPA 4GH2A 4CQGA 5FEDA 4ASZA 3GENA 4BDKA 4GV1A 1OL5A 2I0VA 4X3FA 3VVHA 3KREA 4FNYA 5ANOA 4I24A 3P7AA 4IWPA 2DWBA 3GU5A 2PMLX 4NEUA 4RX8A 4UMQA 3QUDA 4KS8A 4FZFB 3BGQA 2R3GA 4P4CA 4W4YA 3RWQA 2X9FA 3K2LA 1YXVA 3CY3A 4GFMA 5CI7A 3G6HA 3GOKA 4O7ZA 3BWFA 1R3CA 2E9NA 2C3JA 2WQNA 1OIRA 4FV1A 4L8MA 4OUCA 4XG3A 3ZRKA 4ZS4A 2X6EA 3FZOA 3V51A 2W1DA 2VWUA 3W2SA 5AUXA 3FMJA 4JOAA 4TKSA 3U4UA 3CS9A 4FSUA 4O22A 2ITXA 5CSWA 3ZDUA 3F69A 5ANEA 1CKIA 2WIHA 5JZNA 3C5UA 4KKGA 1FPUA 3UPXA 4OBOA 4YC8A 4RFZA 2XNOA 3QRKA 5DEYA 4D28A 5H2UA 1MUOA 5A4CA 3TWJA 3E8DA 3FEGA 4K0YA 4CMTA 4QP6A 4TTHB 3KU2A 5LVPA 5JFVA 5KCVA 2JKQA 2WEIA 4IM0A 5CWZA 5GINE 3ZSHA 5IISA 4FEWA 3DNEA 3OVVA 3G9NA 4DEAA 1MRUA 3PRFA 5D1JA 2VTLA 3SG8A 3FI2A 3NW6A 2Z02A 2BAJA 4WSQA 3ZXTA 4O1OA 4U45A 4RRVA 3DBQA 5DR6A 4ZY4A 4AP7A 1W98A 3VRYA 4ZLYA 3ZEWA 5EI6A 2PULA 4BDJA 2F4JA 4YO4A 4XBUA 1XO2B 3VS1A 2BR1A 2B7AA 2XIZA 1A06A 2C30A 4QYHA 4U6RA 4E5AX 1A9UA 3FMKA 4BB4A 2VWVA 5E9EA 4IHPA 5LOHA 2PVYA 3RNYA 5M56A 2OGVA 4QT1A 1YHSA 5CF5A 2FVDA 5J9LA 5AP5A 3NGAA 5CAUA 2PSQA 3UIMA 3U4WA 4FV6A 3W18A 5JRSA 2IW6A 4O6LA 3DAKA 4YLJA 3DXNA 5CSXA 3I79A 3UP2A 3Q4ZA 1L3RE 1Q8TA 2ZAZA 1ZXEA 2ZB0A 2QODA 4IW0A 1WVWA 4QRCA 3TIYA 3ZXZA 4H1JA 1G3NA 2NO3A 3IPHA 5D10A 1SMHA 4D4RA 2CSNA 2VWBA 1H1QA 1OVEA 4NFMA 4S32A 4R5SA 4BZNA 4EQMA 5IMEA 2G2FA 3DBCA 4WBBB 5TE0A 5L6WL 2WNTA 3C4XA 2CJMA 2H96A 3CXWA 1U4DA 1TQPA 3E88A 2QHNA 3KEXA 3VS6A 4X6QC 3KGAA 3OG7A 3R9RA 3LQ3A 4GMYA 1JAMA 4KUJA 4KIKA 3WF8A 4AE6A 5EQEA 3OCGA 2FSOX 4YJTA 3TXOA 3VBYA 4RA5A 4E7WA 3KF4A 5L6OA 4U44A 3AOXA 2H34A 5KMKA 5M08A 4BI0A 5LWMA 4GU9A 5DBXA 3OMVA 2FA2A 4ITHA 3O51A 4RIYA 4FIGA 4JG6A 1B38A 3HEGA 4L9IA 4RWJA 1PRYA 1K2PA 4D1ZA 5AAEA 4FKJA 4CKJA 4A9YA 2J90A 3RCDA 4C3FA 4AF3A 1F0QA 4LOPA 5JGAA 3MGYA 3NYXA 4X7QA 4DG2E 5I4NA 2BDFA 5HD7A 3UTOA 4JT3A 3E62A 3OS3A 4GYIA 4DG3E 3HGKA 3CKXA 4DH5A 4UB7A 4JR7A 1Q62A 2GMXA 2HELA 3CGFA 4JBOA 3WZUA 2VWYA 3P79A 3Q2MA 2ZM1A 3DY7A 4TT7A 1GJOA 4BKZA 5IQCA 5EW9A 3VS0A 4CFMA 1PW2A 4XHKB 4O83A 3VHEA 2G2HA 4R1YA 5IEVA 5CU4A 4EC9A 2RF9A 2WMTA 3BBWA 3ENMA 3MH3A 3R21A 4JG7A 4IX4A 4EH6A 2UZTA 4RVKA 4DGNA 2YAAA 3FYJX 3FPQA 3QCYA 1YI4A 5GZAA 3FSFA 3WARA 3QF9A 3ZH8A 4M68A 4PL3A 3F61A 2F2CB 5T68A 1Y8GA 2JLDA 2C1AA 4RWIA 5EOLA 3LM5A 4KABA 2F7XE 4F63A 4LV8A 3G33A 2R9SA 3RGFA 3LXKA 3UYTA 2XZSA 5HHWA 2Y4IB 5E8XA 4ANOA 5CEKA 5LJJA 3NWWA 3ZC6A 3ETAA 1PXKA 4D0WA 1M14A 3GXLA 1CMKE 3A99A 1OI9A 4AS0A 3GU8A 4NFNA 2W4JA 4D2VA 4F7SA 3NNUA 3Q52A 5KHXA 2J0LA 4FKTA 2IN6A 3HYHA 3NW7A 4E6DA 2BRBA 3E3PA 1LEZA 3KF7A 4H36A 1SYKA 4QP8A 4PNIA 3EMGA 5CVHA 1VYZA 3D5WA 4FV5A 4QMWA 2UUEA 4W8EA 4F1TA 1PYEA 4HYUA 5BUEA 3KFAA 4O7NA 4Y5QA 4ZEGA 5H8GA 4QMSA 3RP9A 4BHZA 3UO6A 3L1SA 4KBAA 3ZYAA 2W9FB 3UNKA 1PY5A 3OF0A 4PY1A 2Y4PA 4C59A 4IEBA 3DQWA 4W9WA 5AX3A 3TT0A 3VBXA 2CCHA 2R3LA 3CCNA 5JSMA 2HW7A 4IAIA 2PVJA 2RFNA 5BYYA 3KMUA 3ZSIA 3GQLA 5ETCA 3NUUA 4DH8A 5M09A 4FG9A 3QD3A 4RMZA 4XS2A 2WO6A 3Q53A 4E20A 4RJ3A 4R7IA 3DK7A 2RL5A 3QZIA 5CEQA 5HX8A 3FY0A 3BLRA 2OICA 4HCVA 4I41A 4GS6A 5HTIA 3KXMA 1H26A 4C62A 5AV1A 2UV2A 3QTZA 4YJNA 2YEXA 4RVTA 5DR9A 3ACKA 4D9TA 4J95A 1YQJA 4O0VA 3IO7A 2QO9A 2IVTA 2RFEA 2VTHA 1Z5MA 5EKOA 4DC2A 3S00A 3GFWA 3JPVA 4DF3A 4WD5A 4PTGA 4XV1A 2W0JA 5L8JA 3ZC5A 5IEXA 2PYWA 1H08A 4MNEA 5JN2A 5HKMA 5CEMA 1H24A 3G90X 1R39A 4TYHA 2PE2A 3KRWA 1ZOGA 3FKOA 2B9HA 4JI9A 3O17A 4I4EA 3REPA 3RAIA 3T9TA 1BL6A 3QZHA 3GQIA 5AUWA 4WT6A 4M84A 4ACDA 2XK3A 4BIEA 3DT1A 4PPAA 5AADA 3LOKA 3UO4A 3IECA 4O0YA 5A4LA 3AG9A 2W1IA 4DFLA 2YWVA 3Q2JA 3F6XA 4C4IA 3MTFA 4FT0A 5CANA 2XJ2A 4BGGA 3HMMA 3U6JA 4Q5EA 5AP7A 4YPSA 3LKMA 2VX0A 2XK4A 2R3RA 2WMAA
chains in the Genus database with same CATH superfamily
4FKUA 4I0TA 3ZMMA 3VUTA 4F09A 1FGIA 2WQOA 4PL5A 4RWKA 4F9AA 3FXXA 2WU6A 3V3VA 4GSBA 2UW3A 4YC6A 4ZZOA 3C4EA 3SDJA 1OUYA 4CFVA 3FKLA 2FH9A 1Q8YA 5CNOA 5CT7A 4IFCA 4BBEA 1OL2A 3UQGA 2QVSE 5IQBA 2ITQA 3SD0A 5HIBA 2I0HA 2BPMA 4DEDA 3DCVA 3RK9A 5BUIA 1TFFA 1YXTA 3LPBA 4NW6A 3V5JA 4O0UA 4ZK5A 2CGUA 3C51A 4I5PA 3AQVA 2X8IA 2XVDA 3QD4A 3QKMA 3F5UA 2KTYA 5CTPA 2W1EA 4BCPA 3PZEA 4BICA 4CTCA 4DH7A 4DFXE 3LMHA 5AAFA 4XP2A 4O4FA 3A8XA 3AMAA 4RVMA 3RPVA 1YRPA 4AXAA 4RPVA 4ALWA 4D55A 4GCJA 5KX8A 4J1RA 3IS5A 3JY9A 4YSJA 1ZMUA 2IVVA 1UU3A 1UV5A 2ZJWA 3E3BX 5J9YA 2GQGA 3E93A 3OBGA 3L8SA 4XG7A 5D7VA 3UQCA 4K2RA 4E6QA 4FSYA 4V01A 4F0GA 2JBOA 3VS4A 4EH5A 3M1SA 4YJVA 5AEPA 5CALA 2E9UA 3RAWA 3FZSA 4IZ5A 2CGVA 3AMBA 1RJBA 4G17A 4W8DA 3BZ3A 3W2RA 3ZFYA 3RAKA 5HG9A 3Q9WA 2JGZA 3BEGA 4GJ3A 5EG3A 4HCTA 4WRGA 1BI7A 4DFNA 2PL0A 3UZTA 5BVKA 1WBVA 2PMNX 3HV4A 5IUHA 4R3CA 4BBFA 3DKOA 4MVFA 4I21A 4EOOA 3D7TA 4NSTA 4F6WA 3WF5A 4Y5HA 4L45A 2UW6A 4YNEA 2R3JA 2R3OA 4HGSA 1F3MC 2PVNA 3BCEA 3R83A 3V5WA 4JDJA 3ZM4A 3ZUVA 2OWBA 4BTJA 3W8LA 5I9ZA 4BIBA 4B4LA 3NDMA 2OXXA 4IJ9A 4WRSA 3TZ8A 1G8JA 2GNIA 2GNGA 2XA4A 2FB8A 1XKKA 2W06A 2X0PA 3DU8A 4OLIA 4QYEA 3SAYA 3UQFA 2WTIA 4HCUA 4BDHA 3V8SA 4F99A 1XJDA 2UZDA 2WTDA 3TCPA 5FRIA 3SKCA 3QL8A 4ZMEA 2ZM3A 4U8ZA 3MY5A 4G1WA 3N4UA 2XBJA 1V0PA 4NUSA 3VO3A 4EOQA 3MVLA 2XIXA 5DT3A 4YZCA 3FLYA 4PDSA 3LHJA 3O2MA 2XB7A 4IC7A 4X2JA 4ZSGA 5FWKK 4DDIA 5J9ZA 2Y0AA 4QD6A 4RJ8A 5CF4A 5A6OA 4GVJA 3RZBA 1YXUA 4QTCA 4BDIA 4ZXTA 1OKVA 3FLZA 4C7TA 4F1MA 4PF4A 5L2QA 4U0IA 3F3UA 5I9YA 3RHKA 4I5CA 4KAOA 5M53A 4C8BA 2EXCX 3WBLA 1BL7A 1T46A 3OXTA 3UVQA 4AZWA 1ZYJA 4RQVA 5HO6A 5ACKA 3D15A 4AGDA 2PVFA 5HE1A 5D7AA 2OH0E 1W82A 2AC3A 5IF1A 1PYXA 4CSVA 3H0YA 3P86A 1TQIA 3IDPA 1Q8WA 5EH0A 2EU9A 4XG9A 3V5PA 2QR7A 2H8HA 3G51A 2XBAA 3RK7A 4HVIA 2WPAA 4HOKA 5I9XA 4UWCA 2YM8A 1SZMA 1Y91A 2XEYA 1WMKA 2BAKA 3FC2A 3TJDA 3SW7A 3EQBA 2W1HA 4FTMA 4ZTQA 2XKFA 1REKA 4GYGA 4K8AA 4O0TA 2P33A 5I3RA 1Y6BA 3EQFA 4GT4A 4QYYA 4HYHA 2JKMA 4AOJA 3UDTA 2R3MA 4QMQA 2V0DA 5HOAA 2CLXA 2F2UA 4EH2A 2ZMCA 2FO0A 4I23A 4O27B 2ITZA 3ROCA 1S9IA 4NL0A 5EKNA 2X0GA 5HBJA 3BGZA 3OT3A 2WIPA 2W9ZB 5H9BA 3ZLXA 2PPQA 4LDTA 4Q2AA 3RAHA 3FL4A 2UW0A 4AZVA 4DHJA 4AXDA 1TZDA 5EM5A 3TN8A 3HLLA 3DFCB 4AN3A 3MVMA 2C3IB 4Y72A 2J50A 1IAHA 3EOCA 3BHUA 1E1XA 2QOQA 4I20A 3GVUA 3TNWA 3EKKA 2XAOA 4E6AA 1NVQA 3NLBA 4RJ7A 3V04A 3O5AA 4IWQA 3PXZA 4LRMA 4FGRA 1FVTA 4IB0A 4CT2A 5FEEA 1ZYLA 2IJMA 2R0IA 3BPRA 3PA4A 3MESA 2HAKA 3ORLA 5C8NA 2O5KA 4MXYA 4A4LA 4FRFA 4C33A 3A62A 4AW1A 2W1GA 3R00A 1UNLA 4AQCA 2JDRA 2W4OA 2UZLA 3FMEA 5HCXA 1Z9XA 3AT3A 3COHA 3RNIA 4C0TA 3I0OA 4O96A 5GJGA 4AE9A 2RGPA 2GHLA 2JFLA 2YIYA 3IK3A 2XM9A 3LZBA 2IZTA 4NW5A 2QR8A 2WAJA 4I5MA 3FE3A 3HA8A 3JS2A 5ANKA 3UNJA 1YI3A 4JJRA 2LAVA 4B0GA 4JR3A 3UJGA 4DA5A 4XMOA 1FMKA 1NXKA 3PIXA 4FT7A 1RE8A 2X7GA 2YDJA 3P5KA 5K4IA 3COIA 3PJ2A 4H3BA 3M11A 2XUUA 5BQ0A 4XCUA 4Y85A 5AAGA 3II5A 4IIRA 2W1CA 1Q3WA 1VEBA 5EW3A 3OY3A 3R22A 4GK2A 3TV7A 4FTAA 4AT4A 5JMSA 3FKNA 4GT3A 5GIOE 2J2IB 3EFJA 4RC3A 5HEZA 5KKRC 1WBNA 5BVOA 3MS9A 3HA6A 3G15A 3HP2A 2XAMA 4O7VA 3SC1A 2PZRA 2ZV7A 3QX4A 5DT0A 3ZOSA 2CGXA 2CPKE 5BVDA 3TUBA 4EQCA 4A9RA 3W2PA 4L6QA 2X2MA 5L3AA 3VJOA 4JBVA 5IG1A 3VQHA 1UNHA 3PIZA 3R6XA 5IH6A 2PUPA 4CT1A 3SHEA 3PVBA 3ZO3A 1DAWA 4M69A 3SXFA 3IOPA 1O9UA 2BAQA 2XIYA 2UZOA 3B8QA 3QQJA 3WYYA 1QCFA 5KE0A 4X3FB 2BRMA 4EKKA 4DFUA 3Q4UA 3UOLA 5DFPA 4MAOA 2IWIA 5IA3A 1ZYDA 2P0CA 3BLHA 3HAMA 3PE2A 3ANQA 4EC8A 4NKSA 5FD2A 4ONAA 4RG0A 3HMOA 4EK4A 3QHRA 2YDIA 4QTAA 5CU6A 5EI8A 4WUNA 3GP0A 3O0GA 4DTAA 5C4KA 2GFSA 3ULIA 4ZTMA 4LOOA 4ZSLA 4S30A 4UWYA 3KMMA 4AT5A 2C47A 2GHMA 2IW8A 5CAPA 3FV8A 3R8VA 3DXQA 3UMXA 4L3JA 2Z7SA 2SRCA 2VN9A 5JGDA 4FNZA 1OKWA 4GKIA 3WIGA 1M2PA 5HTBA 3VS5A 3FZPA 2GS7A 4X0MA 4MTAA 4F6SA 1J91A 2J5EA 3PXRA 3MV5A 4RIXA 4E4LA 1UWJA 2J5FA 3BYSA 3KC3A 4MBJA 2P3GX 3MFRA 5AA9A 1GZKA 3MY1A 3QC4A 5TOZA 3ZO2A 3KKVA 2FSTX 4JRVA 1ZLTA 4IAYA 3OWJA 4R3RA 5A4TA 4CKIA 1ZYCA 2OJGA 4BBMA 1WFCA 4I4FA 2JKKA 4MD7E 2YZAA 4CFUA 5M4IA 4JQ8A 4AA4A 3SXRA 4L43A 3DAEA 3LLTA 2BHHA 4GUEA 3V01A 1CKJA 1Q24A 4IZ7A 5AM6A 4RC4A 3BWJA 4FKSA 3HL7A 1OECA 1W83A 2IZRA 3K54A 4YTHA 2ZMDA 3GNIB 4EHZA 5CU0A 2XKEA 3AT4A 2X0OA 4FKIA 2UVYA 2QO2A 3GI3A 4WIHA 3V5LA 3E64A 3SRVB 3KMWA 4DITA 3GU7A 2Z8CA 2ITWA 3FMLA 4GVAA 2Y6OA 4C3PA 5H8BA 2B4SB 3OCBA 4G5JA 2GNJA 1FINA 4RFYA 2IZUA 4XH6A 4YLLA 4YTIA 5IQFA 5DHJA 1YWRA 2VNYA 1S9JA 1XBAA 2QQ7A 3ORZA 3ZBFA 2PVHA 3QXPA 5KMMA 4AG8A 4HVSA 5CAOA 3UDSA 1K9AA 4L7FA 3FI4A 5K5XA 2X0QA 2GS2A 2JBPA 4NK9A 4IX3A 2GSFA 1V0BA 2XNGA 5J1WA 2UW9A 5CEIA 5IH4A 3FQSA 3SOCA 1PMVA 3R1NA 4JS8A 3PTGA 5HTCA 5FP6A 4I1ZA 3SXSA 4Y8DA 5A14A 4WSYA 2W05A 3OWLA 3W2OA 1Q41A 4BGQA 4UV0A 4WG5A 1W84A 1PKGA 4BRXA 3ORKA 1IRKA 3D2KA 3PVWA 4M0ZA 3PJ8A 5K3YA 1H1PA 3OUNB 4USDA 2YAKA 4FSQA 2EXMA 2HXQA 2PTKA 2QG5A 3HV5A 3K3JA 2R64A 4I3ZA 4MEDA 5CASA 5HIEA 3FQHA 4E5BA 1ATPE 1G8AA 4K33A 3P1AA 1M2QA 2C1BA 1BMKA 2UW7A 4O4BB 4BCKA 3LXNA 4DEBA 4EOSA 2B53A 3B8RA 4K77A 3QTRA 4G5PA 4L42A 2I0YA 4CGAA 1MRVA 4QMXA 4B8LA 4MX9A 4YZDA 3KL8A 4M67A 3EFKA 3MBLA 2HYYA 2C68A 3ORXA 1R0EA 4PPBA 3WOWA 1APME 3NNXA 1LP4A 5CS6A 1WCCA 3DBEA 4UYNA 3RPYA 4AZFA 1J1BA 2CN8A 2G2IA 3A7JA 4NM3A 5E8TA 3VUKA 2BTRA 4FV4A 2BMCA 4QNYA 3NNWA 5AR5A 4E8AA 3QGWA 2EVAA 4KBCA 1YHVA 4UEUA 4FVQA 4C02A 4L52A 4BJJA 4C2WA 5AR3A 3ZZWA 5IA2A 3MVJA 2WMWA 2UZBA 1WBOA 1Q8ZA 4K6ZA 2YABA 3LFDA 4Z9LA 4BDBA 4HZSA 3RJCA 2VX1A 4DGOA 2OZOA 3VUGA 4FKOA 3CY2A 1IEPA 3FUPA 1ZAOA 3LMGA 3NYNA 5FLFA 4IDVA 1IR3A 3R0TA 4N70A 4HVHA 1AQ1A 4CKRA 4L01A 4NIFA 2WOTA 3Q9XA 3DXPA 2FYSA 3F5XA 2BKZA 3UC4A 2O8YA 4M13A 3OY1A 4PDPA 3P08A 4O38A 3E8CA 4EH4A 3TUDA 4D4YA 4DGMA 3VIDA 4L3PA 3PXKA 5CQWA 3POOA 2WQEA 4O0SA 5BNJA 4R7HA 3TZ9A 4O0XA 2VO3A 3L9PA 4G3GA 4GFGA 3THBA 4CFXA 3NUAA 4Z3VA 4APCA 3C13A 4D2PA 4EH7A 3NCGA 3BQCA 3FMDA 2XNEA 3PUPA 3UOJA 3VS3A 5F4NA 3QGYA 1URCA 2Y7JA 1URWA 4DCAA 2QU5A 3P9JA 2B1PA 2J0JA 3KULA 5E8WA 4PQNA 4FSWA 3ITZA 5CVFA 1H0WA 3RM6A 4O2ZA 4CLIA 4HNIA 3QRIA 4DN5A 4TL0A 1H0VA 4Z7HA 5FDPA 3OOMA 1JVPP 4FK3A 5IA5A 2PUNA 1VR2A 3F2NA 1H28A 4J8NA 3WZJA 5BX0A 5JT2A 4FV8A 4IADA 5ETAA 5EDRA 1FOTA 2O3PA 4BIDA 3MB7A 2WTKC 3BU6A 4AW5A 4CV9A 4EOLA 5L8KA 4I93A 4EUUA 4QMLA 4CFWA 3LCSA 2YZLA 3L8XA 4JIKA 3F7ZA 4UMUA 4FF8A 4FYNA 2BRHA 3O8UA 4RBLA 5A46A 2GU8A 3HUBA 5D41A 3BE9A 3TEIA 1WVXA 2HWOA 4IB3A 5GZ8A 2PZPA 4BR3A 1ZOHA 1OGYA 1IG1A 2R3QA 4XJ0A 5IQDA 3V8TA 4S33A 2V5QA 4JL9A 4MNEB 5D11A 5TR6A 2BZJA 4H39A 2W5HA 2WQMA 4CMOA 2PZ5A 3E87A 3EHAA 3HV7A 5EHOA 3EQPA 3VUMA 2UZUE 3C7QA 3Q32A 5HBEA 1R0PA 3QKLA 5CENA 4U9AA 2W5BA 5LXMA 3AC8A 3F7WA 1YWVA 1OUKA 2UW8A 3NIZA 4R5YA 4I0SA 2HOGA 2RIOA 4YZNA 4JX7A 4EBWA 3DJ6A 2ITOA 3PG3A 2VAGA 4ZJVA 4X2KA 2BKKA 4GG7A 5L6PA 3I6WA 5I9VA 4FV3A 2BDJA 3TKHA 3ZFMA 5HQ0A 2V22A 4FVRA 4C2VA 1PMEA 3V5TA 2OXDA 1X8BA 4KWPA 2J4ZA 3MSSA 1ZOEA 4QOXA 5DRBA 3Q4TA 4Z16A 1ZY5A 5KUPA 3GC8A 5CSHA 4S31A 3R7OA 2XKDA 2BZHB 2QO7A 4D58A 3I6UA 2HZ0A 3R1YA 4P7EA 5J7BA 1DAYA 5E1SA 3TV6A 4WHZA 4XP3A 4BDAA 4EHVA 1IA8A 4KS7A 3A8WA 3OT8A 1G5SA 1OL7A 2ONLC 2R4BA 4FT5A 2VGOA 3E7VA 4YZ9A 4YO6A 3H30A 3IW8A 2H9VA 2VTRA 4BTFA 3EWHA 1I44A 2VWZA 3A7IA 1YWNA 4G3EA 4HNFA 4QEBA 2JIIA 3PPZA 3BIZA 4W4WA 4WO5A 2OFUA 4FIIA 3Q60A 4L7SA 4YZBA 4DGGA 5BVNA 4FE2A 2PHKA 3WZKA 3L9NA 3ALOA 4M97A 4F78A 4XEYA 3ZM9A 3TTJA 4O81A 3K5VA 4FOBA 5GZ9A 3UVPA 3FWQA 4HGEA 3PRIA 3DS6A 3W0PA 3FXZA 1M2RA 3GCSA 1PXLA 5AP4A 3HMNA 4A9UA 3DV3A 2HWPA 4N6YA 1W2CA 2JD5A 3H4JA 3ELJA 4QP1A 4LRJA 4XRLA 5EYKA 2CNQA 4U81A 3OFMA 2YCRA 4GJ2A 4FIEA 5CZHA 5IQEA 3BKBA 2VRXA 3AD6A 5E7RA 2C0OA 1UU9A 4NCTA 2VWIA 2F7EE 3CTJA 3U87A 4PTEA 4AFJA 4FL1A 5DT4A 1OPJA 4MQ2A 2JC6A 3TKIA 3O71A 3E92A 4Q5HA 2R3FA 3MY0A 4LUDA 2JFMA 4DLJA 1KE9A 3EN5A 4R8QA 4YJOA 3U6HA 4FVPA 3BYUA 2RFDA 3R9HA 1UU7A 2WD1A 3IDCA 4X21A 2WMUA 4FSMA 3BHVA 2OF4A 1WBWA 4UZDA 5DIAA 2ZDTA 3CLYA 4PP9A 4TNDA 4X3JA 4ZSEA 2UW5A 4AA5A 3L9LA 5J1VA 3EZVA 4MH7A 4EJ7A 5C4LA 3HP5A 5M4CA 2PMOX 1MQ4A 3PPKA 2QOOA 4I5HA 4TWOA 5JEBA 1HCKA 4HW7A 3E7OA 1LPUA 3CQEA 3DTWA 3VJNA 5EYCA 3PP1A 5KHWA 4JBPA 3MDYA 3Q96A 4XYFA 4AXCA 1ZZLA 4QMTA 4RFMA 2FUMA 5H8EA 2O63A 5HBHA 3VN9A 4E73A 5IU2A 4EZ3A 1OIQA 4KKHA 4MXCA 4AZSA 4DTKA 4R7BA 4BDFA 3QLFA 5A3XA 4HGLA 3LIJA 1YW2A 4AGWA 3G5DA 5LVLA 2ITYA 5IH5A 2UW4A 4N6ZA 4YJUA 2B55A 4QP9A 5AMNA 3V6RA 4RC2A 5BVEA 4H1MA 4FTQA 3I0QA 3F2AA 4EQUA 4ID7A 1U46A 3VUDA 4AFEA 2BFXA 4A4OA 1PJKA 4C4JA 4V0GA 2O2UA 4TPTA 5CSPA 3MIYA 2XIKA 1TQMA 3F2RA 1YI6A 3MJ2A 1H25A 4A4XA 2YCSA 2XMYA 3W1FA 2OH4A 1WBPA 2QD9A 4WG4A 5L2SA 3SG9A 2RSVA 4C58A 2X8DA 3HZTA 3KXXA 4II5A 4ZZMA 3HKOA 3DB6A 3DOGA 3KRXA 1HOWA 5HVYA 4IM2A 4C34A 4MKCA 5CZIA 4O2PA 3RALA 2J9MA 4YUQA 5CYIA 3FLSA 2NRYA 3NAXA 4KD1A 2YACA 4LV5A 3NFGB 1WAKA 2OIQA 3IW4A 2VTIA 3H3CA 1BLXA 3TNHA 2KULA 4CRSA 4MXXA 3UVRA 3UC3A 3FQEA 3CBLA 3FMHA 4AUAA 1R78A 5H3QA 5E8UA 4C4EA 3H9OA 4E5WA 3SVVA 1JKTA 2IVUA 3B2WA 4S34A 1JPAA 2YIRA 5KO1A 2WTKB 5L8LA 2Y9QA 3QKKA 5FXRA 4RJ4A 2ESMA 3TZMA 2A98A 3G0FA 1W8CA 4BKYA 4EJNA 4NM7A 4DEEA 4RIWB 5HU9A 3D0EA 3DBFA 3VBTA 4LYNA 3KVXA 3AT2A 2G01A 4EOMA 4P5ZA 4H58A 3PP0A 2QOIA 4FGBA 4TYIA 4ZS0A 5HCZA 4AAAA 4F7LA 3TI1A 3D2IA 3EQDA 3VC4A 2BROA 3MH1A 3DJ7A 3SW4A 4NKAA 4PMMA 3R73A 4CNHA 4ZTNA 4CRLA 2IG7A 3ALNA 5L2IA 3IKAA 5HVJA 5BYLA 3I5NA 4G16A 5M55A 3SLSA 1GIJA 3QALE 5AA8A 5K4JA 2YFXA 2C5OA 5E91A 1W2FA 5T6KA 5AUUA 3ANRA 4BCMA 2W99B 2XNNA 2QOKA 3LAUA 3UPZA 1DI8A 2XP2A 3IOKA 4O7LA 3AKJA 1CDKA 4YURA 4K11A 5DI1A 4CMUA 2BFYA 3FLNC 4FZAB 2WB8A 2YCFA 3QQLA 2BALA 4WOVA 3VWAA 2C5NA 3QU0A 4K9YA 2BHEA 2CHLA 3Q6UA 4CG9A 4IZAA 3EQRA 4EWHA 3CJGA 4EYMA 4DT8A 3AC3A 1PMNA 3AC1A 2XK6A 2QCSA 2VO7A 4XLVA 4KRDA 5DGZA 2X7OA 5EM8A 3T9IA 3QTUA 5HIDA 4N4SA 2XIRA 3NSZA 2YIWA 4MF1A 4ERKA 4K1BA 3ORTA 2C6MA 5C03A 3KQ7A 2Q0NA 3F66A 4FTTA 2R7BA 2YCQA 1O6LA 4GIIA 3I7CA 4G6OA 4XOYA 5CAQA 1VJYA 3DA6A 2NNWB 5IQGA 5ANGA 1OL6A 4O0RA 2ZVAA 3FLWA 3ENHA 4YLKA 2B0QA 3K3IA 2P2HA 4I6QA 5E8VA 4J97A 4DDGA 4FEQA 5ETIA 4UX9A 2GTMA 1ZMVA 3B2TA 5AR8A 5KMIA 3TKUA 4MYGA 2X2LA 3ATTA 2XNBA 4RLKA 3ZRLA 4A9TA 4BWXA 3SQQA 5E1EA 5CEPA 1XMLA 4ZTRA 1J3HA 2ERKA 5E4HA 4KA3A 3LCTA 1K3AA 2B9FA 5LVOA 2IPXA 5LVMA 2A27A 1U59A 2XEZA 2BZIB 5EQPA 5HCYA 2VTAA 1PXNA 4CV8A 3BHTA 3N51A 3PXFA 5ICPA 5LARA 4OR5A 5JFWA 5LMKA 3ZUUA 2V55A 1NVSA 1JSTA 3FMNA 4LGDA 3Q6WA 4M7IA 3PSDA 3QZGA 3R7YA 4D2SA 4EH9A 5EM6A 3CTQA 3LJ0A 3QD2B 5LWNA 3W0OA 5HZNA 5AV3A 3ZBXA 4TNBA 5G6VA 5EQYA 2WKMA 5DR2A 4HZRA 4ZJJA 2VTTA 4A07A 4PX6A 2ZB1A 2P4IA 4E4MA 3EN4A 4AGUA 2R7IA 2OW3A 3F88A 2JIVA 3W32A 4H3QA 2XKCA 3DZOA 4FTCA 5HO7A 3MYGA 3R8MA 4MCVA 1JSUA 5C9CA 4FUXA 5EI2A 1CKPA 3GT8A 3L8PA 4C38A 3NVMB 3NFFB 4XG8A 3R7VA 1P4FA 4EL9A 5K5NA 4OT6A 5KMNA 1MP8A 1ZRZA 1H27A 4RT7A 4D4SA 1A48A 3H9RA 4JXFA 5FXQA 3F3VA 3R30A 3FPMA 4I6HA 4YBJA 5FQDC 3EQCA 1J1CA 2JDVA 4CTBA 4U3ZA 4R6VA 1YDTE 1Q8UA 2VWXA 3CKWA 3KVWA 2YDKA 2VTMA 3R9DA 2UZNA 1YDSE 2E9PA 3TACA 5DOSA 3TYKA 3NEWA 4O0WA 4MWIA 4YHFA 4RIXB 4RGJA 2VNWA 5CXHA 1G8KA 2ITNA 3QRUA 3H0ZA 3R9OA 1FQ1B 5EDQA 4BL1A 3WI6A 4OAVB 2OFVA 3LW0A 2WOUA 2RG5A 2C5XA 4O21A 4XOZA 4DG0E 4ZTSA 1CM8A 4G2FA 4JDIA 4BDDA 5IEYA 3QTIA 4J96A 4QMYA 3VULA 2G1TA 4I92A 4IZYA 5AP0A 3ZLSA 3R28A 4IJPA 5AUVA 1NT2A 5C01A 4F9BA 2W17A 4HYSA 4WNOA 4BCIA 1UU8A 1GZNA 1B39A 3EFLA 3WIKA 2WTCA 2X4FA 3PYYA 3HMPA 4ZTHA 3OBJA 2BCJA 3HDNA 4HPUE 5I9UA 5D12A 5CEOA 5DNRA 4FUYA 4IVDA 5L4QA 5DEWA 3BBTB 2ONLA 2HZNA 2Z7QA 2A19B 4RA4A 2AQXA 2W96B 2GPHA 3JYAA 3ZHPC 3EL7A 4DEHA 2XYNA 4U97A 1JLUE 3BU5A 1P5EA 4FV2A 5AIRA 5FTOA 2X39A 4F9YA 1B6CB 2C5YA 3QYWA 2JAVA 3ZS5A 4O7RA 5AFVA 5GNKA 4HVGA 2OJ9A 3PVUA 5EFQA 2YJSA 5AP2A 2ITUA 3CGOA 4AW2A 3CR0A 3JVSA 3ULZA 5F1ZA 4BCJA 2QOLA 4ARKA 3FI8A 4MUQA 3UG2A 4FSRA 4KRCA 3MFTA 2PU8A 5CLPA 1JKLA 3OCSA 1TVOA 4MWHA 4FTLA 3D7ZA 4QYFA 2WMBA 3D94A 4EK6A 3UGCA 5L2TA 4BFMA 5HICA 2WMRA 2CNUA 3LCKA 3BV2A 3U8WA 3DKFA 3TIZA 2OU7A 4CVAA 3ZDIA 5J95A 4X2GA 1PKDA 4XRJA 3UMWA 2CDZA 4TY1A 3OHTA 4HVDA 3QCQA 3Q5ZA 3QQUA 4U7ZA 3IG7A 2YM5A 3IDBA 4CXAA 4XLIA 3OCTA 4WNPA 4LFIA 2OZAA 4F9CA 3LMIA 4GT5A 5B0XA 1PF8A 3DK6A 2C6TA 3V6SA 4YTCA 5FTGA 4ASXA 1AD5A 5B2MA 4NCTC 2Q83A 3F5GA 2XJ1A 4O4CA 5AM7A 3VBVA 4EOJA 1KUTA 2UZVA 2C0IA 3ZCLA 5AR4A 2VZ6A 2OXYA 3VUHA 2B9IA 2G15A 2V7OA 2YIXA 4P5QA 4ERWA 4W9XA 3EB0A 4EOIA 4QNAA 3KXZA 3VS7A 4WA9A 4FG8A 3MA3A 4O84A 5HNGA 2GTNA 4RX9A 4M8TA 3R2BA 2VTSA 5ANJA 5JQ5A 4O82A 3NUXA 1BUHA 4FIHA 4R78A 1OBDA 3I1AA 3GCUA 2PMIA 3TV4A 3F3TA 5CI6A 3GC7A 4X2NA 4Y83A 3R2YA 4CFNA 4AZTA 1QL6A 5BVFA 1QPDA 3O8PA 2HIWA 2CKOA 2R3HA 3BHYA 4EK5A 1JKSA 5IDNA 2NYAA 4IVAA 3UO5A 4QP3A 2R3IA 2IW9A 4RIOA 4EORA 2CKEA 2QOFA 2XARA 4R3PA 4QYGA 5AUZA 2OIDA 4FKVA 2RKUA 4F0FA 5CU2A 4PNKA 4DAWA 2YERA 3AGLA 3T3VA 3EIDA 3W55A 4NWMA 5LVNA 1FGKA 5DG5A 3PWYA 2X2KA 3GEQA 5K9IA 1QPCA 2WFYA 1XH4A 2J51A 1UA2A 3DJ5A 1UVRA 4FKWA 4U40A 1QMZA 3KCKA 3HV3A 3VF9A 3CIKA 5EW8A 2ZV9A 3QZFA 2Y6MA 4ITJA 2C6LA 3PXQA 4FIFA 3VF8A 1YKRA 4FIJA 5FEQA 4BZOA 5KMOA 1EH4A 5HESA 4LMUA 3ZONA 1XH9A 4XV9A 2XNPA 4LGGA 5F94A 4A7CA 3QA0A 3WZEA 3RWPA 4TZRA 3O8TA 4NM5A 3V5QA 4F9WA 5EYDA 2YISA 3SGCA 4ANQA 4TYGA 3COMA 2YITA 4UWBA 3C5IA 2ITVA 2BIKB 4ACHA 4NH1A 2NPQA 4J99A 3NUSA 4IWOA 5GJDA 4F4PA 5FUTA 4KNBA 3VNTA 2ZDUA 1TKIA 2QI8A 4GIHA 4L44A 1XH7A 3OTVA 2PUIA 4FI1A 4DINA 3C0HA 1U54A 3ET7A 5AUTA 2BRGA 4Y95A 3SA0A 1O6YA 3AGMA 4PWNA 3EN7A 5TKDA 2ZYBA 2JKOA 4LQMA 2XJ0A 3KRLA 3LJ1A 2C6DA 5HGIA 3D5VA 3CEKA 4FTIA 1BYGA 1RDQE 3BRBA 4BCQA 3BV3A 4KIKB 2VTJA 3PFYA 2YLFA 4J98A 5DMZA 4G6NA 3W16A 5C27A 4ZSJA 3GB2A 3QUEA 4YBKA 5FTQA 2VWWA 3DKCA 1U5RA 4C57A 4C37A 4IC8A 3UNZA 1YDRE 3D5UA 4UALA 4GRBA 4FODA 4NZWB 2Y4IC 4QP7A 2XRUA 4TYEA 3UDBA 3VBWA 5HNBA 5A9UA 1OGUA 2Z7LA 5B7VA 3HAVA 4RIYB 2WMQA 5EYMA 4YPDA 4IAKA 5ETFA 4KBKA 4ENXA 4NYEA 3GUBA 3EFWA 4BDEA 4B8MA