4WRGA

1.9 angstrom structure of egfr kinase domain
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
289
Chain Sequence
AMGEAPNQALLRILKETEFKKIKVLGTVYKGLWIPEGEKVKIPVAIKESPKNKEILDEAYVMASVDNPHVCRLLGICLTSVQLITQLMPFGLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title 1.9 angstrom structure of EGFR kinase domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 289
sequence length 326
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wrgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wrgA01
4FUXA 2WU6A 4DEAA 4F0IA 2OZOA 3EQCA 5EH0A 4MBIA 3ZMMA 4C4JA 2ETRA 2W17A 2OKRA 2C6LA 1BI7A 1ZLTA 2C6DA 1KWPA 3QRTA 4L52A 2XK6A 4UN0C 1K3AA 4GK4A 4BWKA 4AW5A 5L6OA 2JDVA 3CD3A 3GBZA 2CGWA 3GI3A 3RP9A 1OIRA 4D9TA 4NKSA 4LOQA 3O8PA 3VUHA 3OC1A 3TNWA 4RIXB 3EFLA 2XNOA 2VX3A 4M84A 1MUOA 3PVBA 2JIUA 3WBLA 3F66A 3SOAA 3PE2A 2WFYA 4YJSA 3BZ3A 4AT3A 3PZEA 4U44A 2VGPA 4DHFA 3TV4A 2XH5A 2YCRA 1OMWA 2C6EA 2FA2A 2QLUA 1E9HA 4X2KA 2ZV7A 5BVNA 4O83A 1NY3A 5LVPA 3R8UA 4Z55A 4WO5A 4LMNA 4C34A 4L44A 4RA5A 4H1JA 3V3VA 3VIDA 3Q9ZA 2PSQA 2WO6A 2XS0A 5IF1A 3DBCA 1H0VA 4FKUA 3TEIA 2G9XA 4IAFA 5ANEA 5K3YA 1U59A 4ZZMA 2R9SA 2AUHA 3FMDA 1WVYA 4G6NA 4BCGA 4FSQA 2PHKA 5ANOA 5AA9A 2JC6A 3QA8A 4Y5HA 3BYUA 1PRYA 4I5MA 3W33A 4E4XA 5IQBA 2BIYA 5J7HA 3IW4A 2CNUA 5IQCA 3TNIA 3QQJA 2XIKA 3SLSA 5D7AA 2QD9A 4KIPA 4D2RA 5IG1A 2VO6A 3PY1A 2WPAA 4PL3A 4U97A 5CZHA 3TNPC 3R1NA 4A4XA 3WIGA 4D5HA 1XO2B 5CENA 4D2WA 4EHGA 4P4CA 3QTQA 1OL2A 2VNYA 5DPVA 1ND4A 1VEBA 4IVAA 4ITHA 4OLIA 4F08A 3KN5A 4F65A 3PXFA 1JNKA 4FKIA 4RQKA 3RM7A 3QKLA 3E8NA 3EN5A 3C4XA 3RHXA 1F0QA 1YHSA 5DRBA 4EHZA 5JMSA 5F1ZA 1ATPE 3WIKA 4DINA 4ID7A 4MHAA 4HVDA 2WXVA 2V0DA 3MA3A 4LUEA 2YM4A 3JVSA 1Y6AA 1PXKA 3FMKA 3S3IA 4ZSGA 2W9FB 2GFSA 5J9ZA 5M4CA 1XBBA 5KX8A 2REIA 4CFWA 4RFMA 2QR7A 2C6IA 1VR2A 2VU3A 2PUPA 3AD6A 4NCTA 3IDCA 2XRWA 3G90X 3DJ6A 3VS5A 3G6GA 3MY1A 4CTCA 3VS0A 3RMFA 3F3WA 3ZH8A 3NCZA 4F1OA 4YZCA 1W0XC 4TWOA 2XIZA 4BGQA 4RIWB 3IW7A 3NAYA 2JAVA 5HEZA 4FICA 3NYNA 3CTJA 3DQXA 2BRMA 3EN7A 5F9EA 2BDWA 4EH7A 2Z02A 2NP8A 2VWBA 5JQ8A 3MPMA 5M06A 4IC7A 4EBVA 4CMTA 3GCQA 4EONA 5HO7A 4EOKA 2KULA 3GC7A 4RPVA 4RLKA 1ZYJA 2PVJA 4OBOA 4QTAA 3P86A 4WG4A 5T3QA 3TTIA 4AA0A 5AP7A 2NNWB 5I4NA 1MRVA 2F4JA 2GFCA 2VWUA 4XOZA 5HG5A 3POOA 4I0TA 3TZ9A 1WBTA 3BE9A 4U3ZA 4WBBB 4LV5A 5KO1A 4MNEB 5CYIA 1RJBA 3AC4A 5BMMA 3ALOA 4ZLYA 1A06A 3ZU7A 4Y72A 5CANA 4RX9A 4EJNA 2O3PA 4M66A 4USFA 3FI8A 3F61A 2W4OA 3DAKA 4O6LA 4G3CA 2JBOA 3EFJA 2Y4IC 1ZOEA 2WMWA 2ITUA 3ORKA 2C0TA 3PG3A 4H3PA 4RWKA 5FD2A 5C26A 3L9NA 1V0PA 4QP2A 4CFNA 2YABA 2XK3A 2WQBA 4FTAA 2XKDA 3QWJA 3W2RA 5CALA 4TYHA 4ACMA 3LXNA 4PP7A 4GCJA 4DEBA 5IZFA 5H2UA 2HK5A 3BLHA 1A9UA 2X1NA 2X8EA 5CVHA 5FLFA 3FZOA 3ZO3A 3MA6A 4ITJA 3ZXZA 4AGUA 4AW2A 4JBQA 5LJJA 2IG7A 2R3GA 4ZEGA 2XEYA 2W99B 2OJ9A 3QGWA 4BDCA 2IZUA 3V5LA 4R8QA 3ORPA 1Y8GA 2GMXA 3BLRA 1PKGA 5BQ0A 2HWOA 3EN4A 3DK3A 4H3BA 1XQZA 4JDIA 4KBAA 2ZM1A 2R3OA 2IVVA 3CC6A 3C4WA 4KNBA 4ANOA 2UV2A 2BRBA 4RIOA 3VO3A 5IQFA 4YZBA 2JIIA 2VTNA 3D5WA 4PMTA 5KMIA 3A62A 3DKOA 3WF7A 3BWJA 4U81A 4ALUA 4KABA 3PIXA 4O1PA 4R7HA 5CI7A 5HE0A 5CF6A 5HBJA 4FVPA 3NVMB 4O84A 4BFMA 4F7NA 3NR9A 1NT2A 3F3UA 4IVCA 3R00A 3RK7A 4EOQA 4R1VA 3ELJA 4C4EA 4OTDA 2FO0A 5TE0A 2ZOQA 1E1XA 4CRSA 4OBPA 1XBCA 1GNGA 1UNLA 3BIZA 1YXXA 4GW8A 4YZ9A 3R22A 2FSOX 5IA1A 1Z5MA 1ZWSA 4YHTA 4E4MA 5FTGA 2Z7SA 4M8TA 2R3FA 3DK7A 3HV7A 3MN3A 4O7WA 4FKRA 3NUNA 3QX2A 4OTHA 2B54A 2CN8A 3WZJA 4DEGA 3LJ2A 3IW5A 4FEXA 4DFUA 3QX4A 1BX6A 4L6QA 3BYVA 4Y5QA 3S4QA 3UVRA 2XUUA 3UQGA 1K9AA 4YTIA 3E8EA 5M51A 3O17A 5AR7A 5E9EA 4ZS0A 2CGXA 3R9DA 3HAVA 3DV3A 3O7LB 2X7GA 4JG7A 5EDQA 5JFSA 2C69A 1SVHA 2VTSA 4IZYA 1V0BA 3D0EA 3VS7A 4Y85A 2OXDA 2RGPA 3V5QA 3DBFA 4ENYA 4EOJA 5I3OA 3BYOA 4TWCA 3TL8A 5GIPE 4HPUE 3R8LA 4DH7A 5GZ9A 3GU5A 4MNFA 4IJPA 4G9RA 2VWWA 2PMIA 4LL0A 5KNJA 4KIOA 3EN9A 3QTWA 4Q9ZA 4W4WA 4FTUA 4QPAA 3TT0A 4GJ2A 2YCQA 4L7FA 3Q6UA 2ZDTA 5ACKA 3ZUVA 4N6ZA 4GUBA 4JRNA 3UOKA 1BYGA 1P4FA 3UIUA 4BF2A 3RVGA 1NVSA 1FMOE 3P7AA 4DITA 4C02A 4ZMFA 3E92A 3G0FA 1OI9A 3ORXA 3VS6A 3W2QA 3DNEA 4C4GA 3SC1A 4FVRA 4HGLA 3FZPA 4PY1A 4FTNA 4QP4A 4G17A 4FV6A 2QONA 3KMMA 4H58A 5CSWA 4DFXE 3RAHA 4RQVA 2BR1A 3TJCA 5TKDA 4D4RA 4CMOA 4D2VA 3POZA 3FMMA 3PIZA 4HCUA 4FIIA 3ERKA 1XH4A 3DA6A 1FPUA 2JKOA 4JQEA 5IUGA 4K9YA 3AQVA 4BICA 5I9XA 4RZWA 4NZWB 2O2UA 2OXXA 2HY0A 3ZHPC 2GS7A 4KKGA 4D28A 4GG5A 4QMYA 4BIDA 3TUCA 2R7BA 3CR0A 4IHPA 4ENXA 4U5JA 4BN1A 1GIIA 1Y91A 4KB8A 2QO9A 3ZXTA 4AT4A 4DBXA 2G2HA 3QYWA 4X3JA 3SGCA 1FVTA 5IQGA 3W55A 4WSYA 5AM7A 2JDOA 4FKSA 4BY9E 3VN9A 3O8UA 2AC3A 4JOAA 4CSVA 3QWKA 4CYJA 3GNIB 2YCFA 2OO8X 3DBEA 3MH3A 4GS6A 3F7WA 4CG8A 2C0OA 3LFEA 2I6LA 2UZUE 1RDQE 4I41A 5AIRA 3L9PA 4ZTQA 3Q53A 4H05A 3IOPA 4O0UA 3SXRA 3I60A 5EDPA 4AFEA 3UG1A 4LGDA 5FM3A 4APPA 3AD4A 5L8LA 3TKHA 1GZOA 4C8BA 2PZIA 4FKQA 3TZMA 3KCFA 4TL0A 2YIYA 4FX3A 5IISA 3OCBA 4OTPA 3OWLA 4TYIA 5G1XA 4C7TA 4EZ5A 2JBPA 2CLQA 1CKIA 4LRJA 5HICA 1ERKA 1ZMVA 4BZNA 3NLBA 5ANGA 3FEGA 3FMEA 3QUPA 5JSMA 3LFDA 3D83A 4KIKA 5CLPA 1Z57A 4O0TA 4GMYA 1KE7A 3FMJA 3WZDA 1JKLA 2XEZA 1IA8A 4F0GA 2C5NA 2YN8A 5CSXA 3QHWA 3FMHA 5D12A 5B2KA 5CAQA 1JOWB 4CKRA 2XNPA 4QYYA 5LCJA 4U45A 4EH3A 3EIDA 4QNAA 2Q0BA 4FYOA 3GC8A 5HLNA 4TYHB 4J53A 1H4LA 2RFSA 3A60A 3LM0A 5E8VA 1W84A 5J1VA 3DFCB 4W4VA 1NA7A 3LLAA 3EQBA 4U43A 1Q8ZA 2WMXA 4IZ5A 1ZMUA 2OXYA 3ANQA 2J0JA 3SQQA 4R3PA 2VD5A 2BZKB 2E9UA 2OK1A 1ZOHA 5KBQA 3SHEA 1K2PA 4RA4A 4X3FC 4E1ZA 4XLIA 4ZJVA 3QQHA 2XP2A 4RSSA 3MPAA 3NDMA 2UVXA 1EH4A 4DEIA 1YHWA 4PTGA 4HW7A 4JR3A 5CAPA 3OW4A 3R02A 5BVWA 2QOIA 4XCUA 1APME 3Q3BA 4FIJA 2UVYA 4BKYA 3FJQE 3VBQA 2AC5A 4E5BA 4FZ6A 4EK8A 2EXMA 5T68A 2DQ7X 4IZAA 4BKJA 5EK7A 4DLIA 5DFPA 4UWBA 3WI6A 2SRCA 5A54A 3H9FA 3WILA 4D2TA 3IW6A 4H3QA 4NSTA 3F5GA 1HCKA 2JIVA 3QL8A 4R78A 4ZJIA 4IFCA 5DH3A 3O23A 2PVFA 3OTVA 5HI2A 2R0UA 1H00A 4IW0A 2W0JA 1PXLA 5EG3A 5HIDA 2VV9A 4EQUA 2BDFA 3VHEA 2G2IA 4BDBA 3C13A 3FUPA 2BZIB 2QOFA 4BDHA 1WCCA 1M14A 4IJ9A 3OW3A 2PE0A 5DWRA 5J9YA 1WVXA 2R2PA 5HO6A 4AGDA 4ANSA 5JRQA 2UZVA 2ONLC 2XNGA 4IM3A 5GNKA 4AG8A 4QOXA 2VWXA 3MVLA 3ATSA 3U6HA 1DM2A 4FT0A 3VC4A 4Y73A 3R9OA 4FI1A 2FVDA 2ZYBA 1WBWA 1L3RE 3AMAA 3FV8A 5I5ZA 4YJTA 3SD0A 4JIAA 4PMSA 5FXQA 4ERWA 4NIFA 5LMKC 5DT4A 2XZSA 4BGGA 1F3MC 1UWJA 2OF4A 5HNIX 3OBJA 2Q0NA 2VZ6A 3RPSA 5BVOA 4FTTA 2B55A 2I0HA 4LRKA 2NPQA 3EKKA 2WIHA 4FTJA 4C38A 2QLQA 3ET7A 3R0TA 3QCYA 1QCFA 5DVRA 2GS2A 4ZY5A 1NW1A 2RG6A 3F5XA 3G51A 4ARKA 2QOKA 3H10A 1H1QA 4ZIMA 3EQFA 5E1EA 4D1SA 3NYXA 4V0GB 3NEWA 3OCSA 1OBGA 1J1BA 3LMGA 1YI4A 4FG9A 2JAMA 4O7NA 1R0EA 4C35A 4F9AA 5AR5A 4WNKA 3SG9A 3QKKA 1FVRA 1AGWA 2UW5A 4ZTNA 5HOAA 2XBJA 2WMAA 3LIJA 3SKCA 1PMUA 2XMYA 5FUTA 4FTRA 4BHNA 5TT7A 4EH2A 3BEGA 5A46A 1OIQA 4RX5A 4RIXA 2GNIA 2CKPA 1BKXA 3TN8A 5AADA 1XJDA 1Q62A 2YDKA 3PDTA 4HGTA 3RNIA 4FV4A 3DOGA 4EKKA 4F4PA 2BAJA 1OKVA 1SZMA 3HNGA 4IB5A 3VUTA 4CLIA 4QYEA 2Z7LA 4EOMA 1ZYCA 5K9IA 1VZOA 3F2AA 3D14A 2BUJA 4KBCA 5AUWA 2A4LA 2PVMA 2GNHA 4ZS4A 5ANKA 4DTKA 4DG0E 4RWLA 3DB8A 3D94A 2GTMA 5CT0A 5HD7A 3QD3A 3E93A 3C0HA 2X9EA 2J9MA 3KA0A 3ZM4A 5KMKA 3FSFA 4YLJA 3GU8A 5DIAA 4K8AA 3R63A 5C8KA 4YR8A 2WZJA 5EM7A 4FL3A 5M57A 4EYJA 4DTAA 3P0MA 4XG3A 2YIWA 4LGHA 3MY0A 4CZUA 2XKEA 4FG8A 2G2FA 4NT4A 3RKBA 4W4YA 4J71A 4FTLA 4JT3A 3UTOA 5I0BA 4FZAB 3QZGA 3QTXA 3NUYA 4X2FA 1YOLA 3C0IA 2B9FA 3DAJA 3DLSA 3H0YA 3DDQA 3QA0A 1M2RA 3RGFA 2EB2A 3L1SA 2VTIA 2J50A 4WRGA 5EHOA 2ZB1A 3R21A 4LFIA 4TYEA 5I9YA 3CBLA 1U5QA 1YHVA 3MIYA 4JRVA 4ZTSA 3TV7A 4NM3A 3RZFA 3VBWA 4BCFA 3MI9A 3UMWA 3OUKA 3QC4A 4AZTA 4FSZA 5CU2A 4AU8A 2C3KA 4RBLA 3Q9WA 3ETAA 2BAKA 5EM6A 4YTFA 5D11A 3TIZA 4RJ4A 2WOTA 5FWKK 2VX0A 4D4SA 3EN6A 4WIHA 4EC9A 2CJMA 4AWIA 3LFNA 1XBAA 1UNHA 1XH6A 3QQGA 4GRBA 3KVWA 3OD6X 2ZAZA 2C3IB 3HRFA 5HTCA 3R7YA 4PMMA 4RIWA 3GVUA 3ORLA 1CMKE 2VAGA 3FPMA 3UGCA 4D0XA 4QMNA 5A6OA 3THBA 4AW1A 1PYXA 3U6IA 4QMZA 3BBWA 2PY3A 3EOCA 3JXWA 5FM2A 4EOIA 4HGSA 5AMNA 2BZJA 3BI6A 1R0PA 3O51A 4O22A 4CCBA 4IX4A 5BUIA 4EZ3A 3MVJA 2BDJA 5EW9A 4XG4A 3LCTA 4EYMA 3HL7A 3ZOSA 3BCEA 4Z3VA 3PE1A 4XBUA 1JVPP 4MNEA 2YIRA 4O27B 4IH8A 5AX9A 2DWBA 4WG5A 3UE4A 4B8MA 3E3PA 4NJ3A 4AACA 4R6VA 5CU3A 3F88A 4Z9LA 3AC3A 4G3FA 4FNYA 4MWHA 3V8TA 3UNZA 2BALA 2RF9A 3VW8A 4ERKA 4EKLA 3HGKA 4QTCA 4QYGA 3U54A 2BTRA 3HMOA 4X7QA 2J0KA 5KZ0A 4BBFA 4YBKA 4AS0A 3UMXA 2BIKB 4ZTRA 4DGGA 2VTHA 2QC6A 2NRUA 3I0OA 2YM8A 5CY3A 3COHA 2Y0AA 1BMKA 2X6EA 3COMA 3A7HA 1I09A 2YM3A 4C33A 4L7SA 4DAWA 3GCUA 3ZO2A 1BUHA 1H25A 3C4CA 2YEXA 1UA2A 3PA3A 3EQRA 5BUJA 4YMJA 2PE2A 2WU7A 1NVRA 4ALWA 1F5QA 2Z2WA 1YWRA 1PXJA 5HCZA 4DH1A 5HLPA 4FSWA 2QU6A 2ITNA 5M4UA 1M2QA 5HE1A 3MVMA 4JDKA 5L6WL 3D5XA 1ZYDA 1G5SA 2A2AA 3DDPA 3IS5A 4E7WA 3FY0A 3RPRA 4M0ZA 4QQJA 5K4JA 2WQNA 3QTZA 4WG3A 4USEA 2GHMA 3MFRA 4DGMA 3KULA 1FGKA 3P7CA 4YP8A 4TNDA 2QHMA 4GYIA 4L00A 2V7OA 3CQUA 3FL4A 1U4DA 3AGLA 2F7XE 3HYHA 3LFFA 3S95A 3GFWA 3KL8A 4G2FA 4FTIA 1MQ4A 3U87A 4CMUA 1Q8WA 4DFBA 1G3NA 5F94A 2CHLA 3P9JA 3E88A 4XYFA 2PVHA 2B0QA 5DR6A 4FEUA 4TKSA 5KMNA 1UWHA 3VHKA 5DG5A 3I5ZA 4BYIA 1FVVA 2PMOX 4BWXA 4ZAUA 1J91A 3AGMA 3QRKA 3E87A 1WBNA 4QMUA 4TRLA 5B0XA 2HWPA 4E73A 3H9OA 4OW8A 4FKGA 3WE4A 4AF3A 3VF9A 4EK5A 4ZTHA 3IW8A 3LQ8A 4HCVA 4RVMA 4RJ8A 5D41A 2I0YA 4CCUA 2C6KA 3KVXA 1DAWA 3OF0A 3R73A 5FP6A 2VRXA 3OWPA 5IA3A 4O0YA 4HYSA 4H39A 3I7CA 4FEVA 1OBDA 5CT7A 4BYJA 2B52A 3DAEA 2ITPA 1OECA 4JNWA 4K11A 4IM0A 2W1DA 3OOGA 4RWJA 5ETAA 2Y4PA 4AOTA 3VJOA 1UV5A 4WUAA 2QOBA 3OCGA 3V51A 4ACCA 3A4PA 2OJJA 1J1CA 4XNEA 3UO6A 4L42A 3HP2A 4NW5A 3A99A 3F9NA 4IXPA 2WTKC 5DHJA 4PMPA 4GL9A 5ETIA 3VQUA 3BWFA 2OIQA 4D4VA 4PNKA 3EWHA 2YIXA 3F6XA 3HV6A 3RZBA 2ITXA 3CD8A 3UYTA 3BV3A 2WQMA 3DS6A 1XH5A 4F0FA 2B1PA 2YM6A 5HE3A 3D7TB 3UJGA 1RQQA 4U9AA 3LCOA 3PTGA 5IQDA 3SW4A 5LOHA 4RIYB 2ZJWA 3W8QA 4YNEA 3RNYA 4I3ZA 4QMLA 4D9UA 5ETFA 4L3PA 4PF4A 1UU3A 3UQCA 4LOOA 4CTBA 5KKRC 2J6MA 1H26A 2R3MA 3PY3A 4IC8A 2YJSA 3BHYA 1SYKA 5CEOA 5L2IA 5IQIA 3WARA 3EQIA 5DLSA 4ANBA 3EJ1A 3A61A 5AV3A 1DS5A 2ITOA 5M07A 2CN5A 5H3QA 2RSVA 3IONA 5IH6A 2OLCA 1YI6A 2W1ZA 3NVKI 2OF2A 3OTUA 2R64A 3EH9A 3E7VA 1Y57A 4K77A 3FKLA 1YRPA 4CFVA 4FV9A 4RVKA 3FKNA 4JI9A 5EM5A 4ZOGA 2QCSA 2H34A 4UB7A 3NUXA 4FYNA 5LVMA 3U55A 4M67A 5HBHA 4R3CA 3UIXA 4JX7A 2WTVA 4XLVA 4F6UA 2Q83A 5I9VA 1J7UA 5C03A 1ZYLA 3QC9A 4KAOA 4UYAA 4XV1A 3W2OA 5IA4A 1PMNA 3HA6A 1YQJA 4IQ6A 4V01A 4RX8A 2I0EA 3RHKA 5EQEA 4DE4A 4CNHA 2I1MA 5JQ5A 5HHWA 3F7ZA 4IDTA 3ZDUA 3KF4A 2Y4IB 5AR2A 4LMUA 2W1FA 5ITAA 2B4SB 2YLEA 1FMKA 4CQEA 5BYYA 2YAAA 4C4HA 4FIFA 4O7SA 4UZDA 1HCLA 1GIJA 5CVFA 5HVJA 3RBWA 4AFJA 4BCIA 3CE3A 5EOLA 4N70A 3NW7A 4GFGA 4CD0A 1PF8A 3ZC6A 5FBNC 3UBDA 4ZLZA 5A4TA 4CG9A 4FZFB 4PP9A 4OBQA 4GT4A 3SG8A 3BU6A 3HX4A 2OJFE 5BVKA 5ETCA 3CP9A 3PPJA 3ZCLA 4S33A 4KRDA 3NUUA 5HTBA 3A4OX 3C1XA 4J99A 2QOHA 4KSPA 3E62A 5G6VA 2PE1A 3F3ZA 5I9WA 1SM2A 3I5NA 3WYXA 4AOJA 4ZXTA 2XJ2A 3TIYA 3PPZA 3K3JA 3P4KA 5C9CA 5H8EA 5A6NA 3ZDIA 3U4UA 4IDVA 3DKFA 5IEVA 1KV2A 2CGVA 4KINA 3VUKA 5EHLA 1CKPA 2ERZE 3T8OA 3AMYA 4EJ7A 2VX1A 4FV3A 1J7LA 4IAKA 4RVLA 4XX9A 4EL9A 4GU6A 1M2PA 5FDPA 3R28A 3UO4A 3P7BA 5CNNA 4BCHA 2OGVA 3TM0A 3AC1A 3GC0A 1V0OA 4OT6A 4BKZA 1GJOA 2Z8CA 3PJ1A 3EHAA 1FOTA 4L3LA 3LAUA 3R1YA 3G0EA 1GIHA 2WNTA 4U79A 5BVEA 3Q4ZA 4UMTA 4FTOA 3N4VA 3NUAA 3UC4A 4BCKA 3OEZA 2XJ1A 4YHFA 3BRBA 3O0GA 3HMPA 4FC0A 1KE6A 1ZRZA 2VWZA 5DBXA 3DPKA 4ACHA 1P5EA 3P78A 2OICA 1BL6A 5HTIA 3UOLA 3OCTA 4ANNA 4NFNA 3KULB 4NJDA 4MXYA 2GCDA 4O0SA 4P7EA 3S00A 4UXQA 5E1SA 4G5PA 3ZUTA 1UKIA 4BCMA 4Z7HA 2OI4X 4NEUA 4WRSA 4HZSA 2E2BA 4MQ1A 5AEPA 3LLTA 2GNLA 2I40A 3QRIA 4ACDA 3PZHA 5C4LA 2VWYA 3UP2A 3DGKA 4E26A 2ESMA 1OKYA 3G9NA 4FV2A 1OGUA 3RTPA 1CDKA 2ITWA 4XG8A 3FHRA 2EWAA 3QFVA 4PX6A 3I4BA 4AXAA 3TI1A 3VWAA 5M56A 3NYOA 4IWDA 4ZJJA 4FSRA 2WQEA 3LM5A 4XS2A 5GJFA 2O5KA 5AR8A 1XR1A 4FV5A 5IMEA 3ID6C 4EQCA 4Y8DA 4MD7E 1PXIA 1QL6A 4EK4A 3ZFYA 3FYKX 4IVDA 5AP0A 4GU9A 2G15A 4FIGA 2LAVA 1O6KA 3NRMA 4CFFA 4A9SA 4F09A 4R3RA 2OZAB 3JS2A 5HVYA 1TVOA 4KS7A 1V1KA 3WOWA 1LEWA 3C0GA 4GT5A 4DEEA 3R2YA 4O0WA 4A4LA 3MV5A 4H1MA 5EFQA 1UU7A 2BVAA 4O0VA 5CSHA 2JKQA 3UC3A 3QZHA 1Q3DA 5H8GA 4ZK5A 1U46A 3L9LA 3G15A 2PPQA 2BRNA 4I21A 4RVTA 3JR1A 4YNOA 1ZY5A 4TNBA 4F7LA 4FNXA 2GDOA 3MYGA 3T9IA 3QGYA 4RC3A 4V05A 4MTAA 2XVDA 2JITA 1OL1A 1JKSA 2IJMA 3CCNA 2WEIA 4IBMA 4OGRA 5D1JA 3LFQA 1S9IA 2Y9QA 3FMNA 1VYWA 2JKMA 4O2PA 4CVAA 4W9XA 3R30A 4V0GA 4MBLA 1MQBA 1XH7A 3W10A 2F2CB 3QQLA 3U51A 4QP3A 1PXOA 1FBNA 4GH2A 1WVWA 2XIXA 5B2LA 5DE2A 4JDJA 5IH4A 1IRKA 3ODZX 4O81A 4NFMA 5C4KA 4O7RA 1JKTA 2CMWA 2XCKA 4HZRA 4YJPA 4CKJA 1QPCA 2EXCX 4HNIA 2QOQA 1FGIA 3GOPA 2GPHA 2QQ7A 3TKIA 3ZTXA 3GGFA 4PWNA 3M2WA 5IUHA 4HGEA 3MESA 1YXSA 4XG6A 4CZYB 2QG7A 2ZB0A 1ZOGA 4AZWA 5DA3A 1ZXEA 4DCEA 3KREA 2VUWA 3VQHA 3BYSA 4MXAA 4FKOA 5LXMA 4UMRA 3ZLSA 5LARA 3REPA 4RWIA 3BHTA 3IK3A 4OTGA 3UVQA 3TUBA 5AUTA 3LZBA 3HRBA 3NNXA 3UP7A 3WZKA 1H07A 3Q5IA 4GVJA 4PNIA 4NM7A 3DXQA 2CSNA 4NW6A 4EUUA 4R7BA 3PJCA 4U41A 4G5JA 3ROCA 3HMMA 3VVHA 4RX7A 2WMRA 3D9VA 4J7BA 4LQMA 5B2MA 2CDZA 2XM8A 4YC3A 3SXSA 2C5XA 3CSVA 4YJUA 2CGUA 4PV0A 5DEYA 1PMEA 4I20A 4OAVB 4C59A 3MVHA 2PK9A 3VUIA 3FAAA 2CNQA 4I4EA 1J7IA 2WELA 2FB8A 1NVQA 3MIAA 2OH4A 3DLZA 4XMOA 5AR4A 3CXWA 2QOOA 3BGZA 3MB7A 4TTHB 5LMAA 1YWNA 1JPAA 2CLXA 3ENMA 4TPTA 3VRZA 4EOOA 4BDJA 4FOBA 5EKNA 3I7BA 5I9ZA 3E63A 1LP4A 1LPUA 1KV1A 1UVRA 1BI8A 4BR3A 4O21A 2XNBA 5GINE 4F6WA 2B9HA 2OIDA 5FTOA 5EI6A 5I9UA 4R7IA 2EU9A 4B7TA 2PMLX 3W2SA 3O50A 3QXPA 5E8WA 5HQ0A 4GUEA 1UKHA 1WFCA 3D2KA 4WA9A 5EDRA 5FTQA 2UUEA 3OEFX 3W2CA 3PXZA 5AV1A 2E9PA 4RRVA 2R7IA 3P08A 5FEQA 3R8ZA 4DFZE 5IPJA 4DCAA 3QD4A 4FSYA 3HKOA 4MQ2A 2QKRA 5E8TA 5BVDA 2OFVA 5ACBC 4M12A 4L45A 1CKJA 4MXOA 4YJNA 1O6LA 5CTPA 1QPJA 2GHGA 3UOHA 5K4IA 3I0QA 4JG8A 4EQMA 2YWVA 4DN5A 3COKA 1H24A 4BWPA 2OW3A 3CJFA 3ZSIA 5AV0A 3TG1A 3NAXA 4X2GA 4HYUA 4NCTC 4ALVA 3QLGA 2IW9A 4BDKA 2C5OA 4JBPA 3LQ3A 1GZ8A 2ITQA 4FTKA 3PLAE 2Y8OA 4AP7A 2WD1A 1WAKA 3JUHA 2QKWB 1GOLA 2OJGA 2XF0A 2XK4A 4O7LA 2HZ0A 4L8MA 4YJQA 4LI5A 4U42A 4BTJA 4MWIA 4UMQA 2J4ZA 4IWPA 4AN3A 2R3RA 3PRIA 4P2KA 1URCA 4FMQA 4W9WA 5CAVA 4BDFA 3A7FA 5JEBA 4OT5A 5IKWA 3W1FA 4OR5A 4HYHA 3KXHA 5K5NA 4ASXA 4ZLOA 2UVZA 3R7UA 3TDWA 3VRYA 3PJ3A 3BYMA 4CFUA 2J5EA 3FQEA 2XK8A 2YCSA 5E8YA 4FNZA 1GZNA 2P4IA 3ORIA 4G9CA 5TR6A 4BI1A 4EK6A 5L2TA 3NMUF 5CU4A 2C47A 1KE9A 1YWVA 3GU4A 2R3KA 2RIOA 3CTHA 4KD1A 4FZDB 4DT9A 3WZUA 4CEGA 4S2ZA 4V04A 2VTPA 4CV9A 3HMNA 1Z9XA 4E5AX 3S1HA 5FG8A 4JS8A 4BCPA 1M52A 2RFDA 4QTBA 4F99A 5IDNA 4WSQA 4OUCA 3PJ2A 2IZSA 4QMXA 4HVGA 2X39A 3BQRA 3R1SA 1OKWA 3QQKA 2X8DA 1IG1A 5CEPA 5JKGA 4IWOA 5M53A 2X9FA 5J9LA 4F9WA 4GSBA 3WZEA 3M11A 3VS1A 5JZJA 4YO4A 3ALNA 3V5WA 1UNGA 3NNUA 2W9ZB 1S9JA 4A9RA 4TWPA 1ZARA 3AC5A 1IAHA 5EYCA 2PZ5A 5A4EA 5AAFA 2BRGA 4QT1A 2WKMA 4PTEA 2FSTX 1SVEA 4YTHA 3E8DA 4I1ZA 4D1XA 4QP7A 2C4GA 3U9CA 4QMMA 4XUFA 4EHEA 2BRHA 3FL5A 3FXWA 3KMWA 5DRDA 5CAOA 1DAYA 5CSVA 4XP3A 1IASA 4DC2A 4JLCA 4LM5A 5I3RA 3OHTA 4FSNA 3SV0A 4ACGA 4BBEA 3SXFA 4ZZNA 1XH8A 3ROYA 3WF8A 3ZBXA 2P2IA 2R3IA 4S30A 3W32A 4O2ZA 3EL8A 4YHJA 3BX5A 2DYLA 2RFEA 2P3GX 2BHHA 2WIPA 3C50A 3EQDA 3Q32A 1OZ1A 3ODYX 3N51A 4IVBA 3OXZA 4X6QC 2GSFA 3V01A 3BHVA 4XG9A 4LL5A 5HU3A 3II5A 4JVGA 2XIYA 4AW0A 4B8LA 3TUDA 3RCDA 1OIYA 4E5WA 1VJYA 2WB8A 3LFCA 4YC6A 5EW3A 2LGCA 2GQGA 2C68A 2ZV2A 5M55A 3HECA 1LEZA 4ZSAA 4JBVA 4BHZA 5JN2A 4CQGA 4XRJA 1OPLA 5KMOA 3KB7A 2J7TA 2C6TA 2V5QA 3FLNC 4QRCA 5J87A 3QRUA 4Y83A 1BLXA 3LQ5A 1P14A 5HVKA 3C9WA 3N4TA 3FPQA 1OM1A 3AD5A 3ZRLA 4IAAA 4WNMA 4MH7A 2UZNA 4OTQA 3EFKA 5AWMA 2ETKA 5E8SA 4C61A 2XYUA 4FUYA 2YLFA 4GV1A 4TXCA 4A06A 2GQRA 5A3XA 4ZY4A 5J79A 2CKOA 4N4SA 2R3NA 2NRYA 3V6SA 2YHVA 3D7TA 2X4ZA 5HLWA 4RIYA 5GZAA 4FL2A 5BMSA 2Y7JA 3DTCA 4FKWA 4HOKA 4TN6A 3GCSA 4D55A 4EC8A 3PA4A 5KMMA 3V5PA 3C51A 3OXIA 3MDYA 4HPTE 3ITZA 3PIYA 5IQHA 4AE6A 3AT4A 4DTBA 4HVSA 3CY2A 3F69A 3KXGA 3R6XA 4U0IA 3AMBA 1OL5A 4M69B 4CKIA 2BMCA 4D2SA 5TO8A 4BDAA 5B7VA 2H9VA 2BAQA 3QCSA 1XHAA 3Q4TA 4LOPA 2VO7A 3HP5A 4DH3A 3EKNA 1MRUA 2XBAA 3CQWA 4I6FA 4USDA 5EYDA 3AT3A 4BCOA 3I81A 1QPEA 4O6EA 2HZIA 5EM8A 1Q8UA 2HOGA 4TT7A 3NCGA 4G16A 4IWQA 4Z7GA 4N6YA 4MF0A 2W06A 4O86A 3QAME 3QTUA 1KOAA 3ORTA 4PDPA 5CX9A 5JFVA 3Q5ZA 3L8VA 5F95A 4BTKA 2CKQA 4G3EA 1H1RA 1J3HA 4MD8E 4IZ7A 4FK3A 2X8IA 2UZBA 2YDIA 3ZONA 4PL5A 2OG8A 1WBPA 2X0GA 3MFSA 4WBOA 5FEEA 4W8EA 4EWQA 4ONAA 3UIMA 3BKBA 3OOMA 3CQEA 4YJRA 1YXVA 3PXKA 3TACA 3KXNA 2XNNA 3GC9A 4C57A 5CF4A 5EKOA 2OSCA 3HEGA 4MCVA 4M68A 3AG9A 4D2PA 3HV3A 4KRCA 3MTLA 3FI2A 5HIEA 4RFYA 1VYZA 2IN6A 4CRLA 4YGAA 5IEYA 3F3VA 1PKDA 5JT2A 2O8YA 4YLLA 4YPDA 4IANA 5CEMA 3PY0A 4O1OA 3VUMA 1OITA 1ZYSA 5LVLA 3KK8A 4F64A 2WAJA 4QYHA 5EYMA 5KE0A 3R7EA 3KXZA 3MSSA 3KY2A 4ITIA 3R2BA 3DTWA 2YWPA 3MH1A 3NIEA 4RZVA 4AZEA 2UW4A 2VNWA 4NK9A 5C01A 2BTSA 4QMQA 1OB3A 4I5CA 3SA0A 5BYLA 4Y95A 3U8WA 3ENHA 4EOSA 5AAGA 5LMBA 2C6OA 4M13A 4WT6A 3KK9A 3HUBA 2BFYA 3LCSA 4AUAA 1JQHA 3RAKA 2GNFA 5C1QB 3R83A 3KGAA 4KWPA 3KRWA 4I0SA 5IQAA 3EQGA 2QODA 2C5YA 5FEDA 4YLKA 3UDBA 3ZLWA 3KF7A 4C4FA 4UZHA 1OPJA 2FSMX 2HW6A 3PA5A 5IMXA 5IU2A 1JLUE 4AAAA 3V8SA 2EB3A 4MAOA 2C6MA 4IFGA 1Y6BA 4BVUA 5JK3A 2CCIA 3TDVA 4UY9A 2WEVA 4EH8A 2XK9A 2BKKA 5DOSA 5GHVA 3LJ1A 3IPHA 3OBGA 4NH1A 3LFBA 4HNFA 4RJ3A 5HCXA 2VWIA 4PQNA 4L46A 2JDRA 3DB6A 3HDNA 4GG7A 1QMZA 3DJ5A 4UX9A 4D1ZA 4DGLC 4IB3A 3OP5A 1PY5A 1YXUA 3R7IA 5HNBA 5LWMA 3WF6A 4QQ5A 4F1MA 4K2RA 2OH0E 3IDBA 3ORZA 4GIIA 3SAYA 3DFAA 4M3QA 4APCA 4ANMA 4UMUA 3QRJA 3T3UA 1W7HA 3RWPA 3L8PA 3HAMA 3QKMA 4IE9A 3P23A 3UPZA 5J5SA 4FT5A 3FC2A 4KKEA 4FV1A 3V04A 2ITTA 2R3QA 2ZV8A 1PXPA 3KFAA 2ITVA 1PJKA 4C3RA 3QTRA 3UPXA 3N9XA 3C7QA 4Q5HA 4GK2A 3PSDA 2C30A 2VWVA 4IX6A 4D5KA 4XRLA 4CZTA 1Q97A 2HENA 1Q8YA 1ZZLA 4B6LA 5ANJA 2WTKB 5D10A 3SDJA 2PVNA 3OY1A 3SRVA 5CQWA 2A0CX 2QO2A 4BTFA 5CZIA 3R9HA 5H8BA 3NSZA 4FEWA 3Q60A 3Q9XA 1ZY4A 1XKKA 4FIHA 2VO0A 4J98A 4FSUA 1Q4LA 5EOBA 5DYJA 4FEQA 4UEUA 4A07A 3NNVA 3LOKA 3C5IA 4S34A 4AZVA 1IAJA 1U5RA 4AQCA 4X2NA 2OZAA 4DT8A 2QNJA 5KKRB 2YDJA 3DT1A 2BILB 2V7AA 3Q4UA 4CXAA 3GQIA 2ZDUA 4XHKB 3UZPA 3EQHA 4GKIA 2JLDA 4RJ6A 3E64A 2P33A 3UVPA 3ZEPA 4E6DA 4C2VA 1YVJA 3ZFMA 3FY2A 2IVSA 5GJDA 2RL5A 5JGDA 2QO7A 4RMZA 4JJRA 1OKZA 2ZMDA 3W18A 3MTFA 4IX5A 1REJA 1HOWA 1JSUA 2R3HA 4CGAA 5AUXA 3BHHA 3M42A 4Q9SA 4RC2A 2F57A 4BDDA 2VTRA 3IDPA 3FLYA 1ZZ2A 2OBJA 4J1RA 4C3FA 3UQFA 3CKWA 2QG5A 3DK6A 2WQOA 3I1AA 4YBJA 3EQPA 3QUEA 4UALA 2X2LA 3GXLA 4JXFA 4XEYA 5FQDC 3FXZA 3VUDA 3R71A 3N4UA 2XM9A 3V6RA 4KBKA 2ZMCA 2UW3A 3Q4CA 4KUJA 4PPAA 3BQCA 3ORMA 4U80A 2C3LA 2H8HA 3C4ZA 3NUSA 4LGGA 4MXXA 4PPBA 4E4LA 1TQIA 3FLZA 5A4CA 4JR7A 3JVRA 1STCE 3BEAA 2YFXA 1UU8A 2XJ0A 3OT3A 4R5SA 2PWLA 3U9NA 4ZZOA 3OWJA 4NWMA 4CT2A 1E1VA 4IMYA 3TNQB 4IAZA 4YO6A 2VO3A 5HZNA 4A4OA 3MBLA 5AUVA 4EORA 4AN2A 4XH6A 4FF8A 4I23A 4WNPA 4XP2A 5AP2A 5GJGA 5H9BA 2VTJA 4E6QA 3NPCA 3LMHA 3FZ1A 3FKOA 1GY3A 4AZFA 1Q24A 2XB7A 4AOIA 2UW7A 1R1WA 3TNHA 2FGIA 3KMUA 1KE8A 3NW5A 3VS4A 2B7AA 3C4EA 5M4FA 5AP5A 2VTTA 3B8QA 3VAPA 3GP0A 2JGZA 5HD4A 4F7SA 4ANQA 3CKXA 3GUBA 4LUDA 4XBRA 3R7VA 3PSBA 5E90A 5FDXA 5C27A 4DEDA 4TYGA 2W4JA 3U6JA 4RGJA 3ULIA 4QP9A 4C58A 4DFNA 3K54A 5CASA 3B2WA 1YW2A 3BPRA 5HORA 4MVFA 4C0TA 5J8IA 3VUGA 4FV0A 2J5FA 3Q96A 4QPMA 4ORKA 2CCHA 1BL7A 4FV7A 3HUCA 3AC2A 3LFSA 4QP6A 2UW0A 4X21A 5FXRA 3RCJA 2OU7A 2E9VA 4ZTMA 3R8VA 4GEOA 4GIHA 2QU5A 2WOUA 1AD5A 2YM5A 3H3CA 3PP1A 4FKTA 4NM5A 4B4LA 5KBRA 3F3TA 5CXHA 2PVKA 3R9RA 3O8TA 5CWZA 4U6RA 1YOMA 5HESA 4X3FA 1R78A 4R77A 3FMLA 2B9IA 2RG5A 4U3YA 5HGIA 2HIWA 2YA9A 2WMVA 3KC3A 3Q52A 2YITA 4G6LA 4EWHA 2UZEA 4PDSA 4EEVA 3FSKA 1YKRA 1YI3A 4OTRA 3ATTA 1PYEA 2UZDA 3W8LA 1WZYA 5ANIA 3QBNA 3DQWA 2DUVA 2GQSA 4FVQA 5DMZA 4IAYA 4QTDA 5LQFA 3GCPA 5IA2A 4P90A 2X6DA 2Y6MA 4XG2A 2C1AA 2WMBA 1URWA 3R1QA 2A19B 3E3BX 4LYNA 4QPSA 5E8XA 3WF5A 4CYIA 3QCXA 2W7XA 1X8BA 4RJ7A 3FE3A 3LMIA 3KRLA 3R01A 3BGPA 2HXLA 4O7ZA 3PP0A 3Q2MA 4DFYA 3MH0A 4B9DA 3H30A 1CTPE 4YU2A 1CM8A 3ACJA 2PZRA 3CLYA 4B0GA 3PXQA 4OTWA 2W1CA 3LCDA 2C0IA 4E8AA 1CSNA 4O96A 2PU8A 4F6SA 4F9YA 2J51A 4ZP5A 3BBTB 2ONLA 2PL0A 4YJOA 1UU9A 2GTNA 5K5XA 3O71A 1T45A 2WMTA 3VF8A 3MJ1A 4F1TA 2R5TA 2XYNA 1FINA 4BCJA 3JYAA 1M7QA 4ZSJA 3MY5A 2JDSA 4A7CA 3G5DA 2JDTA 4OTFA 1U54A 2OFUA 3PXRA 2HELA 4IIRA 4P5QA 5CNOA 2R3PA 4HCTA 5TF9A 3VBXA 3FYJX 5AX3A 5LMKA 4MYGA 5JGBA 3U4WA 2XNEA 4ANLA 2UW6A 2IVTA 3BLQA 1RW8A 3CS9A 4BI0A 5E8UA 2FYSA 4W4XA 3GB2A 3PUPA 1G8SA 1PHKA 3G2FA 4N57A 4I6BA 3ORNA 2RKUA 2IZTA 3KRXA 1JSTA 2W1IA 3EB0A 2OIBA 3GENA 4TW9A 3SRVB 4B99A 3MFTA 1JWHA 5IA5A 3UNJA 4RG0A 4FT7A 3FBVA 4XJ0A 4EOLA 4FNWA 5CVGA 5DR2A 5CXZA 2B9JA 4FTCA 5JFXA 1H08A 3IOKA 3DCVA 3UOJA 2WTCA 2WMSA 2IVUA 3BU5A 4WOVA 5KUPA 3ZSGA 3QALE 3SW7A 5IUIA 3NS9A 4I93A 4BDGA 4I92A 3QHRA 3A8WA 2XCHA 3P5KA 2V55A 4FTMA 4QMTA 3OZ6A 2W5AA 2X4FA 3D2IA 3LE6A 4YJVA 2QURA 5DR9A 3T9TA 5BNJA 4EH5A 4II5A 2GU8A 3A7IA 1TQMA 2GHLA 3GU6A 4BIBA 4FSMA 4O82A 4UV0A 4L53A 4L43A 4Q2AA 4J52A 5E91A 2WMQA 4G34A 4UBAA 4BCNA 4I94A 3ZZEA 4M7IA 1TKIA 4MK0A 2UZOA 3IG7A 1WBOA 4AN9A 1O6YA 2C5VA 3EMGA 3OVVA 5KHXA 5L4QA 1NXKA 3UG2A 4BZOA 3I6WA 4FIEA 5E92A 4O7VA 3UODA 4HJOA 4FBXA 2HZNA 2BFXA 2V22A 3TV6A 4BC6A 3LKMA 2E9OA 5EW8A 3VBVA 3TJDA 4O0XA 4E93A 4EOPA 3ZEWA 2H6DA 3CTQA 3D7ZA 3ZLXA 5FBOA 2RFNA 3PJ8A 4L9IA 2W05A 4DBNA 1JKKA 3DNDA 3BU3A 4XV9A 3E7OA 3TTJA 4JDHA 3VJNA 5E8ZA 5C8NA 2GNJA 3OFMA 2CKEA 5HNGA 4AT5A 2P2HA 5CF5A 2JFLA 2BROA 1B38A 2JD5A 3AC8A 1L8TA 3L8SA 4U7ZA 2ITYA 4C2WA 2ZM3A 5AP4A 2QOLA 3RPVA 5FXSA 3L8XA 1H0WA 3VBTA 2Z7QA 4D4YA 3LHJA 3FWQA 2VTLA 1P2AA 1OL7A 3FI3A 4ZSEA 3QZFA 4IAIA 4H36A 1JBPE 3GEQA 4O38A 3QXOA 4CT1A 4DA5A 1DI9A 5HG7A 4C4IA 4RT7A 2UW9A 4FR4A 3RALA 1MP8A 1REKA 5BYZA 5HX8A 4ASEA 1Q5KA 3RJCA 3ZRKA 5GZ8A 3BGQA 2QHNA 1IEPA 2Z7RA 3L9MA 4QYFA 1TQPA 3FLSA 2Y6OA 2X2KA 3OG7A 4M69A 4ASZA 3K2LA 3LXKA 4Q5EA 3QD0A 1W8CA 4WHZA 1QPDA 3E5AA 1T46A 3WYYA 4FKLA 4DGNA 3RM6A 3MW1A 3PLSA 3VS2A 5AP1A 1GZKA 2VTAA 3D5VA 2PZPA 4FA2A 4F70A 4FTQA 3RAIA 5E4HA 2JKKA 2QVSE 5AUUA 2JFMA 2OWBA 3A2CA 3D5UA 3S2PA 2WTDA 4XG7A 4JAJA 3M1SA 2WHBA 3QD2B 3QF9A 4X3FB 3DBQA 2C3JA 2XIRA 4QMVA 4YUQA 5KZIA 5L3AA 4O91A 4IEBA 3R7OA 1MRYA 2QI8A 2W1HA 3OMVA 4WKQA 5LCKA 4I0RA 2WTIA 3GT8A 4JIKA 2VTMA 3B8RA 4EZ7A 2BPMA 4DGOA 4J95A 3TXOA 4ZMEA 5CF8A 1GAGA 5CSPA 4MX9A 3Q2JA 5IH5A 1YOJA 2YIQA 2X7FA 2Z60A 3F5PA 4G1WA 2O64A 4EH6A 4NL0A 4IM2A 2UZLA 3EFWA 5EI2A 2EUFB 3PVUA 1JAMA 3KN6A 4JX3A 2O0UA 3ZBFA 4BBMA 4CV8A 3OROA 3FQSA 3RK5A 1OPKA 3KKVA 5D9HA 5HBEA 4FL1A 5J5TA 2R3JA 2UZTA 1AQ1A 2YISA 4PRJA 4QP1A 5JGAA 4QD6A 2O65A 3OWKA 2ETMA 2HYYA 3NYVA 2F2UA 3UYSA 3NWWA 3MH2A 4FT3A 4S31A 4E6CA 2F9GA 4F9CA 4YC8A 4RLLA 3E8CA 3ANRA 2JEDA 4L67A 4TZRA 3MB6A 4AX8A 2QOCA 4ZTLA 5ICPA 5TOZA 4CLJA 4FT9A 2VTOA 2X81A 1WBVA 2PVYA 3CPCA 4QMWA 4AZSA 2C1BA 3P1AA 2ZM4A 5FP5A 2IZRA 4BDEA 3EYGA 5M4IA 2WTWA 1U54B 3O7LD 3RAWA 3UO5A 1Q41A 5LVOA 2PTKA 3FZSA 4C3PA 2IW6A 4BL1A 3DKGA 5J1WA 4O7TA 4RJ5A 5AIKA 5EHYA 3RINA 2PUUA 5JZNA 4I6QA 4X2JA 3H4JA 2W1GA 4AGWA 2A27A 4P5ZA 4FE2A 3QCQA 2PVRA 3MJ2A 3S0OA 4R5YA 1OVEA 3O2MA 4NTSA 4AE9A 4BTMA 5LWNA 4K0YA 2ERKA 3ZM9A 2XNMA 3W16A 4EH9A 3JPVA 3LXLA 3ZSHA 1A48A 2W1EA 5A14A 5CAUA 1IA9A 2YZLA 4FV8A 3QYZA 4BCQA 3ZC5A 5KCVA 4A9YA 3A8XA 3RWQA 5KHWA 3BHUA 3FZRA 2KTYA 1Q99A 2QR8A 2YAKA 4MXZA 4EUTA 3MWUA 3LPBA 3PG1A 4FGRA 4J8NA 3EL7A 3HRCA 2GNGA 4IADA 5EYKA 3G33A 4E20A 3DXPA 1WMKA 4AGCA 2YM7A 4FKJA 4MBJA 1KSWA 3QTIA 4HVHA 2F49A 5M09A 4XV3A 4BI2A 3KCKA 1G8AA 1KOBA 1ZMWA 5JRSA 4J8MA 4M97A 3LFAA 4BB4A 3OS3A 3NZ0A 4I24A 4FGBA 4FG7A 2BCJA 5K0XA 2IWIA 5C8MA 4C62A 5BX0A 5HG8A 1LR4A 3QLFA 3FI4A 4KA3A 3FLWA 4NU1A 4A9UA 2ZV9A 4NTTA 5E7RA 5IQEA 4YZMA 3COIA 3MFUA 4XV2A 2I0VA 3V5TA 4FKPA 3T3VA 5DI1A 4DF3A 2XKCA 4M0YA 5BVFA 3SX9A 5LVNA 1SMHA 4QO9A 3IKAA 5D7VA 3D4QA 4DH8A 4NM0A 3OXTA 3VULA 5CU6A 2IW8A 4X6RA 5CEKA 2DS1A 2P0CA 3O96A 3SVVA 1B6CB 2IPXA 2EVAA 5HX6A 1RE8A 5HE2A 4BGHA 4C36A 4DG3E 4D58A 3TCPA 3GCVA 3PXYA 3Q9YA 4UXLA 4L68A 4UYNA 3GFEA 3GOKA 3OUNB 4I6HA 3NNWA 3BELA 3RPOA 3GQLA 2PUNA 2FSLX 1IR3A 3BE2A 1H8FA 5JH6A 1PW2A 4F9BA 4YURA 4YSJA 2HXQA 2PVLA 4MXCA 2ITZA 4PTCA 2HAKA 1PMVA 1OIUA 4DH5A 3ZO1A 3DY7A 2BKZA 2XKFA 1W82A 3Q04A 4HYIA 5EQYA 5DNRA 3D15A 3ZS5A 3EZVA 4CFMA 5AR3A 4JL9A 1M7NA 4XOYA 4A9TA 4DFLA 5AFVA 3PVWA 3MPTA 3PYYA 5GIOE 1M17A 2YACA 4F7JA 4U8ZA 5FRIA 5A4QA 4DG2E 3P79A 4UWCA 1R3CA 5DT3A 4LG4A 3VBYA 3FQHA 5HG9A 5AM6A 3NGAA 5A9UA 3QU0A 3ZZWA 5AJQA 5EQPA 5CS6A 4S32A 3F2RA 2VTQA 4I22A 3H0ZA 3ZFXA 3C5UA 4YZNA 4DLJA 4AA4A 2J0IA 1H1WA 2UZWE 4Y46A 3V8WA 3AT2A 5CEQA 3CGFA 1YDSE 4PDYA 4IX3A 2VN9A 1Y8YA 4K18A 2NO3A 3CEKA 3OY3A 2HW7A 1OUKA 3NIZA 3VS3A 3QZIA 4BZDA 2XK7A 3IECA 3BV2A 3R8PA 4DEHA 3EZRA 3G6HA 3GU7A 3KU2A 4FOCA 5M08A 1ZAOA 2XRUA 1O9UA 4LRMA 4U40A 5AUZA 4HVIA 2V62A 3R9NA 3HLLA 2WGJA 4QQCA 1P4OA 3DJ7A 1Q3WA 4CFXA 5KMLA 4N0SA 3PSCA 3OT8A 4K33A 4ZSLA 4ZY6A 4Z16A 5IEXA 5KMJA 2WTJA 5CQUA 4MD9E 3UZRA 4JAIA 3TWJA 2CPKE 3LVPA 3KXMA 4PDOA 3FLQA 3LW0A 4GYGA 5BUEA 3PVGA 5L2QA 4PPCA 3DU8A 1B39A 3KRRA 4I5HA 5CI6A 3HDMA 3QUDA 2J2IB 4EK3A 3FC1X 3A7JA 1I44A 1XWSA 4FSTA 3K3IA 4UWYA 3CJGA 4E4NA 4L01A 4IB1A 4EBWA 5L2SA 3KXXA 4UMPA 4QTEA 4NYEA 5HU9A 4YTCA 4JQ7A 3H9RA 2HCKA 2IO6A 2W4KA 3CY3A 5DGZA 5AUYA 2X2MA 3K5UA 2AYPA 5IDPA 4DYMA 1FQ1B 3IGOA 4G3GA 4W8DA 3F5UA 4KIQA 4R1YA 3PWYA 3DKCA 3TZ7A 3ACKA 3KRJA 3QTSA 4ASDA 5AV4A 4YZDA 3CGOA 1Q8TA 2R4BA 2ACXA 3AXWA 3SOCA 2PUIA 3ZYAA 2A1AB 2E9NA 4EI4A 5J7BA 4KIKB 5HCYA 2YERA 2W96B 3QQUA 3ZUUA 4KS8A 4WUNA 5K0KA 5T6KA 4FZ7A 4E6AA 1OL6A 5J95A 5F4NA 4MKCA 5F20A 5M44A 3UZTA 4M14A 3R04A 3DZQA 1PXMA 3WF9A 4K1BA 5ANDA 1YDTE 3FDNA 2J0LA 4PUZA 4WNOA 4D0WA 4I4FA 1H1PA 3QQFA 4QQTA 4BIEA 3KEXA 3ZLYA 5L2WA 4G31A 3LJ0A 4LV8A 4YSMA 2PMNX 4M15A 1KUTA 3DZOA 2FUMA 3WE8A 3C4FA 2P55A 4GT3A 4TY1A 1OUYA 3B2TA 3VW6A 1PXNA 4G6OA 3ZO4A 4EHVA 2G01A 2HY81 2YJRA 3AOXA 4GFOA 5DEWA 4PL4A 3FZTA 1JSVA 1SNUA 2FH9A 4EH4A 5L6PA 4FKVA 5DN3A 4TYJA 2H96A 3PFQA 4O7YA 1R39A 3CPBA 3LXPA 3ZRMA 4MEDA 4G3DA 3R7GA 4MF1A 3HV5A 3IQ7A 4RFZA 5HKMA 4NKAA 4O0RA 4IACA 5L8JA 2BZHB 3TKUA 2F7EE 2BHEA 3PWDA 4FODA 2EXEA 3NX8A 3LCKA 1Q61A 4OTIA 2J0MB 4J96A 2I7QA 2VGOA 2WMUA 3TZ8A 3R8MA 2OJIA 4KKHA 3EYHA 5AP6A 2G1TA 1H28A 4C37A 1WBSA 3F2NA 2YZAA 4E3CA 1H01A 2W5BA 3DBDA 4J97A 4GK3A 5A4LA 2F7ZE 2R3LA 4L3JA 2W5HA 3W2PA 5DT0A 2GS6A 1H27A 3KQ7A 4QMSA 4GKHA 3JY0A 4GJ3A 3HV4A 3RI1A 1XH9A 4BDIA 3JY9A 3I79A 5HO8A 5FGKA 2HZ4A 4RC4A 3UIBA 5AA8A 3F82A 3ULZA 4AA5A 5BPYA 2ZVAA 4JQ8A 2PYWA 4GVAA 4QMPA 2O63A 2J90A 3DXNA 3CIKA 4KSQA 2CNVA 1YDRE 1YXTA 3I6UA 5AV2A 5AP3A 3K5VA 3MS9A 3HVCA 3HZTA 3NW6A 5AAEA 4TWNA 5EI8A 3A7GA 4XP0A 5JFWA 1LUFA 3V5JA 3MGYA 3HA8A 4GFMA 1H1SA 1W98A 4I5PA 3Q6WA 4BRXA 4K6ZA 3PPKA 4NIFB 4QMOA 5IA0A 4YPSA 2PULA 3VNTA 3IGGA 5HIBA 5CEIA 3HMIA 3PRFA 5CU0A 3FXXA 2R0IA 4NUSA 1DI8A 4JG6A 2UW8A 5L8KA 4OAUC 4JBOA 4QNYA 3RPYA 3FHIA 3UNKA 3IO7A 4X0MA 4F63A 4IB0A 4QP8A 2X7OA 3RK9A 1KE5A 2PZYA 4FK6A 3NUPA 3G9LX 1SNXA 1W83A 4WD5A 1SVGA 2XA4A 2B53A
chains in the Genus database with same CATH superfamily
4FUXA 2WU6A 4DEAA 4F0IA 2OZOA 3EQCA 5EH0A 4MBIA 3ZMMA 4C4JA 2ETRA 2W17A 2OKRA 2C6LA 1BI7A 1ZLTA 2C6DA 1KWPA 3QRTA 4L52A 2XK6A 4UN0C 1K3AA 4GK4A 4BWKA 4AW5A 5L6OA 2JDVA 3CD3A 3GBZA 2CGWA 3GI3A 3RP9A 1OIRA 4D9TA 4NKSA 4LOQA 3O8PA 3VUHA 3OC1A 3TNWA 4RIXB 3EFLA 2XNOA 2VX3A 4M84A 1MUOA 3PVBA 2JIUA 3WBLA 3F66A 3SOAA 3PE2A 2WFYA 4YJSA 4QEBA 3BZ3A 4AT3A 4DDIA 3PZEA 4U44A 2VGPA 4DHFA 3TV4A 2XH5A 2YCRA 1OMWA 2C6EA 2FA2A 2QLUA 1E9HA 4X2KA 2ZV7A 5BVNA 4O83A 1NY3A 5LVPA 3R8UA 4Z55A 4WO5A 4LMNA 4C34A 4L44A 4RA5A 4H1JA 3V3VA 3VIDA 3Q9ZA 2PSQA 2WO6A 2XS0A 5IF1A 3DBCA 1H0VA 4FKUA 3TEIA 2G9XA 4IAFA 5ANEA 5K3YA 1U59A 4ZZMA 2R9SA 2AUHA 3FMDA 1WVYA 4G6NA 4BCGA 4FSQA 2PHKA 5ANOA 5AA9A 2JC6A 3QA8A 4Y5HA 3BYUA 1PRYA 4I5MA 3W33A 4E4XA 5IQBA 2BIYA 5J7HA 3IW4A 2CNUA 5IQCA 3TNIA 3QQJA 2XIKA 3SLSA 5D7AA 2QD9A 4KIPA 4D2RA 5IG1A 2VO6A 3PY1A 2WPAA 4PL3A 4U97A 5CZHA 3TNPC 3R1NA 4A4XA 3WIGA 4D5HA 1XO2B 5CENA 4D2WA 4EHGA 4P4CA 3QTQA 1OL2A 2VNYA 5DPVA 1ND4A 1VEBA 4IVAA 4ITHA 4OLIA 4F08A 3KN5A 4F65A 3PXFA 3NFGB 1JNKA 4FKIA 4RQKA 3RM7A 3QKLA 3E8NA 2XARA 3EN5A 3C4XA 3RHXA 1F0QA 1YHSA 2A98A 5DRBA 4EHZA 5JMSA 5F1ZA 1ATPE 3WIKA 4DINA 4ID7A 4MHAA 4HVDA 2WXVA 2V0DA 3MA3A 4LUEA 2YM4A 3JVSA 1VLRA 1Y6AA 1PXKA 3FMKA 3S3IA 4ZSGA 2W9FB 2GFSA 5J9ZA 5M4CA 1XBBA 5KX8A 2REIA 4CFWA 4RFMA 2QR7A 2C6IA 1VR2A 2VU3A 2PUPA 3AD6A 4NCTA 3IDCA 2XRWA 3G90X 3DJ6A 3VS5A 3G6GA 3MY1A 4CTCA 3VS0A 3RMFA 3F3WA 3ZH8A 3NCZA 4F1OA 4YZCA 1W0XC 4TWOA 2XIZA 4BGQA 4RIWB 3IW7A 3NAYA 2JAVA 5HEZA 4FICA 3NYNA 3CTJA 3DQXA 2BRMA 3EN7A 5F9EA 2BDWA 4EH7A 2Z02A 2NP8A 2VWBA 5JQ8A 3MPMA 5M06A 4IC7A 4EBVA 4CMTA 3GCQA 4EONA 5HO7A 4EOKA 2KULA 3GC7A 4RPVA 4RLKA 1ZYJA 2PVJA 4OBOA 4QTAA 3P86A 4WG4A 5T3QA 3TTIA 4AA0A 5AP7A 2NNWB 5I4NA 1MRVA 2F4JA 2GFCA 2VWUA 4XOZA 5HG5A 3POOA 4I0TA 3UDSA 3TZ9A 1WBTA 3BE9A 4U3ZA 4WBBB 4LV5A 5KO1A 4MNEB 5CYIA 1RJBA 3AC4A 5BMMA 3ALOA 4ZLYA 1A06A 3ZU7A 4Y72A 5CANA 4RX9A 4EJNA 2O3PA 4M66A 4USFA 3FI8A 3F61A 2W4OA 3DAKA 4O6LA 4G3CA 2JBOA 3EFJA 4AAYA 2Y4IC 1ZOEA 2WMWA 2ITUA 3ORKA 2C0TA 3PG3A 4H3PA 4RWKA 5FD2A 5C26A 3L9NA 1V0PA 4QP2A 4CFNA 2YABA 2XK3A 2WQBA 4FTAA 2XKDA 3QWJA 3W2RA 5CALA 4TYHA 4ACMA 3LXNA 4PP7A 4GCJA 4DEBA 5IZFA 5H2UA 2HK5A 3BLHA 1A9UA 2X1NA 2X8EA 5CVHA 3BLAA 5FLFA 3FZOA 3ZO3A 3MA6A 4ITJA 3ZXZA 4AGUA 4AW2A 4JBQA 5LJJA 2IG7A 2R3GA 4ZEGA 2XEYA 2W99B 2OJ9A 3QGWA 4BDCA 1XMLA 2IZUA 3V5LA 4R8QA 3ORPA 1Y8GA 2GMXA 3BLRA 1PKGA 5BQ0A 2HWOA 3EN4A 3DK3A 4H3BA 1XQZA 4JDIA 4KBAA 2ZM1A 2R3OA 2IVVA 3CC6A 3C4WA 4KNBA 4ANOA 2UV2A 2BRBA 4RIOA 3VO3A 5IQFA 4YZBA 2JIIA 2VTNA 3D5WA 4PMTA 5KMIA 3A62A 3DKOA 3WF7A 3BWJA 4U81A 4ALUA 4KABA 3PIXA 4O1PA 4R7HA 5CI7A 5HE0A 5CF6A 5HBJA 4FVPA 3NVMB 4O84A 4BFMA 4F7NA 3NR9A 1NT2A 3F3UA 4IVCA 3R00A 3RK7A 4EOQA 4R1VA 3ELJA 4C4EA 4OTDA 2FO0A 5TE0A 2ZOQA 1E1XA 4CRSA 4OBPA 1XBCA 4LDTA 1GNGA 1UNLA 3BIZA 1YXXA 4GW8A 4YZ9A 3R22A 2FSOX 5IA1A 1Z5MA 1ZWSA 4YHTA 4E4MA 5FTGA 2Z7SA 4M8TA 2R3FA 3DK7A 3HV7A 3MN3A 4O7WA 4FKRA 3NUNA 3QX2A 4OTHA 2B54A 2CN8A 3WZJA 4DEGA 3LJ2A 3IW5A 4FEXA 4DFUA 3QX4A 1BX6A 4L6QA 3BYVA 4Y5QA 3S4QA 3UVRA 2XUUA 3UQGA 1K9AA 4YTIA 3E8EA 5M51A 3O17A 5AR7A 5E9EA 4ZS0A 2CGXA 3R9DA 3HAVA 3DV3A 3O7LB 2X7GA 4JG7A 5EDQA 5JFSA 2C69A 1SVHA 2VTSA 4IZYA 1V0BA 3D0EA 3VS7A 4Y85A 2OXDA 2RGPA 3V5QA 3DBFA 4ENYA 3W0MA 4EOJA 5I3OA 3BYOA 4TWCA 3TL8A 5GIPE 4HPUE 3R8LA 4DH7A 5GZ9A 3GU5A 4MNFA 4IJPA 4G9RA 2VWWA 2PMIA 4LL0A 5KNJA 4KIOA 3EN9A 3QTWA 4Q9ZA 4W4WA 4FTUA 4QPAA 3TT0A 4GJ2A 2YCQA 4L7FA 3Q6UA 3BL9A 2ZDTA 5ACKA 3ZUVA 4N6ZA 4GUBA 4JRNA 3UOKA 1BYGA 1P4FA 3UIUA 4BF2A 3RVGA 1NVSA 1FMOE 3P7AA 4DITA 4C02A 4ZMFA 3E92A 3G0FA 1OI9A 3ORXA 3VS6A 3W2QA 3DNEA 4C4GA 3SC1A 4FVRA 4HGLA 3FZPA 4PY1A 4FTNA 4QP4A 4G17A 4FV6A 2QONA 3KMMA 4H58A 5CSWA 4DFXE 3RAHA 4RQVA 2BR1A 3TJCA 5TKDA 4D4RA 4CMOA 4D2VA 3POZA 3FMMA 3PIZA 4HCUA 3TYKA 4FIIA 3ERKA 1XH4A 3DA6A 1FPUA 2JKOA 4JQEA 5IUGA 4K9YA 3AQVA 4BICA 5I9XA 4RZWA 4NZWB 2O2UA 2OXXA 2HY0A 3ZHPC 2GS7A 2NYAA 4KKGA 4D28A 4GG5A 4QMYA 4BIDA 3TUCA 2R7BA 3CR0A 4IHPA 4ENXA 4U5JA 4BN1A 1GIIA 1Y91A 4KB8A 2QO9A 3ZXTA 4AT4A 4DBXA 2G2HA 3QYWA 4X3JA 3SGCA 1FVTA 5IQGA 3W55A 4WSYA 5AM7A 2JDOA 4FKSA 4BY9E 3VN9A 3O8UA 2AC3A 4JOAA 4CSVA 3QWKA 4CYJA 3GNIB 2YCFA 2OO8X 3DBEA 3MH3A 4GS6A 3F7WA 4CG8A 2C0OA 3LFEA 2I6LA 2UZUE 1RDQE 4I41A 5AIRA 3L9PA 4ZTQA 3Q53A 4H05A 3IOPA 4O0UA 3SXRA 3I60A 5EDPA 4AFEA 3UG1A 4LV7A 4LGDA 5FM3A 4APPA 3AD4A 5L8LA 3TKHA 1GZOA 4C8BA 2PZIA 4FKQA 3TZMA 3KCFA 4TL0A 2YIYA 4FX3A 5IISA 3OCBA 4OTPA 3OWLA 4TYIA 5G1XA 4C7TA 4EZ5A 2JBPA 2CLQA 1CKIA 4LRJA 5HICA 1ERKA 1ZMVA 4BZNA 3NLBA 5ANGA 3FEGA 3FMEA 3QUPA 5BV3A 5JSMA 3LFDA 3D83A 4KIKA 5CLPA 1Z57A 4O0TA 4GMYA 1KE7A 3FMJA 3WZDA 1JKLA 2XEZA 1IA8A 4F0GA 2C5NA 2YN8A 5CSXA 3QHWA 3FMHA 5D12A 5B2KA 5CAQA 3O5AA 1JOWB 4CKRA 2XANA 2XNPA 4QYYA 5LCJA 4U45A 4EH3A 3EIDA 4QNAA 2Q0BA 4FYOA 3GC8A 5HLNA 4TYHB 4J53A 1H4LA 2RFSA 3A60A 3LM0A 5E8VA 1W84A 5J1VA 3DFCB 4W4VA 1NA7A 3LLAA 3EQBA 4U43A 1Q8ZA 2WMXA 4IZ5A 1ZMUA 2OXYA 3ANQA 2J0JA 3SQQA 4R3PA 2VD5A 2BZKB 2E9UA 2OK1A 1ZOHA 5KBQA 3SHEA 1K2PA 4RA4A 4X3FC 4E1ZA 4XLIA 4ZJVA 3QQHA 2XP2A 4RSSA 3MPAA 3NDMA 2UVXA 1EH4A 4DEIA 1YHWA 4PTGA 4HW7A 4JR3A 5CAPA 3OW4A 3R02A 5BVWA 2QOIA 4XCUA 1APME 3Q3BA 4FIJA 2UVYA 4BKYA 3FJQE 3VBQA 2AC5A 4E5BA 4FZ6A 4EK8A 2EXMA 5T68A 2DQ7X 4IZAA 4BKJA 5EK7A 1ST4A 4DLIA 5DFPA 4UWBA 3WI6A 2SRCA 5A54A 3H9FA 3WILA 4D2TA 3IW6A 4H3QA 4NSTA 3F5GA 1HCKA 2JIVA 3QL8A 4R78A 4FJVA 4ZJIA 4IFCA 5DH3A 3O23A 2PVFA 3OTVA 5HI2A 2R0UA 1H00A 4IW0A 2W0JA 1PXLA 5EG3A 5HIDA 2VV9A 4EQUA 2BDFA 3VHEA 2G2IA 4BDBA 3C13A 3FUPA 2BZIB 2QOFA 4BDHA 1WCCA 1M14A 4IJ9A 3OW3A 2PE0A 5DWRA 5J9YA 1WVXA 2R2PA 5HO6A 4AGDA 4ANSA 5JRQA 2UZVA 2ONLC 2XNGA 4IM3A 5GNKA 4AG8A 4QOXA 2VWXA 3MVLA 3ATSA 3U6HA 1DM2A 4FT0A 3VC4A 4Y73A 3R9OA 4FI1A 2FVDA 2ZYBA 1WBWA 1L3RE 3AMAA 3FV8A 5I5ZA 4YJTA 3SD0A 4JIAA 4PMSA 5FXQA 4ERWA 4NIFA 5LMKC 5DT4A 2XZSA 4BGGA 1F3MC 1UWJA 2OF4A 4O4FA 5HNIX 3OBJA 2Q0NA 2VZ6A 3RPSA 5BVOA 4FTTA 2B55A 2I0HA 4LRKA 2NPQA 3EKKA 2WIHA 4FTJA 4C38A 2QLQA 3ET7A 3R0TA 3QCYA 1QCFA 5DVRA 3W0RA 2GS2A 4ZY5A 1NW1A 2RG6A 3F5XA 3G51A 4ARKA 2QOKA 3H10A 1H1QA 4ZIMA 3EQFA 5E1EA 4D1SA 3NYXA 4V0GB 3NEWA 3OCSA 1OBGA 1J1BA 3LMGA 1YI4A 4FG9A 2JAMA 4O7NA 1R0EA 4C35A 4F9AA 5AR5A 4WNKA 3SG9A 3QKKA 1FVRA 1AGWA 2UW5A 4ZTNA 5HOAA 2XBJA 2WMAA 3LIJA 3SKCA 1PMUA 2XMYA 5FUTA 4FTRA 4BHNA 5TT7A 4EH2A 3BEGA 5A46A 1OIQA 4RX5A 4RIXA 2GNIA 2CKPA 1BKXA 3TN8A 5AADA 1XJDA 1Q62A 2YDKA 3PDTA 4HGTA 3RNIA 4FV4A 3DOGA 4EKKA 4F4PA 3W0PA 2BAJA 1OKVA 1SZMA 3HNGA 4IB5A 3VUTA 4CLIA 4QYEA 2Z7LA 4EOMA 1ZYCA 5K9IA 1VZOA 3F2AA 3D14A 2BUJA 4KBCA 5AUWA 2A4LA 2PVMA 2GNHA 4ZS4A 5ANKA 4DTKA 4DG0E 4RWLA 3DB8A 3D94A 2GTMA 5CT0A 5HD7A 3QD3A 3E93A 3C0HA 2X9EA 2J9MA 3KA0A 3ZM4A 5KMKA 3FSFA 4YLJA 3GU8A 5DIAA 4K8AA 3R63A 5C8KA 4YR8A 2WZJA 5EM7A 4FL3A 5M57A 4EYJA 4DTAA 3P0MA 4XG3A 2YIWA 4LGHA 3MY0A 4CZUA 2XKEA 4FG8A 2G2FA 4NT4A 3RKBA 4W4YA 4J71A 4FTLA 4JT3A 3UTOA 5I0BA 4FZAB 3QZGA 3QTXA 3NUYA 4X2FA 1YOLA 3C0IA 2B9FA 3DAJA 3DLSA 3H0YA 3DDQA 3QA0A 1M2RA 3RGFA 2EB2A 3L1SA 2VTIA 2J50A 4WRGA 4DHJA 5EHOA 2ZB1A 3R21A 4LFIA 4TYEA 5I9YA 3CBLA 1U5QA 1YHVA 3MIYA 4JRVA 4ZTSA 3TV7A 4NM3A 3RZFA 3VBWA 4BCFA 3MI9A 3UMWA 3OUKA 3QC4A 4AZTA 4FSZA 5CU2A 4AU8A 2C3KA 4RBLA 3Q9WA 3ETAA 2BAKA 5EM6A 4YTFA 5D11A 3TIZA 4RJ4A 2WOTA 5FWKK 2VX0A 4D4SA 3EN6A 4WIHA 4EC9A 2CJMA 4AWIA 3LFNA 1XBAA 1UNHA 1XH6A 3QQGA 4GRBA 3KVWA 3OD6X 2ZAZA 2C3IB 3HRFA 5HTCA 3R7YA 4PMMA 4RIWA 3GVUA 3ORLA 1CMKE 2VAGA 3FPMA 3UGCA 4D0XA 4QMNA 5A6OA 3THBA 4AW1A 1PYXA 3U6IA 4QMZA 3BBWA 2PY3A 3EOCA 3JXWA 5FM2A 4EOIA 4HGSA 5AMNA 2BZJA 3BI6A 1W2FA 1R0PA 3O51A 4O22A 4CCBA 4IX4A 5BUIA 4EZ3A 3MVJA 2BDJA 5EW9A 4XG4A 3LCTA 4EYMA 3HL7A 3ZOSA 3BCEA 4Z3VA 3PE1A 4XBUA 1JVPP 4MNEA 2YIRA 4O27B 4F78A 4IH8A 5AX9A 2DWBA 4WG5A 3UE4A 4B8MA 3E3PA 4NJ3A 4AACA 4R6VA 5CU3A 3F88A 4Z9LA 3AC3A 4G3FA 4FNYA 4MWHA 3V8TA 3UNZA 2BALA 2RF9A 3VW8A 4ERKA 4EKLA 3HGKA 4QTCA 4QYGA 3U54A 2BTRA 3HMOA 4X7QA 2J0KA 5KZ0A 4BBFA 4YBKA 4AS0A 3UMXA 2BIKB 4ZTRA 4DGGA 2VTHA 2QC6A 2NRUA 3I0OA 2YM8A 5CY3A 3COHA 2Y0AA 1BMKA 2X6EA 3COMA 3A7HA 1I09A 2YM3A 4C33A 4L7SA 4DAWA 3GCUA 3ZO2A 1BUHA 1H25A 3C4CA 2YEXA 1UA2A 3PA3A 3EQRA 5BUJA 4YMJA 2PE2A 2WU7A 1NVRA 4ALWA 1F5QA 2Z2WA 1YWRA 1PXJA 5HCZA 4DH1A 5HLPA 4FSWA 2AQXA 2ITNA 2QU6A 1M2QA 5HE1A 5M4UA 3MVMA 4JDKA 5L6WL 3D5XA 1ZYDA 1G5SA 2A2AA 3DDPA 3IS5A 4E7WA 3FY0A 3RPRA 4M0ZA 4QQJA 5K4JA 2WQNA 3QTZA 4WG3A 4USEA 2GHMA 3MFRA 4DGMA 3KULA 1FGKA 3P7CA 4YP8A 4TNDA 2QHMA 4GYIA 4L00A 2V7OA 3CQUA 3FL4A 1U4DA 3AGLA 2F7XE 3HYHA 3LFFA 3S95A 3GFWA 3KL8A 4G2FA 4FTIA 1MQ4A 3U87A 4CMUA 1Q8WA 4DFBA 1G3NA 5F94A 2CHLA 3P9JA 3E88A 4XYFA 2PVHA 2B0QA 5DR6A 4FEUA 4TKSA 5KMNA 1UWHA 3VHKA 5DG5A 3I5ZA 4BYIA 1FVVA 2PMOX 4BWXA 4ZAUA 1J91A 3AGMA 3QRKA 3E87A 1WBNA 4QMUA 4TRLA 5B0XA 2HWPA 4E73A 3H9OA 4OW8A 4FKGA 3WE4A 4AF3A 3VF9A 4EK5A 4ZTHA 3IW8A 3LQ8A 4HCVA 4RVMA 4RJ8A 5D41A 2I0YA 4CCUA 2C6KA 3KVXA 1DAWA 3OF0A 3R73A 5FP6A 2VRXA 3OWPA 5IA3A 4O0YA 4HYSA 4H39A 3I7CA 4FEVA 1OBDA 5CT7A 4BYJA 2B52A 3DAEA 2ITPA 1OECA 4JNWA 4K11A 4IM0A 2W1DA 3OOGA 4RWJA 5ETAA 2Y4PA 4AOTA 3VJOA 1UV5A 4WUAA 2QOBA 3OCGA 3V51A 4ACCA 3A4PA 2OJJA 3W0OA 1J1CA 4XNEA 3UO6A 4L42A 3HP2A 4NW5A 3A99A 3F9NA 4IXPA 2WTKC 5DHJA 4PMPA 4GL9A 5ETIA 3VQUA 3BWFA 2OIQA 4D4VA 4PNKA 3EWHA 2YIXA 3F6XA 3HV6A 3RZBA 2ITXA 3CD8A 3UYTA 3BV3A 2WQMA 3DS6A 1XH5A 4F0FA 3VONA 2B1PA 2YM6A 5HE3A 3D7TB 3UJGA 1RQQA 4U9AA 3LCOA 3PTGA 5IQDA 3SW4A 5LOHA 4RIYB 2ZJWA 3W8QA 4YNEA 3RNYA 4I3ZA 4QMLA 4D9UA 5ETFA 4L3PA 4PF4A 1UU3A 3UQCA 4LOOA 4CTBA 5KKRC 2J6MA 1H26A 2R3MA 3PY3A 4IC8A 2YJSA 3BHYA 1SYKA 5CEOA 5L2IA 5IQIA 3WARA 3EQIA 5DLSA 4ANBA 3EJ1A 3A61A 5AV3A 1DS5A 2ITOA 5M07A 2CN5A 5H3QA 2RSVA 3IONA 5IH6A 3NFFB 2OLCA 1YI6A 2W1ZA 3NVKI 2OF2A 3OTUA 2R64A 3EH9A 3E7VA 1Y57A 4K77A 3FKLA 1YRPA 4CFVA 4FV9A 4RVKA 3FKNA 4JI9A 5EM5A 4ZOGA 2QCSA 2H34A 4UB7A 3NUXA 4FYNA 5LVMA 3U55A 4M67A 5HBHA 4R3CA 3UIXA 4JX7A 2WTVA 4XLVA 4F6UA 2Q83A 5I9VA 1J7UA 5C03A 1ZYLA 3QC9A 4KAOA 4UYAA 4XV1A 3W2OA 5IA4A 1PMNA 3HA6A 1YQJA 4IQ6A 4V01A 4RX8A 2I0EA 3RHKA 5EQEA 1ST0A 4CNHA 4DE4A 2I1MA 5JQ5A 5HHWA 3F7ZA 1G8KA 4IDTA 3ZDUA 3KF4A 2Y4IB 5AR2A 4LMUA 2W1FA 5ITAA 2B4SB 2YLEA 1FMKA 4FRFA 4CQEA 5BYYA 2YAAA 4C4HA 4FIFA 4O7SA 4UZDA 1HCLA 1GIJA 1W2CA 5CVFA 5HVJA 3RBWA 4AFJA 4BCIA 3CE3A 5EOLA 4N70A 3NW7A 4GFGA 4CD0A 1PF8A 3ZC6A 5FBNC 3UBDA 4ZLZA 5A4TA 4O4DA 4CG9A 4FZFB 4PP9A 4OBQA 4GT4A 3SG8A 3BU6A 3UDTA 3HX4A 2OJFE 5BVKA 5ETCA 3CP9A 3PPJA 3ZCLA 4S33A 4KRDA 3NUUA 5HTBA 3A4OX 3C1XA 4J99A 2QOHA 4KSPA 3E62A 5G6VA 2PE1A 3F3ZA 5I9WA 1SM2A 3I5NA 3WYXA 4AOJA 4ZXTA 2XJ2A 3TIYA 3PPZA 3K3JA 3P4KA 5C9CA 5H8EA 5A6NA 3ZDIA 3U4UA 4IDVA 3DKFA 5IEVA 1KV2A 2CGVA 4KINA 3VUKA 5EHLA 1CKPA 2ERZE 3T8OA 3AMYA 4EJ7A 2VX1A 4FV3A 1J7LA 4IAKA 4RVLA 4XX9A 4EL9A 4GU6A 1M2PA 5FDPA 3R28A 3UO4A 3P7BA 5CNNA 4BCHA 2OGVA 3TM0A 3AC1A 3GC0A 1V0OA 4OT6A 4BKZA 1GJOA 2Z8CA 3PJ1A 3EHAA 1FOTA 4L3LA 3LAUA 3R1YA 3G0EA 1GIHA 2WNTA 4U79A 5BVEA 3Q4ZA 4UMTA 4O4BB 4FTOA 3N4VA 3NUAA 3UC4A 4BCKA 3OEZA 2XJ1A 4YHFA 3BRBA 3O0GA 3HMPA 4FC0A 1KE6A 1ZRZA 2VWZA 5DBXA 3DPKA 4ACHA 1P5EA 3P78A 2OICA 1BL6A 5HTIA 3UOLA 3OCTA 4ANNA 4NFNA 3KULB 4NJDA 4MXYA 2GCDA 4O0SA 4P7EA 3S00A 4UXQA 4I6LA 5E1SA 4G5PA 3ZUTA 1UKIA 4BCMA 4Z7HA 2OI4X 4NEUA 4WRSA 4HZSA 2E2BA 4MQ1A 5AEPA 3LLTA 2GNLA 2I40A 3QRIA 4ACDA 3PZHA 5C4LA 2VWYA 3UP2A 3DGKA 4E26A 2ESMA 1OKYA 3G9NA 4FV2A 1OGUA 3RTPA 4MUQA 1CDKA 2ITWA 4XG8A 3FHRA 2EWAA 3QFVA 4PX6A 3I4BA 4AXAA 3TI1A 3VWAA 5M56A 3NYOA 4IWDA 4ZJJA 4FSRA 2WQEA 3LM5A 4XS2A 5GJFA 2O5KA 5AR8A 1XR1A 4FV5A 5IMEA 3ID6C 4EQCA 4Y8DA 4MD7E 1PXIA 1QL6A 4EK4A 3PUFC 3ZFYA 3FYKX 4IVDA 5AP0A 4GU9A 2G15A 4FIGA 2LAVA 1O6KA 3NRMA 4CFFA 4A9SA 4F09A 4R3RA 4DHZA 2OZAB 3JS2A 5HVYA 1TVOA 4KS7A 3AKKA 1V1KA 3WOWA 1LEWA 3C0GA 4GT5A 4DEEA 3R2YA 4O0WA 4A4LA 3MV5A 4H1MA 5EFQA 1UU7A 2BVAA 4O0VA 5CSHA 2JKQA 3UC3A 3QZHA 1Q3DA 5H8GA 4ZK5A 1U46A 3L9LA 3G15A 2PPQA 2BRNA 4I21A 4RVTA 3JR1A 4YNOA 1ZY5A 4TNBA 4F7LA 4FNXA 2GDOA 3MYGA 3T9IA 3QGYA 4RC3A 4V05A 4MTAA 2XVDA 2JITA 1OL1A 1JKSA 2IJMA 3CCNA 2WEIA 4IBMA 4OGRA 5D1JA 3LFQA 1S9IA 2Y9QA 3FMNA 1VYWA 2JKMA 4O2PA 4CVAA 4W9XA 3R30A 4V0GA 4MBLA 1MQBA 1XH7A 3W10A 2F2CB 3QQLA 3U51A 4QP3A 1PXOA 1FBNA 4GH2A 1WVWA 2XIXA 5B2LA 5DE2A 4JDJA 5IH4A 1IRKA 3ODZX 4O81A 4NFMA 5C4KA 4O7RA 1JKTA 2CMWA 2XCKA 4HZRA 4YJPA 4CKJA 1QPCA 2EXCX 4HNIA 2QOQA 1FGIA 3GOPA 2GPHA 2QQ7A 3TKIA 3ZTXA 3GGFA 4PWNA 3M2WA 5IUHA 4HGEA 3MESA 1YXSA 4XG6A 4CZYB 2QG7A 2ZB0A 1ZOGA 4AZWA 5DA3A 1ZXEA 4DCEA 3KREA 2VUWA 3VQHA 3BYSA 4MXAA 4FKOA 5LXMA 4UMRA 3ZLSA 5LARA 2XAMA 3REPA 4RWIA 3BHTA 3IK3A 4OTGA 3UVQA 3TUBA 5AUTA 3LZBA 3HRBA 3NNXA 3UP7A 3WZKA 1H07A 3Q5IA 4GVJA 4PNIA 1G8JA 4NM7A 3DXQA 2CSNA 4NW6A 4EUUA 4R7BA 3PJCA 4U41A 4G5JA 3ROCA 3HMMA 3VVHA 4RX7A 2WMRA 3D9VA 4J7BA 4LQMA 5B2MA 2CDZA 2XM8A 4YC3A 3SXSA 2C5XA 3CSVA 4YJUA 2CGUA 4PV0A 5DEYA 1PMEA 1W2DA 4I20A 4OAVB 4C59A 3MVHA 2PK9A 3VUIA 3FAAA 2CNQA 4I4EA 1J7IA 2WELA 2FB8A 1NVQA 3MIAA 2OH4A 3DLZA 4XMOA 5AR4A 3CXWA 2QOOA 3BGZA 3MB7A 4TTHB 5LMAA 1YWNA 1JPAA 2CLXA 3ENMA 4TPTA 3VRZA 4EOOA 4BDJA 4FOBA 5EKNA 3I7BA 5I9ZA 3E63A 1LP4A 1LPUA 1KV1A 1UVRA 1BI8A 4BR3A 4O21A 2XNBA 5GINE 4F6WA 2B9HA 2OIDA 5FTOA 5EI6A 5I9UA 4R7IA 2EU9A 4B7TA 2PMLX 3W2SA 3O50A 3QXPA 5E8WA 5HQ0A 4GUEA 1UKHA 3PFYA 1WFCA 3D2KA 4WA9A 5EDRA 5FTQA 2UUEA 3OEFX 3W2CA 3PXZA 5AV1A 2E9PA 4RRVA 2R7IA 3P08A 5FEQA 3R8ZA 4DFZE 5IPJA 4DCAA 3QD4A 4FSYA 3HKOA 4MQ2A 4AXEA 2QKRA 5E8TA 5BVDA 2OFVA 5ACBC 4M12A 4L45A 1CKJA 4MXOA 4YJNA 1O6LA 5CTPA 1QPJA 2GHGA 3UOHA 3W0QA 5K4IA 3W0SA 3I0QA 4JG8A 4EQMA 2YWVA 4DN5A 3COKA 1H24A 4BWPA 2OW3A 3CJFA 3ZSIA 5AV0A 3TG1A 3NAXA 4X2GA 4HYUA 4NCTC 4ALVA 3QLGA 2IW9A 4BDKA 2C5OA 4JBPA 4O4CA 3LQ3A 1GZ8A 2ITQA 4FTKA 3PLAE 2Y8OA 4AP7A 2WD1A 1WAKA 3JUHA 2QKWB 1GOLA 2OJGA 2XF0A 2XK4A 4O7LA 2HZ0A 4L8MA