4WRGA

1.9 angstrom structure of egfr kinase domain
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
289
Chain Sequence
AMGEAPNQALLRILKETEFKKIKVLGTVYKGLWIPEGEKVKIPVAIKESPKNKEILDEAYVMASVDNPHVCRLLGICLTSVQLITQLMPFGLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Epidermal growth factor receptor
publication title 1.9 angstrom structure of EGFR kinase domain
rcsb
source organism Homo sapiens
total genus 96
structure length 289
sequence length 326
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wrgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wrgA01
2BHEA 2X8EA 5BMMA 1HCKA 4OBQA 5ANEA 4EUUA 2R3QA 4W8EA 2QU6A 1UU9A 4CSVA 4YURA 4N0SA 3R9HA 4JIKA 1U54B 1E1VA 2AYPA 3JY0A 3N51A 1R1WA 5LQFA 2WGJA 2EXEA 2PMIA 4JOAA 4DTBA 3EB0A 3M1SA 3EN5A 1WAKA 3II5A 3PXKA 3R73A 3V01A 5CSWA 1CTPE 3PIXA 3Q5ZA 5LMKA 2OJIA 1KWPA 5I3RA 4B8MA 3RNYA 3GC0A 2Q0NA 3EOCA 1BL6A 3FMDA 2GHMA 2PZYA 1HCLA 4FTLA 5HO8A 4IFGA 4DGLC 2WMTA 4MTAA 2ZOQA 1NT2A 2CCIA 4LFIA 2V22A 3HRBA 4XG9A 4ANLA 2OG8A 2XNNA 2QOCA 2VN9A 3FPMA 4FZDB 4OTGA 4PMTA 4WT6A 5FD2A 5HHWA 3QZFA 1DAYA 3OBJA 3W32A 3TZMA 2JAVA 1MRUA 3OT8A 4FV2A 4I0TA 2YM5A 3KMUA 5DIAA 3BV2A 2XIRA 3QRKA 3QUPA 4O1PA 1PXNA 2GS7A 4I5PA 2GFCA 3DZOA 3MVMA 4P5ZA 5LCJA 3TDVA 3O51A 3R7EA 1MQBA 1NVRA 3POZA 4DN5A 4ERKA 4GFMA 3WZUA 2IVVA 3ZLWA 2GHGA 5KKRB 3A61A 3QD4A 3FI4A 4UEUA 2JIUA 3GP0A 3O8UA 3WE4A 4D2WA 3AC5A 3LCKA 5BQ0A 4KABA 4M7IA 2GNFA 4EH7A 3WZJA 3PJ3A 2O64A 4JQ7A 2XNGA 4X21A 3RNIA 1W8CA 3TUDA 4NKSA 4BC6A 2F49A 2IG7A 2HZ4A 3V3VA 3SRVA 4FMQA 4UBAA 5BYLA 2ITNA 3BHYA 4FEUA 3R9OA 3TCPA 5EK7A 3KCFA 2JBPA 4GYGA 2C0IA 4O2PA 1WVXA 3O71A 4WD5A 5D12A 3AD5A 4GIHA 2QOOA 3LFSA 5BYYA 5GINE 2ACXA 3BE2A 3F3ZA 4Y5QA 5CU3A 4FBXA 5KMLA 4JRNA 4AZFA 5EW9A 2WOUA 3CTQA 2WU6A 3P7AA 5EQPA 3KXMA 3ENMA 5A4TA 3R02A 2ZMCA 5CF5A 4GYIA 3UZTA 2W06A 2FSMX 4CFWA 4G5PA 1Q5KA 4C34A 2UW9A 1X8BA 2PE2A 4FZAB 4I92A 2ITXA 2ZV9A 3LLAA 1ZZLA 4YJNA 5FM3A 3DDPA 3GT8A 4FOCA 4BDAA 1H0VA 3LMIA 3LCTA 2J0MB 4AGWA 3CY3A 3H0YA 3HZTA 5C26A 3N4VA 3LW0A 1F0QA 4FGRA 4FSMA 2HW6A 5CNNA 5EYMA 4CQEA 4TWCA 3S95A 3NWWA 5TE0A 1WFCA 1JKKA 2NP8A 4XG3A 3UYTA 4FNZA 2YCSA 2QO9A 3TNQB 4IC7A 1GIJA 1G3NA 1PYEA 3EQIA 4D1XA 3QAME 1KUTA 3P79A 3FI2A 3BCEA 4O27B 3PSBA 4NEUA 5ACBC 4NIFA 4RC3A 3RAKA 4KKGA 4CKJA 3DFCB 3VHEA 1H07A 1KE9A 4F9WA 3SOAA 4M13A 5DMZA 3QHWA 2Z60A 2W1DA 3LCSA 3F5UA 4CGAA 2J2IB 3KRXA 2CGXA 3UPXA 5KNJA 3VO3A 3SX9A 2J6MA 2GNIA 2PVMA 3CS9A 3Q5IA 3QL8A 4BHZA 1Q24A 3V8TA 3EZRA 3ANQA 4RLLA 2XA4A 2B53A 3NSZA 4O7VA 3ET7A 3OWJA 1GOLA 2Y4PA 3TIYA 5C1QB 3P1AA 2PSQA 4ZOGA 1IG1A 4QPSA 2HK5A 3C0HA 4YLKA 2UZBA 5M07A 2BALA 5CVHA 2XIKA 2YIYA 3NCGA 4ZJIA 4FV7A 3KMMA 4J95A 3MB6A 2YZLA 1G8AA 4GFGA 4QMZA 1OL1A 2VTIA 3LM0A 5CNOA 2WAJA 2CPKE 3FLQA 5L3AA 3F5XA 2XK7A 3KULB 4FSNA 4DE4A 1KE5A 3SXRA 5FXRA 4AOIA 5J7HA 3MWUA 2HWPA 3FKOA 4FSUA 2UZNA 2QOHA 1U54A 3AXWA 3CQEA 4L3PA 5KZIA 3VN9A 3N4TA 1OIRA 3QX4A 3QHRA 4L7FA 4D4SA 4ALUA 3LXNA 5JGAA 3S2PA 4USFA 4RPVA 1H1RA 3G0FA 4I6QA 2BAJA 5E7RA 4IAZA 5KCVA 3D15A 3P78A 4FKGA 4O0YA 5J1VA 4XYFA 4F64A 4JG6A 2BFXA 4TW9A 2W9ZB 2QVSE 4M15A 4J52A 4HGTA 3UODA 2VD5A 3T8OA 3VS6A 3GC7A 3IW7A 5IMXA 2GCDA 3U51A 5DYJA 4OTHA 2Z7LA 4BVUA 5I3OA 4O96A 5DH3A 2JKKA 3R8PA 1QMZA 3VUKA 3HP5A 3I5NA 5BUEA 4FNYA 4TKSA 5EDRA 5LARA 2ESMA 3PA3A 4ACHA 3RINA 3TZ8A 2WIHA 2XB7A 1YI3A 3QC4A 4CLIA 1K3AA 1WBVA 4ZSEA 2OJFE 3R6XA 5AUWA 3IDCA 3NR9A 4S32A 3UJGA 1OGUA 1JOWB 1YHSA 4BCJA 2VO3A 1UU8A 2XEYA 4CZYB 3F9NA 1DI8A 1CKPA 2Y7JA 3WILA 4MD9E 5IISA 3CXWA 4LYNA 5EOLA 3ZLYA 2YCFA 3CJFA 2EWAA 2JBOA 3TN8A 2X9FA 1UNLA 3PG3A 4EOMA 1XH9A 5FP5A 2XJ1A 4JS8A 5HNGA 2JD5A 3HECA 1L3RE 2R3NA 2WMUA 3NNXA 3UIUA 2C6TA 2KTYA 4APPA 4BI0A 1OL6A 4ZIMA 1M2QA 1YXTA 4UMPA 3PVGA 3QUEA 5AR5A 3WIKA 3EJ1A 5HI2A 4E1ZA 3D2KA 4EBWA 4HNIA 2W99B 1VR2A 2W96B 3DAEA 4FIHA 4FKPA 3TNIA 2HWOA 4A4LA 5L2WA 1XKKA 3AOXA 2WOTA 4AZVA 1V0PA 4OUCA 5HTIA 3LE6A 2X8IA 4RFZA 3QC9A 4YLLA 1OVEA 3QTXA 4IB1A 4CZTA 3Q6UA 4AZSA 3D5VA 1OPJA 3TG1A 1V0OA 5IH4A 1ZXEA 4FZFB 4NWMA 2IZUA 1Z9XA 3R7UA 4IAIA 2PVKA 2PVLA 3WIGA 2AC5A 4U42A 2OWBA 2QG7A 3IECA 2X8DA 3PPZA 5TOZA 5HG5A 3KN6A 4DITA 3DK7A 3LFFA 3H30A 2XH5A 3C4ZA 3PLSA 1CDKA 3OF0A 1GIHA 4Y46A 4V05A 4B0GA 1P4FA 2X7OA 3U6HA 4FTJA 3CKWA 3LXLA 1ERKA 3FQEA 3E3BX 3FC1X 4XLIA 1FVRA 4TYGA 1PMEA 3A7GA 2FUMA 4AX8A 4QPMA 1RQQA 5A3XA 3TJDA 5BVNA 3ZSIA 2IO6A 2XK8A 5E90A 3LM5A 4IFCA 2QU5A 4QP2A 4Q9SA 1G8SA 3ULZA 3NYOA 3LCOA 5A4QA 4HCVA 5K5XA 5BPYA 4R77A 2UUEA 4QTCA 4FEQA 3C50A 3BE9A 3G51A 4FSQA 4EK6A 3PFQA 3I6UA 3F7WA 4QMVA 2YM4A 4AZWA 3SW7A 2C6MA 1OB3A 3FL4A 5B0XA 3FMJA 4IZAA 2OLCA 4I4EA 2G01A 4OLIA 2UW8A 5M55A 4F65A 4YBJA 4W4YA 5IKWA 4F99A 4Y95A 5K4JA 4JLCA 3FMMA 3KULA 2WMBA 3JYAA 2JC6A 3HNGA 3DAJA 4EC8A 5BMSA 3ENHA 3NNVA 2JITA 5L8KA 3R8UA 2QC6A 3V5LA 1AQ1A 5A4LA 1KOAA 1J7LA 3OY3A 3T9TA 5AP0A 4U79A 3UO6A 4BDJA 3G9NA 5EI2A 3GU5A 1Q8WA 1Y8GA 5AP5A 4BIBA 4F6WA 4GH2A 3CP9A 4C2WA 3FHRA 3EFJA 5L4QA 3QQGA 3O0GA 3UC4A 3W2PA 4FT3A 1O6LA 5AP2A 2CNVA 2BZKB 5GNKA 4HVGA 4RA4A 4M84A 3ZC5A 4G3GA 3JUHA 2A27A 3D5UA 3FY0A 4W4XA 3MFRA 4R7HA 3BV3A 1SVHA 2R7BA 3D5WA 4ORKA 5IPJA 4HVHA 4UALA 3FI8A 4M68A 2ITWA 4H58A 3WI6A 4EHEA 3GCUA 4USEA 4N57A 4D2RA 4M8TA 3R04A 1WMKA 4I24A 3HV5A 3QWJA 4LM5A 2IW9A 4ZLZA 5HU3A 2G2IA 4OW8A 3BX5A 3AG9A 4L46A 2BR1A 2JDSA 3ZU7A 4AP7A 5L2TA 5EI6A 3JXWA 2BHHA 2C30A 2Y4IB 3PG1A 3R1YA 4YZ9A 5IQGA 1KE7A 2ITUA 3EMGA 2R3FA 4M0ZA 5DN3A 5HVJA 3UO4A 4JX3A 2XNOA 3BEGA 5CXZA 1KV1A 4QRCA 5DT0A 2OIDA 4JDHA 3VHKA 5DA3A 2HCKA 2ZV8A 2H8HA 3PLAE 1RDQE 4NTTA 5CQWA 4AOJA 3VWAA 4QYFA 4FSZA 4EK4A 3QWKA 2W1GA 1JKSA 1U4DA 3VQHA 4DBNA 2CNQA 2QOFA 3LHJA 3G5DA 4F6UA 3MVLA 3QCQA 4NSTA 3LFCA 1M17A 3F2RA 1R78A 3OS3A 4MXCA 4O38A 3OD6X 4EQMA 4EYMA 4O7WA 4QNAA 4C2VA 2XK6A 2ONLC 4C3PA 2ZV2A 3FZPA 5DE2A 2F7ZE 3K5VA 3KRRA 3BHVA 4A06A 4LV5A 3P7CA 1BI7A 4HVIA 2EB2A 3FQSA 3H9FA 4M97A 4BFMA 3ZSGA 4H3BA 4KIKA 5IQCA 2YM7A 5AR4A 1ZZ2A 3DJ5A 5KX8A 3PA4A 1MRYA 3W8LA 5BUJA 3M42A 4PMPA 4JT3A 3RM7A 5DR6A 3WYYA 2QKRA 3OG7A 5CAUA 5M09A 4RJ3A 4O82A 4XV3A 4HGLA 4QMTA 4QP1A 5LVLA 5HTCA 4FTRA 2B1PA 3ZS5A 2B0QA 2VTJA 4YZBA 3NUPA 3R8VA 3UYSA 2VRXA 3UOJA 3UIXA 2WHBA 3FLYA 2B55A 4FL3A 3UP2A 1GZ8A 5IQBA 3SXSA 5LWNA 1YDSE 1CKIA 5AAFA 4L43A 3TACA 4PTEA 4DEEA 3IW5A 3MPMA 4I20A 2BKKA 4R8QA 2C1AA 4ANQA 5KMNA 4X2FA 5IA5A 3RM6A 3RVGA 5CENA 2E9PA 5AV2A 4C7TA 1SVEA 2F2UA 3I0OA 3A7JA 2B9IA 2YA9A 4YZMA 4L00A 3RP9A 3UDBA 2O8YA 3CSVA 4N4SA 3KMWA 1YHVA 4RWJA 2OJGA 3K3IA 3OP5A 5ETFA 1JWHA 1Q8ZA 5AWMA 2P0CA 4NUSA 5FXSA 5JK3A 2CLXA 3NDMA 5AP1A 3FMKA 4GJ2A 2C1BA 2IJMA 3C4FA 3HYHA 4XCUA 1BMKA 5ANOA 5DGZA 2WMRA 4XS2A 3SG8A 3ZM4A 3GNIB 5AV0A 2Y6MA 2IW8A 1JPAA 3WF5A 1YI6A 4MXOA 4DAWA 2ZM3A 3A8WA 3KK8A 3DLSA 4L42A 5JGBA 3FMHA 4E5BA 3R2YA 5K5NA 1UU3A 4FKIA 2EXCX 2WNTA 2JIVA 1Q8TA 4AGCA 2RG5A 3ACJA 5IA2A 2C47A 5ANIA 3SHEA 4I6BA 4FYNA 1OIYA 1XQZA 3B8QA 2O2UA 3GEQA 1H27A 3EH9A 3PWDA 5HG8A 4ZTNA 1TVOA 3KA0A 2X1NA 5T68A 5IA3A 3BRBA 3G2FA 4YC8A 3THBA 1REKA 5CT7A 1H8FA 1M2RA 3FDNA 3LXPA 4G3EA 4AQCA 4I3ZA 2XBAA 4FTOA 4YHJA 2WMWA 4KSPA 4AXAA 4CG9A 3KU2A 5AV3A 4Y85A 2XIZA 2QI8A 4QYEA 2FO0A 4LGGA 5IQDA 2VTRA 3M11A 3PVBA 4FTKA 2GFSA 4CFUA 4ANNA 3Q9YA 5JGDA 4JL9A 3A99A 3Q32A 4UN0C 2HY81 4IXPA 4QO9A 4DLJA 3JY9A 4IADA 4PTCA 3FBVA 4NT4A 3UBDA 4EBVA 4GVAA 3TV7A 2YACA 4FV3A 3JPVA 2B9HA 1QPEA 2CKPA 3NLBA 4FTQA 2PVFA 4C33A 1PXKA 1KE8A 2F7XE 1YKRA 4CTBA 3PA5A 2A4LA 5A9UA 2XUUA 2UVYA 3GOKA 3NUNA 3MV5A 4JIAA 1PMVA 4YJRA 4EJNA 4ASEA 3R28A 4RC4A 5CAOA 4JBQA 3W2QA 5HICA 3RWQA 4L7SA 2UZUE 4U43A 4O7ZA 4OT6A 4YTHA 2Y4IC 4ZTMA 4HOKA 3NUSA 3PPKA 2OIQA 2XM8A 4UV0A 4BBFA 5E1SA 1U46A 3EZVA 2LAVA 4A9UA 1ZOHA 2J50A 4O0XA 4CMTA 2JKQA 4UMTA 4BDGA 5E8VA 4C37A 2VTHA 4EWHA 4I1ZA 4O6LA 1EH4A 3OOMA 3OXTA 4GFOA 3WF9A 3ZXTA 4QMUA 4YZCA 5AUTA 1PKGA 4CRSA 4M12A 1YXSA 2VTLA 2CGWA 2PVRA 2W17A 4H3PA 3Q60A 1H08A 4WRGA 2OW3A 4Y5HA 5LVOA 4FKWA 3HLLA 4QMOA 5CAVA 2YIWA 3O96A 3QRUA 4X7QA 5IEYA 3PDTA 3DGKA 4FNXA 4TL0A 4D28A 4PWNA 4GK4A 4FTIA 3ATTA 3A8XA 5GIPE 3LJ1A 4DF3A 5AX9A 1ZMWA 3QRIA 3HEGA 2XK4A 4C35A 1J3HA 2W1IA 1FBNA 5HO7A 4C4HA 4AFEA 4XEYA 4NZWB 3LJ2A 4HNFA 4MHAA 3QLGA 4MCVA 3CJGA 4TY1A 3SOCA 4RJ6A 3DAKA 1MRVA 3KEXA 3PP1A 3VS1A 4MD8E 2W7XA 4AW2A 3EN4A 2W0JA 4MX9A 4TPTA 1WCCA 1W83A 3N9XA 5FG8A 5JFSA 3GU7A 2H34A 4IW0A 4MEDA 5AP6A 4ACMA 3KRJA 4TWOA 2KULA 2G1TA 4FF8A 4G3CA 4ZSLA 4A9YA 3ZRMA 4BKZA 3DBCA 3E3PA 4PNKA 3KRLA 5AUUA 5E92A 3ORIA 4BI1A 4BDDA 2HIWA 4RWIA 5FEQA 4AA5A 4F9AA 4IE9A 2YDJA 4EJ7A 2WU7A 3RKBA 4AN3A 4EH6A 2UW5A 5E1EA 5HCYA 5I0BA 2XK3A 2I6LA 4IDVA 3VVHA 4PP7A 4LOPA 3OT3A 3MW1A 2RF9A 3F5GA 3PVUA 2CJMA 4J96A 5DG5A 1R39A 4U6RA 5FM2A 3HMNA 2EB3A 3W2SA 4EK5A 5CEMA 4RT7A 2FVDA 2YIQA 3HMOA 4MBJA 4PY1A 4RX5A 1XR1A 2NRUA 4MXAA 5J79A 4HYSA 2YCRA 2YN8A 4K9YA 4PRJA 3F2AA 4QD6A 4K18A 4ZJJA 3PVWA 5CI6A 2VWWA 3OCGA 5HESA 3VF9A 2EU9A 3EQCA 4AN9A 4K77A 4RRVA 4IAKA 2WTCA 4QTAA 3KF7A 4M69B 2VO6A 4QP7A 4ZP5A 2OXXA 4J99A 3ZCLA 4M67A 5DRBA 2CCHA 2QLQA 3UG2A 5D10A 5HE1A 4TZRA 4GG7A 2PYWA 3VIDA 4LOQA 3QTSA 4QMQA 5LMBA 5LXMA 2ZYBA 2HZ0A 3SXFA 2IZRA 4AT3A 4B9DA 4FT7A 2FH9A 4KKEA 2VTTA 2WELA 3D5XA 2VTNA 4KS7A 3E87A 4GKHA 5DT3A 4JX7A 4DH7A 3E64A 3ZSHA 4UXQA 2R3PA 3ZO1A 3C9WA 3MA3A 2BKZA 4MD7E 5DR2A 2GNGA 2VX3A 4EUTA 2ETRA 4DHFA 5CVFA 2HZIA 4FKLA 1DS5A 2X4ZA 4RFMA 3V51A 4O0WA 5IA4A 5FXQA 4QQJA 4S33A 3BQRA 2YDKA 4LRJA 1TKIA 2E9VA 4UMQA 5I9VA 2O65A 4V0GB 1OBGA 2VGOA 3DXNA 2DS1A 3WYXA 3R9RA 3RK9A 4EH2A 2PHKA 1FVTA 4IM0A 3L8XA 5CSVA 2R3LA 2JLDA 3VUIA 4IWQA 2W1FA 4HW7A 4RZVA 4UYNA 4QP4A 4L44A 1PHKA 3LQ8A 3ZH8A 2OBJA 4RGJA 2XJ2A 2P33A 4S31A 2V55A 2X6DA 1T45A 4CFXA 1XH8A 5J8IA 4D4VA 4J7BA 4MAOA 4FL1A 4IWOA 4XV2A 4X6RA 5BVWA 3Q04A 4CFNA 2PUIA 3RK5A 2UW7A 3OTVA 4GU9A 5TF9A 4AW0A 4C3FA 2RFEA 3EFLA 2CSNA 5CLPA 3GC8A 3GCVA 4J98A 3LFDA 3KREA 3TDWA 1BLXA 4BWXA 4R1YA 5E4HA 2YAAA 1E9HA 4TT7A 3OOGA 5HG9A 2V0DA 2GQRA 1ZYJA 4CG8A 4C8BA 3R83A 2R0UA 3W2CA 5HNIX 5LVNA 3QTZA 3NAYA 2R3KA 3ZDUA 5IQFA 2OXDA 4H39A 2BRGA 3UNJA 5EQYA 4ZMFA 3Q4CA 4X2KA 2FA2A 3I79A 2FSOX 3P86A 4W4WA 2W05A 5I9UA 2J0JA 4EQUA 1WZYA 3I60A 4Y73A 4X3FA 2WQMA 1UKIA 2C5VA 2WTVA 5ANJA 1YVJA 5BNJA 4AAAA 5HTBA 4IAFA 3OCBA 3TNHA 2J5EA 2I0EA 3C4WA 2BAQA 3NX8A 4GL9A 4MKCA 1LP4A 5E8SA 5AR3A 4JDKA 1REJA 1QPDA 1QPCA 3EFWA 5HIDA 4BIDA 4BYJA 3IW4A 4G5JA 3KXGA 5HQ0A 4N6YA 1ZRZA 2VWBA 2XNBA 3ORZA 2DUVA 4FTTA 4FV1A 2XRWA 4NL0A 2R2PA 2GSFA 4JJRA 4PPBA 4ITHA 4C57A 4ZSJA 4USDA 5EYKA 4YUQA 5HLWA 4FKVA 5FWKK 5D9HA 4L53A 2A2AA 5EDPA 4F7LA 1A06A 3QUDA 4PPCA 5B2KA 3QD2B 4PNIA 4D55A 2C6DA 5CALA 4FG8A 2C68A 3MGYA 4FI1A 3LXKA 3WZKA 3VUMA 4YBKA 2RSVA 4K8AA 1V1KA 3F66A 3A2CA 5A4CA 5CF8A 2WEIA 5IEVA 3KXNA 1YXXA 4JI9A 3JVRA 4F09A 3O7LB 3Q96A 4E73A 4L01A 3L9MA 3V5JA 2C5OA 4C36A 4BL1A 3VUTA 1OI9A 4F08A 5M4CA 1Z57A 4IB0A 3UG1A 2WMXA 3MN3A 3TV6A 5ETCA 3VF8A 5CX9A 4O86A 3BKBA 4BCIA 4DC2A 4WHZA 3FXXA 1BI8A 4APCA 4E4MA 5L6OA 3Q2JA 4IAAA 2O63A 4W4VA 1NW1A 4AS0A 4QQTA 4KINA 3TXOA 4BDEA 4JR7A 4EOKA 5HIBA 4O21A 5KMJA 2QR7A 2V62A 3PY3A 1R0PA 5E8XA 4XV9A 5D7VA 2QOLA 1P4OA 3RAHA 2UZVA 4G17A 4MQ1A 3D14A 5K9IA 2WEVA 4OTQA 5JSMA 2PE0A 4DEAA 3MBLA 3NIZA 4XX9A 3R30A 4JBVA 1M52A 3CGFA 1APME 3PZHA 4YSMA 4DG0E 4YJTA 3ETAA 3HMIA 3P08A 4TYHA 4BCGA 4NFNA 4GMYA 4RG0A 2XS0A 3QTRA 3F61A 4A4OA 4IB3A 4FA2A 3IDPA 5HX8A 4ZK5A 3BELA 3QZGA 4M14A 4GT3A 4D1ZA 2C3JA 5AP4A 1Y8YA 3PZEA 2I1MA 2OGVA 4F0FA 1P14A 2DQ7X 4CNHA 3A4OX 4ACCA 2LGCA 4JQ8A 2WQNA 2WTWA 2PVYA 2H9VA 1YW2A 1ZOGA 3HA6A 1GAGA 2YHVA 5KO1A 2XRUA 2BMCA 2J0KA 1YWRA 4FODA 4EH5A 3UZRA 5M06A 3DNDA 3PJ1A 4JBOA 5KE0A 2ZMDA 2RFNA 5GIOE 4UXLA 1OPKA 2W4OA 3Q3BA 3WF8A 3SGCA 4FK3A 1QCFA 4U3YA 4F63A 4JBPA 1NA7A 5CYIA 3I4BA 4II5A 2B7AA 5FBOA 4EKKA 3LIJA 2VWZA 4MVFA 1XBCA 3BPRA 3UOLA 3UVPA 1Q3WA 1OKVA 5LVPA 3RPRA 1M7QA 3DTWA 4R7BA 2QHNA 4U80A 3UIBA 3VJOA 3KXZA 3EYGA 3QU0A 3KVWA 4FVQA 4C62A 5BVEA 4FIGA 1J7UA 3WOWA 3MYGA 4XG7A 3ZM9A 3GVUA 3FMLA 4IIRA 4U44A 5E9EA 4NKAA 5JEBA 4GW8A 3LAUA 3S4QA 2J5FA 2QURA 3QQJA 1JVPP 4ZXTA 3O7LD 3UO5A 2E9NA 4F0IA 4F1TA 3R63A 4AE9A 3TTJA 4A7CA 5EHLA 4FSWA 4E7WA 3Q4ZA 2BPMA 4PTGA 1TQIA 4OR5A 3QYWA 4BDIA 4EH4A 4L8MA 3LVPA 2PVNA 2C6LA 2ZDTA 2I0VA 3OWPA 3FL5A 4O0TA 5AAGA 5L2SA 1OIQA 4FKSA 3VW8A 4C0TA 4C59A 2B9JA 3KL8A 4RVTA 2R3GA 1K9AA 4K0YA 3HRCA 1DAWA 3QTWA 3GXLA 1SZMA 4H36A 5C9CA 1F3MC 4ZLYA 5IG1A 3AQVA 4ZLOA 2X2MA 2JDVA 3UQGA 5C03A 2WQOA 2I0HA 4G34A 4BZDA 3D83A 4DFZE 3UNKA 3NMUF 4QYYA 4EYJA 3LMHA 4O81A 1ZWSA 3PXZA 3MDYA 1JSUA 4IQ6A 5CT0A 2IZSA 3RI1A 3FZOA 3ZFMA 3Q52A 5HVKA 5JQ8A 5FUTA 4YJVA 1UV5A 3SDJA 4CXAA 1PF8A 5F9EA 3EKNA 3FMNA 3MH1A 5KUPA 3ZUTA 1GY3A 5JFWA 4EZ7A 4D9UA 3HUBA 4GCJA 3S00A 2JFLA 3HUCA 4O7RA 4ZSGA 3NAXA 1YWVA 3PIZA 2R64A 3QCYA 4MH7A 5HEZA 5J7BA 2XYUA 5L8LA 2HELA 4I5HA 4HCUA 4QP6A 4X2NA 3GCPA 4FKJA 3UVRA 4I0RA 4JVGA 3R8ZA 4BTJA 3SA0A 3KKVA 4BIEA 3SD0A 4BZOA 4PV0A 3LFEA 3RTPA 1I09A 3GBZA 3EQDA 4RZWA 4C02A 4E3CA 3QD0A 5A4EA 3NUXA 4FTMA 1B39A 3DCVA 5CAQA 3VS0A 2UVZA 4F1OA 2BROA 4RIXB 3OEZA 3FZSA 3HAVA 1CSNA 2C69A 3PPJA 4KRDA 2F2CB 4RA5A 4IM3A 4YNEA 5EFQA 1LPUA 5B2LA 4O7YA 2JGZA 1H1WA 2WO6A 4RQVA 4V04A 1NY3A 1XH6A 3T9IA 2R3MA 3CPBA 3VQUA 4AW5A 4OTWA 3NVMB 3NYXA 1QL6A 3H4JA 5IDNA 3IK3A 1GZNA 4LOOA 1PKDA 5CU4A 4EHVA 3VS3A 4E6DA 3QCXA 3NUAA 2PWLA 3C4XA 3VRYA 2WZJA 3R7YA 4DGOA 4FZ7A 4WNPA 1P2AA 3FLZA 3E93A 2X2KA 4FV6A 4HYHA 1OKYA 4AW1A 5HBEA 5J5SA 1UWJA 4E6CA 3AC1A 4FOBA 1XWSA 4GT4A 2NRYA 3DFAA 4G31A 4ERWA 3MH0A 3RBWA 2C5YA 2B54A 5CSXA 4ASZA 2WTJA 3DJ6A 5FGKA 3ZO2A 1JKTA 1J1CA 3TUCA 4R5YA 2GNJA 3SKCA 3FHIA 3F3VA 3I7BA 4FIEA 3VULA 2QOIA 4EK8A 4U9AA 5T3QA 2H96A 3EN6A 3V5TA 2WKMA 5DRDA 3DKCA 3VS2A 1TQPA 4FGBA 2G15A 1IA8A 2Y9QA 3ULIA 4NTSA 4KIPA 2ITQA 3TKUA 4HYUA 4IC8A 3C13A 4MXYA 3W18A 2FYSA 2VNYA 4O22A 2ITTA 4FG9A 2RGPA 4PL3A 4WNMA 5EM5A 5JMSA 2PL0A 2VU3A 1MQ4A 3SG9A 1L8TA 2JEDA 4BGQA 4DH3A 1XH4A 3DK3A 4ZTQA 4BKYA 4AGUA 5M44A 1Q8YA 3F7ZA 3T3UA 3VRZA 5F4NA 4QMWA 4RVMA 3BI6A 4BN1A 2GTNA 5C8NA 2X0GA 4L6QA 1T46A 3OCTA 2B4SB 3A7FA 3K5UA 4UZDA 3SQQA 1XBBA 4PX6A 3W2RA 3ZBXA 1PMUA 3IPHA 5IUGA 3DV3A 4LG4A 3DQXA 2PK9A 2ETMA 4U45A 5IA0A 4WBBB 5G1XA 3FPQA 4F70A 3MSSA 4AOTA 5JRQA 3RCJA 3H9OA 3WF6A 1FQ1B 1FGIA 2OU7A 4RX8A 4EH8A 5D11A 4N70A 4C4FA 3C4CA 1WVWA 3G0EA 2HXLA 3TL8A 1W7HA 2ONLA 4DH8A 4NFMA 4KIOA 5HKMA 3KXXA 4D0XA 3WARA 3DXQA 2PY3A 3F2NA 5EHOA 3R22A 5DHJA 4G2FA 4BDBA 1H28A 4FV8A 3E62A 5CU0A 1YXUA 4HCTA 5HBJA 1ZOEA 4BRXA 3ORXA 1Q41A 2Z7SA 1WBWA 4RBLA 1STCE 3PXFA 1O6KA 2QO2A 5M53A 4QMXA 3O8PA 2C6OA 2CKQA 3NUYA 5GJDA 2OF4A 2X39A 4E4NA 2OFVA 3VAPA 2GQGA 3R7GA 4RQKA 2X7FA 3RZBA 3GQLA 4C4GA 3L9NA 1OPLA 4NJ3A 1PJKA 1IEPA 5CS6A 4B8LA 1IRKA 1M7NA 4JQEA 2BFYA 2VTOA 3W16A 3W33A 1XH7A 3QQFA 3ZEWA 3R9NA 3VBYA 2XYNA 3PUPA 3UPZA 3FSKA 4EHGA 4LL5A 3ITZA 3OTUA 5KHWA 5IQHA 4BDHA 2J0IA 4IZ5A 3EKKA 4E5WA 4OTIA 4IEBA 5DLSA 5KZ0A 5HO6A 3QKKA 4GIIA 4F6SA 2GMXA 5F95A 2ITZA 2QOBA 4Y8DA 2B9FA 4IHPA 4L67A 3U9NA 3LFBA 2QHMA 4RIXA 2Y0AA 2OKRA 2Z2WA 4BTKA 4JG8A 2F7EE 4UX9A 2XKDA 4CMOA 5CSHA 4J1RA 5EW8A 4AFJA 2R9SA 3CE3A 4FUXA 5AJQA 2OI4X 3I81A 3CD8A 5JZNA 1BX6A 3QFVA 4U41A 2QCSA 3L1SA 4QMMA 5AFVA 4BY9E 5DWRA 1PXLA 2OJ9A 3VS5A 4BDKA 4MBLA 4XG6A 4D4RA 3M2WA 5LCKA 4J71A 3CD3A 3GENA 1R0EA 4GV1A 3REPA 5CU6A 1JKLA 3GB2A 3QQKA 4PL4A 5K3YA 4BTMA 1AD5A 4PF4A 2PMLX 3AC8A 2RFDA 2GS2A 3EL7A 3QCSA 3RPSA 4CFVA 4YR8A 2Z7RA 3OWKA 4GSBA 3HKOA 4W9XA 2XP2A 5H8EA 3BU6A 3QA8A 4NK9A 3VBTA 3DKFA 3ORLA 4O0SA 4CT1A 3QZIA 2RG6A 3P7BA 4G9RA 3ROCA 3OMVA 4IAYA 5F94A 1OITA 3MI9A 3AMAA 2OK1A 1SVGA 4YO6A 1PY5A 1Y57A 2J51A 3F6XA 4HGEA 5GJFA 1V0BA 3QGYA 4UYAA 1ZLTA 2BRNA 3DU8A 3HGKA 3PY1A 5AV1A 4BWKA 1W82A 3E8CA 4BCQA 3BWJA 2PMOX 1VYZA 1LEWA 3EHAA 3D94A 4AT4A 4BHNA 4DFYA 5AV4A 3OFMA 2VX0A 3FKLA 3BQCA 3HV7A 1OUKA 3HMPA 2GHLA 4DFNA 2GNLA 2CGUA 3OXIA 4DGGA 2P2IA 4M0YA 5AMNA 4YTFA 2W1HA 4K6ZA 4ZJVA 1O9UA 2ERKA 3GGFA 5AIRA 2ZB0A 2JDRA 2Y6OA 4XP0A 2GS6A 3DS6A 2YM8A 4FYOA 3F3WA 4GJ3A 3OC1A 4HPUE 3VW6A 4RFYA 4ZTRA 4OGRA 3FMEA 4CYIA 4FSTA 5IA1A 4OTPA 3CQWA 5HCZA 4FV9A 3OUKA 3VC4A 2JDTA 3VBQA 2A1AB 5ITAA 1H26A 3Q4UA 4WKQA 1ND4A 4DBXA 2CKEA 4AUAA 1FGKA 4BBEA 5HD4A 2R0IA 4UWBA 4TWPA 2DWBA 3L9PA 2JFMA 4B4LA 4WIHA 4BCMA 4ZZNA 4AU8A 2IVTA 4NM3A 3ZRLA 3Q6WA 4QP3A 4NW5A 4MWIA 4EZ5A 5AM6A 3GCQA 4AG8A 3HDNA 2UZOA 4YPSA 3ORPA 1WBSA 5EW3A 5CEOA 4BCNA 5DEYA 3C5IA 4BGHA 1SNUA 4QP8A 4G3FA 1WBOA 4AA0A 4G6OA 4EZ3A 3VS7A 4ZS4A 3ZLXA 3OVVA 5HBHA 2XCKA 5JRSA 4HGSA 2O0UA 3ZZWA 4BCFA 3TZ7A 5JQ5A 2H6DA 5KMMA 3KK9A 4JG7A 4EORA 3R9DA 3BYSA 3LKMA 3MH2A 1KOBA 4XOYA 2HXQA 4IDTA 3DBFA 4MQ2A 4BDCA 3MJ1A 3ACKA 2CLQA 4XG8A 3UP7A 1PRYA 4IWPA 3QYZA 4ASXA 4W9WA 4K1BA 3PJ8A 4LRKA 2O3PA 2XMYA 2CN8A 3PXRA 4QOXA 3ORNA 4ACDA 5KMKA 3G9LX 3GFEA 2HW7A 1JSVA 3DKOA 5DR9A 2C0OA 4E5AX 5CY3A 4F9CA 2O5KA 3FUPA 2ERZE 3IOKA 4RIYB 4XG4A 1ATPE 4C4EA 1ZARA 5EOBA 4U0IA 4FSRA 3ZONA 3IW6A 4NYEA 4XOZA 4FTCA 4IH8A 4O6EA 5EDQA 5AX3A 4UWCA 1R3CA 5FTGA 4RX7A 4D0WA 3FYJX 3LFQA 5DBXA 2W5BA 4YTCA 5HORA 3KY2A 4TWNA 1Y6BA 2PVHA 3Q9ZA 1YOJA 4PMMA 3GU4A 4NW6A 3NGAA 4U97A 4EOLA 4YHTA 4LMNA 4S30A 1G5SA 5LVMA 4OTDA 2X81A 2QOQA 2BTSA 3BLQA 5CU2A 4DFBA 2XBJA 2C5NA 2X9EA 4JNWA 5M51A 4BYIA 2YCQA 4KA3A 2FSTX 3CCNA 4IX5A 4X3JA 3EWHA 3ORMA 2VZ6A 4OT5A 3FE3A 2XM9A 2OH4A 4ANMA 2P4IA 4YJSA 2C6EA 3A7IA 3R1QA 3ELJA 3VBWA 3CIKA 3UMWA 2XF0A 5CSPA 4WO5A 1PMNA 4LGDA 4O7SA 1FMOE 2A0CX 4WNOA 3ZBFA 4CV9A 4FC0A 5HX6A 3EQPA 5KHXA 2EXMA 2Z8CA 4KRCA 2YABA 5TR6A 4EOIA 4HVDA 4Z7HA 4QMYA 2YDIA 2IVUA 5E8UA 2XIXA 4J8MA 1W84A 4GUEA 5E91A 2YERA 3QTIA 2XIYA 5IH6A 2VWUA 4ALWA 4FVPA 4O0VA 3U6IA 4QMNA 1NVSA 2RL5A 3K2LA 3ZLSA 3ZC6A 4BCOA 3R71A 4E93A 1VJYA 4CLJA 2GPHA 3D9VA 3T3VA 5HIEA 4RJ5A 2R3RA 3A62A 4D2SA 2QLUA 4R1VA 5H9BA 5GJGA 1BL7A 3RHXA 2RKUA 1JBPE 3V5PA 2CDZA 3OCSA 4KIQA 4NCTC 4KAOA 3L9LA 4EHZA 2BZJA 2ZB1A 3NYNA 1JLUE 5LJJA 4H3QA 4N6ZA 3FSFA 3LLTA 3F3UA 4FT9A 4BB4A 5AAEA 2WMQA 3B2TA 3BIZA 4HZRA 4Q9ZA 3E92A 4B99A 4K2RA 2X2LA 3UMXA 3QTQA 4XRJA 3AT4A 3V8WA 3MVHA 5AUYA 4IM2A 4EC9A 2UZEA 2R4BA 4UMUA 4O7LA 4RIOA 4AZTA 1Q61A 3COKA 5IQIA 1BKXA 1YXVA 3H3CA 5JN2A 3FXWA 3BYOA 3AT2A 4XBRA 3ZDIA 3H10A 5EHYA 4GKIA 3ZZEA 3EQGA 3RAIA 4QYHA 3MVJA 3BWFA 5F1ZA 3CGOA 4NIFB 4OBPA 5FRIA 5AR7A 4ACGA 2YWVA 4ENYA 4ZY4A 1F5QA 4FV5A 4A4XA 3MJ2A 4X0MA 3E7OA 1GNGA 2C3IB 4EQCA 5GZ9A 5I9YA 4CMUA 1PXPA 4LL0A 3FLNC 3JR1A 3ZMMA 3UOKA 2XKFA 2ITPA 2PULA 1PXIA 1ZAOA 3MY5A 1UVRA 3ZTXA 3WZEA 3CR0A 5HVYA 5ACKA 1U59A 1E1XA 3C0GA 1KE6A 3IG7A 3POOA 3PSDA 1PXJA 4EOPA 4DT9A 3DNEA 3ZO4A 4WRSA 3U8WA 5K4IA 3TM0A 3VBXA 4R5SA 3O8TA 4QQCA 5BUIA 4WUAA 3ZO3A 3TZ9A 5HE2A 2ETKA 4E20A 3QBNA 1ZY5A 3NRMA 2ITOA 4I6HA 4UWYA 3OY1A 5M57A 3MFTA 4I94A 3QALE 3QXPA 3I7CA 2YITA 3KGAA 3NW7A 3RHKA 2VWXA 2WQBA 3F69A 4JXFA 3QQHA 2AUHA 2YLFA 4WOVA 4RIYA 3NCZA 4UY9A 3DOGA 5EH0A 3RJCA 2VO0A 3C4EA 5IDPA 3G6HA 4JDJA 5EKOA 3CTHA 5DEWA 1Q8UA 2Z7QA 4G6LA 4S2ZA 3EQBA 3IDBA 4IANA 4EH3A 4BICA 4OBOA 5E8ZA 3WE8A 4FR4A 4U7ZA 4YMJA 2J4ZA 2J9MA 2G2FA 2GNHA 3KB7A 3L8VA 4HJOA 4QPAA 4YTIA 4BDFA 2JAMA 2YM3A 3VUDA 2YJRA 4LMUA 3QGWA 2OICA 3HVCA 3Q9XA 1GZOA 5CF6A 1PW2A 5AA8A 5LMKC 3LPBA 3B2WA 4IX6A 3RPYA 4F9BA 2CNUA 3R7IA 5EQEA 4QTDA 4RVLA 4F0GA 2EUFB 5BVDA 2QODA 3AT3A 4IBMA 5LMAA 3Q2MA 2WTKC 2CMWA 1H4LA 2P55A 4B6LA 2NO3A 3RGFA 4XV1A 3AMBA 5CZIA 1W0XC 5M08A 2UZWE 2CGVA 4EKLA 2F57A 4LI5A 3DT1A 4CZUA 5IEXA 4O91A 4UMRA 3V5QA 3LFAA 3NPCA 4S34A 4ZTHA 3RK7A 5A46A 1NXKA 4KUJA 4CVAA 3LZBA 3VNTA 5M56A 3EQHA 3HP2A 5J9ZA 2WXVA 2WMVA 4X3FC 1M14A 3V8SA 4R3RA 4YJUA 4M3QA 5JFXA 4JAJA 3PWYA 3IO7A 3MY1A 4TYIA 2VTQA 5J9YA 4IACA 3L8SA 5ANKA 4CV8A 1S9IA 4YC6A 4C4JA 2W1CA 5A14A 2UW4A 3OBGA 5F20A 5JFVA 4FX3A 3UVQA 1FMKA 2UZTA 4M69A 4WA9A 5A54A 4LRMA 3ODZX 3ZOSA 3VS4A 4ZMEA 1FOTA 3MFSA 3NUUA 1SNXA 5I9ZA 3UQFA 2WQEA 2R3OA 3IGGA 4XHKB 3LJ0A 2YJSA 4FEWA 3OROA 3C0IA 3BLRA 5EM6A 3B8RA 2P2HA 3DBEA 4WSQA 3AGMA 3ANRA 4RMZA 5H8BA 4H1JA 4ZAUA 4GK3A 4BCKA 2C3KA 3OZ6A 3HV4A 5IF1A 3NW6A 5EM8A 2HOGA 2R5TA 4CFFA 4KWPA 3QX2A 4ANOA 2VGPA 1W98A 5JZJA 5LOHA 1M2PA 3AD4A 4O2ZA 3FI3A 4CKRA 4JAIA 2G2HA 4EOQA 2QG5A 4WG4A 3FEGA 4YZDA 1GZKA 1H1QA 2YFXA 5GHVA 3SAYA 5KMOA 4R78A 2OSCA 2IZTA 4V0GA 3WBLA 2PTKA 4G3DA 4I21A 3DLZA 4FZ6A 2OFUA 5J1WA 3QRJA 4A9TA 1K2PA 4C58A 2R3HA 1UA2A 3R2BA 3G90X 2ZM4A 3QTUA 4L52A 4PDOA 1S9JA 5L8JA 2YISA 4O1OA 5D1JA 5AP3A 4U40A 4MK0A 4Y83A 2QR8A 4UB7A 4A9SA 3FQHA 4DA5A 3I1AA 1U5RA 5HOAA 3TUBA 4X2GA 3MH3A 2WFYA 4ZEGA 1HOWA 5H3QA 3FXZA 1FVVA 2XKCA 3TI1A 4F9YA 2WB8A 3P9JA 1YWNA 2GQSA 4YSJA 4WNKA 2XJ0A 4R7IA 1FINA 1H01A 3AC2A 4RJ4A 3C7QA 3KF4A 2BZIB 3W2OA 3K3JA 3ZHPC 2BZHB 4RJ7A 3U4UA 3SC1A 3ORKA 4J53A 4I93A 1ZY4A 4L68A 4TXCA 4GEOA 1Q99A 4O7TA 3COMA 4ITJA 5J87A 4Z7GA 3QKMA 3FKNA 5H2UA 4FV4A 3NNWA 1JQHA 4JDIA 4ZTSA 4C61A 1LEZA 1WBPA 2BAKA 3D2IA 5DPVA 5EM7A 5HE3A 4EOOA 1YQJA 4XLVA 5A6NA 2W5HA 3PXYA 4G1WA 4IJ9A 1BUHA 4DFUA 3I5ZA 1H24A 4ANSA 3HV3A 2YAKA 3A60A 4ONAA 3W8QA 4HYIA 3COHA 1LUFA 3DA6A 1DI9A 3FZTA 5IQAA 4FKTA 3DK6A 4IX4A 1VEBA 3FV8A 4TRLA 3ODYX 4XH6A 4DG2E 3S0OA 3LQ5A 2JIIA 3MPAA 3RMFA 5KBRA 3KXHA 4XUFA 1MUOA 5ETIA 4BTFA 2QNJA 2YIXA 2I40A 5ETAA 3QRTA 5L6PA 3MPTA 2VTAA 2QO7A 4AZEA 4B7TA 3A7HA 4ZTLA 2QOKA 3HX4A 3P5KA 4NJDA 3TT0A 3AGLA 3RALA 2YZAA 4CYJA 3I6WA 2FSLX 4EI4A 2PUPA 4TYJA 3HDMA 3EQRA 2WIPA 2VWVA 1FPUA 4QNYA 2BDFA 3VBVA 3GC9A 1H25A 2FGIA 5DT4A 5CWZA 1PYXA 3C1XA 5AR8A 5C4LA 3F88A 4FKOA 5KKRC 2YM6A 2HZNA 3F82A 4FTUA 3R8LA 1URWA 3ZFYA 4C3RA 4KBCA 3GU8A 4D5KA 2VTMA 4PDSA 2YIRA 1IASA 4DEIA 3PJ2A 5IU2A 2BVAA 3FLWA 2JDOA 1U5QA 4CEGA 1AGWA 2V7AA 1YOMA 2VUWA 3BBTB 4FTNA 5DNRA 4FV0A 2DYLA 2BILB 3OW3A 2Q0BA 4FIJA 2C6KA 5CXHA 4HPTE 4AACA 4OTFA 3BHHA 3DB6A 4L9IA 2I0YA 3TIZA 2UZDA 3ZXZA 4KIKB 1XJDA 3P4KA 4QMSA 4YGAA 2ZJWA 5CVGA 5EI8A 4YPDA 4Z55A 1CKJA 2CHLA 3IS5A 4FT0A 3GU6A 3UIMA 3D0EA 3ZUUA 5KBQA 1YRPA 4O0RA 3WZDA 5ANGA 2WMAA 1IR3A 4I0SA 5CZHA 1MP8A 2XCHA 4OTRA 2XNMA 1YI4A 3DY7A 4YZNA 3FJQE 1NVQA 2BIYA 4I6FA 5EG3A 1YDRE 3EN7A 3LOKA 3ID6C 1SMHA 4IVDA 3BGZA 2NPQA 3P23A 3DJ7A 4U81A 5FEEA 1XO2B 4DINA 2RFSA 3BGQA 3BLHA 1ZYCA 4ARKA 5I9WA 3R0TA 4KSQA 2SRCA 1Q3DA 2IPXA 1I44A 4FIFA 4G16A 4GVJA 4AGDA 5IH5A 1TQMA 4I5MA 4PP9A 4AWIA 5CEKA 1CM8A 4RVKA 3VUGA 5K0XA 4FEXA 5I4NA 4MXXA 1JAMA 2ITYA 4GUBA 2C4GA 2RIOA 4AE6A 3E7VA 3NVKI 4EL9A 3BHUA 4P4CA 4FKUA 4BGGA 3LQ3A 4O83A 3PXQA 4D58A 3TKIA 1J91A 3CPCA 5HNBA 3V6RA 4D2TA 2HAKA 4CCBA 2ZVAA 3MS9A 4O0UA 4WG3A 5EKNA 3GQIA 4DFLA 2NNWB 3O17A 1J1BA 3AD6A 3V6SA 5HCXA 1H1PA 3CY2A 3O2MA 4P2KA 3COIA 4XMOA 4RIWB 4OAVB 5HGIA 1QPJA 1ZYDA 2XKEA 3K54A 4ITIA 4QTBA 5HG7A 3RZFA 1O6YA 4L45A 5BVOA 4PDYA 4D2PA 3H0ZA 3NW5A 4XP2A 2W5AA 4GT5A 1Y6AA 2UW3A 5BYZA 4MF1A 3DZQA 1UU7A 2VV9A 4DEBA 3DBQA 3UOHA 4FEVA 3QKLA 3UQCA 2B52A 2OH0E 4U5JA 3JS2A 5CEQA 3CBLA 4KB8A 3MFUA 4WSYA 3RWPA 3FZ1A 4DEHA 4YO4A 3TV4A 5FEDA 4C38A 4O7NA 4Q5EA 4RWKA 3BU3A 5C27A 4Z3VA 4L3JA 3U54A 2CN5A 3O50A 4CQGA 4D9TA 3RAWA 3AC4A 3P0MA 4G9CA 4PUZA 5KMIA 3R21A 4RJ8A 3E8DA 4YLJA 4CT2A 4E6QA 4F7JA 5TO8A 3PY0A 3PSCA 3IKAA 4NM0A 4GK2A 4AA4A 5C01A 4BWPA 4ENXA 3V04A 4RLKA 2OF2A 4DLIA 4XG2A 5T6KA 4ZZOA 5HU9A 4TNBA 1B6CB 1XH5A 2V5QA 2YWPA 3CC6A 4XBUA 2CKOA 4EWQA 1Q97A 3HA8A 5AUXA 5L2IA 4QMLA 3ZEPA 3I0QA 5AA9A 5AADA 4FIIA 4M66A 3ZUVA 5D7AA 4MF0A 4CTCA 1JSTA 3BYUA 2QD9A 4IJPA 1YHWA 3MY0A 4IVBA 4CFMA 4IVAA 4WBOA 3GOPA 1Q4LA 1PXMA 2Y8OA 2YLEA 4I4FA 3HL7A 4F7NA 4DTAA 3PTGA 4EK3A 1H00A 2JKMA 3KRWA 3ORTA 3NNUA 4I41A 4RWLA 4XRLA 4NH1A 3RPOA 4CCUA 4EONA 2QQ7A 3JVSA 3OHTA 3NEWA 2C0TA 2GTMA 3HV6A 2E2BA 3ALNA 3R1SA 4KNBA 3OEFX 4U3ZA 5C8MA 4U8ZA 5EYDA 3E88A 2PVJA 4GU6A 1UWHA 3CKXA 5CQUA 1BYGA 4FE2A 3IGOA 3V5WA 2EVAA 5GZ8A 1OKWA 4FICA 2UW6A 5FDXA 3ZYAA 4E4LA 3Q4TA 1XHAA 3RPVA 3GCSA 3U6JA 2Z02A 4FG7A 3QQUA 3E8NA 3PE2A 3MESA 3D7TB 2VTSA 5HZNA 2XK9A 3BYVA 2WTIA 5AIKA 2VO7A 3BHTA 3UNZA 2P3GX 1IA9A 3BZ3A 3F3TA 5IUIA 4ASDA 3W55A 5AEPA 3ROYA 1KSWA 5J5TA 5M4IA 2OZOA 2OO8X 5L6WL 3ALOA 1SM2A 3DXPA 3QA0A 3CQUA 1P5EA 1OECA 4YC3A 4Z16A 3D7ZA 4ZSAA 4EH9A 1OUYA 5G6VA 4D4YA 2FB8A 3UC3A 4I23A 5HLNA 3PIYA 5AUVA 4DH1A 4IVCA 3OUNB 3QXOA 4Z9LA 3VJNA 3AC3A 2G9XA 3NS9A 4ALVA 4JR3A 2ZAZA 4IZ7A 5I9XA 1Q62A 3C5UA 5HLPA 3MIYA 2VX1A 4MNEB 2PUNA 4YU2A 2E9OA 4DYMA 3FAAA 3Q53A 4FT5A 4V01A 2XNEA 2BRBA 2R3JA 4J97A 4DEDA 2GDOA 4QP9A 4NU1A 2W4JA 5FTOA 4FSYA 2I7QA 2X4FA 2C5XA 3MIAA 4RX9A 1B38A 4X6QC 3MTFA 3KCKA 4R6VA 4F4PA 2BRMA 3UZPA 4K33A 2WD1A 4PMSA 4TYEA 5FLFA 4OAUC 3ERKA 4RIWA 4KS8A 4HVSA 3KQ7A 3TKHA 3W10A 4A9RA 5FBNC 3R01A 4DGNA 4ANBA 2BDWA 1YOLA 3DTCA 4BCPA 5AP7A 4YHFA 3TWJA 1OKZA 3KC3A 3DBDA 3KVXA 5L2QA 2WMSA 2F4JA 4EEVA 3FWQA 4JRVA 3R1NA 1H1SA 4EOSA 5FDPA 3NZ0A 2V7OA 4BR3A 2IVSA 4P90A 5B2MA 4IZYA 5C8KA 4QMPA 4FUYA 4ZZMA 2UVXA 5IQEA 5J9LA 3RCDA 5DVRA 4F7SA 3BBWA 3GUBA 5BVFA 4P7EA 5IUHA 3U87A 2BDJA 5FQDC 4NM7A 1OL5A 2R3IA 5IMEA 4TTHB 3F5PA 4QT1A 3OW4A 4Y72A 5GZAA 2OZAB 2HYYA 1UNHA 2IW6A 4LUDA 3DB8A 2PZ5A 4LUEA 4O84A 4KKHA 3HMMA 3FC2A 2W9FB 4LQMA 4YP8A 4MNFA 4XJ0A 5AR2A 5BVKA 4E8AA 3BGPA 5M4UA 3G15A 3LCDA 5CI7A 5ICPA 4AF3A 1ZYSA 4I5CA 5CEIA 5JH6A 3QF9A 2J90A 2OJJA 3TTIA 4AN2A 4QTEA 4YJQA 1OZ1A 4Q5HA 3UTOA 4H1MA 2PZPA 1ZMVA 4ZS0A 3BU5A 3CTJA 4A07A 4I22A 5AM7A 4MWHA 3QZHA 3FY2A 3MA6A 4DCEA 1IAJA 2X6EA 5CANA 3FYKX 3AMYA 2E9UA 2YEXA 3PP0A 4BZNA 1Y91A 4GG5A 4EOJA 1DM2A 4IMYA 2HY0A 2BIKB 1XBAA 1GIIA 3TJCA 3KN5A 1PXOA 3EFKA 3NIEA 4Q2AA 2OIBA 2UZLA 3E8EA 4W8DA 3G33A 5E8WA 4LGHA 1UKHA 2C3LA 5HD7A 4FL2A 2QKWB 2JKOA 4PL5A 4D1SA 3U4WA 2WTKB 4YJOA 1A48A 2PE1A 4FKRA 4FNWA 3U55A 4FTAA 1OM1A 4WUNA 5DFPA 2PPQA 3BYMA 1SYKA 1Z5MA 2BTRA 5CEPA 3D7TA 3IW8A 3TNWA 4CD0A 2PZRA 4GS6A 3OXZA 4XNEA 4QQ5A 4E4XA 1IAHA 1OBDA 4X2JA 5AUZA 4XP3A 4ZY5A 5CASA 4IX3A 4DEGA 3G6GA 2R7IA 3QLFA 2IN6A 4X3FB 5JKGA 2F9GA 1YDTE 4QYGA 5CTPA 3GI3A 3EQFA 3EIDA 5TT7A 5DOSA 3R7VA 4J8NA 4DGMA 4F1MA 3WF7A 4DT8A 1RW8A 2HENA 5FTQA 3LFNA 4DCAA 1LR4A 4RSSA 2WTDA 2WPAA 3ATSA 5A6OA 4BF2A 3MTLA 3SRVB 4KD1A 2A19B 2PUUA 2XEZA 3E63A 5FP6A 1UNGA 2REIA 3PRIA 4BKJA 1ZMUA 4UZHA 4PDPA 3SV0A 3H9RA 4NCTA 3O23A 5ANDA 3DQWA 3ZFXA 4MXZA 4MNEA 4C4IA 1A9UA 5J95A 3W1FA 1VYWA 4MBIA 2GU8A 5CAPA 4DH5A 2BCJA 4BCHA 4CRLA 1RE8A 2ZM1A 2VWIA 4H05A 2XZSA 5B7VA 3LMGA 4MYGA 2AC3A 2X7GA 3QQLA 4KBAA 5EYCA 3TEIA 5IZFA 4D5HA 3SVVA 5JT2A 4FKQA 3R7OA 5I5ZA 3CEKA 2PZIA 4ID7A 2IWIA 4P5QA 3MB7A 2Q83A 3S3IA 2ZV7A 5DI1A 1ZYLA 3NYVA 3IOPA 4IWDA 3QD3A 1OL2A 3PYYA 4G6NA 3IQ7A 4LV8A 3CLYA 2XNPA 4YJPA 5K0KA 1WVYA 5HE0A 3IONA 3DPKA 3KFAA 3U9CA 1WBTA 3D4QA 1J7IA 4ZY6A 3PJCA 4IB5A 3HAMA 4PPAA 4HZSA 4R3CA 1KV2A 1RJBA 3BEAA 3GFWA 2PMNX 4KBKA 2W1ZA 3PE1A 2W4KA 4YNOA 2OXYA 1GJOA 1URCA 5D41A 2UW0A 5M4FA 2W1EA 4WG5A 5E8YA 3UGCA 4DG3E 2VWYA 1CMKE 5H8GA 4E26A 4CKIA 3ZRKA 4RC2A 4K11A 2VNWA 3DKGA 3FLSA 4FK6A 3SLSA 5C4KA 2QONA 1H0WA 3DDQA 4BI2A 5BX0A 2VAGA 4FVRA 3SW4A 3OWLA 4TYHB 3VUHA 4PQNA 3E5AA 5E8TA 3HRFA 2BUJA 2OZAA 1WBNA 3EYHA 3Q9WA 2UV2A 4TN6A 2ZDUA 3EN9A 4DFXE 2J0LA 3R00A 5TKDA 2J7TA 3PRFA 2ITVA 5LWMA 2C6IA 4GRBA 3TNPC 4TNDA 4DTKA 4NM5A 2PU8A 2VTPA 4D2VA 1JNKA 3FZRA 2BRHA 3R8MA 4R3PA 3C51A 1OIUA 4BBMA 1VZOA 4AT5A 4E6AA 5CF4A 1OL7A 2XVDA 4L3LA 3S1HA 3L8PA 3EL8A 3N4UA 1OMWA 3UE4A 3A4PA
chains in the Genus database with same CATH superfamily
2BHEA 2X8EA 5BMMA 1HCKA 4OBQA 5ANEA 4EUUA 2R3QA 4W8EA 2QU6A 1UU9A 4CSVA 4YURA 4N0SA 3R9HA 4JIKA 1U54B 1E1VA 2AYPA 3JY0A 3N51A 1R1WA 5LQFA 2WGJA 2EXEA 2PMIA 4JOAA 4DTBA 3EB0A 3M1SA 3EN5A 1WAKA 3II5A 3PXKA 3R73A 3V01A 5CSWA 1CTPE 3PIXA 3Q5ZA 5LMKA 2OJIA 1KWPA 5I3RA 4B8MA 3RNYA 3GC0A 2Q0NA 3EOCA 1BL6A 3FMDA 2GHMA 2PZYA 1HCLA 4FTLA 5HO8A 4IFGA 4DGLC 2WMTA 4MTAA 2ZOQA 1NT2A 2CCIA 4LFIA 2V22A 3HRBA 4XG9A 4ANLA 2OG8A 2XNNA 2QOCA 2VN9A 3FPMA 4FZDB 4OTGA 4PMTA 4WT6A 5FD2A 5HHWA 3QZFA 1DAYA 3OBJA 3W32A 3TZMA 2JAVA 1MRUA 3OT8A 4FV2A 4I0TA 2YM5A 3KMUA 5DIAA 3BV2A 2XIRA 3QRKA 3QUPA 4O1PA 1PXNA 2GS7A 4I5PA 2GFCA 3DZOA 3MVMA 4P5ZA 5LCJA 3TDVA 3O51A 3R7EA 1MQBA 1NVRA 3POZA 4DN5A 4ERKA 4GFMA 3WZUA 2IVVA 3ZLWA 2GHGA 5KKRB 3A61A 3QD4A 3FI4A 4UEUA 2JIUA 3GP0A 3O8UA 3WE4A 4D2WA 3AC5A 3LCKA 5BQ0A 4KABA 4M7IA 2GNFA 4EH7A 3WZJA 3PJ3A 2O64A 4JQ7A 2XNGA 4X21A 3RNIA 3BL7A 1W8CA 3TUDA 4NKSA 4BC6A 2F49A 2IG7A 2HZ4A 3V3VA 3SRVA 4FMQA 4UBAA 5BYLA 2ITNA 3BHYA 4FEUA 3R9OA 3TCPA 5EK7A 3KCFA 2JBPA 4GYGA 2C0IA 4O2PA 1WVXA 3O71A 4WD5A 5D12A 3AD5A 4GIHA 2NYAA 2QOOA 3LFSA 5BYYA 4O4FA 5GINE 2ACXA 3BE2A 3F3ZA 4Y5QA 5CU3A 4FBXA 5KMLA 4JRNA 4AZFA 5EW9A 2WOUA 3PUFC 3CTQA 2WU6A 3P7AA 5EQPA 3KXMA 3ENMA 5A4TA 3R02A 2ZMCA 5CF5A 4GYIA 3UZTA 2W06A 2FSMX 4CFWA 4G5PA 1Q5KA 4C34A 2UW9A 1X8BA 2PE2A 4FZAB 4I92A 2ITXA 2ZV9A 3LLAA 1ZZLA 4YJNA 5FM3A 3DDPA 3GT8A 4FOCA 4BDAA 1H0VA 3LMIA 3LCTA 2J0MB 4AGWA 3CY3A 3H0YA 3HZTA 5C26A 3N4VA 3LW0A 1F0QA 4FGRA 4FSMA 2HW6A 5CNNA 5EYMA 4CQEA 4TWCA 3S95A 3NWWA 5TE0A 1WFCA 1JKKA 2NP8A 4XG3A 3UYTA 4FNZA 2YCSA 2QO9A 3TNQB 4IC7A 1GIJA 1G3NA 1PYEA 3EQIA 4D1XA 3QAME 1KUTA 3P79A 3FI2A 3BCEA 4O27B 3PSBA 4NEUA 5ACBC 4NIFA 4RC3A 3RAKA 4KKGA 4CKJA 2XANA 3DFCB 3VHEA 1H07A 1KE9A 4F9WA 3SOAA 4M13A 5DMZA 3QHWA 2Z60A 2W1DA 3LCSA 3F5UA 4CGAA 2J2IB 3KRXA 2CGXA 3UPXA 5KNJA 3VO3A 3SX9A 2J6MA 2GNIA 2PVMA 3CS9A 3Q5IA 3QL8A 4BHZA 1Q24A 3V8TA 3EZRA 3ANQA 4RLLA 2XA4A 2B53A 3NSZA 4O7VA 3ET7A 3OWJA 1GOLA 2Y4PA 3TIYA 5C1QB 3P1AA 2PSQA 4ZOGA 1IG1A 4QPSA 2HK5A 3C0HA 4YLKA 2UZBA 2XAMA 2BALA 5CVHA 5M07A 2XIKA 2YIYA 3NCGA 4ZJIA 4FV7A 3KMMA 4J95A 3MB6A 2YZLA 1G8AA 4GFGA 4QMZA 1OL1A 2VTIA 2X0QA 3LM0A 5CNOA 2WAJA 2CPKE 3FLQA 5L3AA 3F5XA 2XK7A 3KULB 4FSNA 4DE4A 1KE5A 3SXRA 5FXRA 4AOIA 5J7HA 3MWUA 2HWPA 3FKOA 4FSUA 2UZNA 2QOHA 1U54A 3AXWA 3CQEA 4L3PA 5KZIA 3VN9A 3N4TA 1OIRA 3QX4A 3QHRA 4L7FA 4D4SA 4ALUA 3LXNA 5JGAA 3S2PA 4USFA 4RPVA 1H1RA 3G0FA 4I6QA 2BAJA 5E7RA 4IAZA 5KCVA 2XARA 3D15A 3P78A 4FKGA 4O0YA 5J1VA 4XYFA 4F64A 4JG6A 2BFXA 4TW9A 2W9ZB 2QVSE 4M15A 4J52A 4HGTA 3UODA 2VD5A 3T8OA 3VS6A 3GC7A 3IW7A 5IMXA 2GCDA 3U51A 5DYJA 4OTHA 2Z7LA 4BVUA 5I3OA 4O96A 5DH3A 2JKKA 3R8PA 1QMZA 3VUKA 3HP5A 3I5NA 5BUEA 4FNYA 4TKSA 5EDRA 5LARA 2ESMA 3PA3A 4ACHA 3RINA 3TZ8A 2WIHA 2XB7A 1YI3A 3QC4A 4CLIA 1K3AA 1WBVA 4ZSEA 2OJFE 1ST0A 3R6XA 5AUWA 2AEGA 3IDCA 3NR9A 4S32A 3UJGA 1OGUA 1JOWB 1YHSA 4BCJA 2VO3A 1UU8A 2XEYA 4CZYB 3F9NA 1DI8A 1CKPA 2Y7JA 3WILA 4MD9E 5IISA 3CXWA 4LYNA 5EOLA 3ZLYA 2YCFA 3CJFA 2EWAA 2JBOA 3TN8A 2X9FA 1UNLA 3PG3A 4EOMA 1XH9A 5FP5A 2XJ1A 4JS8A 5HNGA 2JD5A 3HECA 1L3RE 2R3NA 2WMUA 3NNXA 3UIUA 2C6TA 2KTYA 4APPA 4BI0A 1OL6A 4ZIMA 1M2QA 1YXTA 4UMPA 4O4BB 3PVGA 3QUEA 5AR5A 3WIKA 3EJ1A 5HI2A 4E1ZA 3D2KA 4EBWA 4HNIA 2W99B 1VR2A 2W96B 3DAEA 4FIHA 4FKPA 3TNIA 2HWOA 4A4LA 5L2WA 1XKKA 3AOXA 2WOTA 4AZVA 1V0PA 1W2DA 4OUCA 5HTIA 3LE6A 2X8IA 4RFZA 3QC9A 4YLLA 1OVEA 3QTXA 4IB1A 4CZTA 3Q6UA 4AZSA 3D5VA 1OPJA 3TG1A 1V0OA 5IH4A 1ZXEA 4FZFB 4NWMA 2IZUA 1Z9XA 3R7UA 4IAIA 2PVKA 2PVLA 3WIGA 2AC5A 4U42A 2OWBA 2QG7A 3IECA 2X8DA 3PPZA 5TOZA 5HG5A 3KN6A 4DITA 3DK7A 4O4DA 3LFFA 3H30A 2XH5A 3C4ZA 3PLSA 1CDKA 3OF0A 1GIHA 4Y46A 4V05A 4B0GA 1P4FA 2X7OA 3U6HA 4FTJA 3CKWA 3LXLA 1ERKA 3FQEA 3E3BX 3FC1X 4XLIA 1FVRA 4TYGA 1PMEA 3A7GA 2FUMA 4AX8A 4QPMA 1RQQA 5A3XA 3TJDA 5BVNA 3ZSIA 2IO6A 2XK8A 5E90A 3LM5A 4IFCA 2QU5A 4QP2A 4Q9SA 1G8SA 3ULZA 3NYOA 3LCOA 5A4QA 4HCVA 5K5XA 5BPYA 4FRFA 4R77A 2UUEA 4QTCA 4FEQA 1W2FA 3BE9A 3C50A 3G51A 3W0MA 4FSQA 4EK6A 3PFQA 3I6UA 3F7WA 4QMVA 2YM4A 4AZWA 3SW7A 2C6MA 1OB3A 3FL4A 5B0XA 3FMJA 4IZAA 2OLCA 4I4EA 2G01A 4OLIA 2UW8A 5M55A 4F65A 4YBJA 4W4YA 4QDVA 5IKWA 4F99A 4Y95A 5K4JA 4JLCA 3FMMA 3KULA 2WMBA 3JYAA 2JC6A 3HNGA 3DAJA 4EC8A 5BMSA 3ENHA 3NNVA 2JITA 5L8KA 3R8UA 2QC6A 3V5LA 1AQ1A 5A4LA 1KOAA 1J7LA 3OY3A 3T9TA 5AP0A 4U79A 3UO6A 4BDJA 3G9NA 5EI2A 3GU5A 1Q8WA 1Y8GA 5AP5A 4BIBA 4F6WA 4GH2A 3CP9A 4C2WA 3FHRA 3EFJA 5L4QA 3QQGA 3O0GA 1G8KA 3UC4A 3W2PA 4FT3A 1O6LA 5AP2A 2CNVA 2BZKB 5GNKA 4HVGA 4RA4A 4M84A 3ZC5A 4G3GA 3JUHA 2A27A 3D5UA 3FY0A 4W4XA 3MFRA 4R7HA 3BV3A 1SVHA 2R7BA 3D5WA 4ORKA 5IPJA 4HVHA 4UALA 3FI8A 4M68A 2ITWA 4H58A 3WI6A 4EHEA 3GCUA 4USEA 4N57A 4D2RA 4M8TA 3R04A 1WMKA 4I24A 3HV5A 3QWJA 4LM5A 2IW9A 4ZLZA 5HU3A 2G2IA 4OW8A 3BX5A 3AG9A 4L46A 2BR1A 2JDSA 3ZU7A 4AP7A 5L2TA 5EI6A 3JXWA 2BHHA 2C30A 2Y4IB 3PG1A 3R1YA 4YZ9A 4DDGA 5IQGA 1KE7A 2ITUA 3EMGA 2R3FA 4M0ZA 5DN3A 5HVJA 3UO4A 4JX3A 2XNOA 3BEGA 5CXZA 1KV1A 4QRCA 5DT0A 2OIDA 4JDHA 3VHKA 5DA3A 2HCKA 2ZV8A 2H8HA 3PLAE 1RDQE 4NTTA 5CQWA 4AOJA 3VWAA 4QYFA 4FSZA 4EK4A 3QWKA 2W1GA 1JKSA 1U4DA 3VQHA 4DBNA 2CNQA 2QOFA 3LHJA 3G5DA 4F6UA 3MVLA 3QCQA 4NSTA 3LFCA 1M17A 3F2RA 1R78A 3OS3A 4MXCA 4O38A 3OD6X 4EQMA 4EYMA 4O7WA 4QNAA 4C2VA 2XK6A 2ONLC 4C3PA 2ZV2A 3FZPA 5DE2A 2F7ZE 3K5VA 3KRRA 3BHVA 4A06A 4LV5A 3P7CA 1BI7A 4HVIA 2EB2A 3FQSA 3H9FA 4M97A 4BFMA 3ZSGA 4H3BA 4KIKA 5IQCA 2YM7A 5AR4A 1ZZ2A 3DJ5A 5KX8A 3PA4A 1MRYA 3W8LA 5BUJA 3M42A 4PMPA 4JT3A 3RM7A 5DR6A 3WYYA 2QKRA 3OG7A 5CAUA 5M09A 4RJ3A 4O82A 4XV3A 4HGLA 4QMTA 4QP1A 5LVLA 5HTCA 4FTRA 2B1PA 3ZS5A 2B0QA 2VTJA 4YZBA 3NUPA 3R8VA 3UYSA 2VRXA 3UOJA 3UIXA 2WHBA 3FLYA 2B55A 4FL3A 3UP2A 1GZ8A 5IQBA 3SXSA 5LWNA 1YDSE 1CKIA 5AAFA 4L43A 3TACA 4PTEA 4DEEA 3IW5A 3MPMA 4I20A 2BKKA 4R8QA 2C1AA 4ANQA 5KMNA 4X2FA 5IA5A 3RM6A 3RVGA 5CENA 2E9PA 5AV2A 4C7TA 1SVEA 2F2UA 3I0OA 3A7JA 2B9IA 2YA9A 4YZMA 4L00A 3RP9A 3UDBA 2O8YA 3CSVA 4N4SA 3KMWA 1YHVA 4RWJA 2OJGA 3K3IA 3OP5A 5ETFA 1JWHA 1Q8ZA 1ST4A 5AWMA 2P0CA 4NUSA 5FXSA 5JK3A 2CLXA 3NDMA 5AP1A 3FMKA 4GJ2A 2C1BA 2IJMA 3C4FA 3HYHA 4XCUA 1BMKA 5ANOA 5DGZA 2WMRA 4XS2A 3SG8A 3ZM4A 3GNIB 5AV0A 2Y6MA 2IW8A 1JPAA 3WF5A 1YI6A 4MXOA 4DAWA 2ZM3A 3A8WA 3KK8A 3DLSA 4L42A 5JGBA 3FMHA 4E5BA 3R2YA 5K5NA 1UU3A 4FKIA 2EXCX 2WNTA 2JIVA 1Q8TA 4AGCA 2RG5A 3ACJA 5IA2A 2C47A 5ANIA 3SHEA 4I6BA 4FYNA 1OIYA 1XQZA 3B8QA 2O2UA 3GEQA 1H27A 3EH9A 3PWDA 5HG8A 4ZTNA 1TVOA 3KA0A 2X1NA 5T68A 5IA3A 3BRBA 3G2FA 4YC8A 3THBA 1REKA 5CT7A 1H8FA 1M2RA 3FDNA 3LXPA 4G3EA 4AQCA 4I3ZA 4AXFA 2XBAA 4FTOA 4YHJA 2WMWA 4KSPA 4AXAA 4CG9A 3KU2A 5AV3A 4Y85A 2XIZA 2QI8A 4QYEA 2FO0A 4LGGA 5IQDA 2VTRA 3M11A 3PVBA 4FTKA 2GFSA 4CFUA 4ANNA 3Q9YA 5JGDA 4JL9A 3A99A 3Q32A 4UN0C 2HY81 4IXPA 4QO9A 4DLJA 3JY9A 4IADA 4PTCA 3FBVA 4NT4A 3UBDA 4EBVA 4GVAA 3TV7A 2YACA 4FV3A 3JPVA 2B9HA 1QPEA 2CKPA 3NLBA 4FTQA 2PVFA 4C33A 1PXKA 1KE8A 2F7XE 1YKRA 4CTBA 3PA5A 2A4LA 5A9UA 2XUUA 2UVYA 3GOKA 3NUNA 3MV5A 4JIAA 1PMVA 4YJRA 4EJNA 4ASEA 3R28A 4RC4A 5CAOA 4JBQA 3W2QA 5HICA 3RWQA 4L7SA 2UZUE 4U43A 4O7ZA 4OT6A 4YTHA 2Y4IC 4ZTMA 4HOKA 3NUSA 3PPKA 2OIQA 2XM8A 4UV0A 4BBFA 5E1SA 1U46A 3EZVA 2LAVA 4A9UA 1ZOHA 2J50A 4O0XA 4CMTA 2JKQA 4UMTA 4BDGA 5E8VA 4C37A 2VTHA 4EWHA 4I1ZA 4O6LA 1EH4A 3OOMA 3OXTA 4GFOA 3WF9A 3ZXTA 4QMUA 4YZCA 5AUTA 1PKGA 4CRSA 4M12A 1YXSA 2VTLA 2CGWA 2PVRA 2W17A 4H3PA 3Q60A 1H08A 4WRGA 2OW3A 4Y5HA 5LVOA 4FKWA 3HLLA 4QMOA 5CAVA 2YIWA 3O96A 3QRUA 4X7QA 5IEYA 3PDTA 3DGKA 4FNXA 4TL0A 4D28A 4PWNA 4GK4A 4FTIA 3ATTA 3A8XA 5GIPE 3LJ1A 4DF3A 5AX9A 1ZMWA 3QRIA 3HEGA 2XK4A 4DHZA 4C35A 1J3HA 2W1IA 1FBNA 5HO7A 4C4HA 4AFEA 4XEYA 4NZWB 3LJ2A 4HNFA 4MHAA 3QLGA 4MCVA 3CJGA 4TY1A 3SOCA 4RJ6A 3DAKA 1MRVA 3KEXA 3PP1A 3VS1A 4MD8E 2W7XA 4AW2A 3EN4A 2W0JA 4MX9A 4TPTA 1WCCA 1W83A 3N9XA 5FG8A 5JFSA 3GU7A 2H34A 4IW0A 4MEDA 5AP6A 4ACMA 3KRJA 4TWOA 2KULA 2G1TA 4FF8A 4G3CA 4ZSLA 4A9YA 3ZRMA 4BKZA 3DBCA 3E3PA 4PNKA 3KRLA 5AUUA 5E92A 3ORIA 4BI1A 4BDDA 2HIWA 4RWIA 5FEQA 4AA5A 4F9AA 4IE9A 2YDJA 4EJ7A 2WU7A 3RKBA 4AN3A 4EH6A 2UW5A 5E1EA 5HCYA 5I0BA 2XK3A 2I6LA 4IDVA 3VVHA 4PP7A 4LOPA 3OT3A 3MW1A 2RF9A 3F5GA 3PVUA 2CJMA 4J96A 5DG5A 1R39A 4U6RA 5FM2A 3HMNA 2EB3A 3W2SA 4EK5A 5CEMA 4RT7A 2FVDA 2YIQA 3HMOA 4MBJA 4PY1A 4RX5A 1XR1A 2NRUA 4MXAA 5J79A 4HYSA 2YCRA 2YN8A 4K9YA 4PRJA 3F2AA 4QD6A 4K18A 4ZJJA 3PVWA 5CI6A 2VWWA 3OCGA 5HESA 3VF9A 2EU9A 3EQCA 4AXEA 4AN9A 4K77A 4RRVA 4IAKA 2WTCA 4O4CA 4QTAA 3KF7A 4M69B 2VO6A 4QP7A 4ZP5A 2OXXA 4J99A 3ZCLA 4M67A 5DRBA 2CCHA 2QLQA 3UG2A 5D10A 5HE1A 4TZRA 4GG7A 2PYWA 3VIDA 4LOQA 3QTSA 4QMQA 5LMBA 5LXMA 2ZYBA 2HZ0A 3SXFA 2IZRA 4AT3A 4B9DA 4FT7A 2FH9A 4KKEA 2VTTA 2WELA 3D5XA 2VTNA 4KS7A 3E87A 4GKHA 5DT3A 4JX7A 4DH7A 3E64A 3ZSHA 4UXQA 2R3PA 3ZO1A 3C9WA 3MA3A 2BKZA 4MD7E 5DR2A 2GNGA 2VX3A 4EUTA 2ETRA 4DHFA 5CVFA 2HZIA 4FKLA 1DS5A 2X4ZA 4RFMA 3V51A 4O0WA 5IA4A 5FXQA 4QQJA 4S33A 3BQRA 2YDKA 4LRJA 1TKIA 2E9VA 4UMQA 5I9VA 2O65A 4V0GB 1OBGA 2VGOA 3DXNA 2DS1A 3WYXA 3R9RA 3RK9A 4EH2A 2PHKA 1FVTA 4IM0A 3L8XA 5CSVA 2R3LA 2JLDA 3VUIA 4IWQA 2W1FA 4HW7A 4RZVA 4UYNA 4QP4A 4L44A 1PHKA 3LQ8A 3ZH8A 2OBJA 4RGJA 2XJ2A 2P33A 4S31A 2V55A 2X6DA 1T45A 4CFXA 1XH8A 5J8IA 4D4VA 4J7BA 4MAOA 4FL1A 4IWOA 4XV2A 4X6RA 5BVWA 3Q04A 4CFNA 2PUIA 3RK5A 2UW7A 3OTVA 4GU9A 5TF9A 4AW0A 4C3FA 3W0QA 2RFEA 3EFLA 2CSNA 5CLPA 3GC8A 3GCVA 4J98A 3LFDA 3KREA 3TDWA 1BLXA 4BWXA 4R1YA 5E4HA 2YAAA 1E9HA 4TT7A 3OOGA 5HG9A 2V0DA 2GQRA 1ZYJA 4CG8A 4C8BA 3R83A 2R0UA 3W2CA 5HNIX 5LVNA 3QTZA 3NAYA 2R3KA 3ZDUA 5IQFA 2OXDA 4H39A 2BRGA 3UNJA 5EQYA 4ZMFA 3Q4CA 4X2KA 2FA2A 3I79A 2FSOX 3P86A 4W4WA 2W05A 5I9UA 2J0JA 4EQUA 1WZYA 3I60A 4Y73A 4X3FA 2WQMA 1UKIA 2C5VA 2WTVA 5ANJA 1YVJA 5BNJA 4AAAA 5HTBA 4IAFA 3OCBA 3TNHA 2J5EA 2I0EA 3C4WA 2BAQA 3NX8A 4GL9A 4MKCA 1LP4A 5E8SA 5AR3A 3UDZA 4JDKA 1REJA 1QPDA 1QPCA 3EFWA 5HIDA 4BIDA 4BYJA 3IW4A 4G5JA 3KXGA 5HQ0A 4N6YA 1ZRZA 2VWBA 2XNBA 3ORZA 2DUVA 4FTTA 4FV1A 2XRWA 4NL0A 2R2PA 2GSFA 4JJRA 4PPBA 4ITHA 4C57A 4ZSJA 4USDA 5EYKA 4YUQA 5HLWA 4FKVA 5FWKK 5D9HA 4L53A 2A2AA 5EDPA 4F7LA 1A06A 3QUDA 4PPCA 5B2KA 3QD2B 4PNIA 4D55A 2C6DA 5CALA 4FG8A 2C68A 3MGYA 4FI1A 3LXKA 3WZKA 3VUMA 4YBKA 2RSVA 4K8AA 1V1KA 3F66A 2IEWA 3A2CA 5A4CA 2WEIA 5CF8A 5IEVA 3KXNA 1YXXA 4JI9A 3JVRA 4F09A 3O7LB 3Q96A 4E73A 4L01A 3L9MA 3V5JA 2C5OA 4C36A 4BL1A 3VUTA 1OI9A 4F08A 5M4CA 1Z57A 4IB0A 3UG1A 2WMXA 3MN3A 3TV6A 5ETCA 3VF8A 5CX9A 4O86A 3BKBA 4BCIA 4DC2A 4WHZA 3FXXA 1BI8A 4APCA 4E4MA 5L6OA 3Q2JA 4IAAA 2O63A 4W4VA 4DDIA 1NW1A 4AS0A 4QQTA 4KINA 2X0OA 3TXOA 4BDEA 4JR7A 4EOKA 5HIBA 4O21A 5KMJA 2QR7A 2V62A 3PY3A 1R0PA 5E8XA 4XV9A 5D7VA 2QOLA 1P4OA 3RAHA 2UZVA 4G17A 3BL9A 4MQ1A 3D14A 5K9IA 2WEVA 4OTQA 5JSMA 2PE0A 4DEAA 3MBLA 3NIZA 4XX9A 3R30A 4JBVA 1M52A 3CGFA 1APME 3PZHA 4YSMA 4DG0E 3P5JC 4YJTA 3ETAA 3HMIA 3P08A 4TYHA 4BCGA 4NFNA 4GMYA 4RG0A 2XS0A 3QTRA 3F61A 4A4OA 4IB3A 4FA2A 3IDPA 5HX8A 4ZK5A 3BELA 3QZGA 4M14A 4GT3A 4D1ZA 2C3JA 5AP4A 1Y8YA 3PZEA 2I1MA 2OGVA 4F0FA 1P14A 2DQ7X 4CNHA 3A4OX 4ACCA 2LGCA 4JQ8A 2WQNA 2WTWA 2PVYA 2H9VA 1YW2A 1ZOGA 3HA6A 1GAGA 2YHVA 5KO1A 2XRUA 2BMCA 2J0KA 1YWRA 4FODA 4EH5A 3UZRA 5M06A 3DNDA 3PJ1A 4JBOA 5KE0A 2ZMDA 2RFNA 5GIOE 4UXLA 1OPKA 2W4OA 3Q3BA 3WF8A 3SGCA 4FK3A 1QCFA 4U3YA 4F63A 4JBPA 1NA7A 5CYIA 3I4BA 4II5A 2B7AA 5FBOA 4EKKA 3LIJA 2VWZA 4MVFA 1XBCA 3BPRA 3UOLA 3UVPA 1Q3WA 1OKVA 5LVPA 3RPRA 1M7QA 3DTWA 4R7BA 2QHNA 4U80A 3UIBA 3VJOA 4QEBA 3KXZA 3EYGA 3QU0A 3KVWA 4FVQA 4C62A 5BVEA 4FIGA 1J7UA 3WOWA 3MYGA 4XG7A 3ZM9A 3GVUA 3FMLA 4IIRA 4U44A 5E9EA 4NKAA 5JEBA 4GW8A 3LAUA 3S4QA 2J5FA 2QURA 3QQJA 1JVPP 4ZXTA 3O7LD 3UO5A 2E9NA 4F0IA 4F1TA 3R63A 4AE9A 3TTJA 4A7CA 5EHLA 4FSWA 4E7WA 3Q4ZA 2BPMA 4PTGA 1TQIA 4OR5A 3QYWA 4BDIA 4EH4A 4L8MA 3LVPA 2PVNA 2C6LA 2ZDTA 2I0VA 3OWPA 3FL5A 4O0TA 5AAGA 5L2SA 1OIQA 4FKSA 3VW8A 4C0TA 4C59A 2B9JA 3KL8A 4RVTA 2R3GA 1K9AA 4K0YA 3HRCA 1DAWA 3QTWA 3GXLA 1SZMA 4H36A 5C9CA 1F3MC 4ZLYA 5IG1A 3AQVA 4ZLOA 2X2MA 2JDVA 3UQGA 5C03A 2WQOA 2I0HA 4G34A 4BZDA 3D83A 4DFZE 3UNKA 3NMUF 4QYYA 4EYJA 3LMHA 4O81A 1ZWSA 3PXZA 3MDYA 1JSUA 4IQ6A 5CT0A 2IZSA 3RI1A 3FZOA 3ZFMA 3Q52A 5HVKA 1W2CA 5JQ8A 5FUTA 4YJVA 1UV5A 3SDJA 4CXAA 1PF8A 5F9EA 3EKNA 3FMNA 3MH1A 5KUPA 3ML1A 3ZUTA 1GY3A 5JFWA 4EZ7A 4D9UA 3HUBA 4GCJA 3S00A 2JFLA 3HUCA 4O7RA 4ZSGA 3NAXA 1YWVA 3PIZA 2R64A 3QCYA 4MH7A 5HEZA 5J7BA 2XYUA 5L8LA 2HELA 4I5HA 4HCUA 4QP6A 4X2NA 3GCPA 4FKJA 3UVRA 4I0RA 4JVGA 3R8ZA 4BTJA 3SA0A 3KKVA 4BIEA 3SD0A 4BZOA 4PV0A 3LFEA 3RTPA 1I09A 3GBZA 3EQDA 4RZWA 4C02A 4E3CA 3QD0A 5A4EA 3NUXA 4FTMA 1B39A 3DCVA 5CAQA 3VS0A 2UVZA 4F1OA 2BROA 4RIXB 2X0PA 3FZSA 3OEZA 3HAVA 1CSNA 2C69A 3PPJA 4KRDA 2F2CB 4RA5A 4IM3A 4YNEA 5EFQA 1LPUA 5B2LA 3KIOC 4O7YA 4DHIB 2JGZA 1H1WA 2WO6A 4RQVA 4V04A 1NY3A 1XH6A 3T9IA 2R3MA 3CPBA 3VQUA 4AW5A 4OTWA 4AXCA 3NVMB 3NYXA 1QL6A 3H4JA 5IDNA 3IK3A 1GZNA 4LOOA 1PKDA 5CU4A 4EHVA 3VS3A 4E6DA 3QCXA 3NUAA 2PWLA 3C4XA 3VRYA 2WZJA 3R7YA 4DGOA 4FZ7A 4WNPA 1P2AA 3FLZA 3E93A 2X2KA 4FV6A 4HYHA 1OKYA 4AW1A 5HBEA 5J5SA 1UWJA 4E6CA 3AC1A 4FOBA 1XWSA 4GT4A 2NRYA 3DFAA 4G31A 4ERWA 3MH0A 3RBWA 2C5YA 2B54A 5CSXA 4ASZA 2WTJA 3DJ6A 5FGKA 3ZO2A 1JKTA 1J1CA 3TUCA 4R5YA 2GNJA 3SKCA 3FHIA 3F3VA 3I7BA 4FIEA 3VULA 2QOIA 4EK8A 4U9AA 5T3QA 2H96A 3EN6A 3V5TA 2WKMA 5DRDA 3DKCA 3VS2A 1TQPA 4FGBA 2G15A 1IA8A 2Y9QA 3ULIA 4NTSA 4KIPA 2ITQA 3TKUA 4MUQA 4HYUA 4IC8A 3C13A 4MXYA 3W18A 2FYSA 2VNYA 4O22A 2ITTA 4FG9A 2RGPA 4PL3A 4WNMA 5EM5A 5JMSA 2PL0A 2VU3A 1MQ4A 4LV7A 1L8TA 2JEDA 3SG9A 4BGQA 4DH3A 1XH4A 3DK3A 4ZTQA 4BKYA 4AGUA 5M44A 1Q8YA 3F7ZA 3T3UA 3VRZA 5F4NA 4QMWA 4RVMA 3BI6A 4BN1A 2GTNA 5C8NA 2X0GA 4L6QA 1T46A 3OCTA 2B4SB 3A7FA 3K5UA 4UZDA 3SQQA 1XBBA 4PX6A 3W2RA 3ZBXA 1PMUA 3IPHA 5IUGA 3DV3A 4LG4A 3DQXA 2PK9A 2ETMA 4U45A 5IA0A 4WBBB 5G1XA 3FPQA 4F70A 3MSSA 4AOTA 5JRQA 3RCJA 3H9OA 3WF6A 1FQ1B