1Q8UA

The catalytic subunit of camp-dependent protein kinase in complex with rho-kinase inhibitor h-1152p
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
341
Chain Sequence
KKGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
total genus 111
structure length 341
sequence length 344
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8uA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8uA02
4MNEA 1QPJA 4IADA 4QPSA 2GQRA 2GNJA 4ID7A 5H3QA 5HG9A 3SOAA 2VO3A 1H1QA 5E90A 2XKDA 4D58A 5B7VA 4TWNA 4L67A 3LCKA 3FY2A 4RQKA 4DF3A 1Q8WA 3PSDA 4CQGA 5CU6A 1H1RA 2WMBA 2DWBA 3I6WA 4OUCA 3AD4A 3CTJA 4E4XA 2JAVA 1IAJA 4ZTRA 3RAIA 4D4SA 4ONAA 1H26A 1CKJA 3OY1A 5HOAA 2LAVA 1DI9A 4CZTA 4EH8A 4AS0A 5GZAA 4ERKA 4GIHA 4QYGA 2VTJA 5LMKC 3TNWA 5H9BA 3UIXA 5JRQA 4I5PA 2BUJA 3FLQA 3Q2MA 4CFNA 2VWZA 3WBLA 3B8RA 3UG2A 3II5A 5IQIA 2ESMA 4AGWA 4CNHA 2C6TA 3Q9ZA 2P33A 4HPUE 3ACKA 2OIQA 4FVPA 4GFGA 4O81A 5FLFA 4X2NA 5K3YA 4M12A 3UMWA 3O8UA 2ETRA 4UYAA 5IDPA 4EKKA 3VBYA 2WD1A 4BYIA 3CBLA 4GK3A 2QHNA 4I5HA 3RCDA 2WOUA 3L8SA 5HO8A 1OL2A 3CCNA 4D0WA 5BUIA 2PMOX 4AACA 4YZBA 4B8MA 1XHAA 4CCUA 4DH3A 3CPCA 3HGKA 3VRZA 3Q60A 4BDDA 4H1JA 4JT3A 3D0EA 2C0IA 5IA0A 4ZLOA 5HX8A 4UXLA 4IVDA 2Z7LA 4FV8A 3OTUA 4KWPA 3LOKA 2WMWA 5EQPA 4XG4A 4ZSGA 3QRJA 1PXMA 2WXVA 3RCJA 2F7EE 1T46A 4FNZA 3AGLA 4BDFA 5E8ZA 4BI1A 4RIYB 1WAKA 1UKIA 5B2LA 4DG0E 2B53A 1GAGA 4WRGA 5IA1A 3LQ3A 3OC1A 3R01A 5DRDA 1J1BA 4F99A 1F5QA 3R02A 1IEPA 4G3EA 2QOKA 4YNEA 4CFFA 3F5XA 2W4OA 4J96A 2GNIA 4ITHA 3FL5A 4LMUA 4ACMA 1T45A 4I3ZA 2W1ZA 2XK9A 3EYGA 3RP9A 4EK4A 4TXCA 1REKA 4L6QA 5LMKA 2W1IA 2C68A 4HYIA 2B1PA 4QT1A 4QMYA 5L6WL 2XEZA 4HNFA 4NM5A 4ZTLA 3NYVA 5K5XA 3TNPC 3PXZA 4C4EA 3WZEA 4HVGA 5E8WA 3HVCA 4U80A 4C36A 4IACA 5T3QA 3DKOA 4DYMA 3NMUF 4CFMA 4YZDA 4TWCA 3MY5A 3D83A 3PZHA 4WG4A 2IZSA 1ZLTA 2JFLA 2V5QA 3TEIA 1H27A 5EDQA 3KXZA 4YJRA 1WVXA 1XWSA 4D0XA 4EUTA 4ZY5A 3V8WA 2PZIA 3DU8A 4N4SA 1YXXA 4RMZA 1TKIA 3LFCA 1YWNA 3NW5A 3ORXA 1YOMA 2NP8A 3LPBA 4RIXA 3UGCA 4IBMA 5CZHA 5IA4A 4F63A 3JVSA 3Q6UA 1ZY4A 5F95A 5AV3A 4BCJA 3DTWA 1OKVA 4QQTA 2WNTA 3QD0A 3TG1A 5AA8A 2KULA 5KKRC 2BILB 2P3GX 2C0OA 2R3OA 3S3IA 4C59A 3FPMA 3HP2A 4O91A 4U79A 3ZC6A 2CJMA 3P9JA 3R1QA 4ZLYA 1G5SA 2VO6A 1H1WA 3F66A 4C0TA 2C5XA 2HW6A 4O83A 2W0JA 1QCFA 5HG7A 5IQDA 5CU4A 2QR7A 2GPHA 3ORPA 2F57A 2XK3A 2Y6MA 4BWKA 1TQPA 4E4MA 4EK3A 4JQ8A 1KE9A 4E20A 4HZSA 1DAWA 3DTCA 3PY0A 3FMNA 4I4FA 4FSRA 5HICA 4ZTMA 3K2LA 3ZC5A 4QMLA 4U42A 5EYCA 3WF6A 4D1ZA 5JFXA 2I0HA 2W06A 3NAYA 4MAOA 5AA9A 4RWKA 3R71A 1MQ4A 2GQSA 1G3NA 5ANIA 3VUDA 4Z3VA 4D2PA 4F7LA 4JDJA 2OF4A 3ZMMA 4YC3A 4YHTA 3QUDA 3GFWA 2OXXA 5ETAA 4NM0A 5IQAA 4DEDA 4QO9A 3JPVA 3LXNA 3VS2A 4F09A 5AUVA 3NDMA 3QQUA 2QR8A 4IEBA 3JYAA 1H1PA 3PA5A 4WRSA 3O71A 1Z57A 1OIRA 3QRKA 5IUIA 4BC6A 4EQMA 4EUUA 5CEPA 3BPRA 5D10A 3MFTA 1H07A 3NW7A 1JSVA 4ENXA 2C1BA 3N4VA 2JAMA 4RVMA 4K9YA 1UWHA 2BZIB 4AF3A 4GT5A 3M1SA 3NAXA 4BDIA 1LP4A 2P0CA 4GYIA 2VNWA 2IPXA 2PUUA 1M2PA 1V1KA 4XP0A 4PTCA 1Y6AA 5EOBA 3NX8A 4K77A 3Q9XA 3PXFA 4UZHA 5AUXA 4ERWA 5CSHA 2QOCA 3TZ9A 4DITA 2W5HA 5H8EA 3HA8A 3QC9A 2J7TA 3DQWA 3BLQA 3EYHA 4UWCA 4BBEA 5K9IA 3IDPA 2ZJWA 3F3TA 2BAKA 4EK5A 4E6AA 4F6SA 4AZVA 2VAGA 3K54A 4FKTA 5DMZA 5A46A 3NIEA 2B4SB 4NFNA 2JGZA 2W05A 4O6LA 4F9WA 2W17A 3EN6A 3F9NA 2R3GA 3SOCA 4L45A 3VS4A 3OG7A 5E9EA 3BLHA 2Q0NA 3LFBA 4X21A 1BYGA 2XM8A 3E8DA 3QQGA 1RQQA 2A4LA 4O0XA 3SQQA 3TACA 3OWJA 4XV9A 4RGJA 4WBOA 5LMAA 4L00A 3DLZA 4AG8A 3A7GA 3TIZA 2JDVA 3OFMA 2DS1A 5CASA 5K5NA 1WBSA 2R5TA 5AP7A 1PXKA 4TN6A 4F6UA 5E8XA 3HRBA 4BCFA 4O0VA 3N4UA 4L53A 1UWJA 4BDKA 4O86A 3JVRA 4EHEA 4YTFA 4HGEA 1ZMUA 3A2CA 3A4OX 5C8KA 4CLJA 4MK0A 2OZAA 3BHHA 3SVVA 2JITA 2JIUA 4IHPA 4L68A 3AC1A 1VJYA 4L7FA 5CU3A 3G6GA 1PXIA 2GTMA 4P4CA 5FEQA 2IW8A 3TZ7A 4OTWA 5BNJA 4ZZMA 5JQ5A 5AR3A 5FTOA 1V0OA 4JR3A 3FLZA 1O9UA 2W4KA 3ORKA 4KIKA 5CQUA 2VWIA 5L2WA 3ROCA 3MH1A 4GT4A 1SNXA 4X2GA 3LCTA 3FL4A 5M07A 4WIHA 4K18A 2AUHA 3ZBFA 4GU6A 4AX8A 4G3CA 1JVPP 3FPQA 3W2SA 5J9YA 3QCYA 4DN5A 3LFFA 4XOYA 2JKQA 3QTQA 3CKWA 1BX6A 4PDYA 1B6CB 4AW0A 4HJOA 4K11A 1CDKA 1H4LA 2Z7SA 1MRVA 5CI6A 3OCTA 4FT0A 5CEMA 1RW8A 5HGIA 2J0MB 5BVNA 3NZ0A 3WARA 2UZTA 4RLKA 3KULB 4ZEGA 2EB3A 5KE0A 3QD4A 4EHVA 5ANJA 3C4EA 1YDSE 4L8MA 3R83A 3LLAA 1E9HA 3KRWA 3R7VA 4UZDA 4NTTA 3RM7A 4JG6A 3UE4A 1IR3A 5CSWA 4BHZA 4IX3A 1LPUA 4FZFB 4RX9A 3UBDA 2OF2A 5HTBA 3R73A 4O1PA 3QHRA 4YO6A 5DI1A 3Q4UA 4FZDB 4FTIA 4A9UA 5CVFA 2XKEA 3NR9A 4FSTA 4FYOA 3QKLA 5LXMA 1OUYA 4AZFA 2GTNA 3EHAA 4JIAA 4OR5A 2B52A 4U5JA 3OT3A 2QURA 4F1OA 1U54B 4CTCA 3MVHA 5TKDA 4DG2E 4JDHA 5J5SA 4L46A 3FMEA 2XIRA 2QOQA 1LUFA 3BV2A 3IONA 4TNBA 5ICPA 2CKQA 5EQEA 3R2YA 2V55A 3TZ8A 4QTAA 4F7SA 3A99A 5CF5A 2YCSA 4XP2A 4BIBA 4DFZE 4BCPA 4C34A 4FV4A 4W4VA 4ZLZA 3R0TA 3ZEPA 2REIA 4IB5A 4KS8A 3CJGA 3UVQA 1M52A 3BELA 4U81A 3RAWA 4WNMA 3BWFA 3VO3A 3UZPA 4C02A 3S2PA 1R0EA 1W82A 4K33A 3F6XA 2B9HA 2QOOA 3ZLYA 4DCEA 3SX9A 3UZRA 4S33A 4EORA 4DEAA 5M51A 1CSNA 3VUKA 1QPEA 1JKTA 2BPMA 5IH4A 2BZHB 4FKUA 3N4TA 3DOGA 3R9RA 2RG6A 4AW1A 1Q3DA 3MPAA 5ACKA 1OI9A 2A1AB 4UWYA 3HUCA 3QTWA 2PULA 5IA5A 3U9CA 2EB2A 2VTTA 1BI8A 3HP5A 3BLRA 1LEZA 2CGVA 3HMNA 2CGWA 5IH6A 2R3JA 5L8LA 3NUNA 2A27A 2IVUA 1XJDA 3MFSA 2VWXA 3A7HA 3VS0A 2RFNA 3GVUA 4AOIA 4RC4A 4D2SA 3DA6A 4JXFA 4EC8A 4DTBA 5J9ZA 5BYZA 3D94A 3C4WA 4IJ9A 2J2IB 3E5AA 2XK6A 5B0XA 2UW0A 3QGWA 3FKOA 4D55A 3NNWA 4LRJA 4E1ZA 1A06A 3GU7A 5IQFA 4O84A 3U8WA 3DAJA 1YKRA 4I5CA 2YIRA 4Y95A 3A7FA 5C03A 4I6BA 2VO0A 2G2IA 2PVMA 5TT7A 3ORMA 3TNHA 4I20A 4EYJA 4JDKA 4XEYA 4I0TA 3UQGA 2GHLA 2WZJA 3BIZA 3KF4A 3UOJA 5IQGA 4AA0A 3UZTA 5GHVA 3BYMA 2IZRA 3BQCA 4ZSLA 3KRRA 1SZMA 4MBIA 1SVGA 3I0QA 3VF9A 2WB8A 3EFWA 4DH7A 3FYKX 3U4UA 3DJ5A 3UPZA 1IASA 4DT8A 5J5TA 4APPA 2QCSA 4OGRA 1WVYA 3NNXA 5TF9A 4D1XA 5L8KA 3DXNA 3PIZA 4R1YA 1MP8A 4Y73A 3RPRA 4ZOGA 2X7FA 2PY3A 5BQ0A 4C61A 5HORA 2OXDA 3DV3A 4G2FA 5J8IA 4X3FC 2NO3A 3DGKA 1PKDA 5HNIX 5IA3A 3EMGA 2C6LA 4WNOA 1M2RA 4I6HA 2C5VA 1R3CA 2WAJA 1YXVA 3MGYA 4LV8A 2VN9A 4AUAA 5JH6A 3OF0A 4RWLA 3ZDUA 1HCLA 1OECA 3GEQA 4P7EA 4X6QC 4F7JA 3MB7A 5J1WA 5HE0A 2PE2A 1Z9XA 2X7OA 4NM3A 3TDWA 4M8TA 3H9OA 4YJQA 2FVDA 4KNBA 5HIBA 4JX7A 4W9WA 5HVYA 2H6DA 4J71A 1WMKA 3P7BA 5FXSA 3UC3A 4JJRA 1ZXEA 2XF0A 5BVEA 1S9JA 4YTIA 4D4YA 5KCVA 5KX8A 5A4EA 1JWHA 4ZTHA 5JK3A 3O96A 3IGOA 4IVAA 3DNEA 3VBTA 2WMRA 3WZKA 3C4XA 3MTLA 5M55A 4FSUA 2GS6A 4GG5A 3R9HA 3O0GA 4YBJA 4QTDA 5LVOA 1XR1A 4P2KA 5IPJA 4YJVA 2ERKA 4EK8A 1M7NA 3DDQA 5GINE 5EHYA 2HIWA 4FKVA 5EDRA 4AAAA 5L2TA 5LVNA 2XJ1A 3ANRA 5T6KA 4BCMA 2W7XA 4UXQA 1KV2A 4R77A 2RIOA 4RIWB 5IG1A 3MESA 1NVQA 4X2JA 5DPVA 3R30A 3G33A 3QQHA 4MX9A 2G15A 4IC8A 3FQEA 4X3FA 3O23A 2O0UA 4KBKA 4BVUA 4L3PA 4CMOA 4YSJA 2OK1A 1K9AA 1KE5A 4JQEA 3RPOA 3QHWA 5KBQA 3PP0A 2BKZA 2QG7A 3E88A 1BL6A 3BWJA 5C27A 2ONLC 2WEVA 2VX0A 5BPYA 4M14A 3DCVA 2HZ4A 5LVLA 4HNIA 5HU9A 3BX5A 3LAUA 2VGOA 4Y72A 1W98A 3IW6A 4F0IA 1RE8A 3GGFA 4YC8A 5BVWA 1GZOA 1NT2A 2ZV8A 2OBJA 2UZOA 4GW8A 4K0YA 2EXCX 5AX9A 3VW6A 4B9DA 2Z7RA 2PUNA 3OEZA 5AP6A 4R1VA 4IZAA 4D9TA 4N70A 4Q5EA 2O64A 4OAUC 2JFMA 2X0GA 2VD5A 4WUAA 3BQRA 1UU8A 5DT0A 5LVPA 2EVAA 2R0IA 2R64A 5EH0A 5J9LA 3TKHA 3ZO3A 1H8FA 1UU7A 1VZOA 3I81A 4USFA 2Z2WA 1SVHA 3DDPA 2UZVA 5GJDA 4QMSA 5KZ0A 3KN5A 3KMWA 1OUKA 3AXWA 3OW4A 2ZDUA 3N51A 4FKGA 4J8MA 3VW8A 3FZ1A 3U55A 4HCTA 5BYYA 3QL8A 3UC4A 1XH4A 2XNNA 2EU9A 2IVSA 3BHTA 3QBNA 1GOLA 2R3NA 2X9EA 3PA3A 4Y5HA 4ANOA 4EOJA 3E8NA 3B2WA 4FTKA 2UZUE 4A9YA 3KY2A 3U54A 2AC5A 3LKMA 2HZNA 4NM7A 2YJRA 4E4NA 5AFVA 1WBOA 3FJQE 5AMNA 3V8TA 5KHXA 3HRFA 3VC4A 2YCQA 5DR2A 2IWIA 4IWOA 5AV0A 3MY1A 3ULZA 4F6WA 5A4QA 3TTIA 1P14A 2YCRA 2VWBA 2VO7A 4PL5A 4L01A 1PMUA 5K4IA 4QOXA 3PP1A 2HY81 3QTIA 3NVKI 3BGZA 1R0PA 2I0YA 4XBUA 3UTOA 2EXMA 2YIWA 2ONLA 3AC4A 3VUTA 2WTIA 3EB0A 4KS7A 3M42A 3LFQA 5EM5A 1O6LA 4D2RA 2C6EA 3DAEA 4F4PA 3F82A 5LCKA 4HGSA 4IX4A 4RWJA 3VUMA 4D2VA 4CG8A 4FV9A 2FO0A 1U5RA 2R3HA 2JKOA 2OKRA 3PLAE 4ZSAA 3E92A 5CXHA 5E4HA 3O8PA 3AGMA 2XNEA 4H1MA 4U0IA 4HZRA 4NIFA 3MN3A 4UMQA 2WMVA 4ANLA 3TV7A 3NPCA 3Q04A 4BY9E 5C8MA 3MPMA 4PPAA 4R8QA 5CAQA 3KRLA 3COMA 3G15A 2IO6A 1V0BA 4PMPA 5K0XA 2UZDA 5M56A 3T3VA 2J51A 4QP2A 4MXAA 3ZUUA 5EK7A 3TDVA 4C37A 2ETMA 1OPJA 2WTKC 1Y8YA 4OTRA 4IZ5A 2J6MA 4FZ7A 4QP4A 3RPVA 1U4DA 4ACHA 3QTZA 3DJ6A 3PJ8A 5HD7A 1UU3A 2G9XA 4I21A 2PZYA 5I9VA 4EOIA 3SC1A 2VZ6A 3DAKA 2PK9A 2PUIA 2XK8A 2XB7A 3F3WA 1H28A 2W99B 3GCSA 4JBVA 4PX6A 3PRFA 3EFKA 4ZSJA 2XRUA 5CF8A 3E62A 3H9RA 3I79A 4Q2AA 5M4IA 1P5EA 2C5NA 3NIZA 5CNNA 4B99A 5GJFA 3TWJA 4QNYA 5IQEA 3Q9WA 2PVRA 2CMWA 3DXPA 4LUDA 5GIPE 4PDOA 4IX6A 4FVRA 2YN8A 3E3PA 4LGDA 3WI6A 2HYYA 2IVVA 4BZNA 1PMNA 4U7ZA 2JDOA 5DR6A 2E9PA 4RVLA 4DC2A 4RX5A 1IG1A 4JG7A 3DY7A 2W1EA 4MTAA 4I0RA 3QTRA 1WBVA 2UZEA 3QTXA 4LQMA 1F0QA 5A6OA 3HYHA 3N9XA 4EOKA 5M09A 1FVTA 3DKCA 3FMHA 4BDJA 2OFVA 2V7OA 4W9XA 4UMRA 3KXMA 4YC6A 3RAKA 5IUGA 5J7BA 5HU3A 3AQVA 5KMMA 4TWPA 4EOQA 1HOWA 4UY9A 2YWPA 3PZEA 4NH1A 4IZYA 2ITQA 3MB6A 4XLIA 3JXWA 1UKHA 4HYUA 4G1WA 3LXLA 2PZ5A 3PVWA 1ZARA 1UVRA 3VRYA 5LWNA 4UN0C 5B2KA 4FZAB 2BZJA 2YAKA 3BHUA 3CQWA 3ORIA 4G34A 5CXZA 5CALA 2QC6A 4BCIA 1DI8A 4IVBA 5CT7A 5I9YA 2YM3A 1M17A 1Y91A 3KVXA 3WZJA 4L7SA 3A60A 4FIJA 1Q3WA 4JX3A 3VVHA 1YI3A 5FG8A 4J7BA 2YA9A 4B7TA 4D9UA 2XS0A 2PTKA 2QO9A 3VIDA 5EHLA 4MXXA 4KKGA 4PY1A 3AC3A 4QTBA 4CV9A 4EZ7A 3FY0A 4MNEB 2R3MA 3Q6WA 2HWPA 4PP9A 1YW2A 5DT3A 2W9ZB 2PVYA 4M0YA 1OKWA 4M15A 3I5NA 4FV6A 5E1SA 4BBFA 2BCJA 5AUWA 3GI3A 5JFWA 2OJIA 1JOWB 4YHFA 2X1NA 4I6FA 2UW6A 5KMJA 2CCIA 4DFLA 3RAHA 4TZRA 2A2AA 2C47A 4L43A 5AP2A 2EXEA 1CKIA 3G9LX 4RIYA 2CLQA 5EQYA 5A4TA 4WNPA 3FWQA 4EQUA 4JG8A 5HCXA 5AUUA 5AIRA 4LL0A 3R1NA 3TL8A 4ACGA 3R1SA 3DBCA 4E26A 2JIIA 2Y8OA 3I6UA 3BU6A 4AFJA 2ITNA 1YHVA 4FKSA 2WTCA 3R21A 2CDZA 4IDVA 3CXWA 4RVTA 4F9CA 3LJ0A 3AT3A 5IISA 2OICA 4HCVA 1ZRZA 4KD1A 4XH6A 4GCJA 4QMPA 3V3VA 4IANA 2GHGA 3C4ZA 5E8SA 2C6IA 2VTAA 3FZRA 3KXNA 4KSQA 4RX8A 2JBOA 5EDPA 4EEVA 4BGHA 4QMNA 1KWPA 1MQBA 2CLXA 3FYJX 3I0OA 3IW5A 4FUXA 3UO5A 1ZZ2A 5F4NA 3EKKA 3RBWA 4BFMA 4EH9A 4MXOA 1P4FA 4YHJA 1JKLA 4PTGA 4AW2A 3Q2JA 4Z7HA 3V5WA 2CGXA 5HZNA 4XG3A 5HCYA 1BI7A 2YM8A 2P2IA 3D2IA 4EYMA 3OP5A 2XMYA 3UNZA 2QNJA 5F9EA 3FAAA 4OT6A 3NW6A 2IVTA 2V22A 4FV0A 2BRGA 4O6EA 3PXYA 5GNKA 5HKMA 4ANNA 4EL9A 1QPDA 2I6LA 1GIJA 3U4WA 4QNAA 2XBAA 5IEXA 4XS2A 4ZIMA 5E8YA 4J95A 2PUPA 3FZTA 4C57A 1ZAOA 3NUPA 3PVGA 4U43A 4XP3A 4MF0A 4JLCA 3S0OA 5JSMA 3ID6C 4QYEA 2VTPA 4FTJA 3IOKA 4C8BA 4EH5A 3PG1A 4XCUA 3QZGA 5IEVA 4D5KA 2YWVA 3WE8A 4V01A 5IEYA 2W1FA 4Z55A 4XG7A 3IDCA 2XIXA 4FUYA 4DHFA 3OBJA 2ZB0A 4F70A 5C26A 2XKFA 4BDAA 3DB8A 3NCZA 1WBWA 3P78A 3WIGA 4OBPA 4KAOA 3GCUA 3CY3A 4ZS4A 4CT2A 2BFYA 4FK3A 4A4LA 1KE7A 4QP1A 4FNWA 4HGLA 4Y46A 1YDTE 1KOAA 2WMUA 2B55A 2Z7QA 3V5LA 5HQ0A 1PKGA 4UYNA 4FKJA 1DM2A 4RFMA 3E8EA 5L3AA 1JAMA 1DAYA 4FICA 1Q97A 3D5WA 2J4ZA 5DG5A 5HI2A 4GVAA 3O7LD 2OSCA 3DQXA 3V6SA 4O0UA 1Z5MA 2ITYA 3UP7A 4BF2A 2XH5A 5AV4A 3EL8A 2FUMA 3BE2A 3MDYA 1AQ1A 3GU6A 1KV1A 4MWHA 3WIKA 1XO2B 3FI3A 3SXSA 5CSXA 2X8IA 5EI8A 3EQBA 2Y0AA 3NS9A 2R2PA 2E9UA 2ZOQA 5J95A 4FKRA 5HE3A 3V51A 2F7XE 2ITPA 4JIKA 3MVLA 4QQJA 4IAAA 4FV1A 3MBLA 2YM7A 4TYJA 5IQCA 2Y4IB 4NT4A 4PQNA 4R3CA 5JGDA 3ZFMA 4FG7A 2V7AA 2RFEA 2WU7A 3D5XA 1KE8A 1UNLA 2RFDA 3O2MA 4OTGA 4YNOA 4NCTC 4FZ6A 1A9UA 3C7QA 3H10A 3A4PA 5H8BA 3K5VA 4Z9LA 2XRWA 3MIYA 4CGAA 2W9FB 3F5UA 1Q8YA 3GU4A 3ZUVA 4C3PA 1Y57A 2XUUA 3C9WA 3EQCA 3R63A 1PYEA 2VX1A 1HCKA 3FLNC 4U40A 1YXTA 2FSMX 4WSQA 4PMTA 3F61A 4AW5A 2ZAZA 2Q83A 4DCAA 2ACXA 5FM2A 1OMWA 4BDBA 5IUHA 2G2HA 3C0HA 4J8NA 4FE2A 2XYUA 5AP1A 2PMIA 3TT0A 2O8YA 4FTUA 3ZEWA 4BGQA 3DNDA 4EOLA 3PA4A 3KN6A 4GG7A 3R8ZA 4KUJA 2F4JA 2ZV7A 2GNGA 3FXZA 3FMKA 4H05A 3BRBA 3IK3A 3PFQA 4DLIA 3PJ2A 4NK9A 4LM5A 3CR0A 5E92A 3T9IA 4C3FA 4C4IA 1ZYJA 2BTSA 2PVLA 4QP6A 5HEZA 3ZHPC 4RA5A 2WKMA 4TKSA 3CGOA 3UYTA 3TNQB 3GBZA 3UDBA 2WQMA 2X6EA 3MJ2A 1EH4A 3PJCA 3Q96A 1H0WA 3PG3A 4E73A 3G2FA 4C62A 1GZNA 2PHKA 4FSZA 5D1JA 3IQ7A 1YXUA 4AXAA 3TUCA 2O65A 3P86A 5D7AA 4FTQA 4GH2A 2GFCA 3I60A 4GS6A 4GYGA 4R3PA 1XBCA 2QHMA 3R7UA 4A9SA 1GY3A 5A3XA 1F3MC 4JAIA 3W8LA 4IWDA 5HNGA 2CKPA 5HLNA 3F5GA 2XVDA 2R0UA 4JS8A 4OBOA 3H3CA 2GDOA 2WMAA 3JR1A 4DAWA 2P4IA 5A9UA 3ACJA 3C5UA 1M7QA 4NCTA 1Q8TA 2J5EA 3ELJA 4LRKA 3GENA 4TTHB 4ZY6A 3HZTA 3CP9A 3LCOA 4X2FA 4APCA 5LJJA 2O63A 4IZ7A 1I09A 5E91A 4FKIA 2OIDA 3T8OA 3ZCLA 2JEDA 2YDKA 3QD3A 3ANQA 4FTLA 2CPKE 4AOJA 4DGOA 4QYFA 2VTSA 3G90X 4E7WA 4OTIA 3L9LA 2OIBA 4S30A 2QG5A 5LCJA 3F3VA 2BRHA 4MXZA 4LOPA 2XJ2A 3SD0A 1NXKA 4QYHA 2GCDA 3OW3A 4QMTA 3A62A 3RNIA 4W4XA 2OH0E 4PNKA 5J7HA 1FVRA 2YISA 4DEBA 2YABA 2GMXA 3AT4A 4RC2A 5M53A 5K0KA 4JAJA 4BCGA 2YIXA 3FUPA 3QA0A 2X6DA 3GCQA 2OZAB 3RPYA 3ZZWA 1JLUE 2IZUA 3BGPA 4JI9A 4NU1A 2C4GA 1RJBA 5D11A 5M4CA 4JBQA 3DKGA 2DUVA 3FI2A 3QD2B 4XRLA 2OJJA 4ALVA 1IAHA 3IS5A 4FI1A 3CIKA 4K6ZA 4W8DA 4UBAA 3JY0A 4L44A 4QMVA 3KRXA 4FK6A 3CTHA 4MXYA 4AQCA 4CFUA 4MD7E 4ZMFA 4QP9A 4G31A 3QQLA 2WELA 3NWWA 5AM6A 1U54A 2XCKA 4S32A 5HLWA 3UOLA 2GNHA 1GJOA 5I4NA 3VBWA 3AMYA 4KIKB 4PDPA 4M7IA 4CV8A 1JKSA 3ZRKA 3QA8A 3RVGA 4BBMA 4LI5A 4QMZA 3BCEA 4F9AA 3Q4ZA 3P0MA 4RJ7A 4MCVA 4EH7A 4KB8A 3ZBXA 1E1XA 3RM6A 5FD2A 3V01A 4BCQA 4FEVA 3JY9A 4FIIA 4TYHB 2QU5A 1FMOE 1Q62A 4K1BA 3FV8A 4BICA 4KABA 3BU3A 3ODZX 1MRYA 3FXWA 3ZONA 5AP0A 4G6NA 4OTDA 2JIVA 4PMSA 2XZSA 2E9NA 4O7ZA 3TJDA 3H4JA 2FB8A 3KEXA 3Q5ZA 2CKOA 4ZY4A 3D7TB 2BR1A 1VEBA 4ACDA 4F64A 3I5ZA 4O1OA 2R3FA 3UIMA 3NUSA 4PF4A 4PL4A 3KF7A 5DNRA 4YJPA 3C13A 3NVMB 2ETKA 4M0ZA 3R7EA 1TVOA 5J1VA 3DBEA 1FVVA 3F5PA 4H58A 1KE6A 1MRUA 3K3JA 5BVDA 4X6RA 1CMKE 4MD9E 1PMVA 2X39A 4RFZA 4JBPA 4YJOA 2NNWB 1LR4A 2VNYA 3HECA 3TI1A 4BZOA 5AAEA 2PWLA 1URWA 2WQEA 2RFSA 3UPXA 5FXRA 4DINA 3QRTA 3GC0A 3E8CA 1UV5A 3FQSA 3OCBA 5JRSA 3NSZA 4QMOA 4AA4A 2I40A 2DYLA 4FC0A 2HAKA 2JC6A 3NYOA 3QXPA 5FQDC 3C50A 3ZRMA 1VR2A 5ITAA 4BWXA 4IAZA 2X2MA 4M67A 4S34A 4EHZA 4EOSA 4AN2A 1H08A 3LM0A 5I9XA 2H9VA 4H39A 4BHNA 4AZSA 4QPAA 2C6OA 2XK7A 4TT7A 3TKIA 3LLTA 3ITZA 4RLLA 1GIHA 4UEUA 4ORKA 3SW7A 4G3DA 4EKLA 4ZZNA 3KMMA 5A6NA 2XNMA 3PLSA 2ITUA 4EI4A 5T68A 2J0IA 3C4CA 4NWMA 3RKBA 3W2RA 3HV5A 3A61A 1J7IA 4GL9A 4NTSA 3UO4A 2WMSA 3IGGA 3UP2A 4H3BA 4N57A 2W1GA 1QL6A 2J9MA 3QTUA 2C5YA 4PWNA 2R3PA 4CD0A 5B2MA 4H3PA 4J98A 1OBDA 2ZYBA 2UW7A 5CAVA 2X9FA 3V5PA 3Q4TA 3S00A 2ZM3A 4RJ3A 3ATSA 2YM5A 3EL7A 4D28A 3IPHA 5D41A 4BB4A 5ETFA 2RGPA 5TR6A 5G6VA 5J87A 4C2VA 4QMQA 1L3RE 5IH5A 2UVYA 2W1HA 3I4BA 2XM9A 4CFVA 1BKXA 4XG8A 5L4QA 1Q8UA 5FEEA 5AP3A 5FM3A 4FF8A 4ZS0A 3EZRA 4FA2A 4U44A 5AWMA 4B4LA 5BX0A 4H36A 4U3ZA 4RRVA 1QMZA 2F49A 2VTMA 3T9TA 1PY5A 1J3HA 3BKBA 3HL7A 3QRUA 3EFLA 5H2UA 1XH8A 3NNVA 2VTQA 5AR8A 2QLQA 5CVHA 3A8XA 3RNYA 3R9DA 3UQCA 3HV4A 3EN5A 2R3LA 3E63A 4FSYA 2UVXA 3LCSA 5HIEA 3U6JA 4NJDA 2HW7A 2FSOX 4I1ZA 3BYUA 3GP0A 1OVEA 1UNHA 4JR7A 2B0QA 5TOZA 2IW6A 2GFSA 3R6XA 3KL8A 1XH6A 4MBJA 4L42A 3VS7A 4HGTA 3OUKA 5IKWA 5HO7A 2UW5A 4W8EA 4Y5QA 3BZ3A 3HUBA 3SLSA 2XKCA 3GOKA 3GCVA 4PPCA 3SXRA 4BI0A 4LMNA 2YCFA 5EOLA 2W5AA 3MA6A 4FSNA 1PF8A 3UIUA 5HBJA 2WHBA 3LHJA 2XK4A 3PJ1A 4GT3A 4MVFA 5TE0A 1AGWA 2QOHA 4PP7A 3M2WA 2PVJA 4C4GA 4O27B 4Y83A 3KXGA 4IM2A 2BAQA 2WIPA 2GNLA 3GOPA 2X2KA 2C0TA 2JLDA 4L3LA 4M3QA 5AJQA 4EONA 3EZVA 5C4KA 4QMUA 2IJMA 2BFXA 3E64A 4KBAA 3MYGA 4Y85A 2YLFA 3V6RA 2G2FA 4E6DA 3LFAA 3LFDA 1X8BA 4ENYA 5CAPA 1XQZA 4TYGA 1YOJA 2XP2A 4R7HA 5HO6A 4NFMA 4G5JA 3WILA 3F7ZA 3E3BX 4DH5A 1BUHA 1NVRA 1OB3A 2ITWA 5I9UA 2PZPA 2UZLA 5JZJA 4RIWA 3FZPA 4CEGA 5A54A 4EH4A 5CAOA 5JEBA 4YZNA 4GFOA 4IAFA 3UJGA 3NUAA 3IW7A 2AYPA 2WMQA 4V0GB 1JSUA 1NY3A 4EJ7A 4OTQA 1JBPE 3L8PA 4FT7A 1YQJA 3AT2A 3L8XA 3PTGA 4E8AA 4I5MA 3MI9A 5DR9A 1TQIA 1OGUA 4L9IA 5ANOA 5I9ZA 4DEGA 3BEGA 4GMYA 2JKMA 2KTYA 4XYFA 3DXQA 3OCGA 3QFVA 3S4QA 2W4JA 4ANMA 1PXLA 3SRVB 3MVMA 3ZH8A 3H30A 4OAVB 3D5UA 4GJ2A 3ZO1A 5KHWA 3OD6X 3SG9A 3KCKA 4W4WA 4CFXA 4FIEA 3ZYAA 1ZMWA 4N6ZA 5AR7A 5GJGA 4FL3A 4YLLA 3TCPA 3AC8A 3VWAA 1YVJA 2RF9A 2OO8X 2G1TA 4DTKA 5CVGA 4D4VA 1OL1A 4USDA 2C3KA 1SNUA 3ERKA 3GC9A 3P1AA 4FV7A 4QP8A 3WYXA 5CENA 5IQBA 2QI8A 4L52A 2I0EA 3R04A 4IWPA 4R78A 2YERA 2B9JA 3QCSA 3QYZA 4Z16A 5CF6A 4FTNA 5M4UA 5KMIA 5C4LA 4ANBA 3KMUA 3OUNB 1SM2A 4MNFA 1M2QA 4DE4A 4I41A 3ZO2A 5L2SA 4FT9A 4KIQA 2FGIA 1ZOHA 4KINA 3VS3A 1B38A 3HMOA 4P5QA 5FXQA 3ZLWA 1J91A 3T3UA 5HE1A 5C1QB 4UALA 3ET7A 3L1SA 3BE9A 3MH3A 4FEXA 2VTLA 5DIAA 4YLJA 4X3FB 4R3RA 4EWHA 2P2HA 3FLSA 3UNJA 3KRJA 4AZWA 4FG9A 3BYOA 4FIHA 2VWYA 4TYEA 4Q9ZA 4O0YA 1PRYA 2WTDA 4DGLC 4DEHA 3LE6A 4FSWA 1U59A 3OBGA 5HESA 3WZUA 2ZM4A 3PXQA 3GCPA 5DGZA 2PVHA 3UIBA 1FOTA 3ULIA 4X0MA 4YZ9A 4AA5A 4GUEA 3GQIA 1ZMVA 4JVGA 2I1MA 3DKFA 4I24A 4RJ4A 4ZP5A 2YZAA 4EJNA 4C2WA 1O6YA 3HMPA 4CQEA 2QLUA 2RKUA 3QCQA 2UZBA 1OL5A 4IJPA 1ZYLA 4D2TA 4FVQA 3G5DA 3FLWA 1H1SA 2YITA 3BBWA 3C0GA 1JNKA 4S31A 1W8CA 2QQ7A 1OL7A 2WMXA 4NJ3A 4BRXA 2FSTX 5I0BA 4DGMA 3V04A 3COKA 3K5UA 4CG9A 4PMMA 1P2AA 3ORTA 5HTIA 5BUJA 2A0CX 3L9MA 4RJ6A 4M66A 3LXPA 4M69B 3TV4A 3ZLSA 2BAJA 4NYEA 4MXCA 1BL7A 5CSVA 4HVHA 1CTPE 1ZY5A 4QMXA 1GZ8A 4J53A 1L8TA 2R9SA 5C9CA 2JDSA 4O22A 3VHEA 4R7BA 4EH3A 5L8JA 2C3LA 4HPTE 5AAGA 3GXLA 4V04A 2ITZA 4Q5HA 3F2RA 3MH0A 3R00A 5HG5A 1NVSA 3ZM4A 4YMJA 4J99A 3W8QA 3PPJA 4O82A 4BKJA 2JD5A 3CQEA 4XV2A 5KNJA 3EN9A 2UW3A 3PY3A 3VBQA 2BIYA 3DFAA 4G9RA 4JRNA 4AN9A 2C69A 3KVWA 3DFCB 3RALA 4CYJA 2QKRA 3ZRLA 3RWPA 4XV1A 4KA3A 3ZU7A 3QGYA 4FEUA 2ITXA 4JL9A 1J7UA 2F9GA 5EI2A 3FQHA 4UWBA 3VS1A 4N6YA 2IN6A 3E7OA 5FDXA 3LFSA 1K3AA 3Q32A 2B7AA 2YLEA 3O7LB 3G9NA 4HCUA 2G01A 2WGJA 4TL0A 4DTAA 5DH3A 3OTVA 4LGGA 3H0YA 3OXZA 3Q9YA 3RWQA 4O38A 2ZM1A 3AG9A 3EH9A 4S2ZA 1R39A 4IC7A 4BDEA 3KCFA 4O7RA 3ORZA 4C7TA 3P7CA 5IF1A 2CNVA 4QQCA 5DYJA 3DS6A 4FBXA 3OS3A 4BTJA 2VUWA 1R78A 2YFXA 1ZWSA 1VYWA 2Z8CA 3V5JA 3VHKA 3PY1A 4JOAA 4DGGA 4RZVA 3VUGA 5ANKA 4ZTNA 3NNUA 3L9NA 4CT1A 2WTWA 1PHKA 2W5BA 4GV1A 4E6CA 3PVUA 4ZJVA 2ITOA 3QQKA 2Y6OA 5CEIA 1K2PA 4ZXTA 4CKJA 2YAAA 4XG6A 3ZM9A 5M06A 1FMKA 1DS5A 3SDJA 3NUYA 3ZUTA 3FKNA 4YP8A 5JZNA 3POOA 3GT8A 4FKLA 4XNEA 4DBNA 5EHOA 3FBVA 5E8VA 5BVKA 3RK5A 4UB7A 3RINA 3GU8A 3K3IA 4KBCA 2VRXA 2QOLA 4YTHA 4CRLA 3LZBA 2WQNA 4F0FA 4U8ZA 4AT5A 4OLIA 2HZIA 1SMHA 4UMTA 4P90A 1JSTA 3JUHA 5FBOA 2DQ7X 3KB7A 4WBBB 4EQCA 4ASZA 1PJKA 4E3CA 4I93A 5JGBA 2WIHA 3RK9A 3CD3A 5D7VA 2BROA 3SW4A 3CSVA 2XA4A 4CTBA 1I44A 3HMMA 3GB2A 5EM8A 4RT7A 5IQHA 5C8NA 4GKIA 4CXAA 3D2KA 4EOPA 4AZEA 3MW1A 4XHKB 2F2CB 1M14A 3PPKA 4QRCA 1OKYA 3F88A 4PV0A 5EW3A 4CSVA 4MQ2A 4DLJA 5BUEA 5I9WA 3TJCA 4XOZA 4FTAA 4QTCA 2QD9A 3OY3A 3NUXA 4WUNA 5M44A 4IAYA 5AR2A 3VBXA 4FGRA 4NL0A 4PL3A 4WNKA 4BCHA 3OOMA 4BIEA 2NPQA 3TUDA 2B54A 4EBVA 5HX6A 4BKYA 2SRCA 5AX3A 3MY0A 1YI6A 4FTCA 3F3ZA 5CLPA 4H3QA 1U5QA 5AP4A 4HVIA 3LVPA 3L8VA 4TWOA 3REPA 4AT3A 1R1WA 2VV9A 2WTKB 3W2OA 1PXPA 3ATTA 3MV5A 2ZV2A 5GZ8A 2OJGA 5E1EA 4FODA 5CI7A 3KREA 3R7OA 3PSCA 3OROA 5HIDA 5AADA 4ALUA 5I3OA 5EW8A 5CYIA 1B39A 5CAUA 4WO5A 3F2AA 3PYYA 2Y4IC 4JQ7A 3MJ1A 2QODA 3QQFA 3W2QA 2WFYA 4CFWA 1KSWA 4XG2A 4XMOA 5EYKA 3MPTA 2HK5A 3CY2A 5CU2A 4C58A 5DWRA 4AE9A 3FLYA 4WKQA 1Q8ZA 3R8PA 2PE0A 3PWDA 2WO6A 5D12A 4O7SA 4IB1A 2OWBA 2YDIA 3ORLA 4FGBA 5LOHA 4O0TA 4GFMA 4GRBA 2Y9QA 2JDTA 5KO1A 2CKEA 1ZZLA 4AWIA 1ND4A 1YHSA 5LARA 2W1DA 4C3RA 4DFYA 5JFSA 2VTNA 5CNOA 5DHJA 2BRMA 4ZJIA 2CHLA 5LWMA 3DBQA 4NEUA 5E7RA 4J1RA 1WBNA 5JN2A 3W10A 5EW9A 2PYWA 1GNGA 3CD8A 4GK2A 4UX9A 1O6KA 4FEQA 2R3RA 3H9FA 2Z60A 3DB6A 2R3KA 3I7CA 4QTEA 4NUSA 5DEYA 2Y7JA 2PMNX 2WPAA 3E93A 5AM7A 3OEFX 4DGNA 4FIFA 4I94A 4MYGA 5L6OA 4KKHA 2BMCA 3QAME 3NLBA 1Q24A 4EWQA 1Y6BA 4G5PA 5HD4A 3EFJA 4JNWA 1YHWA 3AC5A 2XNOA 2ERZE 2PU8A 5E8UA 3V5TA 3O17A 1ZOGA 1Q99A 3UMXA 2H96A 1CKPA 3SXFA 2Z02A 2BDWA 3IKAA 5GZ9A 4IAIA 4RX7A 4PPBA 4DEEA 5LQFA 3QZIA 2XJ0A 3GU5A 3C5IA 4ZTSA 5EKOA 5F20A 2YIYA 1NA7A 5IA2A 3OT8A 2UUEA 3QLGA 2J0LA 3RHKA 2ZDTA 3ODYX 4AFEA 4QMWA 3ETAA 1PXNA 4CMTA 4IFGA 4YPDA 2OI4X 5AR4A 4GEOA 4C38A 1W84A 4K2RA 5F94A 1LEWA 4RIXB 3FMLA 5DBXA 4G16A 4F9BA 3FDNA 3HNGA 2CN5A 2EWAA 2ITTA 3P23A 4IM0A 3UYSA 2PSQA 3CEKA 5BMSA 3D5VA 4AT4A 1WVWA 4LOOA 4O7WA 4IW0A 5K4JA 2YEXA 1Q4LA 4XX9A 5ETIA 3ALNA 4XV3A 5ANDA 1KOBA 2R7BA 3OVVA 3ZO4A 4QD6A 1A48A 4XG9A 3PSBA 4EZ5A 4F1MA 2VTRA 1ATPE 3W16A 4V05A 1J7LA 3SHEA 4OBQA 2HXLA 3NCGA 1PW2A 4B0GA 3UQFA 5FRIA 2X8DA 2VTHA 2H8HA 2FYSA 4O21A 4FTOA 5DN3A 3COHA 3EQIA 4L3JA 4KSPA 4YZCA 3RZBA 3KC3A 3LJ1A 3FI8A 4D2WA 4E5BA 4EH6A 1JQHA 3EQFA 4RSSA 5CT0A 4ACCA 4FSQA 4FX3A 4KIPA 4QMMA 4U9AA 4AOTA 3EQDA 3F7WA 4II5A 4BWPA 2YZLA 4UMPA 3C4FA 2O2UA 3IW8A 1FGKA 3VULA 4TYIA 1AD5A 2PPQA 3MVJA 4G3GA 3RGFA 4AE6A 2C3JA 4USEA 2IG7A 3S95A 3PDTA 3PRIA 4QYYA 3BI6A 2X81A 4FR4A 4EOOA 2R4BA 4DFNA 3PXRA 3KK8A 4RFYA 3RI1A 4BGGA 3QQJA 3O50A 3QCXA 4F9YA 4FKQA 3FZOA 4CMUA 5JMSA 3QZFA 4K8AA 5HNBA 2V62A 2HZ0A 4I0SA 1XH7A 4E5AX 4A06A 2PMLX 3D4QA 3EN4A 2J50A 2VTOA 3R9NA 4A9TA 3R2BA 3CLYA 3OXTA 1H00A 2UW4A 1YRPA 4RVKA 3CGFA 2RG5A 4CYIA 4NSTA 3VF8A 4BTKA 5KKRB 3DK6A 4BYJA 1PYXA 4BI2A 4ASEA 4RWIA 4EHGA 3NRMA 4JRVA 4CVAA 2W96B 2GSFA 3AOXA 4LOQA 3TUBA 2X4ZA 1OIQA 2IW9A 4Y8DA 1ERKA 2R3QA 3PIXA 1PXJA 1VYZA 3BHYA 3V8SA 5FDPA 2QOIA 4FOCA 3MH2A 4R5SA 3ZZEA 3EQRA 4BN1A 4RQVA 3U87A 4DA5A 3ROYA 4GU9A 5CEQA 3TZMA 4WHZA 3TNIA 3CPBA 2OZOA 4MF1A 5EM7A 3OZ6A 3PE2A 2J90A 2PE1A 4YBKA 4C33A 3KULA 3U9NA 5AUTA 1OM1A 1STCE 4WA9A 4DFUA 1XBAA 4JBOA 1MUOA 5C01A 4BTMA 3PIYA 2BRBA 3U51A 2UW8A 1GIIA 1H0VA 2A19B 3FXXA 3Q5IA 5EG3A 4M97A 4BDHA 4DH1A 3FMMA 3ZSIA 3B8QA 3BGQA 4ASXA 4NZWB 3FSKA 5GIOE 5DEWA 1ZYCA 3MWUA 3ZTXA 3R9OA 1APME 2YM6A 1Q5KA 2BDJA 4IQ6A 4M13A 3A8WA 5FP6A 4EOMA 4IAKA 1U46A 3VJOA 2GHMA 5HE2A 3R8LA 3F2NA 4FIGA 4XJ0A 2XIYA 4YJUA 3FEGA 3DZOA 3NEWA 2F2UA 1H01A 4N0SA 2QOBA 3GUBA 3KKVA 3QX2A 5H8GA 2BVAA 3W1FA 4TYHA 4R5YA 4DG3E 1ZOEA 3RJCA 4IXPA 4P5ZA 5KMNA 2HOGA 4RBLA 3DZQA 1XKKA 3NYNA 3ORNA 4OTPA 1IA8A 4FT5A 3R7GA 3DBDA 5IZFA 3KK9A 3GFEA 3DK3A 1OPLA 3D7TA 4LUEA 4A9RA 5F1ZA 4WSYA 3HRCA 3VUHA 4YUQA 5HTCA 4MWIA 5DRBA 4HVSA 2I7QA 5L6PA 3E7VA 4O0RA 3D9VA 3Q52A 4D5HA 2BALA 2PL0A 4I23A 2QKWB 2BIKB 3U6IA 4BCKA 2C6MA 2HXQA 5A4CA 4CZUA 2X8EA 3IOPA 4FKWA 5ANEA 4YO4A 3UOKA 4QP3A 4HOKA 2OJ9A 4FNXA 2BRNA 4EK6A 2GQGA 3CKXA 4WT6A 3R8UA 3DLSA 4YJTA 2B9FA 3WE4A 4AGCA 4IH8A 5HBEA 5FTGA 1FPUA 4MQ1A 3FHIA 1OL6A 4CCBA 4U3YA 4A4OA 1UU9A 3FHRA 3PPZA 3HLLA 3TTJA 3UG1A 3IDBA 3TN8A 3QUEA 2ZB1A 5HLPA 4NKAA 3FMDA 3QU0A 4O2ZA 4ZK5A 3HV3A 4PUZA 2YDJA 3LMHA 4UV0A 4BCOA 1Q61A 3HKOA 5FP5A 2FSLX 3D15A 3KXXA 3BU5A 3HAMA 4QPMA 4DT9A 3ZXTA 5KBRA 4YSMA 4FEWA 1J1CA 3R8VA 3VQHA 3ENHA 2Q0BA 2XIZA 3AD5A 4OTFA 4QP7A 2ITVA 4X2KA 2W1CA 3EQHA 5DT4A 2PVKA 3OXIA 4U41A 3ALOA 3DK7A 5CTPA 2XEYA 2RL5A 4IM3A 3KQ7A 3DBFA 2O3PA 1OITA 5CY3A 4FV3A 3QF9A 2OG8A 5KZIA 2RSVA 4FTRA 3R22A 2QU6A 4EH2A 3RTPA 2NRYA 5IMXA 3S1HA 3G0EA 2FA2A 3PE1A 3QUPA 5CS6A 4YU2A 1CM8A 3RPSA 2QO7A 3WOWA 1W0XC 3OCSA 5AUYA 2OGVA 3VS6A 3PXKA 1SVEA 3WF5A 4FV5A 4FV2A 2OH4A 3RMFA 3GC8A 3IECA 2UVZA 2YM4A 3WYYA 3ZFYA 3FE3A 4CRSA 5BVFA 3F3UA 5FEDA 3QKMA 4I22A 1TQMA 3R8MA 5EI6A 5JFVA 4I4EA 3WF8A 4FYNA 4GSBA 3PWYA 4O0WA 3G51A 4TW9A 4ZZOA 2JDRA 4C4FA 4LRMA 4AGUA 3RHXA 4LL5A 4DFBA 5DFPA 5AEPA 2CNQA 4G3FA 1FINA 4TNDA 2J0KA 4E4LA 3B2TA 5CF4A 4B8LA 3LJ2A 3QALE 4F65A 1YWVA 5ANGA 4M68A 3A7IA 5CX9A 3QLFA 5KMLA 4O96A 1OIYA 1ZYSA 4C4JA 3QXOA 4FKOA 3EKNA 5KMOA 4DBXA 5ETCA 5CEKA 3CQUA 5AR5A 2HELA 4BL1A 4ZTQA 2WTJA 2ZMCA 4MEDA 2JBPA 1G8SA 3UNKA 1WZYA 3ENMA 3IO7A 4DFXE 3GNIB 4O7VA 1WBTA 5LMBA 4OTHA 4F7NA 3TV6A 3IG7A 3DT1A 4DH8A 2YHVA 2BTRA 3MIAA 4YLKA 2OW3A 3R7IA 2B9IA 2XBJA 3MFRA 4ZAUA 2CNUA 3OOGA 3UVRA 5JKGA 4O7NA 4ANSA 5TO8A 3ZSHA 4EZ3A 3TIYA 2HY0A 3CC6A 3P79A 4RPVA 4FSMA 4RC3A 1IA9A 2EUFB 2C6KA 3CTQA 4RJ5A 5DE2A 3C1XA 4E6QA 4FNYA 4YURA 3V5QA 3O8TA 4NW6A 4EBWA 4FL1A 2YJSA 3NYXA 1OIUA 3L9PA 4IB0A 3ZLXA 5BVOA 5CU0A 4HYSA 4V0GA 2VX3A 4BDCA 5HVKA 1KUTA 2HWOA 3ZSGA 3RK7A 2QVSE 3QWKA 3LMGA 4FG8A 2YACA 3QC4A 4PRJA 4D4RA 4FL2A 5AV2A 2WMTA 5M57A 5HVJA 5EYDA 2XCHA 5A4LA 3CJFA 1WCCA 2VWWA 1UA2A 5AV1A 2UV2A 3O51A 2C1AA 3GQLA 1GZKA 3FZSA 3SRVA 4ANQA 3R1YA 4W4YA 4RZWA 1FGIA 4G6OA 4MBLA 4ZJJA 5BMMA 4WOVA 4X3JA 1OZ1A 4IFCA 4R7IA 4LG4A 3ZOSA 1FBNA 4O7TA 4G9CA 4XBRA 2OXYA 1NW1A 3LM5A 4F1TA 2UW9A 2VU3A 2UZWE 3D7ZA 3HAVA 3Q53A 2C3IB 5DLSA 2HCKA 4WD5A 4AN3A 3VQUA 4ASDA 3LIJA 3EWHA 3FC2A 1JPAA 3EN7A 2CN8A 3PJ3A 4J97A 4WG5A 4PTEA 3POZA 2PVNA 1YI4A 3C0IA 4EC9A 5EKNA 2QOFA 3EOCA 4LFIA 1WBPA 4FMQA 4IWQA 3MS9A 3NGAA 3VJNA 3Q3BA 2E9VA 2WEIA 1FQ1B 4MD8E 4OW8A 3OWKA 4O2PA 3P7AA 4ARKA 4WG3A 5EFQA 4A4XA 2IZTA 4TY1A 2C30A 3UODA 3HV6A 4FKPA 5IDNA 3HEGA 2UZNA 4FTTA 4Z7GA 5CZIA 5M08A 4I92A 4TPTA 4XLVA 3P4KA 3QWJA 4O0SA 3E87A 4HYHA 5A14A 5CEOA 3SA0A 4E5WA 5HCZA 1ZYDA 2J0JA 1H24A 3LFEA 4G6LA 3PUPA 2VWVA 4KRDA 1BLXA 3G6HA 3MA3A 2CGUA 3VAPA 5J79A 5KUPA 3THBA 3SGCA 1PXOA 3EJ1A 1REJA 3AMAA 3TXOA 2R7IA 4FOBA 3UO6A 3W18A 4A07A 4IIRA 2YIQA 2WQBA 3R28A 2I0VA 4GUBA 2X2LA 3BYSA 4IX5A 5AP5A 1UNGA 2Y4PA 4RJ8A 4YGAA 2H34A 3SV0A 4YR8A 5L2IA 2CSNA 3NUUA 4CLIA 4RA4A 2XNGA 2PZRA 3G0FA 5CQWA 1URCA 3HV7A 4J52A 4CZYB 5JT2A 5AAFA 3Q4CA 3FKLA 3SKCA 4CKRA 3QRIA 4NW5A 3AMBA 3U6HA 3KXHA 3AC2A 4BZDA 2XNBA 2OU7A 4U97A 3KU2A 3W55A 1W7HA 1YDRE 3M11A 4GIIA 5CSPA 4XRJA 3QZHA 4U6RA 1XH5A 5HHWA 4YJSA 4QQ5A 3H0ZA 4IB3A 3HA6A 3CS9A 4CKIA 1OPKA 2F7ZE 4O7LA 4BTFA 5D9HA 4F08A 1XBBA 5ACBC 5I3RA 3R7YA 2BKKA 2E2BA 4HVDA 1YWRA 2X4FA 4YZMA 1IRKA 2WU6A 4ZSEA 2GU8A 3KGAA 4UMUA 2ZV9A 3I1AA 5KMKA 4M69A 3ZDIA 2BDFA 5I5ZA 4GKHA 2AC3A 2J5FA 3LQ8A 3I7BA 5L2QA 4ZMEA 3GC7A 5LVMA 2E9OA 3LXKA 2C5OA 3EQPA 4KRCA 3LFNA 5HBHA 3LW0A 3SG8A 3HDNA 3P08A 5IMEA 4BKZA 1YXSA 4BCNA 3WF9A 4AZTA 3UOHA 5FTQA 2C6DA 2NRUA 3QYWA 3W32A 3A7JA 3D14A 5JGAA 3FC1X 4RG0A 2QONA 3QX4A 4C4HA 4AGDA 3KA0A 1XH9A 2GS7A 3C51A 2VGPA 1P4OA 3MFUA 4MKCA 4LYNA 2P55A 3BV3A 5DVRA 3VBVA 2HENA 3FMJA 3LQ5A 5FGKA 3VNTA 3ZXZA 1OKZA 5IU2A 4BIDA 2WTVA 3EQGA 2O5KA 3HMIA 3HX4A 4G17A 4M84A 3ZFXA 4DEIA 2BHEA 4X7QA 1S9IA 4BDGA 4BR3A 2JKKA 1QPCA 3BHVA 3CE3A 3F69A 3MSSA 2V0DA 4OT5A 5E8TA 3VS5A 5CANA 3TKUA 4YPSA 4KIOA 3UVPA 4HW7A 1PMEA 3SAYA 4RIOA 5EM6A 2ZMDA 5AIKA 5FUTA 3MTFA 3OMVA 4MH7A 5FWKK 2CCHA 2XIKA 1Y8GA 3QKKA 4E93A 4F0GA 4MHAA 3OWPA 4GVJA 2XNPA 1WFCA 1E1VA 4IE9A 3COIA 2PVFA 4C35A 1RDQE 3VN9A 5FBNC 3EIDA 3BBTB 3BYVA 1OBGA 4IMYA 3W33A 2OJFE 4B6LA 3WF7A 3W2CA 2ZVAA 5G1XA 4PDSA 1V0PA 4IDTA 1H25A 2VWUA 4O7YA 2WOTA 1Q41A 4GJ3A 3W2PA 3TM0A 2VTIA 4FT3A 4NIFB 4NKSA 4A7CA 4LGHA 4LV5A 2X7GA 4Q9SA 3DJ7A 3AD6A 2BZKB 3OHTA 4KKEA 3LCDA 3HDMA 2XYNA 4ITJA 4XUFA 5BYLA 2GNFA 4U45A 1SYKA 4YJNA 5AUZA 5HG8A 3VUIA 3PVBA 1JKKA 3FI4A 3RZFA 3FSFA 2QO2A 2BHHA 4PNIA 4AP7A 4AU8A 3DPKA 2OFUA 3WZDA 4TRLA 4FTMA 5M4FA 2WQOA 3IW4A 2GS2A 1YOLA 4I6QA 4R6VA 4YTCA 1BMKA 2LGCA 3P5KA 2FH9A 3JS2A 1G8AA 4JDIA 3KFAA 2R3IA 4GK4A 3BEAA 5EYMA 2OLCA 5CWZA 3OWLA 4ITIA 4IVCA 3QTSA 5DA3A 5DOSA 3ZS5A 4D1SA 4ALWA 5JQ8A 3LMIA 1W83A
chains in the Genus database with same CATH superfamily
4MNEA 1QPJA 4IADA 3O5AA 4QPSA 2GQRA 2GNJA 4ID7A 5H3QA 5HG9A 3SOAA 2VO3A 1H1QA 5E90A 2XKDA 4D58A 5B7VA 4TWNA 4L67A 3LCKA 3FY2A 4RQKA 4DF3A 1Q8WA 3PSDA 4CQGA 5CU6A 1H1RA 2WMBA 2DWBA 3I6WA 4OUCA 3AD4A 3CTJA 4E4XA 2JAVA 1IAJA 4ZTRA 3RAIA 4D4SA 3PUFC 4ONAA 1H26A 1CKJA 3OY1A 5HOAA 2LAVA 1DI9A 4CZTA 4EH8A 4AS0A 5GZAA 4ERKA 4GIHA 4QYGA 2VTJA 5LMKC 3TNWA 5H9BA 3UIXA 5JRQA 4I5PA 2BUJA 3FLQA 3Q2MA 4CFNA 2VWZA 3WBLA 3B8RA 3UG2A 3II5A 5IQIA 2ESMA 4AGWA 4CNHA 2C6TA 3Q9ZA 2P33A 4HPUE 3ACKA 2OIQA 4FVPA 4GFGA 4O81A 5FLFA 4X2NA 5K3YA 4M12A 3UMWA 3O8UA 2ETRA 4UYAA 5IDPA 4EKKA 3VBYA 2WD1A 4BYIA 3CBLA 4GK3A 2QHNA 4I5HA 3RCDA 4QDEA 2WOUA 3L8SA 5HO8A 1OL2A 3CCNA 4D0WA 5BUIA 2PMOX 4AACA 4YZBA 4B8MA 1XHAA 4CCUA 4DH3A 3CPCA 3HGKA 3VRZA 3Q60A 4BDDA 4H1JA 4JT3A 3D0EA 2C0IA 5IA0A 4ZLOA 5HX8A 4UXLA 4IVDA 2Z7LA 4FV8A 3OTUA 4KWPA 3LOKA 2WMWA 5EQPA 4XG4A 4ZSGA 3QRJA 1PXMA 2WXVA 3RCJA 2F7EE 1T46A 4FNZA 3AGLA 4BDFA 5E8ZA 4BI1A 4RIYB 1WAKA 1UKIA 5B2LA 4DG0E 2B53A 1GAGA 4WRGA 5IA1A 3LQ3A 3OC1A 3R01A 5DRDA 1J1BA 4F99A 1F5QA 3R02A 1IEPA 4DDGA 4G3EA 2QOKA 4YNEA 4CFFA 3F5XA 2W4OA 4J96A 2GNIA 4ITHA 3FL5A 4LMUA 4ACMA 1T45A 4I3ZA 2XANA 2W1ZA 2XK9A 3EYGA 3RP9A 4EK4A 4TXCA 1REKA 4L6QA 5LMKA 2W1IA 2C68A 4HYIA 2B1PA 4QT1A 4QMYA 5L6WL 2XEZA 4HNFA 4NM5A 4ZTLA 3NYVA 5K5XA 3TNPC 4MUQA 3PXZA 4C4EA 3WZEA 4HVGA 5E8WA 3HVCA 4U80A 4C36A 4IACA 5T3QA 3DKOA 4DYMA 3NMUF 4CFMA 4YZDA 4TWCA 3MY5A 3D83A 3PZHA 4WG4A 2IZSA 1ZLTA 2JFLA 2V5QA 3TEIA 1H27A 5EDQA 3KXZA 4YJRA 1WVXA 1XWSA 4D0XA 4EUTA 4ZY5A 3V8WA 2PZIA 3DU8A 4N4SA 1YXXA 4RMZA 1TKIA 3LFCA 1YWNA 3NW5A 3ORXA 1YOMA 2NP8A 3LPBA 4RIXA 3UGCA 4IBMA 5CZHA 5IA4A 3BLAA 4F63A 3JVSA 3Q6UA 1ZY4A 5F95A 5AV3A 4BCJA 3DTWA 1OKVA 4QQTA 2WNTA 3QD0A 3TG1A 5AA8A 2KULA 5KKRC 2BILB 2P3GX 2C0OA 2R3OA 3S3IA 4C59A 3FPMA 3HP2A 4O91A 4U79A 3ZC6A 2CJMA 3P9JA 3R1QA 4ZLYA 1G5SA 2VO6A 1H1WA 3F66A 4C0TA 2C5XA 2HW6A 4O83A 2W0JA 3UDZA 1QCFA 5HG7A 5IQDA 5CU4A 2QR7A 2GPHA 3ORPA 2F57A 2XK3A 2Y6MA 4BWKA 1TQPA 4E4MA 4EK3A 4JQ8A 1KE9A 4E20A 4HZSA 1DAWA 3DTCA 3PY0A 3FMNA 4I4FA 2X0PA 4FSRA 5HICA 3K2LA 3ZC5A 4QMLA 4U42A 4DHIB 5EYCA 3WF6A 4D1ZA 5JFXA 2I0HA 2W06A 3NAYA 4MAOA 5AA9A 4RWKA 3R71A 1MQ4A 2GQSA 1G3NA 5ANIA 3VUDA 4Z3VA 4D2PA 4F7LA 4JDJA 2OF4A 3ZMMA 4YC3A 4YHTA 3QUDA 3GFWA 2OXXA 5ETAA 4NM0A 5IQAA 4DEDA 4QO9A 3JPVA 3LXNA 3VS2A 4F09A 5AUVA 3NDMA 3QQUA 2QR8A 4IEBA 3JYAA 1H1PA 3PA5A 4WRSA 3O71A 1Z57A 1OIRA 3QRKA 5IUIA 4BC6A 4EQMA 4EUUA 5CEPA 3BL7A 3BPRA 5D10A 3MFTA 1H07A 3NW7A 1JSVA 4ENXA 2C1BA 3N4VA 2JAMA 1G8KA 4RVMA 4K9YA 1UWHA 2BZIB 4AF3A 4GT5A 3M1SA 3NAXA 4BDIA 1LP4A 2P0CA 4GYIA 2VNWA 2IPXA 2PUUA 1M2PA 1V1KA 4XP0A 4PTCA 1Y6AA 5EOBA 3NX8A 4K77A 3Q9XA 3PXFA 4UZHA 5AUXA 4ERWA 5CSHA 2QOCA 3TZ9A 4DITA 2W5HA 5H8EA 3HA8A 3QC9A 2J7TA 3DQWA 3BLQA 3EYHA 4UWCA 4BBEA 5K9IA 3IDPA 4AXFA 2ZJWA 3F3TA 2BAKA 4EK5A 4E6AA 4F6SA 4AZVA 2VAGA 3K54A 3W0NA 4FKTA 5DMZA 5A46A 3NIEA 2B4SB 4NFNA 2JGZA 2W05A 4O6LA 4F9WA 2W17A 3EN6A 3F9NA 2R3GA 3SOCA 4L45A 3VS4A 3OG7A 5E9EA 3BLHA 2Q0NA 3LFBA 4X21A 1BYGA 2XM8A 3E8DA 3QQGA 1RQQA 2A4LA 4O0XA 3SQQA 3TACA 3OWJA 4XV9A 4RGJA 4WBOA 5LMAA 4L00A 3DLZA 4AG8A 3A7GA 3TIZA 2JDVA 3OFMA 2DS1A 5CASA 5K5NA 1WBSA 2R5TA 5AP7A 1PXKA 4TN6A 4F6UA 5E8XA 3HRBA 3UDSA 4BCFA 4O0VA 3N4UA 4L53A 1UWJA 4BDKA 4O86A 3JVRA 4EHEA 4YTFA 4HGEA 1ZMUA 3A2CA 3A4OX 5C8KA 4CLJA 4MK0A 2OZAA 3BHHA 3SVVA 2JITA 2JIUA 4IHPA 4L68A 3AC1A 1VJYA 4L7FA 5CU3A 3G6GA 1PXIA 2GTMA 4P4CA 5FEQA 2IW8A 3TZ7A 4OTWA 5BNJA 4ZZMA 5JQ5A 5AR3A 5FTOA 1V0OA 4JR3A 3FLZA 1O9UA 4O4CA 2W4KA 3ORKA 4KIKA 5CQUA 2VWIA 5L2WA 3ROCA 3MH1A 4GT4A 1SNXA 4X2GA 3LCTA 3FL4A 5M07A 4WIHA 4K18A 2AUHA 3ZBFA 1ST0A 4GU6A 4AX8A 4G3CA 1JVPP 3FPQA 3W2SA 5J9YA 3QCYA 4DN5A 3LFFA 4XOYA 2JKQA 3QTQA 3CKWA 1BX6A 4O4DA 4PDYA 1B6CB 4AW0A 4HJOA 4K11A 1CDKA 1H4LA 2Z7SA 1MRVA 5CI6A 3OCTA 4FT0A 1OGYA 5CEMA 1RW8A 5HGIA 2J0MB 5BVNA 3NZ0A 3WARA 2UZTA 4RLKA 3KULB 4ZEGA 2EB3A 5KE0A 3QD4A 4EHVA 5ANJA 3C4EA 1YDSE 4L8MA 3R83A 3LLAA 1E9HA 3KRWA 3R7VA 4UZDA 4NTTA 3RM7A 4JG6A 3UE4A 1ST4A 1IR3A 5CSWA 4BHZA 4IX3A 1LPUA 4FZFB 4RX9A 3UBDA 2OF2A 5HTBA 3R73A 4O1PA 3QHRA 4YO6A 5DI1A 3Q4UA 4FZDB 4FTIA 4A9UA 5CVFA 2XKEA 3NR9A 4FSTA 4FYOA 3QKLA 5LXMA 1OUYA 4AZFA 2GTNA 3EHAA 4JIAA 4OR5A 2B52A 2ZFYA 4U5JA 3OT3A 2QURA 4F1OA 1U54B 4CTCA 3MVHA 5TKDA 2XAMA 4DG2E 4JDHA 5J5SA 4L46A 3FMEA 2XIRA 3AKKA 1W2CA 1LUFA 2QOQA 3BV2A 3IONA 4TNBA 5ICPA 2CKQA 3R2YA 5EQEA 2V55A 3TZ8A 4QTAA 4F7SA 3A99A 5CF5A 2YCSA 4XP2A 4BIBA 4DFZE 4BCPA 4C34A 3PFYA 4FV4A 4W4VA 4ZLZA 3R0TA 3ZEPA 2REIA 4IB5A 4KS8A 3CJGA 3UVQA 4ZTMA 1M52A 3BELA 4U81A 3RAWA 4WNMA 3BWFA 3VO3A 3UZPA 4C02A 3S2PA 1R0EA 1W82A 4K33A 3F6XA 2B9HA 2QOOA 3ZLYA 4DCEA 3SX9A 3UZRA 4S33A 4EORA 4DEAA 5M51A 1CSNA 3VUKA 1QPEA 1JKTA 2BPMA 5IH4A 2BZHB 4FKUA 3N4TA 3DOGA 3R9RA 2RG6A 4AW1A 1Q3DA 3MPAA 5ACKA 1OI9A 2A1AB 4UWYA 3HUCA 3QTWA 2PULA 5IA5A 3U9CA 2EB2A 2VTTA 1BI8A 3HP5A 3BLRA 1LEZA 2CGVA 3HMNA 2CGWA 5IH6A 2R3JA 5L8LA 3NUNA 2A27A 2IVUA 1XJDA 3MFSA 2VWXA 3A7HA 3VS0A 2RFNA 3GVUA 4AOIA 4RC4A 4D2SA 3DA6A 4JXFA 4EC8A 4DTBA 5J9ZA 5BYZA 3D94A 3C4WA 4IJ9A 2J2IB 3E5AA 2XK6A 5B0XA 2UW0A 3QGWA 3FKOA 4D55A 3NNWA 4LRJA 4E1ZA 1A06A 3GU7A 5IQFA 4O84A 3U8WA 3DAJA 1YKRA 4I5CA 2YIRA 4Y95A 3A7FA 5C03A 4I6BA 2VO0A 2G2IA 2PVMA 5TT7A 3ORMA 3TNHA 4I20A 4EYJA 4JDKA 4XEYA 4I0TA 3UQGA 2GHLA 2IEWA 2WZJA 3BIZA 3KF4A 3UOJA 5IQGA 4AA0A 3UZTA 5GHVA 3BYMA 2IZRA 3BQCA 4ZSLA 3KRRA 1SZMA 4MBIA 1SVGA 3I0QA 3VF9A 2WB8A 3EFWA 4DH7A 3FYKX 3U4UA 3DJ5A 3UPZA 1IASA 4DT8A 5J5TA 4APPA 2QCSA 4OGRA 1WVYA 3NNXA 5TF9A 4D1XA 5L8KA 3DXNA 3PIZA 4R1YA 1MP8A 4Y73A 3RPRA 4ZOGA 2X7FA 2PY3A 5BQ0A 4C61A 5HORA 2OXDA 3DV3A 4G2FA 5J8IA 4X3FC 3TYKA 2NO3A 3DGKA 1PKDA 5HNIX 5IA3A 3EMGA 2C6LA 4WNOA 1M2RA 4I6HA 2C5VA 1R3CA 2WAJA 1YXVA 3MGYA 4LV8A 2VN9A 4AUAA 5JH6A 3OF0A 4RWLA 3ZDUA 1HCLA 1OECA 3GEQA 4P7EA 4X6QC 4F7JA 3MB7A 5J1WA 5HE0A 3BL9A 2PE2A 1Z9XA 2X7OA 2AEGA 4NM3A 3TDWA 4M8TA 3H9OA 4YJQA 2FVDA 4KNBA 5HIBA 4JX7A 4W9WA 5HVYA 2H6DA 4J71A 1WMKA 3P7BA 5FXSA 3UC3A 4JJRA 1ZXEA 2XF0A 5BVEA 1S9JA 4YTIA 4D4YA 5KCVA 5KX8A 5A4EA 1JWHA 4ZTHA 5JK3A 3O96A 4AXEA 3IGOA 4IVAA 3DNEA 3VBTA 2WMRA 3WZKA 3C4XA 3MTLA 5M55A 4FSUA 2GS6A 4GG5A 3R9HA 3O0GA 4YBJA 4QTDA 5LVOA 1XR1A 4P2KA 5IPJA 4YJVA 2ERKA 4EK8A 1M7NA 3DDQA 5GINE 5EHYA 2HIWA 4FKVA 5EDRA 4AAAA 5L2TA 5LVNA 2XJ1A 3ANRA 5T6KA 4BCMA 2W7XA 4UXQA 1KV2A 4R77A 2RIOA 4RIWB 5IG1A 3MESA 1NVQA 4X2JA 5DPVA 3R30A 3G33A 3QQHA 4MX9A 2G15A 4IC8A 3FQEA 4X3FA 3O23A 4LV7A 2O0UA 4KBKA 4BVUA 4L3PA 4CMOA 4YSJA 2OK1A 1K9AA 1KE5A 4JQEA 3RPOA 3QHWA 5KBQA 3PP0A 2BKZA 2QG7A 3E88A 1BL6A 3TMOA 3BWJA 5C27A 2ONLC 2WEVA 2VX0A 5BPYA 4M14A 3DCVA 2HZ4A 5LVLA 4HNIA 5HU9A 3BX5A 3LAUA 2VGOA 4Y72A 1W98A 3IW6A 4F0IA 1RE8A 3GGFA 4YC8A 5BVWA 1GZOA 1NT2A 2ZV8A 2OBJA 2UZOA 4GW8A 4K0YA 2EXCX 5AX9A 3VW6A 4B9DA 2Z7RA 2PUNA 3OEZA 5AP6A 4R1VA 4IZAA 4D9TA 4N70A 4Q5EA 2O64A 4OAUC 2JFMA 2X0GA 2VD5A 4WUAA 3BQRA 1UU8A 5DT0A 5LVPA 2EVAA 2R0IA 2R64A 5EH0A 5J9LA 3TKHA 3ZO3A 1H8FA 1UU7A 1VZOA 3I81A 4USFA 2Z2WA 1SVHA 3DDPA 2UZVA 5GJDA 4QMSA 5KZ0A 3KN5A 3KMWA 1OUKA 3AXWA 3OW4A 2ZDUA 3N51A 4FKGA 4J8MA 3VW8A 3FZ1A 3U55A 4HCTA 5BYYA 3QL8A 3UC4A 1XH4A 2XNNA 2EU9A 2IVSA 3BHTA 3QBNA 1GOLA 2R3NA 2X9EA 3PA3A 4O4EA 4Y5HA 4ANOA 4EOJA 3E8NA 3B2WA 4FTKA 2UZUE 4A9YA 3KY2A 3U54A 2AC5A 3LKMA 2HZNA 4NM7A 2YJRA 4E4NA 5AFVA 1WBOA 3FJQE 5AMNA 3V8TA 5KHXA 3HRFA 3VC4A 2YCQA 5DR2A 2IWIA 4IWOA 5AV0A 3MY1A 3ULZA 4F6WA 5A4QA 3TTIA 1P14A 2YCRA 2VWBA 2VO7A 4PL5A 4L01A 1PMUA 5K4IA 4QOXA 3PP1A 2HY81 3QTIA 3NVKI 3BGZA 1R0PA 2I0YA 4XBUA 3UTOA 2EXMA 2YIWA 2ONLA 3AC4A 3VUTA 2WTIA 3EB0A 4KS7A 3M42A 3LFQA 5EM5A 1O6LA 4D2RA 2C6EA 3DAEA 4F4PA 3F82A 5LCKA 4HGSA 4IX4A 4RWJA 3VUMA 4D2VA 4CG8A 4FV9A 2FO0A 1U5RA 2R3HA 2JKOA 2OKRA 3PLAE 4ZSAA 3E92A 5CXHA 5E4HA 3O8PA 3AGMA 2XNEA 4H1MA 4U0IA 4HZRA 4NIFA 3MN3A 4UMQA 2WMVA 4ANLA 3TV7A 3NPCA 3Q04A 4BY9E 5C8MA 3MPMA 4PPAA 4R8QA 5CAQA 3KRLA 3COMA 3G15A 2IO6A 1V0BA 4PMPA 5K0XA 2UZDA 5M56A 3T3VA 2J51A 4QP2A 4MXAA 3ZUUA 5EK7A 3TDVA 4C37A 2ETMA 4BJJB 1OPJA 2WTKC 1Y8YA 4OTRA 4IZ5A 2J6MA 4FZ7A 4QP4A 3RPVA 1U4DA 4ACHA 3QTZA 3DJ6A 3PJ8A 5HD7A 1UU3A 2G9XA 4I21A 2PZYA 5I9VA 4EOIA 3SC1A 2VZ6A 3DAKA 2PK9A 2PUIA 2XK8A 2XB7A 3F3WA 1H28A 2W99B 3GCSA 4JBVA 4PX6A 3PRFA 3EFKA 4ZSJA 2XRUA 5CF8A 3E62A 3H9RA 3I79A 4Q2AA 5M4IA 1P5EA 1XMLA 2C5NA 3NIZA 5CNNA 4B99A 5GJFA 3TWJA 4QNYA 5IQEA 3Q9WA 2PVRA 2CMWA 3DXPA 4LUDA 5GIPE 4PDOA 4IX6A 4FVRA 2YN8A 3E3PA 4LGDA 3WI6A 2HYYA 2IVVA 4BZNA 1PMNA 4U7ZA 2JDOA 5DR6A 2E9PA 4RVLA 4DC2A 4RX5A 1IG1A 4JG7A 3DY7A 2W1EA 4MTAA 4I0RA 3QTRA 1WBVA 2UZEA 3QTXA 4LQMA 1F0QA 5A6OA 3HYHA 3N9XA 4EOKA 5M09A 1FVTA 3DKCA 3FMHA 4BDJA 2OFVA 2V7OA 4W9XA 4UMRA 3KXMA 4YC6A 3RAKA 5IUGA 5J7BA 5HU3A 3AQVA 5KMMA 4TWPA 4EOQA 1HOWA 4UY9A 2YWPA 3PZEA 4NH1A 4IZYA 2ITQA 3MB6A 4XLIA 3JXWA 1UKHA 4HYUA 4G1WA 3LXLA 2PZ5A 3PVWA 1ZARA 1UVRA 3VRYA 5LWNA 4UN0C 5B2KA 4FZAB 2BZJA 2YAKA 3BHUA 3CQWA 3ORIA 4G34A 5CXZA 5CALA 2QC6A 4BCIA 1DI8A 4IVBA 5CT7A 5I9YA 2YM3A 1M17A 1Y91A 3KVXA 3WZJA 4L7SA 3A60A 4FIJA 1Q3WA 4JX3A 3VVHA 1YI3A 5FG8A 4J7BA 2YA9A 4B7TA 4D9UA 2XS0A 2PTKA 2QO9A 3VIDA 5EHLA 4MXXA 4KKGA 4PY1A 3AC3A 4QTBA 4CV9A 4EZ7A 3FY0A 4MNEB 2R3MA 3Q6WA 2HWPA 4PP9A 1YW2A 5DT3A 2W9ZB 2PVYA 4M0YA 1OKWA 4M15A 3I5NA 4FV6A 5E1SA 4BBFA 2BCJA 5AUWA 3GI3A 5JFWA 2OJIA 1JOWB 4YHFA 2X1NA 4I6FA 2UW6A 5KMJA 2CCIA 4DFLA 3RAHA 4TZRA 2A2AA 2C47A 4L43A 5AP2A 2EXEA 1CKIA 3G9LX 4RIYA 2CLQA 5EQYA 5A4TA 4WNPA 3FWQA 4EQUA 4JG8A 5HCXA 5AUUA 5AIRA 4LL0A 3R1NA 3TL8A 4ACGA 3R1SA 3DBCA 4E26A 2JIIA 2Y8OA 2X0OA 3BU6A 3I6UA 4AFJA 2ITNA 1YHVA 4FKSA 2WTCA 3R21A 2CDZA 4IDVA 3CXWA 4RVTA 4F9CA 3LJ0A 3AT3A 5IISA 2OICA 4HCVA 1ZRZA 4KD1A 4XH6A 4GCJA 4QMPA 3V3VA 4IANA 3W0RA 2GHGA 3C4ZA 5E8SA 2C6IA 2VTAA 3FZRA 3KXNA 4KSQA 4RX8A 2JBOA 5EDPA 4EEVA 4BGHA 4QMNA 1KWPA 1MQBA 2CLXA 3FYJX 3I0OA 3IW5A 4FUXA 3UO5A 1ZZ2A 5F4NA 3EKKA 3RBWA 4BFMA 4EH9A 4MXOA 1P4FA 4YHJA 1JKLA 4PTGA 4AW2A 3Q2JA 4Z7HA 3V5WA 2CGXA 5HZNA 4XG3A 5HCYA 1BI7A 2YM8A 2P2IA 3D2IA 4EYMA 3OP5A 2XMYA 3UNZA 2QNJA 5F9EA 3FAAA 4OT6A 3NW6A 2IVTA 2V22A 4FV0A 2BRGA 4O6EA 3PXYA 5GNKA 5HKMA 4ANNA 4EL9A 1QPDA 2I6LA 1GIJA 3U4WA 4QNAA 2XBAA 5IEXA 4XS2A 4ZIMA 5E8YA 4J95A 2PUPA 3FZTA 4C57A 1ZAOA 3NUPA 3PVGA 4U43A 4XP3A 4MF0A 4JLCA 3S0OA 5JSMA 3ID6C 4QYEA 2VTPA 4FTJA 3IOKA 4C8BA 4EH5A 3PG1A 4XCUA 3QZGA 5IEVA 4D5KA 2YWVA 3WE8A 4V01A 5IEYA 2W1FA 4Z55A 4XG7A 3IDCA 2XIXA 4FUYA 4DHFA 3OBJA 2ZB0A 4F70A 5C26A 2XKFA 4BDAA 3DB8A 3NCZA 1WBWA 3P78A 3WIGA 4OBPA 4KAOA 3GCUA 3CY3A 4ZS4A 3KIOC 4CT2A 2BFYA 4FK3A 4A4LA 1KE7A 4QP1A 4FNWA 4HGLA 4Y46A 1YDTE 1KOAA 2WMUA 2B55A 2Z7QA 3V5LA 3VONA 5HQ0A 1PKGA 4UYNA 4FKJA 1DM2A 4RFMA 3E8EA 5L3AA 1JAMA 1DAYA 4FICA 1Q97A 3D5WA 2J4ZA 5DG5A 5HI2A 4GVAA 3O7LD 2OSCA 3DQXA 3V6SA 4O0UA 1Z5MA 2ITYA 3UP7A 4BF2A 2XH5A 5AV4A 3EL8A 2FUMA 3BE2A 3MDYA 1AQ1A 3GU6A 1KV1A 4MWHA 3WIKA 1XO2B 3FI3A 3SXSA 5CSXA 2X8IA 5EI8A 3EQBA 2Y0AA 3NS9A 2R2PA 2E9UA 2ZOQA 5J95A 4FKRA 5HE3A 3V51A 2F7XE 2ITPA 4JIKA 3MVLA 4QQJA 4IAAA 4FV1A 3MBLA 2YM7A 4TYJA 5IQCA 2Y4IB 4NT4A 4PQNA 4R3CA 5JGDA 3ZFMA 4FG7A 2V7AA 2RFEA 2WU7A 3D5XA 1KE8A 1UNLA 2RFDA 3O2MA 4OTGA 4YNOA 4NCTC 4FZ6A 1A9UA 3C7QA 3H10A 3A4PA 5H8BA 3K5VA 4Z9LA 2XRWA 4F78A 3MIYA 4CGAA 2W9FB 3F5UA 1Q8YA 3GU4A 3ZUVA 4C3PA 1Y57A 2XUUA 3C9WA 3EQCA 3R63A 1PYEA 2VX1A 1HCKA 3FLNC 4U40A 1YXTA 2FSMX 4WSQA 4PMTA 3F61A 4AW5A 2ZAZA 2Q83A 4DCAA 2ACXA 5FM2A 1OMWA 4BDBA 5IUHA 2G2HA 3C0HA 4J8NA 4FE2A 2XYUA 5AP1A 2PMIA 3TT0A 2O8YA 4FTUA 3ZEWA 4BGQA 3DNDA 4EOLA 3PA4A 3KN6A 4GG7A 3R8ZA 4KUJA 2NYAA 2F4JA 2ZV7A 2GNGA 3FXZA 3FMKA 4H05A 3BRBA 3IK3A 3PFQA 4DLIA 3PJ2A 4NK9A 4LM5A 3CR0A 5E92A 3T9IA 4C3FA 4C4IA 1ZYJA 2BTSA 2PVLA 4AAYA 4QP6A 5HEZA 3ZHPC 4RA5A 2WKMA 4TKSA 3CGOA 3UYTA 3TNQB 3GBZA 3UDBA 2WQMA 2X6EA 3MJ2A 1EH4A 3PJCA 3Q96A 1H0WA 3PG3A 4E73A 3G2FA 4C62A 1GZNA 2PHKA 4FSZA 5D1JA 3IQ7A 1YXUA 4AXAA 3TUCA 2O65A 3P86A 5D7AA 4FTQA 4GH2A 2GFCA 3I60A 4GS6A 4GYGA 4R3PA 1XBCA 2QHMA 3R7UA 4A9SA 1GY3A 5A3XA 1F3MC 4JAIA 3W8LA 4IWDA 5HNGA 2CKPA 5HLNA 3F5GA 2XVDA 2R0UA 4JS8A 4OBOA 3H3CA 2GDOA 2WMAA 3JR1A 4DAWA 2P4IA 5A9UA 3ACJA 3C5UA 1M7QA 4NCTA 1Q8TA 2J5EA 3ELJA 4LRKA 3GENA 1W2DA 4TTHB 4ZY6A 3HZTA 3CP9A 3LCOA 4X2FA 4APCA 5LJJA 2O63A 4IZ7A 1I09A 5E91A 4FKIA 2OIDA 3T8OA 3ZCLA 2JEDA 2YDKA 3QD3A 3ANQA 4FTLA 2CPKE 4AOJA 4DGOA 4QYFA 2VTSA 3G90X 4E7WA 4OTIA 3L9LA 2OIBA 4S30A 2QG5A 5LCJA 3F3VA 2BRHA 4MXZA 4LOPA 2XJ2A 3SD0A 1NXKA 4QYHA 2GCDA 3OW3A 4QMTA 3A62A 3RNIA 4W4XA 2OH0E 4PNKA 5J7HA 1FVRA 2YISA 4DEBA 2YABA 2GMXA 3AT4A 4RC2A 5M53A 5K0KA 2XALA 4JAJA 4BCGA 2YIXA 3FUPA 3QA0A 3W0PA 2X6DA 3GCQA 2OZAB 3RPYA 3ZZWA 1JLUE 2IZUA 3BGPA 4JI9A 4NU1A 2C4GA 1RJBA 5D11A 5M4CA 4JBQA 3DKGA 2DUVA 3FI2A 3QD2B 4XRLA 2OJJA 4ALVA 1IAHA 3IS5A 4FI1A 3CIKA 4K6ZA 4W8DA 4UBAA 3JY0A 4L44A 4QMVA 3KRXA 4FK6A 3CTHA 4MXYA 4AQCA 4CFUA 4MD7E 4ZMFA 4QP9A 4G31A 3QQLA 2WELA 3NWWA 5AM6A 1U54A 2XCKA 4S32A 5HLWA 3UOLA 2GNHA 1GJOA 5I4NA 3VBWA 3AMYA 4KIKB 4PDPA 4M7IA 4CV8A 1JKSA 3ZRKA 3QA8A 3RVGA 4BBMA 2XARA 4LI5A 4QMZA 3BCEA 4F9AA 3Q4ZA 3P0MA 4RJ7A 4MCVA 4EH7A 4KB8A 3ZBXA 1E1XA 3RM6A 5FD2A 3V01A 4BCQA 4FEVA 3JY9A 4FIIA 4TYHB 2QU5A 1FMOE 1Q62A 4K1BA 3FV8A 4BICA 4KABA 3BU3A 3ODZX 1MRYA 3FXWA 3ZONA 5AP0A 4G6NA 4OTDA 2JIVA 4PMSA 2XZSA 2E9NA 4O7ZA 3TJDA 3H4JA 2FB8A 3KEXA 3Q5ZA 2CKOA 4ZY4A 3D7TB 2BR1A 1VEBA 4ACDA 4F64A 3I5ZA 4O1OA 2R3FA 3UIMA 3NUSA 4PF4A 4PL4A 3KF7A 5DNRA 4YJPA 3C13A 3NVMB 2ETKA 4M0ZA 3R7EA 1TVOA 5J1VA 3DBEA 1FVVA 3F5PA 4H58A 1KE6A 1MRUA 3K3JA 5BVDA 4X6RA 1CMKE 4MD9E 1PMVA 2X39A 4RFZA 4JBPA 4YJOA 2NNWB 1LR4A 2VNYA 3HECA 3TI1A 4BZOA 5AAEA 2PWLA 1URWA 2WQEA 2RFSA 3UPXA 5FXRA 4DINA 3QRTA 3GC0A 3E8CA 1UV5A 3FQSA 3OCBA 5JRSA 3NSZA 4QMOA 4AA4A 2I40A 2DYLA 4FC0A 2HAKA