1Q8UA

The catalytic subunit of camp-dependent protein kinase in complex with rho-kinase inhibitor h-1152p
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
341
Chain Sequence
KKGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 111
structure length 341
sequence length 344
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8uA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8uA02
4A9TA 5JRSA 4FTCA 4OTQA 4EOLA 4N57A 3MH0A 3MY1A 4D9TA 4PDYA 4D55A 3NNXA 3NZ0A 3A60A 4YJUA 5CEQA 3QHRA 4ACMA 1Y6AA 3LMHA 3I0OA 4N0SA 4YPSA 4BY9E 2FVDA 5CSPA 2IVUA 4AT3A 3C5IA 1FQ1B 3KXXA 3W18A 4M8TA 4RX5A 3FQHA 3FI8A 3LFEA 4C4FA 2I6LA 2R4BA 3IDPA 3MFUA 4YZ9A 5EYCA 2FSLX 1TQMA 1M14A 3D7ZA 2WQMA 4G6NA 2ONLA 2ITYA 1H0WA 4O2ZA 1ZOHA 3P79A 5E1SA 3FXZA 2VTRA 3AGMA 3DLZA 4APCA 4C35A 4LI5A 4XJ0A 2ITTA 2R0IA 2W99B 5EW8A 4CCUA 3PZHA 4GU6A 4FT5A 3PPKA 3NS9A 2YACA 2H96A 1KE9A 2BAKA 3E8CA 5AV2A 4FV9A 1BI7A 1VZOA 1M2QA 2YDIA 3GU7A 5ANDA 4D0WA 5IQIA 4PMTA 5GINE 2EXCX 4MF0A 3LQ3A 2QR8A 3L8XA 2RKUA 5BNJA 4LOQA 3D5VA 1YI4A 2RG5A 4IZ5A 4ZY6A 5AM7A 4FYNA 4NFNA 5HG8A 4CV9A 5GJDA 3IO7A 4C3FA 4C4JA 2IPXA 4DG0E 4U9AA 2X81A 4YU2A 5LMAA 2B53A 4RX9A 2BALA 3EN9A 3QTSA 4U44A 5L8JA 5A46A 4JJRA 2CKEA 4FV2A 4CFWA 4AW1A 5LOHA 2J90A 3HLLA 3MW1A 1DI8A 3LLAA 5DVRA 5CU4A 2X7GA 3R8UA 3S3IA 4DCEA 4Y85A 4L01A 3II5A 4JNWA 5HKMA 2AYPA 3WZKA 3FXWA 3F69A 3M42A 4C4GA 3UQFA 1V0BA 3U54A 1JWHA 3EL7A 3IW8A 4DTAA 5AV1A 1GZKA 3FE3A 3IGOA 1H24A 3QUPA 1Q24A 4U0IA 4UMTA 5HQ0A 1UKIA 4EOOA 1FMOE 1PXNA 1BUHA 4UZDA 3FL4A 3R30A 4FVRA 4C37A 4PX6A 3MPAA 4G34A 2IW6A 4BDCA 4AZFA 1ZMVA 1U5QA 2IVTA 3R00A 3AT4A 2UZDA 3PE1A 5AWMA 5J87A 4AN2A 4DINA 5L2SA 3I7BA 4BYIA 3VF8A 4Y83A 3MI9A 3A62A 5ANIA 4OTFA 3S1HA 5IQEA 2C6IA 3KN5A 4L8MA 4LFIA 5CEMA 2F4JA 2Z8CA 1Q99A 2XJ1A 4RQKA 5HG5A 3TDVA 3BEAA 3Q2JA 5CF8A 4ZLOA 3EJ1A 3LZBA 3I81A 3OXIA 3PSCA 4YBKA 3KF4A 4GT5A 4YJOA 4YTCA 3REPA 4PWNA 1ZOEA 1YXVA 2OJJA 4A9UA 4TYHA 4W9XA 1IASA 1OIQA 3DU8A 2OBJA 2UZOA 2ZM3A 4YUQA 2PULA 3BYVA 4BI2A 3EYGA 3EQPA 3FLSA 3BLHA 2VGOA 3M2WA 4R7HA 3D5UA 4G16A 3NCZA 3VW8A 3SDJA 5CAUA 4YC8A 4JVGA 3P86A 4KKHA 2XS0A 2OZAA 1YHVA 4CLIA 3TCPA 1M52A 3Q4TA 4DEHA 4FEUA 1XHAA 3QLFA 4I0SA 2PE1A 2VO3A 2OKRA 4QMLA 3KULA 3FLWA 2Q0NA 4DG2E 2VWIA 4YSJA 3GCSA 4JG7A 2C6EA 3SHEA 5IKWA 5M4IA 4XRJA 2X8DA 4AGWA 4CRLA 2GHMA 4QMNA 1W84A 4TWOA 4DN5A 4UXLA 3PA4A 4U42A 1K3AA 4DA5A 4B0GA 4C38A 3Q9XA 1ZARA 3DQWA 4JR3A 4RA5A 1Y91A 4QYYA 5FEDA 5C8KA 2UZWE 5L2IA 2X6EA 3ZZWA 3R83A 1OB3A 4QNAA 5J7HA 4TTHB 3RK9A 4AP7A 3U6JA 3VIDA 3RAIA 3KRWA 4Q5EA 1U54B 3FKLA 4HVHA 4GIIA 3L9MA 4N6ZA 4L52A 3R9HA 2F9GA 1OL5A 3QD4A 2OXYA 2XF0A 3UO5A 5A14A 3ZYAA 3RVGA 3MH2A 1REKA 5GZ9A 5DR9A 2Z02A 3LHJA 2OH4A 1RDQE 1PW2A 2JIVA 3F88A 3PY3A 4FODA 4RX8A 4TWNA 2QHNA 3PDTA 2VTQA 4I6BA 4I22A 5ETFA 2WTVA 4PMMA 3VUHA 2YABA 4Y73A 5FXQA 3GCUA 4IC7A 3RKBA 3BBWA 3VW6A 5JK3A 3RM6A 3MWUA 3KREA 4IFCA 5ETIA 1U5RA 3MFRA 1ZZ2A 4BKJA 4UMRA 3RINA 4YBJA 4A7CA 3HL7A 4XV3A 3ITZA 3MB7A 4F63A 4IZYA 3FYJX 5EI2A 5EM8A 4ENYA 3DDPA 3KC3A 4IX6A 4APPA 3HECA 1HCKA 2C0TA 2ACXA 4UMQA 4FTJA 2GS7A 4GV1A 4RZWA 5E8SA 4BTKA 5H8GA 3E5AA 5CYIA 3PWYA 3U55A 3QKKA 2PTKA 3LFDA 3ULZA 1XH7A 4UV0A 4BDJA 4L44A 1UU3A 2P0CA 4AGDA 4CCBA 4U3ZA 3MY5A 3LIJA 4IX4A 4C36A 4FV1A 2OXXA 2UZBA 1TQPA 1U46A 5CT7A 3R7YA 3VAPA 2JBPA 3PPZA 4XG9A 4KB8A 3RPSA 4YHTA 2XYNA 4EONA 3TDWA 3TV6A 2WGJA 5HZNA 4LOPA 1JKTA 3KCFA 2XNOA 1R1WA 3Q3BA 4YLKA 2R9SA 3A4PA 3SXRA 3FLNC 5CNNA 3QYZA 3FAAA 1YHWA 1ZY4A 3U8WA 3W2CA 4WNKA 3M1SA 4IIRA 4QPSA 3UVRA 4G9CA 3NVKI 1JQHA 4RC4A 3VJNA 2C6OA 5FXSA 4D4SA 3S0OA 4JBQA 3UQGA 5KMJA 3EL8A 4YC6A 2W1HA 5IEVA 5HLPA 4F9CA 3LXPA 1YWNA 4FTTA 4R8QA 3OXZA 4A9SA 4BDBA 3VRZA 2WMWA 4USEA 2BROA 3QZHA 1W98A 3QD0A 3UOHA 2AC3A 3C13A 2UVZA 2PVFA 3DBCA 4IH8A 4KA3A 5JH6A 2X6DA 3LXLA 2X9FA 2E9OA 1R39A 5DH3A 3MYGA 5HHWA 3PG1A 3DPKA 3QQGA 4AZSA 4LL0A 3UGCA 5CX9A 4XG8A 5DT0A 4II5A 2XIYA 1AGWA 4BDGA 2W4OA 1J7IA 2VTIA 5BYZA 4QP2A 5HO7A 4DFYA 2KTYA 2V62A 5IEXA 3ERKA 4L67A 1FVVA 2XCHA 2PVLA 2UW7A 4DCAA 4P5QA 3QQHA 4Q9ZA 4I41A 1FINA 5CF5A 4JOAA 3WIGA 4ACGA 4F0IA 4FL1A 4JIKA 1WVYA 3NUAA 2RF9A 3ZC6A 5KO1A 4IAIA 5JN2A 2ZMCA 1ATPE 2R3KA 1P4OA 4E20A 2CKQA 4H39A 4TN6A 3PLSA 5I9ZA 4YURA 1PMNA 3BIZA 4XG4A 3UP7A 2VWXA 4ZZMA 5IQFA 3U4WA 1YVJA 3ZO3A 3LJ1A 2VTSA 4GU9A 3U9CA 2R5TA 3LW0A 3MTLA 4DF3A 4O27B 4FZ6A 2CKOA 4LRMA 3UQCA 4EOQA 1W83A 1R3CA 3DAKA 4GK2A 4M12A 3CXWA 4UWCA 4MD8E 2VRXA 4RC3A 3ETAA 4MK0A 5FDPA 2OXDA 2P4IA 3QTIA 4MVFA 1J91A 2W96B 3V5JA 5KMLA 2F7XE 1UNHA 3HDMA 4EHZA 2X0GA 2X2KA 4UX9A 3MA6A 3OWPA 4CSVA 3L9LA 5IA3A 1YDRE 4MBIA 1F0QA 5HICA 4FSWA 3UBDA 5EOLA 4BI0A 2V0DA 5BX0A 1M7NA 3OMVA 1IG1A 1XBCA 3DK3A 4PDSA 1XBAA 3N4TA 3OC1A 3QQJA 5AP3A 1SMHA 3MIAA 2VTLA 3WZDA 3SAYA 4HGSA 3QTWA 4W4YA 5DI1A 2W17A 3FI4A 3WF6A 5DMZA 5GZAA 1Q5KA 4R5SA 4RBLA 3TNIA 3G0EA 3D5WA 4IAKA 4QMZA 4FIJA 5GZ8A 3ACJA 3QF9A 4U3YA 3QX4A 2W4KA 3NW6A 4X0MA 5JMSA 2EXEA 2QNJA 2X8IA 4C4HA 1H0VA 5HVYA 4FV8A 4JT3A 5I9YA 1OGUA 4JG8A 3CCNA 2X9EA 1U54A 2CMWA 2BZIB 4NM7A 4PNIA 5AP5A 3R8LA 5I0BA 4FG7A 5FM3A 5J8IA 2ERKA 4J53A 3IDCA 3FV8A 4HZRA 3CPBA 4DEAA 4PMPA 3DXQA 3V8WA 5KX8A 4M68A 5AP4A 3VQUA 4W8DA 4ANQA 5ANJA 2UVYA 5AR2A 4A4XA 2CKPA 3FI2A 4NFMA 5AA8A 2VNWA 1MRYA 3C7QA 3PXZA 3LLTA 3O51A 5JFXA 4EH9A 4FKOA 4WNPA 2XJ0A 4DGLC 4HPUE 2RFSA 4RWLA 4OTDA 5EDPA 1SVGA 3ALNA 1G5SA 2ITXA 4QTEA 4IAYA 1A9UA 1Q61A 5DR2A 4KABA 4QMSA 3VULA 2C47A 2QCSA 4R1YA 4WIHA 2XNGA 3NCGA 4XX9A 2ZM1A 2CN8A 3ORNA 4WT6A 5CY3A 5L6PA 3HRBA 2I0VA 2C6TA 4FV7A 5HEZA 2ZV2A 4LGGA 3MB6A 4UXQA 4L53A 3N9XA 1P4FA 4M66A 4CFUA 4Z9LA 3V6SA 4G5JA 4ACDA 3K5VA 3QTXA 1YOJA 3GVUA 5IA5A 5M56A 3W8LA 4FKGA 4KS8A 2WMBA 4FL3A 5AR5A 1OKYA 4EUTA 5FBOA 3FY2A 3MDYA 4AT4A 4CNHA 3BKBA 3R7VA 4XLIA 4B8MA 2CJMA 3PXYA 3VS5A 5E8XA 4EK8A 3PRIA 5M57A 3ULIA 3V5TA 5M07A 5EH0A 2QO7A 4PRJA 2G15A 3EYHA 4NW6A 1M7QA 1OM1A 2JAVA 5FQDC 3OTUA 3OD6X 4JXFA 2HWPA 4M7IA 4X2GA 5BVWA 3IGGA 4C61A 3HAMA 4P5ZA 4LGDA 3ZHPC 3UP2A 3UJGA 1OMWA 4A9RA 1NT2A 2PUIA 3NYXA 5EDQA 3TNQB 4E6AA 1GY3A 3QQKA 3RPOA 4O0YA 3ANRA 4FV6A 1RE8A 1YI3A 4PDOA 3W2RA 2J6MA 4XP3A 2RSVA 2IO6A 2XNMA 2YITA 4QYHA 1H1QA 5E4HA 2YERA 3WOWA 5IQDA 4O83A 2E2BA 4FTQA 1LP4A 2HZ0A 2XNBA 3PZEA 2XP2A 4C57A 2QURA 3GT8A 4DGMA 5KMKA 2QO9A 4J8MA 5D7VA 5H8BA 3GCVA 2JKKA 3QGWA 2UZLA 1FGIA 3BYUA 4I92A 2VV9A 3NNWA 2A4LA 4LUEA 4GJ2A 2AC5A 2QOKA 3H10A 4WG4A 4YLJA 2B9HA 3DJ5A 5H3QA 5TF9A 3VF9A 2PZYA 2W1DA 4ASDA 4BDAA 3GEQA 4HYUA 4NH1A 1CKPA 5GJFA 5A4EA 3UYSA 4JDHA 4YPDA 3BV3A 2XUUA 3CJFA 3S95A 5HE0A 4RIXB 4C59A 2P2HA 1V1KA 4DBXA 1OIYA 5EKOA 4AFJA 4OTIA 3DAJA 1GZOA 5HG7A 1VEBA 3FPMA 2WMRA 4FX3A 5BQ0A 2HY81 2Y4IC 4FTIA 1SM2A 2DQ7X 1JBPE 4IANA 4G1WA 1RQQA 2Z7RA 4FNXA 3C4XA 2W1ZA 1H25A 4WD5A 4RWKA 4TWPA 1GIJA 5DGZA 3SXSA 3TEIA 4BRXA 2ZV9A 4DAWA 4IMYA 2P33A 3FZRA 4NTSA 2OJGA 2QR7A 2A27A 2BZHB 4G5PA 4ITHA 4ANMA 3ATTA 4ZMFA 4TYJA 3DXNA 4RLLA 4E7WA 5CI7A 1JAMA 2QKWB 3JUHA 4D2TA 4BKYA 3OTVA 3E92A 5C01A 3VS2A 4TNDA 4AF3A 1H4LA 2FSOX 3NW5A 3BV2A 2YDKA 2WQBA 4RMZA 4JG6A 3G0FA 4AOIA 3NYNA 4NM3A 4FZ7A 4G6LA 4Z7HA 4O0UA 4ANOA 4FTLA 4DLIA 4GMYA 2CN5A 4YZNA 3PIYA 2VO0A 5AR4A 4RVMA 4ZJJA 1FGKA 3DS6A 3DTCA 4ALWA 3SD0A 1B39A 2OJ9A 4BN1A 3GENA 3WI6A 4ZZNA 3LKMA 5FUTA 3U9NA 1J3HA 4GYIA 1YXUA 5LVMA 1UA2A 1H26A 2DS1A 5C8NA 4G17A 2QLUA 4ZSJA 3CY2A 3Q32A 3ZLSA 3A7HA 4QMTA 3P7AA 4K77A 3H9RA 3G2FA 4QYEA 4MXXA 2HZ4A 1YDTE 2ZAZA 4D4VA 2RG6A 4ITIA 4QMXA 2VTJA 4BI1A 1YKRA 3KEXA 4WHZA 5KHXA 1GNGA 3D2KA 5C9CA 3FPQA 2BAQA 5C27A 5D1JA 1FPUA 1OI9A 5FDXA 4O7LA 1Y6BA 4U45A 2WO6A 2W4JA 4IFGA 5AFVA 2FO0A 4EOJA 4X2JA 1WVWA 5L2WA 4EJ7A 3SG8A 5FLFA 4PY1A 2FUMA 2H6DA 2FSMX 5DE2A 4CYJA 5IPJA 3AGLA 4FV3A 1LEWA 4ENXA 3GQLA 3R1YA 4S2ZA 4BBFA 2UVXA 3MY0A 4A4LA 4DT9A 3SOAA 4JAIA 4UY9A 4WOVA 4YR8A 3WE8A 2PL0A 5G1XA 3P1AA 5JT2A 2WU6A 2XRWA 3C50A 3KFAA 4IB3A 4FSUA 1NA7A 2IWIA 3R28A 1GAGA 2VO6A 5E8ZA 3CD8A 4EHVA 3NMUF 3COHA 4O91A 4OTGA 3Q4ZA 1JLUE 2JITA 3QZIA 4QQTA 5AUVA 2GCDA 2YA9A 3RAHA 2J2IB 4EOPA 3BGZA 4E6QA 5BVDA 3MFTA 2C1AA 2QOLA 4AW0A 5TE0A 1M2RA 4O0SA 4WSYA 3ACKA 2VN9A 3R7UA 2JKMA 4LOOA 4X2NA 3LXNA 5CSHA 5CEIA 3DV3A 4LRJA 3WF7A 4FIEA 1NVSA 3G6GA 3EIDA 3MESA 3C0IA 1Q41A 3CE3A 3MTFA 5M53A 2G2HA 3COMA 3P0MA 3PSDA 5EKNA 4DH1A 3HKOA 1I09A 1XKKA 5JQ5A 4R3RA 3UG2A 3DKOA 3W1FA 4QMOA 4EOMA 1XR1A 5FM2A 4UN0C 1YOMA 1Q3WA 4FEWA 2J9MA 4FZFB 3B8QA 3M11A 2B54A 3PFQA 3ET7A 4A07A 4WUNA 1OVEA 5HX8A 4DH7A 3Q4UA 1WZYA 3HNGA 4B4LA 2YIWA 2XIKA 4ZJVA 2YLFA 2C3IB 4KIKB 4H1MA 2GNFA 4GK4A 3TNHA 1CKJA 2R0UA 3H9FA 4CFVA 4YNOA 5KNJA 4MTAA 1KE8A 4QP6A 4F6SA 2CGUA 1XH4A 5HU3A 1ZYCA 3ZRKA 1QPCA 4L7FA 2HXQA 4XH6A 4GJ3A 2J4ZA 5DEYA 3CD3A 2G1TA 4R7IA 4EH7A 2R64A 4HJOA 4C3PA 4Z16A 1IA9A 1CKIA 2XK3A 5AUWA 3NX8A 1G8AA 1UNGA 4GKHA 3LCDA 4EOKA 3ENHA 5D7AA 3QD3A 5HVJA 3LQ5A 3OVVA 5CXHA 2CGXA 1JOWB 3D14A 4RJ7A 4TPTA 4F65A 3F3TA 3GUBA 5HIDA 5BVNA 3THBA 2VTAA 4FSQA 4GT3A 4H3PA 3BU3A 2CNUA 3F66A 5DT3A 2R7BA 3EH9A 1PXLA 4JRNA 4FZDB 4QRCA 3I5NA 2Y0AA 3LFCA 4HCTA 3BU6A 4NTTA 2QKRA 3E87A 1OKVA 2ZVAA 2R3RA 3IPHA 5CF4A 1OBGA 4FEXA 5IQHA 3GC7A 4TXCA 1Q8UA 3CP9A 3RTPA 4BL1A 1TKIA 4RIWB 5BMSA 2PZ5A 2ESMA 4KSPA 4BBMA 1PYEA 2YZLA 2BPMA 4L3PA 1OPLA 4TL0A 3UIBA 1KE5A 5KMMA 4IVAA 4O7RA 3ZXZA 3E3BX 3TWJA 4XP2A 2BKZA 5IUHA 4KRDA 4CZTA 4D2PA 4PNKA 1OPKA 5M06A 5I5ZA 2G2FA 2YM6A 5F1ZA 3OT3A 4RIXA 1AQ1A 3OT8A 4BWPA 4UBAA 4CZUA 3A8WA 2ZJWA 3PA5A 3MVJA 3A4OX 3QWJA 3OCSA 4IVCA 1Z5MA 4RRVA 3CLYA 3R7EA 4DG3E 3ZM4A 1W0XC 4FEVA 2IZRA 4D1XA 5AEPA 1SNXA 5LVNA 3DFCB 5ITAA 5EDRA 2WPAA 5K5NA 1YW2A 2J5FA 2OWBA 2WEIA 3CQUA 3G9NA 3OOGA 3P7BA 3QU0A 4B99A 5LVOA 2Z60A 4Y8DA 3PVUA 4ZTHA 4O81A 2VTHA 5IISA 3AG9A 1WCCA 3QAME 4FKTA 3IDBA 3TUCA 5CVFA 1JSUA 5CQUA 4G3DA 4IB1A 3KXMA 3VS1A 3PE2A 4GVJA 5B7VA 2J50A 2JIUA 4KBAA 4CRSA 2B0QA 3UZTA 5A6NA 1CM8A 4DITA 3ATSA 3MIYA 4E93A 2VNYA 3BWJA 4IWQA 1URWA 3PWDA 4Y46A 3FL5A 4G3FA 5J9YA 4BZDA 3TZ8A 1XH6A 3WZEA 3LAUA 1XO2B 4F7NA 1NW1A 3MVHA 4EBWA 2J0KA 4PP9A 3RZFA 1R78A 3RHKA 5DT4A 2ZM4A 3TKHA 4RG0A 3TNPC 1ZLTA 2WQOA 3BLRA 3KXHA 4PPBA 4CT1A 3SRVB 4O7NA 4GFGA 3BHHA 3F5XA 3SVVA 3LCTA 1BL6A 4QTBA 5AUXA 5CT0A 3E8EA 3UTOA 2CHLA 4MYGA 4W4XA 4YZMA 4DFNA 2CCHA 4ZTNA 4BCQA 3ZCLA 1OZ1A 3MH1A 4YTHA 2XA4A 1GZNA 4FG8A 1P14A 5HD7A 3BGQA 2C6KA 4F1TA 3ZSGA 5GIOE 2YM4A 3EQRA 4YO4A 1WFCA 3Q4CA 3QA0A 4CMTA 3PUPA 2BZKB 3B8RA 3VBVA 4QT1A 1ZZLA 3G9LX 4YJTA 5EM6A 3EOCA 1IR3A 3NLBA 2BRMA 3KMWA 4YTFA 2VWWA 4AZEA 4ID7A 1H1SA 3OXTA 4QP4A 2F57A 3HRCA 4M84A 4EKKA 5J9LA 1VJYA 4YGAA 2O0UA 4S30A 3VS0A 2WU7A 3LFBA 1P5EA 3SC1A 3CTQA 2JBOA 4IX5A 2EVAA 3CIKA 3O8UA 3Q04A 4HNIA 3GCPA 3POZA 4GVAA 2P3GX 2WOUA 5HTIA 3SW7A 3DLSA 4TZRA 4AX8A 2BCJA 4JBOA 5EHYA 4P2KA 1Q97A 4BVUA 5ICPA 3I5ZA 4J52A 4BB4A 2VWYA 5AX3A 2SRCA 2W5AA 2XNPA 1YOLA 3QL8A 3ZRMA 4LUDA 3R8MA 5AV3A 4A9YA 3KMUA 3L9NA 4ZK5A 3LPBA 4MNEA 4FTUA 4AOTA 4OBPA 2C5VA 4NIFB 5M55A 5BYLA 3KVWA 1KOAA 3ZSHA 3OWLA 3F5UA 4FIHA 4FKVA 4ZTLA 3LCKA 3W8QA 4G9RA 4UYAA 2J5EA 3F2AA 3AT3A 1XJDA 2HIWA 3GQIA 3MBLA 1ZY5A 2E9VA 4R1VA 5E8VA 2WHBA 2R3IA 5CI6A 4IVBA 4FT3A 4FIGA 5T6KA 3BHUA 3D7TB 2GDOA 2RFDA 4EK6A 5BUEA 3ZUTA 2O2UA 1PF8A 2WEVA 4QMVA 3BHVA 4D5KA 3OOMA 5L6WL 4UZHA 1KSWA 1YXSA 4GUEA 3G33A 3VUDA 4PP7A 4JL9A 1OL1A 4OBOA 5CZHA 5LVLA 1T45A 4AW2A 4KIKA 3Q6UA 3LFQA 3AMBA 3OCTA 2GS6A 4EOIA 4QTDA 4L43A 4QYGA 4V04A 4RZVA 2JDRA 2IG7A 3NIEA 2C6DA 3CKWA 3TV4A 5I4NA 2GHGA 4B8LA 2PPQA 4CG9A 2ZDTA 4BCMA 2QOHA 5IUIA 2RGPA 1GIIA 4FV4A 3AC1A 2XEZA 3V5LA 5CENA 4CQGA 2P2IA 5TO8A 4IW0A 4LV5A 1YXXA 4NU1A 4B9DA 1K2PA 2OFVA 3AC4A 4F7JA 4R77A 3DT1A 3LJ2A 4OW8A 3A99A 3HYHA 4MNFA 3LQ8A 3U6HA 3ROCA 2CNQA 3H4JA 4IJPA 2NO3A 3PIXA 2C6LA 5IA1A 1J1BA 2WB8A 3GI3A 2UW5A 3B2TA 1WBSA 2R3LA 2OIQA 3PXQA 5BPYA 3HZTA 4BGQA 3JVRA 1URCA 4QMMA 2HXLA 2XBAA 4L7SA 4BDDA 4E5WA 3UC3A 4RFMA 3PJ3A 5JGAA 1P2AA 3K2LA 3V04A 4EWQA 1PXIA 4A06A 4PV0A 2W9ZB 5AP6A 4EH4A 5A4CA 2R2PA 2X8EA 2Y7JA 1W8CA 5ANOA 3V5PA 1ND4A 2WZJA 1ZWSA 3GU5A 4XV2A 2GQRA 4P4CA 4QMPA 4C34A 4C8BA 3RBWA 1TVOA 2AUHA 2YN8A 2JFMA 3EFJA 4GG7A 4GG5A 4JBVA 4L68A 2IN6A 3FHRA 4FR4A 4G3EA 3DBDA 3EZRA 1GZ8A 4YLLA 4Z3VA 4ZEGA 5AAGA 2OG8A 3L1SA 4EK3A 2X2MA 1E1XA 3FYKX 3MGYA 1REJA 4BHNA 2GFCA 2V7OA 3FZPA 4X6RA 3FEGA 3RK7A 2PMNX 4BDEA 2QQ7A 4I5PA 5I3RA 3ZO2A 2W05A 4C4IA 2B7AA 3GFWA 3AD4A 4ACHA 2PSQA 3EKKA 4L46A 3TACA 5K4IA 4ZSGA 3HUBA 4O0WA 3EQCA 1MQBA 5FG8A 3P7CA 2CPKE 4FNYA 2B4SB 3DTWA 4S31A 4HCVA 3KXZA 5ANEA 2CLXA 1RW8A 3UYTA 3EQHA 2R7IA 3QKMA 4ANNA 4BZOA 3BYSA 5KCVA 3AMYA 2PUUA 5LWNA 3H0ZA 5IQAA 3Q9ZA 1KE6A 1UKHA 1IA8A 2QOCA 1GIHA 4IBMA 3UNJA 1BLXA 4K9YA 1T46A 4XOYA 3UZPA 3ALOA 3MPMA 1Z57A 4IDVA 4FOCA 2DUVA 3G5DA 4BCJA 2ZYBA 3AC5A 2YZAA 4E4XA 1Q8WA 2BRBA 3R9DA 2JDTA 3UC4A 4F70A 3SRVA 3NIZA 4GRBA 2YCQA 2GTNA 1H1WA 3GC9A 1I44A 2W1EA 4BDKA 4I20A 3C4FA 4QP8A 4CV8A 4CTBA 3DDQA 4HVIA 2VTPA 2ZB1A 3NSZA 3EFWA 1Q8ZA 3UVPA 2JAMA 3Q2MA 4WA9A 5DFPA 4O96A 4Z55A 2C0OA 4BIEA 3I79A 3HV3A 3O8TA 4O0TA 4KKGA 4P7EA 3UE4A 4DEEA 4YMJA 5HU9A 5M4FA 3R2YA 4FKWA 5LQFA 3JS2A 4QYFA 5DYJA 2Q0BA 3HUCA 4F9BA 2WTDA 4TKSA 5HOAA 5CASA 4FV5A 3AT2A 2XIRA 4ZS0A 2YEXA 4IXPA 5BVOA 5HTCA 3OS3A 2HK5A 3MJ2A 3WYYA 2IW9A 1PHKA 2RFNA 1W82A 4IACA 4IQ6A 3QHWA 3W2SA 2XEYA 4AOJA 3AQVA 3NAYA 4OT6A 5FTGA 4ASEA 3GOPA 3WBLA 3D94A 2GPHA 4JQEA 4O7YA 4BCOA 4W9WA 4NCTC 3DNEA 4CLJA 1HCLA 2QONA 4RLKA 2C5YA 3E3PA 3KU2A 4FSYA 4NWMA 4PL3A 2C1BA 5CANA 3DXPA 1SZMA 3O7LB 5C4KA 5EQYA 5KBQA 3DKFA 1O6LA 1Y8YA 3FLYA 4HZSA 4L6QA 4NCTA 2OF4A 4ACCA 3DB6A 4USDA 4CD0A 5DNRA 5CZIA 4J97A 5EI8A 4TRLA 5FEQA 4EOSA 4F0FA 3FMKA 2WNTA 3BRBA 3R7GA 4FKUA 4HVDA 2BVAA 4PPCA 3BEGA 1M2PA 2XIXA 3PY0A 5AAEA 3UOJA 5B2KA 3ZBFA 2PWLA 2ITUA 3ORIA 3HMPA 3MA3A 4O22A 3RHXA 2Y6MA 2GQSA 3TZMA 4JQ7A 3SG9A 1XH8A 3PSBA 3W2OA 3FI3A 2ZDUA 3FUPA 3BYOA 4IB0A 4RJ4A 4UB7A 3ORMA 4NIFA 4K2RA 2RFEA 4MH7A 2LGCA 4X21A 1PXJA 1VYZA 2QI8A 4G2FA 4L00A 3T3UA 2VD5A 3LXKA 4PUZA 2WQNA 4JLCA 2WELA 3TT0A 4QP7A 5CSVA 3RWQA 3NW7A 4O1PA 3KRXA 4XLVA 3IK3A 1Q3DA 3NEWA 3UVQA 4J71A 4IWOA 3MSSA 3VS3A 2OZOA 3U6IA 2X4ZA 4WUAA 5M08A 5I9UA 3V6RA 3O23A 2GNLA 4I6QA 2CGWA 2W0JA 3HRFA 4B7TA 2BR1A 5FP6A 4DEDA 3F61A 3MS9A 3VUIA 1IEPA 2ETKA 2O3PA 3TM0A 2DWBA 3AC8A 3GB2A 2OW3A 3A2CA 3FDNA 4ONAA 4MAOA 1CSNA 4MD7E 4ZY5A 3QC4A 4XG7A 3PJ1A 1ERKA 4I23A 4FTOA 2UV2A 3UO4A 4DEGA 2C68A 2Y6OA 4GH2A 4EUUA 3L8VA 4LYNA 3EN4A 3TZ7A 4QTAA 4PDPA 1UNLA 1U4DA 4OAVB 4O7WA 4DFXE 4O86A 3I4BA 4F09A 3I6UA 3PPJA 5EK7A 4I3ZA 1H00A 4AE9A 3F82A 5AP2A 3OBJA 3TTJA 2WMUA 5DPVA 3SXFA 4BYJA 2PMLX 5LMBA 4X3FB 5JSMA 1L3RE 4KBCA 4AE6A 4DE4A 5M09A 3E64A 3C0GA 3G51A 3TNWA 1UU9A 1W7HA 2UW0A 5D10A 5KUPA 3VHEA 5IEYA 1FOTA 1H28A 2FA2A 4FT0A 4HNFA 5E1EA 3IECA 1Y8GA 5BVFA 3KF7A 2REIA 3DBFA 4FOBA 1PXOA 3ODZX 3VBTA 4BCGA 4IEBA 1XH5A 1JKSA 2OSCA 4BDHA 5I9VA 2QOIA 2WMQA 3BCEA 3VBXA 4F1MA 2C69A 2XM9A 2JFLA 3QTUA 3TN8A 4OUCA 2QC6A 4E26A 3Q52A 4MKCA 4D1ZA 5M4UA 2H9VA 3LCSA 5K4JA 3OWJA 3ORZA 2Y8OA 4CFFA 4WRSA 4O38A 4J99A 2XK7A 4FICA 5E7RA 1WBPA 3GU8A 4AXAA 5HORA 2QVSE 2W1GA 3W32A 5IA0A 3LM5A 3TI1A 4H36A 4O7SA 2JDSA 2G01A 2IZUA 3ZUUA 4FUYA 3P4KA 3ZFYA 4OTRA 2QU5A 5TOZA 3LFSA 1RJBA 4RJ5A 1UVRA 4XEYA 2BZJA 3Q60A 4O2PA 1ZAOA 2UZNA 4MHAA 1J7UA 2JEDA 4K11A 1OUKA 4AZVA 2I0HA 4U80A 4WNMA 3FLQA 3VBQA 3F7ZA 3ORLA 2F7EE 3KB7A 1CDKA 4FBXA 3IW6A 4D4RA 3BE2A 3EN6A 2JC6A 4NSTA 3JY0A 3EQGA 4ZTRA 4MXYA 1H1RA 1WVXA 1ZXEA 1UU7A 3VUMA 4BTJA 4XUFA 1PMEA 4I0RA 3QA8A 5IH6A 3F3UA 4F7SA 5IUGA 4IE9A 4CXAA 2XYUA 3NUPA 5BVEA 4FTAA 3P9JA 4U6RA 3T8OA 4C4EA 3GBZA 3ZDUA 3WYXA 3SX9A 4H58A 2VAGA 2W1CA 1B38A 2GHLA 3F5GA 4BR3A 3QUDA 3FWQA 3AD6A 3I0QA 3UPZA 2W1FA 3O96A 3HMOA 5EFQA 5JGBA 2YM8A 4IHPA 3C9WA 4HW7A 3PVGA 3CGFA 3FQSA 1PXKA 4E4LA 1JSTA 5TT7A 2WD1A 3WARA 5J1VA 4BIDA 4D58A 3QQLA 4FKIA 2VTOA 5HBJA 5HX6A 2YHVA 2BRHA 4QD6A 4N70A 1XBBA 1DAYA 3PJCA 5HNGA 3R2BA 1LR4A 4J96A 2WOTA 3FMNA 3R01A 3EQFA 4KWPA 2IW8A 4FI1A 2XKEA 3FC1X 2QOFA 3RMFA 4O7VA 3NVMB 4FGRA 1V0PA 3IQ7A 1JKLA 5G6VA 3CGOA 4CMOA 3F3WA 2JKQA 2IVSA 3JY9A 2QOQA 4I5HA 4XRLA 3DBQA 5AR3A 5H9BA 5HE3A 3TKIA 1SYKA 4O7TA 3KRLA 4WSQA 2W5HA 4FA2A 3PIZA 4EHEA 5L8KA 3BYMA 3QRTA 3PXRA 3AC2A 3HA6A 2XB7A 5DLSA 3V8SA 4A4OA 5LWMA 4TYEA 2XKFA 4JS8A 2GNGA 3K3JA 5D41A 1PJKA 4GCJA 1F3MC 2BFXA 3VVHA 3LVPA 3RNIA 2WTWA 3GOKA 3KN6A 1EH4A 4JIAA 4QMQA 4R78A 4YJVA 5ETAA 2XM8A 4XP0A 3ZEPA 2CCIA 3Q6WA 3DKGA 4L3LA 1J7LA 5EQPA 2ERZE 5EG3A 3PYYA 4FSMA 2HOGA 3VRYA 4TYIA 4GS6A 5F9EA 1OBDA 5E8WA 3D9VA 3ROYA 3IOKA 3P78A 3OUNB 1NXKA 4R3CA 3S4QA 3W2PA 3NUNA 3QQUA 3F9NA 4U79A 5A3XA 3FKNA 3FSFA 3ZBXA 4EC8A 4F9AA 4MBJA 2PZIA 4XS2A 4GSBA 4FUXA 1BYGA 2GQGA 3QRUA 1DM2A 3HMMA 3C4WA 4FIFA 4FKJA 4U81A 4EH8A 3CSVA 4YNEA 4FSTA 3QRJA 4LL5A 4C2WA 1PKDA 5LXMA 4GW8A 3GC0A 2VWBA 1KUTA 3E93A 3FMMA 4GUBA 4W4VA 3H0YA 3KMMA 4NKSA 1ZMUA 4QMWA 3VBWA 4E5BA 4V0GB 3OCBA 4FT7A 5E8TA 5HNBA 5HLWA 2Z7LA 2YM5A 3CEKA 3EN5A 1APME 3VWAA 4DEIA 3PA3A 5JQ8A 3F2NA 3EMGA 4EZ3A 5AADA 3NUYA 3SKCA 5H8EA 3QCQA 3DNDA 3MPTA 4RSSA 2YIXA 4CFXA 4EH6A 3BQRA 2YIQA 4EJNA 4L42A 4NL0A 3ORKA 3R7IA 4EH3A 4I0TA 3GGFA 2YAKA 4FIIA 4HGLA 2R3MA 3GFEA 5DOSA 3SOCA 5HVKA 3RP9A 2WMSA 2PVKA 4YJNA 3LM0A 4LRKA 4AACA 2WQEA 4KSQA 4KBKA 4BTMA 2VX3A 1WBWA 3FY0A 4HGTA 1LUFA 4TYHB 4F6WA 3C4ZA 4V05A 4D2WA 3HEGA 3G15A 2W1IA 5B2MA 4YZBA 5EI6A 4RFZA 4HVSA 1WBNA 2HW7A 3ELJA 5AUYA 3PJ8A 4MCVA 3NRMA 4K18A 3A7IA 3LMGA 4BTFA 2OZAB 4CMUA 2PHKA 3HA8A 3KGAA 3EQBA 2B1PA 4MWIA 4XV9A 5GHVA 4DFLA 3HP5A 4O84A 2ZB0A 3NYVA 4GT4A 4NT4A 4DGNA 5FRIA 4WKQA 3V51A 4AAAA 4HVGA 1YRPA 3FMEA 4IJ9A 1H1PA 1ZYLA 4M97A 5HI2A 4AWIA 1MUOA 2ITQA 3NNUA 4ZXTA 3R63A 3ZU7A 5F95A 3FMJA 1KWPA 5K0XA 1PMVA 4JQ8A 4CG8A 3Q53A 4K8AA 3QQFA 3QUEA 4RVKA 2PE2A 5K3YA 4ERWA 2EB2A 4EQUA 2JLDA 4PTGA 3NUXA 4OGRA 5AP7A 4GL9A 2CNVA 2BRGA 3UPXA 3P5KA 4EORA 3R8VA 3OY1A 4JRVA 3V5WA 5M4CA 3RJCA 3KQ7A 3D83A 3BWFA 3AOXA 5HLNA 5LVPA 2Z2WA 4UEUA 2I1MA 5BUJA 4FE2A 4D9UA 3C4CA 3FZSA 5I9WA 4WBBB 3PG3A 1FVRA 4M13A 3W55A 2OJFE 4AGCA 2HW6A 1JPAA 5D12A 4I93A 3K54A 3R22A 2NRUA 3TIYA 4EK4A 3MV5A 5CVHA 4IWPA 3IG7A 1OIUA 4FTMA 2UW6A 2QLQA 2GS2A 5DEWA 4U97A 4UYNA 3ZSIA 1H8FA 3UOKA 3KK8A 3R0TA 4RVLA 3UZRA 3OHTA 2GU8A 3TUBA 4OAUC 4KS7A 3KKVA 4FYOA 2QOBA 4Y5HA 4DEBA 2XCKA 5HGIA 5JFWA 4HOKA 2XRUA 3DCVA 3NPCA 5HG9A 5HO8A 2JD5A 3LE6A 4NM5A 2C3KA 3R7OA 2BIYA 3R04A 4NW5A 4E4NA 3OP5A 5IDPA 2V22A 5DRBA 2WTIA 5J5SA 3OCGA 3QXOA 1R0EA 4CGAA 4IX3A 4KUJA 2NRYA 1HOWA 3QRKA 4IC8A 3EN7A 3R71A 3E8NA 3UNZA 3POOA 4UWYA 3ZUVA 5B2LA 3FC2A 3A7JA 5DBXA 4EL9A 2BMCA 1FVTA 3ZMMA 4V01A 5CQWA 4IAFA 2ONLC 2BUJA 4AS0A 4BKZA 5IQCA 2R3JA 4HYSA 4OLIA 2WXVA 4E5AX 3E8DA 1U59A 3Q9YA 2YAAA 3SV0A 3EQDA 2C0IA 3BLQA 5AJQA 2VO7A 3W2QA 2NPQA 4O6LA 5KZIA 4XBUA 4C02A 3LCOA 3IOPA 1L8TA 1O6YA 3ZRLA 4G3GA 4XV1A 3F5PA 3ORTA 3Q96A 2XNNA 5F4NA 3ZLXA 4DBNA 1Z9XA 2O63A 5L2QA 4FK3A 2GNHA 3DY7A 5FEEA 3JVSA 1KV2A 2C3LA 4D5HA 3OWKA 2P55A 4XG3A 4QPAA 3C1XA 1OL7A 5B0XA 1PMUA 4TNBA 3IW7A 4K1BA 2HYYA 4HYHA 2E9NA 3BU5A 1G3NA 2E9PA 2WMXA 3PXKA 4QQJA 4QPMA 4Y95A 5HE2A 1NVQA 5IH5A 3N4VA 4J8NA 4BFMA 4D0XA 1H01A 4FEQA 1ZMWA 4QOXA 3T9IA 3TZ9A 4U40A 3PRFA 2GMXA 3BX5A 5JRQA 3R02A 4MWHA 4OR5A 3RWPA 3FJQE 3NWWA 4XBRA 4XNEA 4RX7A 1QPEA 3DQXA 3KXGA 4FVPA 4BGGA 3AC3A 2V7AA 3PY1A 5EYMA 4IZ7A 3SA0A 2IZSA 3BHYA 3RPVA 2ITZA 3A7GA 4MXOA 1UV5A 4V0GA 5E8YA 3UMWA 5DWRA 4BIBA 2FYSA 5CEPA 2OO8X 2HZIA 4Q9SA 1OPJA 2VX1A 5FWKK 3WZJA 2YWVA 1YHSA 3L8SA 5AUTA 1QPDA 2UW8A 3BPRA 4E1ZA 3HMIA 4JAJA 4EQMA 4EZ7A 5IQBA 5GNKA 4AN9A 4LMNA 4RFYA 5IA4A 3NUSA 4FC0A 1KE7A 3GC8A 2GNJA 3D2IA 4LV8A 4O0VA 3R8PA 2PUNA 3PVBA 2XK6A 4BCNA 1JNKA 2VX0A 3FHIA 3L8PA 5HE1A 3ZLWA 3LMIA 3C0HA 3PP1A 2XZSA 2QG5A 3RZBA 1YDSE 4FSZA 4IB5A 3SLSA 1QPJA 4ERKA 3T3VA 4DFBA 2BILB 4X2KA 3UIUA 2FSTX 3EHAA 2OU7A 4ZLZA 3EFKA 5A9UA 4CKIA 2OH0E 4X7QA 3CR0A 3K3IA 3WIKA 2PUPA 3VQHA 1Q4LA 3DGKA 3V01A 4RT7A 2QU6A 4RA4A 2W9FB 2PZPA 4KRCA 4MD9E 5TR6A 1BL7A 2G2IA 4PQNA 2BHEA 4AUAA 4EYJA 3ZEWA 4JBPA 2I0YA 4RC2A 2BHHA 4IZAA 4CZYB 2PMIA 4F6UA 3VJOA 4ZMEA 2J0LA 3DBEA 4CKJA 3EKNA 4DC2A 1PXPA 4GK3A 4K6ZA 5DHJA 4F99A 3NYOA 2KULA 3D15A 4CKRA 2QODA 3E63A 2B9FA 3UIXA 4JDJA 4Y5QA 2WTKB 2YWPA 3I6WA 2EXMA 5KE0A 5KMIA 5ANKA 1FBNA 4FKPA 4QP1A 3UMXA 3I7CA 5CU2A 4BWKA 4EYMA 1DI9A 2BAJA 5JZJA 1SNUA 3VS7A 3D5XA 2PE0A 4YC3A 5T3QA 4HGEA 3FQEA 3IS5A 1OKWA 5DN3A 4I1ZA 4C3RA 5CAPA 3QCYA 4GFOA 1Q8YA 1IAHA 4I5MA 4WG5A 3A7FA 3KRRA 2GNIA 4BC6A 4C7TA 5IMXA 3DK6A 4FTNA 1YWVA 3C4EA 2PVMA 3KCKA 5DIAA 2WMTA 4JDKA 1PKGA 1OECA 2WMVA 2XJ2A 2ZOQA 5ETCA 4NJ3A 4C2VA 4D2RA 4EH5A 2A19B 4RIWA 4ZY4A 3QBNA 5C4LA 3AXWA 1K9AA 3NDMA 1XWSA 5AR7A 3KRJA 3OBGA 5KBRA 1PY5A 5KZ0A 2Y4PA 4IM2A 1OL6A 4AZTA 5FP5A 5EM5A 2VTTA 2W5BA 2XKCA 2XK4A 2C3JA 3FLZA 3KY2A 4M67A 2CGVA 3TL8A 5CF6A 5J1WA 4XG6A 2W06A 3P08A 3UIMA 2QG7A 2BDWA 4ASXA 5IMEA 1R0PA 2OF2A 3O2MA 2UW9A 3QGYA 2J7TA 1XH9A 3R1QA 5E9EA 5D9HA 4FG9A 4FMQA 5L2TA 4H05A 1DS5A 2EU9A 3PTGA 2G9XA 1IRKA 4MBLA 3TXOA 2NNWB 1GJOA 2YJRA 3IONA 2B9IA 4GEOA 3NAXA 4S34A 3HAVA 4IAAA 3ZC5A 5DRDA 2VUWA 4AFEA 2UW3A 3PXFA 1YI6A 3Q5IA 3FZTA 3QD2B 3F7WA 5CSWA 3ID6C 3CC6A 3IW5A 3QCSA 4ZP5A 2UW4A 3BE9A 3VC4A 4KKEA 3CQEA 4YJRA 4FKRA 4PL4A 3OZ6A 2YFXA 3RCJA 1JSVA 5FTOA 4CFMA 4F1OA 5L3AA 5H2UA 3HX4A 4FGBA 2WTJA 2YDJA 4G31A 4YZCA 4S33A 5E8UA 4XMOA 4F7LA 3OW3A 5C1QB 4QQ5A 5BMMA 2Z7QA 2GSFA 2UZUE 4BCPA 2X7FA 2X2LA 4MXCA 4YHFA 3U4UA 3GXLA 5FGKA 4AA0A 2Q83A 5ACKA 4ZTMA 1DAWA 1VR2A 5JFSA 3WF5A 3ZZEA 5KMOA 2RIOA 1UWJA 2GTMA 3QTQA 2C5XA 3EFLA 3R1NA 4CYIA 2EB3A 2PVHA 3ORXA 2PVJA 2HAKA 4M0ZA 4XYFA 3RCDA 4R3PA 4WG3A 4IWDA 3TKUA 4DGOA 3COKA 4ZSLA 3QFVA 3F3ZA 2VWVA 3CTHA 2ZMDA 2O5KA 4FV0A 5FTQA 2ITWA 1BI8A 3NUUA 4BCIA 4NUSA 4DHFA 3IW4A 3WZUA 4E8AA 5IH4A 3EZVA 2B55A 2F7ZE 3DOGA 5IQGA 5CVGA 5JFVA 2PZRA 3QTRA 2A0CX 4EK5A 3MVLA 3ZO4A 4LMUA 4HYIA 4YZDA 3O17A 5CWZA 4YHJA 3F2RA 1J1CA 5AP0A 4M0YA 4PL5A 4GKIA 3SGCA 3C51A 2LAVA 2YCSA 4PMSA 4D2VA 3DK7A 4FK6A 2VGPA 4IM3A 4TYGA 4YJPA 4MXAA 4RJ8A 3ZONA 5GJGA 3RGFA 2XMYA 2C5NA 2WMAA 3QCXA 4DGGA 2JGZA 4BZNA 2V5QA 1CMKE 4MX9A 4O82A 2Y4IB 4S32A 4DFZE 2H34A 2WIPA 3O7LD 3D0EA 3E7OA 1E1VA 4ALVA 4B6LA 3QZFA 5AM6A 5HTBA 1A06A 5BYYA 4QMYA 3QTZA 3WF8A 2BTSA 5CALA 4MQ1A 4H3QA 3H30A 3KL8A 4RPVA 4X3JA 1ZYSA 2YM7A 5J79A 3TUDA 2XH5A 4BF2A 5GIPE 4AU8A 5EYDA 2BDJA 5IG1A 3ENMA 3RPYA 1MRUA 4ALUA 4HCUA 5A4LA 1ZRZA 4E3CA 2UUEA 4G6OA 4K33A 3OEFX 3A61A 3PVWA 4J7BA 5J7BA 4L45A 1VYWA 4Q2AA 5CLPA 4R5YA 5FD2A 2OIBA 4L9IA 1AD5A 3D7TA 3HDNA 4ANBA 3MN3A 4E6DA 4Z7GA 4XCUA 4F0GA 1XQZA 2QOOA 4QP9A 5EYKA 3BI6A 5AUZA 4ZZOA 5K0KA 3LOKA 4F08A 5IDNA 1X8BA 3U87A 1JVPP 2WTKC 4AG8A 2R3NA 4I6HA 2F2UA 5K9IA 2OLCA 4O7ZA 2BIKB 3ZFMA 5HIBA 3R9RA 2C5OA 5EHOA 4BCFA 4KIPA 4LG4A 4NKAA 1S9JA 1A48A 4IAZA 4OTPA 4JDIA 4N6YA 3VUTA 5EOBA 3HV5A 3BZ3A 5HESA 3CKXA 4E73A 1F5QA 1QMZA 1M17A 3E62A 3HGKA 4GIHA 5JEBA 4NK9A 3R73A 4OTWA 1JKKA 3OG7A 1OIRA 2NP8A 3I1AA 3ANQA 3MVMA 3VS6A 3G90X 2CSNA 4D28A 3FSKA 1UU8A 2QD9A 3RALA 4YSMA 3JYAA 5CEKA 4CVAA 3Q5ZA 5HIEA 3C5UA 4OBQA 2BKKA 5HCXA 4DLJA 4F64A 3GCQA 3PP0A 3DFAA 4FKQA 1H07A 3ZDIA 4LQMA 3TV7A 2ITVA 4UALA 3BQCA 4JR7A 1MRVA 1ZYDA 3COIA 3OFMA 1O6KA 1FMKA 4O0XA 4IDTA 4RJ3A 3CTJA 4UMPA 3R8ZA 3NR9A 3BBTB 3DKCA 5HCZA 2O64A 2J51A 3LJ0A 4MXZA 3ZH8A 4ZLYA 5L6OA 2X4FA 4XOZA 3FBVA 4J95A 3HV7A 4MF1A 3UG1A 4EQCA 4AT5A 3WF9A 4EWHA 5IZFA 3VS4A 3FZOA 5M51A 4WNOA 2WKMA 4BCHA 2O65A 4C58A 4KINA 4F4PA 1NVRA 4KIOA 5AV4A 1IAJA 4AQCA 2HY0A 4CT2A 5LARA 4ITJA 4I5CA 3OROA 3WILA 3CY3A 5AP1A 1TQIA 2ITOA 3HVCA 4DT8A 4BHZA 3TTIA 2A1AB 2JIIA 2YJSA 3CBLA 5DG5A 3V8TA 2Y9QA 3ZXTA 2R3GA 5A54A 3R6XA 4X6QC 4BDIA 4AW5A 4C62A 5E91A 5HO6A 4XG2A 3MH3A 2W7XA 2XBJA 2EWAA 4N4SA 3I60A 2VTNA 3ZS5A 2VTMA 5KKRB 1Q8TA 3UODA 4C33A 4RIYB 4H3BA 4WO5A 4IADA 4O6EA 4FNZA 5LCKA 5L4QA 5J95A 5LJJA 3DA6A 2R3QA 4ORKA 3N51A 2ETRA 2O8YA 4DH5A 1OITA 5HCYA 2E9UA 1GOLA 3FMHA 4AN3A 4U41A 4JX3A 1BX6A 2F2CB 4I94A 5JZNA 3L9PA 2YCRA 2PYWA 4I6FA 4U5JA 2R3HA 3D4QA 2BDFA 1E9HA 2Z7SA 3A8XA 2XKDA 4Y72A 3QX2A 2FGIA 3RAWA 3JXWA 3EWHA 4CQEA 3FZ1A 3G6HA 5BUIA 2PU8A 2WIHA 4YJQA 3KK9A 1PRYA 5A4TA 2OK1A 5IF1A 3TIZA 4RQVA 3FXXA 5CAQA 4O21A 3DJ6A 5CEOA 3DJ7A 1YQJA 2CLQA 3RPRA 4F9YA 5EHLA 5CXZA 3H9OA 3VNTA 5CU0A 4NZWB 3QYWA 5HBEA 5AAFA 2C30A 3RNYA 4WBOA 2C4GA 3NGAA 3ZOSA 1H08A 2FB8A 4M69B 4I21A 4E4MA 2ZV8A 4PPAA 2OGVA 1V0OA 2ITPA 3HP2A 4UMUA 2J0JA 5KHWA 1MP8A 3RI1A 5L8LA 5F20A 2JDVA 4U7ZA 5JKGA 2HELA 3CS9A 3ZO1A 4QNYA 1WAKA 3TJCA 5FBNC 5M44A 3B2WA 2UZVA 4RVTA 5ANGA 4BICA 1BMKA 1NY3A 2A2AA 3CJGA 3TJDA 3FMLA 3BELA 2J0IA 2V55A 4ZTSA 5ACBC 1O9UA 3NNVA 4O1OA 1S9IA 1UWHA 5HD4A 2XVDA 4AA4A 3GU4A 4U43A 3P23A 4TY1A 1B6CB 3FKOA 3QLGA 3H3CA 4FNWA 3V3VA 3HV4A 5E92A 4QTCA 4Q5HA 3OY3A 4IVDA 5C8MA 4M3QA 4PTEA 4FT9A 2PVNA 4YTIA 2UZTA 3EB0A 4J98A 4ZTQA 3HMNA 3LFAA 4IM0A 4CEGA 2OFUA 4TT7A 2I7QA 3RM7A 2HZNA 5AIRA 3F3VA 3TG1A 4FSRA 5EQEA 4DTBA 3Q9WA 2EUFB 3OF0A 3QRIA 3W10A 3T9TA 4ASZA 4MQ2A 4DH8A 4JI9A 4LGHA 3DB8A 5HNIX 2WAJA 5CS6A 3W16A 2FH9A 4M14A 4CFNA 3E7VA 4OTHA 5BVKA 2XK8A 3EQIA 4FL2A 4QO9A 4TW9A 4EHGA 2ITNA 1QCFA 4AA5A 1H27A 3BGPA 4D1SA 4E6CA 2DYLA 4I4FA 1WBTA 2OI4X 3IKAA 3VN9A 4RIOA 5EW9A 1ZOGA 4K0YA 1LEZA 4ANLA 2R3OA 4MEDA 4TWCA 4L3JA 4EI4A 4ZJIA 3OEZA 4KNBA 4USFA 3V5QA 5LMKC 4GYGA 5I3OA 2WFYA 3JR1A 4YJSA 4XHKB 4P90A 3R21A 2IZTA 4R6VA 3PJ2A 3BHTA 2J0MB 2ETMA 2JKOA 3S00A 3DAEA 3RK5A 5KMNA 5LMKA 2UZEA 3ODYX 4RGJA 4DYMA 1KOBA 5CSXA 3U51A 5FXRA 2X1NA 1SVEA 2BRNA 2YCFA 4KD1A 2ZV7A 5C03A 4H1JA 4PTCA 3VUKA 3ZFXA 1YWRA 2JDOA 4X3FC 4ZSAA 4D2SA 3ZM9A 1PXMA 3O0GA 3QZGA 4J1RA 2C6MA 3UNKA 1WBVA 4HPTE 5IU2A 2IJMA 1KV1A 3KA0A 3UDBA 5HBHA 3FMDA 2XIZA 1YXTA 3MJ1A 5CNOA 4X3FA 1LPUA 4YO6A 5AX9A 5CAOA 4RWJA 3QKLA 4EZ5A 4F9WA 4FSNA 1WBOA 3UOLA 2WTCA 3LFFA 4FKSA 3MFSA 5T68A 4X2FA 4GFMA 2R3FA 4JX7A 3VO3A 1ZYJA 4BDFA 2XK9A 2PMOX 3PLAE 4QMUA 1Y57A 1CTPE 3LFNA 2I0EA 2PVRA 4NYEA 2YIYA 4UWBA 5CTPA 4ZAUA 4G3CA 3K5UA 4NJDA 2IVVA 3R9OA 1G8SA 3E88A 3O50A 1OL2A 5F94A 4D4YA 2I40A 2PVYA 2QO2A 5JGDA 4FKLA 2B9JA 4MNEB 4AZWA 1BKXA 5AV0A 2VWZA 3GU6A 4FF8A 3RAKA 5K5XA 2HCKA 3VUGA 4YP8A 5A6OA 3KULB 4U8ZA 1QL6A 3F6XA 3GNIB 2PK9A 3O71A 5CU3A 5AR8A 5J9ZA 3ZLYA 5D11A 5AA9A 5CAVA 5KKRC 2YM3A 2XNEA 5DA3A 5E90A 5LCJA 4RWIA 3W33A 2OJIA 5AIKA 4BBEA 5C26A 4W4WA 3CQWA 4ARKA 4BGHA 4FVQA 3R1SA 5CU6A 5EM7A 4BCKA 2YIRA 3QC9A 4PF4A 2X7OA 3GP0A 3OW4A 1SVHA 4DTKA 3DZOA 3QWKA 4RIYA 4EH2A 5AUUA 1STCE 5TKDA 3N4UA 3WE4A 3HV6A 3SW4A 4NM0A 4ZSEA 3VBYA 4R7BA 4FTKA 4ZOGA 4CTCA 2VWUA 2OIDA 4C0TA 3KXNA 4KIQA 5IA2A 2F49A 2VZ6A 1WMKA 2BFYA 4BWXA 4EKLA 2QHMA 2RL5A 2X39A 4ZIMA 5J5TA 4QQCA 3KVXA 2BTRA 3QALE 2R3PA 5I9XA 4QP3A 4FTRA 4I24A 4KAOA 3R9NA 2CDZA 4EEVA 2B52A 2HWOA 2GFSA 4M15A 3AMAA 5AMNA 3SQQA 2H8HA 2OICA 2PY3A 4OT5A 3ZTXA 3QXPA 3UO6A 4W8EA 4DH3A 1OUYA 3OUKA 2YISA 3JPVA 1OKZA 4NEUA 4LM5A 1PYXA 3DZQA 2VU3A 5EW3A 3CPCA 2YLEA 4WRGA 4O0RA 4EBVA 3VHKA 4FZAB 4ZS4A 4I4EA 4ANSA 4AGUA 4RJ6A 1MQ4A 3O8PA 5DR6A 4EC9A 4M69A 3S2PA 3AD5A 5A4QA 2HENA 1Q62A 3ORPA 4DFUA
chains in the Genus database with same CATH superfamily
4A9TA 5JRSA 4FTCA 4OTQA 4EOLA 4N57A 3MH0A 3MY1A 4D9TA 4PDYA 4D55A 3NNXA 3NZ0A 3A60A 4YJUA 5CEQA 3QHRA 4ACMA 1Y6AA 3LMHA 3I0OA 4N0SA 4YPSA 4BY9E 2FVDA 5CSPA 2IVUA 4AT3A 3C5IA 1FQ1B 3KXXA 3W18A 4M8TA 4RX5A 3FQHA 3FI8A 3LFEA 4C4FA 2I6LA 2R4BA 3IDPA 3MFUA 4YZ9A 5EYCA 2FSLX 1TQMA 1M14A 3D7ZA 2WQMA 4G6NA 2ONLA 2ITYA 1H0WA 4O2ZA 1ZOHA 3P79A 5E1SA 3FXZA 2VTRA 3AGMA 3DLZA 4APCA 4C35A 4LI5A 4XJ0A 2ITTA 2R0IA 2W99B 5EW8A 4CCUA 3PZHA 4GU6A 4FT5A 3PPKA 3NS9A 2YACA 2H96A 1KE9A 2BAKA 3E8CA 5AV2A 4FV9A 1BI7A 1VZOA 1M2QA 2YDIA 3GU7A 5ANDA 4D0WA 5IQIA 4PMTA 5GINE 2EXCX 4MF0A 3LQ3A 2QR8A 3L8XA 2RKUA 5BNJA 4LOQA 3D5VA 1YI4A 2RG5A 4IZ5A 4ZY6A 5AM7A 4FYNA 4NFNA 5HG8A 4CV9A 5GJDA 3IO7A 4C3FA 4C4JA 2IPXA 4DG0E 4U9AA 2X81A 4YU2A 5LMAA 2B53A 4RX9A 2BALA 3EN9A 3QTSA 4U44A 5L8JA 5A46A 4JJRA 2CKEA 4FV2A 4EH5A 4CFWA 4AW1A 5LOHA 2J90A 3HLLA 3MW1A 1DI8A 3LLAA 5DVRA 5CU4A 2X7GA 3R8UA 3S3IA 4DCEA 4Y85A 4L01A 3II5A 4JNWA 5HKMA 2AYPA 3WZKA 3FXWA 3F69A 3M42A 4C4GA 3UQFA 1V0BA 3U54A 1JWHA 3EL7A 3IW8A 4DTAA 5AV1A 1GZKA 3FE3A 3IGOA 1H24A 3QUPA 1Q24A 4U0IA 4UMTA 5HQ0A 1UKIA 4EOOA 1FMOE 1PXNA 1BUHA 4UZDA 3FL4A 3R30A 4FVRA 4C37A 4PX6A 3MPAA 4G34A 2IW6A 4BDCA 4AZFA 1ZMVA 1U5QA 2IVTA 3R00A 3AT4A 2UZDA 3PE1A 5AWMA 5J87A 4AN2A 4DINA 5L2SA 3I7BA 4BYIA 3VF8A 4Y83A 3MI9A 3A62A 5ANIA 4OTFA 3S1HA 5IQEA 2C6IA 3KN5A 4L8MA 4LFIA 5CEMA 2F4JA 2Z8CA 1Q99A 2XJ1A 4RQKA 5HG5A 3TDVA 3BEAA 3Q2JA 5CF8A 4ZLOA 3EJ1A 3LZBA 3I81A 3OXIA 3PSCA 4YBKA 3KF4A 4GT5A 4YJOA 4YTCA 3REPA 4PWNA 1ZOEA 1YXVA 2OJJA 4A9UA 4TYHA 4W9XA 1IASA 1OIQA 3DU8A 2OBJA 2UZOA 2ZM3A 4YUQA 2PULA 3BYVA 4BI2A 3EYGA 3EQPA 3FLSA 3BLHA 2VGOA 3M2WA 4R7HA 3D5UA 4G16A 3NCZA 3VW8A 3SDJA 5CAUA 4YC8A 4JVGA 3P86A 4KKHA 2XS0A 2OZAA 1YHVA 4CLIA 3TCPA 1M52A 3Q4TA 4DEHA 1G8JA 4FEUA 1XHAA 3QLFA 4I0SA 2PE1A 2VO3A 2OKRA 4QMLA 3KULA 3FLWA 2Q0NA 4DG2E 2VWIA 4YSJA 3GCSA 4JG7A 2C6EA 4O4EA 5IKWA 3SHEA 5M4IA 4XRJA 2X8DA 4AGWA 4CRLA 2GHMA 4QMNA 1W84A 4TWOA 4DN5A 4UXLA 3PA4A 4U42A 1K3AA 4DA5A 4B0GA 4C38A 3Q9XA 1ZARA 3DQWA 4JR3A 4RA5A 4FRFA 1Y91A 4QYYA 5FEDA 5C8KA 1VLRA 2UZWE 5L2IA 2X6EA 3ZZWA 3R83A 1OB3A 4QNAA 5J7HA 4TTHB 3RK9A 4AP7A 3U6JA 3VIDA 3RAIA 3KRWA 4Q5EA 1U54B 3FKLA 4HVHA 4GIIA 3L9MA 4N6ZA 4L52A 3R9HA 2F9GA 1OL5A 3QD4A 2OXYA 2XF0A 3UO5A 5A14A 3ZYAA 3RVGA 3MH2A 3W0MA 1REKA 5GZ9A 5DR9A 2Z02A 3LHJA 2OH4A 1RDQE 1PW2A 2JIVA 3F88A 3PY3A 4FODA 4RX8A 4TWNA 2QHNA 2NYAA 3PDTA 2VTQA 4I6BA 4I22A 5ETFA 2WTVA 4PMMA 3VUHA 2YABA 4Y73A 5FXQA 3GCUA 4IC7A 3RKBA 3BBWA 3VW6A 5JK3A 3RM6A 3MWUA 3KREA 4IFCA 5ETIA 1U5RA 3MFRA 1ZZ2A 4BKJA 4UMRA 3RINA 4YBJA 4A7CA 3HL7A 3P5JC 4XV3A 1ST4A 3ITZA 3MB7A 4F63A 4IZYA 3FYJX 5EI2A 5EM8A 4ENYA 3DDPA 3KC3A 4IX6A 4APPA 3HECA 1HCKA 2C0TA 2ACXA 4UMQA 4AAYA 4FTJA 2GS7A 4GV1A 4RZWA 5E8SA 4BTKA 5H8GA 3E5AA 5CYIA 3PWYA 3U55A 3QKKA 2PTKA 3LFDA 3ULZA 1XH7A 4UV0A 4BDJA 4L44A 1UU3A 2P0CA 4AGDA 4CCBA 4U3ZA 3MY5A 3LIJA 4IX4A 4C36A 4FV1A 2OXXA 2UZBA 1TQPA 1U46A 5CT7A 3R7YA 3VAPA 2JBPA 3PPZA 4XG9A 4KB8A 3RPSA 4YHTA 2XYNA 4EONA 3TDWA 3TV6A 2WGJA 5HZNA 4LOPA 1JKTA 3KCFA 2XNOA 1R1WA 3Q3BA 4YLKA 2R9SA 3A4PA 3SXRA 3FLNC 5CNNA 3QYZA 3FAAA 1YHWA 1ZY4A 3U8WA 3W2CA 4WNKA 3M1SA 4IIRA 4QPSA 3UVRA 4G9CA 3NVKI 1JQHA 4RC4A 3VJNA 2C6OA 5FXSA 4D4SA 3S0OA 4JBQA 3UQGA 5KMJA 3EL8A 4YC6A 2W1HA 5IEVA 5HLPA 4F9CA 3LXPA 1YWNA 4FTTA 4R8QA 3OXZA 4A9SA 4BDBA 3VRZA 2WMWA 4USEA 2BROA 3QZHA 1W98A 3QD0A 3UOHA 2AC3A 3C13A 2UVZA 2PVFA 3DBCA 4IH8A 4KA3A 5JH6A 2X6DA 3LXLA 2X9FA 2E9OA 1R39A 5DH3A 3MYGA 5HHWA 3PG1A 3DPKA 3QQGA 4AZSA 1G8KA 4LL0A 3UGCA 5CX9A 4XG8A 5DT0A 3NFFB 4II5A 2XIYA 1AGWA 4BDGA 2W4OA 1J7IA 2VTIA 5BYZA 4QP2A 5HO7A 4DFYA 2KTYA 2V62A 5IEXA 3ERKA 2X0QA 4L67A 1FVVA 2XCHA 2PVLA 2UW7A 4DCAA 4P5QA 3QQHA 4Q9ZA 4I41A 1FINA 5CF5A 4JOAA 3WIGA 4ACGA 4F0IA 4FL1A 4JIKA 1WVYA 3NUAA 2RF9A 3ZC6A 5KO1A 4IAIA 5JN2A 2ZMCA 1ATPE 2R3KA 1P4OA 4E20A 2CKQA 4H39A 4TN6A 3PLSA 5I9ZA 4YURA 1PMNA 3BIZA 4XG4A 3UP7A 2VWXA 4ZZMA 5IQFA 3U4WA 1YVJA 3ZO3A 3LJ1A 2VTSA 4GU9A 3U9CA 2R5TA 3LW0A 3MTLA 4DF3A 4O27B 4FZ6A 2CKOA 4LRMA 3UQCA 4EOQA 1W83A 1R3CA 3DAKA 4GK2A 4M12A 3CXWA 4UWCA 4MD8E 2VRXA 4RC3A 3ETAA 4MK0A 5FDPA 2OXDA 2P4IA 3QTIA 4MVFA 1J91A 2W96B 3V5JA 5KMLA 2F7XE 1UNHA 3HDMA 4EHZA 2X0GA 2X2KA 4UX9A 3MA6A 3OWPA 4CSVA 3L9LA 5IA3A 1YDRE 4MBIA 1F0QA 5HICA 4FSWA 3UBDA 5EOLA 4BI0A 2V0DA 5BX0A 1M7NA 4AXCA 3OMVA 1IG1A 1XBCA 3DK3A 4PDSA 1XBAA 3N4TA 3OC1A 3QQJA 5AP3A 1SMHA 3MIAA 2VTLA 3WZDA 3SAYA 4HGSA 3QTWA 4W4YA 5DI1A 2W17A 3FI4A 3WF6A 5DMZA 5GZAA 1Q5KA 4R5SA 4RBLA 3TNIA 3G0EA 3D5WA 4IAKA 4QMZA 4FIJA 5GZ8A 3ACJA 3QF9A 4U3YA 3QX4A 2W4KA 3NW6A 4X0MA 5JMSA 2EXEA 2QNJA 2X8IA 4C4HA 1H0VA 5HVYA 4FV8A 4JT3A 5I9YA 1OGUA 4JG8A 3CCNA 2X9EA 1U54A 2CMWA 2BZIB 4NM7A 4PNIA 5AP5A 3R8LA 5I0BA 4FG7A 5FM3A 5J8IA 2ERKA 4J53A 3IDCA 3FV8A 4HZRA 3CPBA 4DEAA 4PMPA 3DXQA 3V8WA 5KX8A 4M68A 5AP4A 3VQUA 4W8DA 4ANQA 5ANJA 2UVYA 5AR2A 4A4XA 2CKPA 3FI2A 4NFMA 5AA8A 2VNWA 1MRYA 3C7QA 3PXZA 3LLTA 3O51A 5JFXA 4EH9A 4FKOA 4WNPA 2XJ0A 4DGLC 4HPUE 2RFSA 4RWLA 4OTDA 5EDPA 1SVGA 3ALNA 1G5SA 2ITXA 4QTEA 4IAYA 1A9UA 1Q61A 2AEGA 5DR2A 4KABA 4QMSA 3VULA 2C47A 2QCSA 4R1YA 4WIHA 2XNGA 3NCGA 4XX9A 2ZM1A 2CN8A 3ORNA 4WT6A 5CY3A 5L6PA 3HRBA 2I0VA 2C6TA 4FV7A 5HEZA 2ZV2A 4LGGA 3MB6A 4UXQA 4L53A 3N9XA 1P4FA 4M66A 4CFUA 4Z9LA 3V6SA 4G5JA 4ACDA 3K5VA 3QTXA 2XAOA 1YOJA 3GVUA 5IA5A 5M56A 3W8LA 4FKGA 4KS8A 2WMBA 4FL3A 5AR5A 1OKYA 4EUTA 5FBOA 3FY2A 3MDYA 4AT4A 4CNHA 3BKBA 3R7VA 4XLIA 4B8MA 2CJMA 3PXYA 3VS5A 5E8XA 4EK8A 3PRIA 5M57A 3ULIA 3V5TA 5M07A 5EH0A 2QO7A 4PRJA 2G15A 3EYHA 4NW6A 1M7QA 1OM1A 2JAVA 5FQDC 3OTUA 3OD6X 4JXFA 2HWPA 4M7IA 4X2GA 5BVWA 3IGGA 4C61A 3HAMA 4P5ZA 4LGDA 3ZHPC 3UP2A 3UJGA 1OMWA 4A9RA 1NT2A 2PUIA 3NYXA 5EDQA 3TNQB 4E6AA 1GY3A 3QQKA 3RPOA 4O0YA 3ANRA 4FV6A 1RE8A 1YI3A 4PDOA 3W2RA 2J6MA 4XP3A 2RSVA 2IO6A 2XAMA 2XNMA 2YITA 4QYHA 1H1QA 5E4HA 2YERA 3WOWA 5IQDA 4O83A 2E2BA 4FTQA 1LP4A 2HZ0A 2XNBA 3PZEA 2XP2A 4C57A 2QURA 3GT8A 4DGMA 5KMKA 2QO9A 4J8MA 5D7VA 5H8BA 3GCVA 2JKKA 3QGWA 2UZLA 1FGIA 3BYUA 4I92A 2VV9A 3NNWA 2A4LA 4LUEA 4GJ2A 2AC5A 2QOKA 3H10A 4WG4A 4YLJA 2B9HA 3DJ5A 5H3QA 5TF9A 3VF9A 2PZYA 2W1DA 4ASDA 4BDAA 3GEQA 4HYUA 4NH1A 1CKPA 5GJFA 5A4EA 3UYSA 4JDHA 4YPDA 3BV3A 2XUUA 3CJFA 3S95A 5HE0A 4RIXB 4C59A 2P2HA 1V1KA 4DBXA 1OIYA 5EKOA 4AFJA 4OTIA 3DAJA 1GZOA 5HG7A 1VEBA 3FPMA 2WMRA 4FX3A 5BQ0A 2HY81 2Y4IC 4FTIA 1SM2A 2DQ7X 1JBPE 4IANA 4G1WA 1RQQA 2Z7RA 4FNXA 3C4XA 2W1ZA 1H25A 4WD5A 4RWKA 4TWPA 1GIJA 5DGZA 3SXSA 3TEIA 4BRXA 2ZV9A 1W2CA 4IMYA 4DAWA 2P33A 3FZRA 4NTSA 2OJGA 2QR7A 2A27A 2BZHB 4G5PA 4ITHA 4ANMA 3ATTA 4ZMFA 4TYJA 3DXNA 4RLLA 4E7WA 5CI7A 1JAMA 2QKWB 3JUHA 4D2TA 4BKYA 3OTVA 3E92A 5C01A 3VS2A 4TNDA 4AF3A 1H4LA 2FSOX 3NW5A 3BV2A 2YDKA 2WQBA 4RMZA 4JG6A 3G0FA 4AOIA 3NYNA 4NM3A 4FZ7A 4G6LA 4Z7HA 4O0UA 4ANOA 4FTLA 4DLIA 4GMYA 2CN5A 4YZNA 3PIYA 2VO0A 5AR4A 4RVMA 4ZJJA 1FGKA 3DS6A 3DTCA 4ALWA 3SD0A 1B39A 2OJ9A 4BN1A 3GENA 3WI6A 4ZZNA 3LKMA 5FUTA 3U9NA 1J3HA 4GYIA 3AKJA 1YXUA 5LVMA 1UA2A 1H26A 2DS1A 5C8NA 4G17A 2QLUA 4ZSJA 3CY2A 3Q32A 3ZLSA 3A7HA 4QMTA 3P7AA 4K77A 3H9RA 3G2FA 4QYEA 4MXXA 2HZ4A 1YDTE 2ZAZA 4D4VA 2RG6A 4ITIA 4QMXA 2VTJA 4BI1A 1YKRA 3KEXA 4WHZA 5KHXA 1GNGA 3D2KA 5C9CA 3FPQA 2BAQA 4AXDA 5C27A 5D1JA 1FPUA 1OI9A 5FDXA 4O7LA 1Y6BA 4U45A 2WO6A 2W4JA 4IFGA 5AFVA 2FO0A 4EOJA 4X2JA 1WVWA 5L2WA 3W0PA 4EJ7A 3SG8A 5FLFA 1W2FA 2FUMA 2H6DA 2FSMX 4PY1A 5DE2A 4CYJA 5IPJA 2XANA 3AGLA 4FV3A 1LEWA 4ENXA 3GQLA 3R1YA 4S2ZA 4BBFA 2UVXA 3MY0A 4A4LA 4DT9A 3SOAA 4JAIA 4UY9A 4WOVA 4YR8A 2X0OA 3WE8A 2PL0A 5G1XA 3P1AA 5JT2A 2WU6A 2XRWA 3C50A 3KFAA 4IB3A 4FSUA 1NA7A 2IWIA 3R28A 1GAGA 2VO6A 5E8ZA 3CD8A 4EHVA 3NMUF 3COHA 4O91A 4OTGA 3Q4ZA 1JLUE 2JITA 3QZIA 4QQTA 5AUVA 4LV7A 2GCDA 2YA9A 3RAHA 2J2IB 4EOPA 3AKKA 3BGZA 4E6QA 5BVDA 3MFTA 2C1AA 2QOLA 4AW0A 5TE0A 1M2RA 4O0SA 4WSYA 3ACKA 2VN9A 3R7UA 2JKMA 4LOOA 4X2NA 3LXNA 5CSHA 5CEIA 3DV3A 4LRJA 3WF7A 4FIEA 1NVSA 3G6GA 3EIDA 2X0PA 3C0IA 3MESA 1Q41A 3CE3A 3MTFA 5M53A 2G2HA 3COMA 3P0MA 3PSDA 5EKNA 4DH1A 3HKOA 1I09A 1XKKA 5JQ5A 4R3RA 3UG2A 3DKOA 3W1FA 4QMOA 4EOMA 1XR1A 5FM2A 4UN0C 1YOMA 1Q3WA 4FEWA 2J9MA 4FZFB 3B8QA 3M11A 2B54A 3PFQA 3ET7A 4A07A 4WUNA 1OVEA 5HX8A 4DH7A 3Q4UA 1WZYA 3HNGA 4B4LA 4LDTA 2YIWA 2XIKA 4ZJVA 2YLFA 2C3IB 4KIKB 4H1MA 2GNFA 4GK4A 3TNHA 1CKJA 2R0UA 3H9FA 4CFVA 4YNOA 5KNJA 4MTAA 1KE8A 4QP6A 4F6SA 2CGUA 1XH4A 5HU3A 1ZYCA 4O4CA 1QPCA 4L7FA 3ZRKA 2HXQA 4XH6A 4GJ3A 2J4ZA 5DEYA 3CD3A 2G1TA 4R7IA 4EH7A 2R64A 4HJOA 4C3PA 4Z16A 1IA9A 1CKIA 2XK3A 5AUWA 3NX8A 1G8AA 1UNGA 4GKHA 3LCDA 4EOKA 3ENHA 5D7AA 3QD3A 5HVJA 3LQ5A 3OVVA 5CXHA 2CGXA 1JOWB 3D14A 4RJ7A 4TPTA 4F65A 3F3TA 3GUBA 5HIDA 5BVNA 3THBA 2VTAA 4FSQA 4GT3A 4H3PA 3BU3A 2CNUA 3F66A 5DT3A 2R7BA 3EH9A 1PXLA 4JRNA 4FZDB 4QRCA 3I5NA 2Y0AA 3LFCA 4HCTA 3BU6A 4NTTA 2QKRA 3E87A 1OKVA 2ZVAA 2R3RA 3IPHA 5CF4A 1OBGA 4FEXA 5IQHA 3GC7A 4TXCA 1Q8UA 3CP9A 3RTPA 4BL1A 1TKIA 4RIWB 5BMSA 2PZ5A 2ESMA 4KSPA 4BBMA 1PYEA 2YZLA 2BPMA 4L3PA 1OPLA 4TL0A 3UIBA 1KE5A 5KMMA 4IVAA 4O7RA 3ZXZA 3E3BX 3TWJA 4XP2A 2BKZA 5IUHA 4KRDA 4CZTA 4D2PA 4PNKA 1OPKA 5M06A 5I5ZA 2G2FA 2YM6A 5F1ZA 3OT3A 4RIXA 1AQ1A 3OT8A 4BWPA 4UBAA 4CZUA 3A8WA 2ZJWA 3PA5A 3MVJA 3A4OX 3QWJA 3OCSA 4IVCA 1Z5MA 4RRVA 3CLYA 3R7EA 4DG3E 3ZM4A 1W0XC 4FEVA 2IZRA 4D1XA 5AEPA 1SNXA 5LVNA 3DFCB 5ITAA 5EDRA 2WPAA 5K5NA 1YW2A 2J5FA 2OWBA 2WEIA 3CQUA 3G9NA 3OOGA 3P7BA 3QU0A 4B99A 5LVOA 2Z60A 4Y8DA 3PVUA 4ZTHA 4O81A 2VTHA 5IISA 3AG9A 1WCCA 3QAME 4FKTA 3IDBA 3TUCA 5CVFA 1JSUA 5CQUA 4G3DA 4IB1A 3KXMA 3VS1A 3PE2A 4GVJA 5B7VA 2J50A 2JIUA 4KBAA 4CRSA 2B0QA 3UZTA 5A6NA 1CM8A 4DITA 3ATSA 3MIYA 4E93A 2VNYA 3BWJA 4IWQA 1URWA 3PWDA 4Y46A 3FL5A 4G3FA 5J9YA 4BZDA 3TZ8A 1XH6A 3WZEA 3LAUA 1XO2B 4F7NA 1NW1A 3MVHA 4EBWA 2J0KA 4PP9A 3RZFA 1R78A 3RHKA 5DT4A 2ZM4A 3TKHA 4RG0A 3TNPC 1ZLTA 2WQOA 3BLRA 3KXHA 4PPBA 4CT1A 3SRVB 4O7NA 4GFGA 3BHHA 3F5XA 3SVVA 3LCTA 1BL6A 4QTBA 5AUXA 5CT0A 3E8EA 3UTOA 2CHLA 4MYGA 4W4XA 4YZMA 4DFNA 2CCHA 4ZTNA 4BCQA 3ZCLA 1OZ1A 3MH1A 4YTHA 2XA4A 1GZNA 4FG8A 1P14A 5HD7A 3BGQA 2C6KA 4F1TA 3ZSGA 5GIOE 2YM4A 3EQRA 4YO4A 1WFCA 3Q4CA 3QA0A 4CMTA 3PUPA 2BZKB 3B8RA 3VBVA 4QT1A 1ZZLA 3G9LX 4YJTA 3W0OA 5EM6A 3EOCA 1IR3A 3NLBA 2BRMA 3KMWA 4YTFA 2VWWA 4AZEA 4ID7A 1H1SA 3OXTA 4QP4A 2F57A 3HRCA 4M84A 4EKKA 5J9LA 3PUFC 1VJYA 4YGAA 2O0UA 4S30A 3VS0A 2WU7A 3LFBA 1P5EA 3SC1A 3CTQA 2JBOA 4IX5A 2EVAA 3CIKA 3O8UA 3Q04A 4HNIA 3GCPA 3POZA 4GVAA 2P3GX 2WOUA 5HTIA 3SW7A 3DLSA 4TZRA 4AX8A 2BCJA 4JBOA 5EHYA 4P2KA 1Q97A 4BVUA 5ICPA 3I5ZA 4J52A 4BB4A 2VWYA 5AX3A 2SRCA 2W5AA 2XNPA 1YOLA 3QL8A 3ZRMA 4LUDA 3R8MA 5AV3A 4A9YA 3KMUA 3L9NA 4ZK5A 3LPBA 4MNEA 4FTUA 4AOTA 5BV3A 4OBPA 2IEWA 2C5VA 4NIFB 5M55A 5BYLA 3KVWA 1KOAA 3ZSHA 3OWLA 3F5UA 4FIHA 4FKVA 4ZTLA 3LCKA 3W8QA 4G9RA 4UYAA 2J5EA 3F2AA 3AT3A 1XJDA 2HIWA 3GQIA 3MBLA 1ZY5A 2E9VA 4R1VA 5E8VA 2WHBA 2R3IA 5CI6A 4IVBA 4FT3A 4FIGA 5T6KA 3BHUA 3D7TB 2GDOA 2RFDA 4EK6A 5BUEA 3ZUTA 2O2UA 1PF8A 2WEVA 4QMVA 3BHVA 2ZFYA 4D5KA 3OOMA 5L6WL 4UZHA 1KSWA 1YXSA 4GUEA 3G33A 3VUDA 4PP7A 4JL9A 1OL1A 4OBOA 5CZHA 5LVLA 1T45A 4AW2A 4KIKA 3Q6UA 3LFQA 3AMBA 3OCTA 2GS6A 4EOIA 4DHZA 4QTDA 4L43A 4QYGA 4V04A 4RZVA 2JDRA 2IG7A 3NIEA 2C6DA 3CKWA 3TV4A 5I4NA 2GHGA 4B8LA 2PPQA 4CG9A 2ZDTA 4BCMA 2QOHA 5IUIA 2RGPA 1GIIA 4FV4A 3AC1A 2XEZA 3V5LA 5CENA 4CQGA 2P2IA 5TO8A 4IW0A 4LV5A 1YXXA 4NU1A 4B9DA 1K2PA 2OFVA 3AC4A 4F7JA 4R77A 3DT1A 3LJ2A 4OW8A 3A99A 3HYHA 4MNFA 3LQ8A 3U6HA 3ROCA 2CNQA 3H4JA 4IJPA 2NO3A 3PIXA 2C6LA 5IA1A 1J1BA 2WB8A 3GI3A 2UW5A 3B2TA 1WBSA 2R3LA 2OIQA 3PXQA 5BPYA 3HZTA 4BGQA 3JVRA 1URCA 4QMMA 2HXLA 2XBAA 4L7SA 4BDDA 4E5WA 3UC3A 4RFMA 3PJ3A 5JGAA 1P2AA 3K2LA 3V04A 4EWQA 1PXIA 4A06A 4PV0A 2W9ZB 5AP6A 4EH4A 5A4CA 2R2PA 2X8EA 2Y7JA 1W8CA 5ANOA 3V5PA 1ND4A 2WZJA 1ZWSA 3GU5A 4XV2A 2GQRA 4P4CA 4QMPA 4C34A 4C8BA 3RBWA 1TVOA 2AUHA 2YN8A 2JFMA 3EFJA 4GG7A 4GG5A 4JBVA 4L68A 2IN6A 3FHRA 4FR4A 4G3EA 3DBDA 3EZRA 1GZ8A 4YLLA 4Z3VA 4ZEGA 5AAGA 2OG8A 3L1SA 4EK3A 2X2MA 1E1XA 3FYKX 3MGYA 1REJA 4BHNA 2GFCA 2V7OA 3FZPA 4X6RA 3FEGA 3RK7A 2PMNX 4BDEA 2QQ7A 4I5PA 5I3RA 3ZO2A 2W05A 4C4IA 2B7AA 3GFWA 3AD4A 4ACHA 2PSQA 3EKKA 4L46A 3TACA 5K4IA 4ZSGA 3HUBA 4O0WA 3EQCA 1MQBA 5FG8A 3P7CA 2CPKE 4FNYA 2B4SB 3DTWA 4S31A 4HCVA 3KXZA 5ANEA 2CLXA 1RW8A 3UYTA 3EQHA 2R7IA 3QKMA 4ANNA 4BZOA 3BYSA 5KCVA 3AMYA 2PUUA 5LWNA 3H0ZA 5IQAA 3Q9ZA 1KE6A 1UKHA 1IA8A 2QOCA 1GIHA 4IBMA 3UNJA 1BLXA 4K9YA 1T46A 4XOYA 3UZPA 3ALOA 3MPMA 1Z57A 4IDVA 4FOCA 2DUVA 3G5DA 4BCJA 2ZYBA 3AC5A 2YZAA 4E4XA 1Q8WA 2BRBA 3R9DA 2JDTA 3UC4A 4DDGA 4F70A 3SRVA 3NIZA 4GRBA 2YCQA 2GTNA 1H1WA 3GC9A 1I44A 2W1EA 4BDKA 4I20A 3C4FA 4QP8A 4CV8A 4CTBA 3DDQA 4HVIA 2VTPA 2ZB1A 3NSZA 3EFWA 1Q8ZA 3UVPA 2JAMA 3Q2MA 4WA9A 5DFPA 4O96A 4Z55A 2C0OA 4BIEA 3I79A 3HV3A 3O8TA 4O0TA 4KKGA 4P7EA 3UE4A 4DEEA 4YMJA 5HU9A 5M4FA 3R2YA 4FKWA 5LQFA 3JS2A 4QYFA 3NFGB 5DYJA 2Q0BA 3HUCA 4F9BA 2WTDA 4TKSA 5HOAA 3BL7A 5CASA 4FV5A 3AT2A 2XIRA 4ZS0A 2YEXA 4IXPA 5BVOA 5HTCA 3OS3A 2HK5A 3MJ2A 3WYYA 2IW9A 1PHKA 2RFNA 1W82A 4IACA 4IQ6A 3QHWA 3W2SA 2XEYA 4AOJA 1OGYA 3AQVA 3NAYA 4OT6A 5FTGA 4ASEA 3GOPA 3WBLA 3D94A 2GPHA 4JQEA 4O7YA 4BCOA 4W9WA 4NCTC 3DNEA 4CLJA 1HCLA 2QONA 4RLKA 2C5YA 3E3PA 3KU2A 4FSYA 4NWMA 4PL3A 2C1BA 5CANA 3DXPA 1SZMA 3O7LB 5C4KA 5EQYA 5KBQA 3DKFA 1O6LA 1Y8YA 3FLYA 4HZSA 4L6QA 4NCTA 2OF4A 4ACCA 3DB6A 4USDA 4CD0A 5DNRA 5CZIA 4J97A 5EI8A 4TRLA 5FEQA 4EOSA 4F0FA 3FMKA 2WNTA 3BRBA 3R7GA 4FKUA 4HVDA 2BVAA 4PPCA 3BEGA 1M2PA 2XIXA 3PY0A 5AAEA 3UOJA 5B2KA 3ZBFA 2PWLA 3W0NA 2ITUA 3ORIA 3HMPA 3MA3A 4O22A 3RHXA 2Y6MA 2GQSA 3TZMA 4JQ7A 3SG9A 1XH8A 3PSBA 3W2OA 3FI3A 2ZDUA 3FUPA 3BYOA 4IB0A 4RJ4A 4UB7A 3ORMA 4NIFA 4K2RA 2RFEA 4MH7A 2LGCA 4X21A 1PXJA 1VYZA 2QI8A 4G2FA 4L00A 3T3UA 2VD5A 3LXKA 4PUZA 2WQNA