3C4CA

B-raf kinase in complex with plx4720
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
275
structure length
258
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Discovery of a selective inhibitor of oncogenic B-Raf kinase with potent antimelanoma activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 258
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c4cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c4cA01
4YGAA 3PY3A 4RQKA 2W1GA 3DKOA 4UYNA 2JDTA 4JQ8A 4G1WA 2R7BA 4CTCA 2ZV8A 2OFVA 1QPEA 4C3RA 2YDIA 2AC5A 1LEWA 4PDSA 4O6LA 3AQVA 3KRRA 3ZXTA 2PY3A 2BVAA 4YNEA 3C9WA 4O0RA 3UNZA 3B8RA 5HOAA 1H08A 4GFOA 1Y91A 2JC6A 2YZLA 4S2ZA 1A9UA 4HW7A 4EOOA 4FICA 4J95A 3WZEA 3DB8A 4QP9A 5IDNA 4RLKA 3CPCA 5EW9A 1OKWA 4LOOA 3QC9A 3QALE 3MFRA 5FP5A 4EQUA 1BI7A 2XK8A 3GCSA 3BHHA 4S33A 1GZOA 1YOJA 4ZY5A 4MNEA 2WIHA 3P7CA 3CJFA 2J5EA 1KE8A 1KUTA 2CNUA 2ITUA 3GC8A 3MH3A 4I6BA 2OJGA 4XP0A 4AU8A 4EEVA 2ZV9A 5KMLA 3W1FA 4C4GA 4E5AX 2GCDA 3EZRA 4FIIA 4ASZA 4Y73A 4F6SA 2VX3A 2XK6A 4RGJA 4BTMA 5G1XA 4DYMA 2OSCA 4F9WA 5DGZA 3R7VA 1GIIA 3HYHA 4FT9A 2VWUA 4QP2A 4NKSA 4IVDA 2JAMA 4KABA 4QQJA 4DHFA 3NUPA 4M12A 2CGXA 3FKLA 4QP1A 4W9XA 2ITQA 3ZO4A 4BKZA 3TUDA 3BZ3A 1OIQA 3SQQA 1CSNA 4AF3A 4IFGA 4IC8A 4DG2E 3F2NA 4EOPA 4NFNA 5CVFA 4D28A 4O0WA 3PXFA 4KKEA 3A7JA 3HGKA 3CQWA 2J0JA 2PMNX 4BKYA 4BCMA 4C38A 4D1XA 5I0BA 2J50A 4FSTA 1YHVA 4C57A 2ZM3A 3BYUA 1GZ8A 2QODA 2IPXA 2FH9A 2R3LA 3MVJA 4R3RA 5J5TA 4O7WA 2WELA 2VO7A 5IMEA 2XF0A 3ZU7A 4LRMA 5C8KA 4RFZA 1ERKA 4FSUA 3ZC6A 2X81A 5I9VA 3EQHA 2P2HA 4FV9A 1RW8A 3I7CA 4FZ7A 5CTPA 3QD3A 4G34A 3R7EA 3BEGA 3ZXZA 4FV8A 4AXAA 4F09A 4FTOA 1UNGA 3FSKA 4HCUA 4EHGA 1PJKA 4F4PA 4RWLA 5DLSA 4MQ1A 3HUBA 4HCVA 4IVCA 3UMWA 4GUBA 4C2VA 4EBVA 5C8NA 3FMKA 4YZ9A 4D5HA 4DT8A 1UU8A 4FTMA 3IG7A 5L2SA 3MJ1A 3QTUA 4J97A 2YLFA 5HEZA 4BKJA 5CAVA 5IA3A 5D7AA 3ZDIA 2W1EA 5AA8A 4FVPA 5IDPA 5JFVA 4GU9A 4MCVA 4YPSA 4AW0A 4EOIA 4PDPA 2Q83A 2ZB1A 1BYGA 4ERKA 4C33A 4CKRA 2X8IA 2FSTX 1FBNA 3A7IA 3NVKI 4O1PA 4L42A 4C8BA 3GGFA 4GFMA 2QG7A 1TQIA 5K9IA 5KE0A 3R21A 5CT7A 3V5LA 3CP9A 3KL8A 3L8VA 4KIPA 4EYMA 3U54A 2P0CA 4I5HA 4MTAA 3FZPA 4FEUA 2BDFA 4DBXA 3RPSA 4FOBA 3RPVA 2P3GX 3MH0A 3ZM4A 2UW8A 3VJOA 4Y72A 4AE6A 1YXSA 4A07A 3CD3A 5G6VA 1PYXA 3TIZA 3H9RA 5JH6A 4MH7A 3V3VA 4FT7A 2C30A 1IAHA 1FQ1B 4QPAA 4OLIA 4ZEGA 3C4FA 4K1BA 4FZ6A 4PDYA 3BE2A 5HLNA 3SLSA 4D4RA 4QYYA 3HP2A 3LFDA 4IFCA 1J7UA 3PWDA 5DR2A 4NIFA 4Q2AA 3O7LD 1OL1A 3DB6A 2C6EA 5LVOA 3BKBA 3FHIA 3GQIA 3FQSA 1QMZA 1HCKA 4JIKA 4XP2A 3RCJA 3SXSA 3MTLA 1GIJA 3MYGA 2ITYA 1ZZ2A 3LXKA 4D2PA 1K3AA 4CMOA 4XRJA 1OZ1A 4M8TA 5TT7A 2WMWA 3B8QA 5HNIX 3DK7A 3LFFA 3SV0A 3MFSA 4WUNA 5EDQA 3V6RA 1JSTA 1PXPA 2F7ZE 3M11A 3HECA 3Q6UA 1Q8WA 4I20A 5BYLA 3EL8A 3VUTA 5KUPA 4FV5A 5E8ZA 3ZYAA 4QP7A 3HDMA 2XUUA 2ITOA 4LOQA 4C35A 5ETAA 4NT4A 2J0LA 3FLZA 3HMIA 3IW5A 3EHAA 4EH2A 1ZLTA 2PHKA 2VTSA 4ACGA 5DBXA 4F9CA 4L8MA 4EH3A 2GNJA 4O0XA 5IQDA 2WU6A 5HBJA 4RJ5A 3EIDA 2BZIB 4M84A 3EYHA 4IX5A 2C6KA 3UOLA 3ORNA 4ZTQA 3HV6A 4G3DA 5CALA 1XBAA 4XJ0A 4YURA 4R5SA 4TY1A 3PLAE 1G8AA 2O2UA 1MQBA 1ZZLA 2YAAA 2WEIA 4FBXA 4JDKA 4WIHA 4C4JA 3FXWA 2R3JA 3QX4A 3RINA 4BTFA 3LLAA 3VUIA 4QTBA 2QOIA 3HMOA 4NW6A 4BCNA 2H96A 4YLKA 3WF6A 1J1BA 1Y6AA 3R71A 4ZZMA 2LGCA 3Q4TA 5CF8A 5LMKA 4BF2A 2FUMA 4FOCA 3DAKA 5TR6A 5FUTA 1H1SA 2XA4A 5FTOA 3KRWA 5IA4A 1YI6A 4KSQA 2UZWE 2XRUA 4K2RA 3LM5A 4G6LA 3RPRA 5A46A 4EC9A 2YM8A 5K4JA 2F57A 2HELA 3E88A 5EM7A 4AW1A 3AC2A 3W8LA 3TUCA 2H6DA 3FQEA 3R22A 3VS1A 1WBOA 4YR8A 4FTCA 3PTGA 4YLJA 3ETAA 3KVXA 3W10A 4CLJA 1PMEA 4R3PA 1H1PA 5EDPA 5M09A 3F3UA 3ZCLA 4HGSA 5HE3A 3L9LA 2W1ZA 3WARA 1SNUA 4GK3A 4PL4A 3B2TA 2QOKA 3C4EA 4ZLZA 3LKMA 5IQEA 3K54A 1KV1A 3PXRA 4EJNA 5AM7A 4PMSA 1NXKA 1OMWA 5K0XA 5HE0A 4CG8A 2IVSA 5FD2A 5A4EA 2W06A 1H07A 4RSSA 4DGGA 4TWNA 4U6RA 2J5FA 5T3QA 4IZ7A 4GVAA 4IHPA 4LUDA 5E8WA 3VBTA 3NUNA 3I6WA 3LFNA 4F7SA 2WFYA 3DLZA 1XH8A 3P0MA 1HOWA 4I41A 4R7IA 4BTJA 4D4SA 1Q3WA 5E1EA 3TWJA 4DG0E 2ITNA 3ROYA 5TOZA 4D0WA 4IAYA 1V0PA 2VTAA 4FVRA 2C0IA 4XRLA 2CKOA 3UIMA 1URCA 4XG3A 5AV2A 3CXWA 3F6XA 4ZTHA 5HIBA 4F0IA 2JKKA 4TYEA 4YMJA 2Z8CA 5J1VA 2J2IB 3LCSA 4OAUC 2PK9A 4ZS4A 3BWJA 4XG2A 2YAKA 3PSCA 3GENA 2OJ9A 2XS0A 4DFYA 2NO3A 2EXMA 3QC4A 3V5QA 4NM5A 4AE9A 5LMBA 2PUNA 2ETMA 4YJVA 2FVDA 1R0EA 3QTWA 5CEOA 2PVMA 4BDFA 5HX8A 2Y9QA 5IA2A 4Q9SA 2W17A 2VUWA 5CZHA 3HMNA 4GYGA 5AV4A 3RI1A 2WTWA 3DCVA 4FSWA 4WT6A 3HV5A 1OPKA 4IJ9A 3RNYA 4XMOA 3FJQE 3GOPA 3QA8A 2PUPA 1OBGA 3EKNA 2PTKA 5LCKA 4O0UA 3UG1A 1F0QA 4HVDA 2XK3A 4F1OA 4ALVA 2HCKA 2ITXA 4KWPA 3ZS5A 3R8PA 4A9TA 3WZJA 3DBEA 5CF4A 5CT0A 5KMIA 3R8LA 2RL5A 5CZIA 4XV3A 3I5NA 3ZC5A 5DI1A 3FMJA 4OTFA 4FODA 4TN6A 3E93A 5JRQA 4OGRA 4GMYA 2XIKA 4YZMA 4GT4A 5L8KA 3E8DA 3HKOA 5LVMA 2QOOA 4BB4A 2WXVA 3KXZA 5AR3A 5A4QA 5E8XA 3G90X 4ZP5A 5HVKA 2HIWA 4DEIA 2VWVA 3OWLA 3F5GA 2X2KA 2BROA 3RTPA 3UJGA 4J71A 1E9HA 3I7BA 1ZYJA 1K2PA 4LRJA 1YXUA 2R3MA 3FXXA 3IGOA 3ID6C 3S2PA 5HTIA 5M4UA 4WD5A 4CEGA 3QD4A 5CQUA 3KGAA 2Z7RA 5FDPA 2IVVA 5ANEA 2XKCA 2UZBA 5J7HA 4RX9A 5J9LA 4O1OA 2VTPA 4FEQA 4XG8A 2EUFB 3ZM9A 4X2GA 1MP8A 2F2CB 3OY3A 5F20A 4KD1A 2NPQA 4O81A 1OKVA 3OVVA 3QQUA 4JR7A 4AZWA 4NEUA 3DQWA 4WHZA 3NCZA 3UNKA 4R77A 2XKEA 2GPHA 4BRXA 2C69A 1OL5A 3F69A 3UQCA 5TE0A 5AR2A 4GKIA 4C3FA 2G01A 2W05A 3LOKA 2C68A 2VGPA 4RVKA 4Z7HA 3PVUA 4Z7GA 2VTIA 5DA3A 3HRBA 4O7VA 4E4MA 4OTRA 2EB2A 2YIRA 5CU4A 5TKDA 3PUPA 3MBLA 4CYJA 3DNEA 3LCKA 4QQ5A 5GZ8A 4FSMA 3QX2A 3DXPA 4L43A 1UU7A 2WQMA 4OBPA 5DEWA 4E26A 3IO7A 3K2LA 5AP4A 2X2LA 3GC9A 3O2MA 4XBRA 3KFAA 4L7SA 3GU4A 3UP7A 1NA7A 2GTMA 4BZDA 1FVTA 1BI8A 3EQBA 5KMNA 5IQIA 4GK2A 3OCGA 2ITTA 2EVAA 2Y0AA 4IB0A 3G9NA 3NSZA 4NKAA 3UG2A 3D15A 5DT0A 3U9NA 4AS0A 2PVLA 3UODA 2NP8A 1OKZA 1VYWA 1Y8GA 3F5XA 4FKSA 4YZCA 5EHYA 4IX6A 3IDPA 5JQ5A 4X2JA 3R9DA 3LJ0A 5E90A 3SW4A 3I81A 4EH8A 4FEWA 2WOTA 1H28A 5DH3A 4ZIMA 2VZ6A 3ZSHA 2X7FA 5KMMA 1M52A 4F08A 3BPRA 4BCOA 5I3OA 4E73A 4MX9A 1CMKE 2VTQA 2XKDA 2QOQA 4J99A 4OBQA 3R2YA 3N4UA 1WFCA 1EH4A 5IEVA 1ND4A 4HGTA 5H3QA 2J4ZA 3I60A 5DMZA 3RK7A 3EQIA 3BRBA 2Y4PA 3ZHPC 1BL6A 4USDA 1GAGA 4AZSA 3NGAA 3CD8A 2XEYA 2PYWA 4D1ZA 2ETKA 3QTSA 4PNIA 4UMRA 3TZ7A 4QPMA 2X0GA 4F1TA 1OVEA 3UGCA 5AR8A 2WMBA 4YJTA 3EJ1A 2UZLA 4YTCA 1BX6A 4YC3A 3F7WA 3QZHA 4LRKA 1B39A 3UQFA 3VJNA 4YC8A 3ANRA 2H34A 3W55A 2IW8A 4FV4A 1LUFA 3TKIA 5JMSA 5KO1A 3RALA 2VU3A 5JT2A 5IEYA 2OZAA 3S0OA 4AOTA 3SRVA 3Q5ZA 4O0TA 5FXSA 3VBWA 3ZZEA 4O7RA 3FI4A 4BIBA 1LR4A 3MA3A 3MS9A 1O6YA 4MKCA 4E6DA 3U6JA 4U9AA 2YDJA 3VF9A 2HW7A 5BMMA 3EFJA 2V0DA 3POZA 4USEA 1Q8TA 1U59A 3NNUA 4FSRA 4AN9A 3K3IA 1XKKA 3LXLA 4FV2A 5AUTA 5CLPA 2SRCA 2VD5A 2C0TA 1YDTE 3CC6A 2YM3A 2GU8A 3O96A 3HV7A 3NYNA 3QQGA 3R04A 4BGGA 2X6DA 4H3QA 3R0TA 3ZTXA 4DF3A 3QD0A 2BDJA 4G3CA 1CM8A 3G6HA 2WMSA 3TKUA 2HY0A 3E63A 3C50A 3FYKX 4FK6A 3ANQA 4GT5A 3AC8A 5EFQA 3UPXA 5AV3A 2R64A 3W18A 4RJ3A 4OT5A 2HZIA 1VEBA 3IW6A 4B6LA 2OFUA 3LW0A 3TM0A 2RFSA 3MY1A 5HNGA 4FTQA 1H0VA 3GFWA 5HNBA 1DI8A 4L52A 1CKIA 1FPUA 4JX7A 5AR7A 2ZJWA 4BCIA 4KIOA 4TWPA 3UIUA 4EOKA 5J7BA 3QQHA 4IAZA 2QI8A 4CQEA 2WHBA 5EI8A 5C03A 5JN2A 4BBEA 2Z7QA 4DEBA 2QO9A 3LAUA 4M3QA 4YNOA 5BVWA 2FGIA 2WMAA 4AOJA 4X2KA 5ANOA 3ZH8A 5LWNA 3I0OA 5H8BA 4FTAA 3ATSA 4L9IA 4U45A 2CNVA 4MXXA 1R78A 3O51A 2VNYA 2XM9A 4ENXA 5EOBA 5M55A 2R3FA 3IONA 4WNMA 4I0RA 4H1MA 4CKJA 2X4FA 4LM5A 3HAVA 1U54A 4WBBB 4AGWA 3HEGA 3NEWA 3P79A 3TUBA 3KXGA 4G9RA 3HUCA 4GJ2A 4FGRA 3ZEWA 2E9UA 2ITPA 2J9MA 3H10A 4O0YA 3KK8A 4RA4A 1YXXA 2VWWA 1FVVA 3D4QA 2YM6A 3LFEA 4U40A 5TO8A 4BDHA 3HV4A 3UPZA 3E8NA 3G2FA 4NWMA 5CNOA 2XNGA 4NM7A 4AOIA 5IH5A 3LFSA 4FSZA 4BL1A 4J7BA 2OK1A 4AZEA 4JI9A 2OJJA 3KXHA 3T9TA 4EK5A 3S1HA 5B2LA 5M53A 4Q5HA 4HYIA 4KKGA 3EKKA 3RAWA 2VTMA 3R9RA 4WNPA 4FUYA 2ZV7A 2YACA 4CT1A 5IISA 5D12A 5IQHA 3FMLA 4JRNA 3LXNA 2BUJA 3ZFXA 5IH4A 2WTDA 1RDQE 4BIEA 5FRIA 3R8UA 4BWPA 4MK0A 3NIEA 1W98A 4BDDA 3OZ6A 3TJCA 3CR0A 1VYZA 4HYUA 3QXPA 5AM6A 5B0XA 4PTCA 1Y6BA 1X8BA 4D2RA 3NLBA 4NM0A 4A9UA 2BRGA 1UU3A 5AA9A 2GHLA 5AP5A 5K4IA 3EZVA 5EH0A 2QCSA 3AT4A 4WG5A 2OIBA 4J96A 4IB5A 3LMIA 2UZTA 4GK4A 2V7AA 3PSDA 3DKCA 3E92A 4DT9A 3KB7A 4HVIA 1R3CA 1XH6A 1YXTA 2PVFA 2YFXA 4LGGA 3U4UA 4U3YA 2A0CX 3GCUA 3E5AA 5AJQA 3P23A 4OTWA 4A4XA 4H3PA 4CQGA 2UW5A 1B38A 3W2QA 4AZFA 1WBSA 2AUHA 1PW2A 2O3PA 3BHTA 3DK6A 5M51A 5LVNA 5DYJA 5M57A 5DIAA 1KE7A 5HCZA 5IU2A 2W7XA 3AD5A 3FC2A 3HA8A 4QYEA 3E87A 3FMNA 3GT8A 3OEZA 4EWQA 1Q24A 4DTBA 2WNTA 2GHGA 3UVRA 3LFAA 2PU8A 4FTRA 1ZYSA 3PG3A 3S3IA 4C2WA 4IACA 3EN9A 3M2WA 4EOMA 3MJ2A 5HO8A 3H4JA 4K77A 2E2BA 4UWYA 3KC3A 1R39A 2DYLA 1A48A 4FR4A 4PDOA 4MNFA 5AUYA 3EQFA 4BGQA 4GG7A 1J91A 1LP4A 3QHRA 4KRCA 5M44A 4O7YA 4M69A 4NK9A 3TI1A 4JIAA 4HNIA 1BL7A 3Q96A 4EH5A 1ZAOA 2QU5A 5FEQA 3FZOA 3C5UA 2XNNA 3FZ1A 3VN9A 3ORXA 1JVPP 4ZSLA 2PVYA 3UC4A 5CAQA 1NW1A 1UKIA 4AFJA 4XBUA 3ZEPA 1FOTA 5BVKA 3RNIA 3O8TA 3R00A 2UW6A 1YKRA 1YOLA 3OFMA 2P55A 5BVDA 4MNEB 3ZLXA 1H00A 4GCJA 2PVJA 2ZVAA 2RF9A 4DTKA 3OBGA 3QTIA 4FC0A 4UXLA 2E9PA 4C36A 4G3EA 2JLDA 2J7TA 5KZIA 3ZLWA 4ANMA 2QHNA 3M1SA 2W4JA 5CX9A 5ACKA 4A7CA 3COKA 3QXOA 3NNXA 3ZRKA 2W1DA 3Q4UA 1DM2A 1UKHA 4QPSA 4C4IA 3ORIA 4D55A 3C4ZA 4ID7A 3CKXA 4X6RA 4D4VA 3BE9A 4Q9ZA 2VTOA 5ACBC 5AFVA 4C37A 3MWUA 3HLLA 3EQPA 2BMCA 1OKYA 2HYYA 5J9ZA 3PPZA 3QBNA 4S32A 2CKQA 4ZSEA 3PA3A 4F70A 5AAGA 4WRSA 1JKSA 3OXIA 3FUPA 4QMYA 3ZUUA 4HZRA 5C9CA 3HDNA 3L8SA 4P4CA 2IZTA 3CY2A 4OUCA 3IW8A 4DFNA 4C4HA 3C1XA 2PE2A 4CGAA 2HZ0A 2W96B 4UY9A 3TIYA 3FMMA 5E9EA 4O22A 2J6MA 4YUQA 4FT0A 4G5PA 1JSUA 2XYNA 5IF1A 3R1QA 2VN9A 3IPHA 3NMUF 5CF5A 4ZMEA 2PVNA 1V0OA 4QMMA 2O64A 2QHMA 3KCKA 4WOVA 3EOCA 3QRKA 5GZ9A 4CD0A 1WZYA 2F49A 5CAOA 1OPJA 3BBWA 3GC0A 4HGEA 4I93A 4IWQA 4NSTA 2CCIA 2WQNA 4IVAA 4OR5A 3VS3A 4BCGA 5IQCA 4BCPA 2XIZA 3QTQA 1SVHA 4OTIA 5DT3A 4BHZA 1YWNA 5H9BA 1YWVA 3W33A 4Q5EA 2OG8A 2X8EA 3KF4A 3QRIA 2RSVA 4L7FA 4XP3A 3KMUA 3A61A 5J95A 4QP6A 2FSOX 3G0EA 5L2QA 1KE6A 1WMKA 2ACXA 2X39A 1O9UA 4JVGA 2Y8OA 2GQSA 3EQCA 5EM6A 4IWPA 5CEIA 4NUSA 4F63A 5HO7A 4D2WA 4TL0A 2WGJA 4B9DA 4F0FA 1WBPA 1H0WA 4IMYA 4YC6A 3CEKA 3SC1A 3PE2A 3BU5A 3JS2A 2E9NA 3TTIA 5DHJA 2C4GA 2YITA 3DKFA 3QUEA 4E1ZA 2BIKB 3LHJA 5L6PA 4EBWA 2VTRA 3CGOA 3ZONA 3G5DA 4AN3A 4JR3A 5FLFA 3LFQA 2E9OA 2PZYA 3D2IA 4DFUA 3P5KA 4RC3A 4JQEA 5CI7A 5CS6A 2QR7A 2I0EA 3D83A 5B7VA 1IG1A 4RJ8A 4BDAA 4XV9A 4DGNA 4IB1A 4RIWA 3DTWA 3VIDA 4QMQA 3H0YA 3KULB 3O23A 2I7QA 3OS3A 4F9BA 3FLNC 2QOHA 3BBTB 4JX3A 4I1ZA 3A8XA 3NAYA 3U4WA 4NZWB 3PP0A 4O96A 4DE4A 4FE2A 1P5EA 1OECA 2HWOA 3MSSA 3BHUA 5AV1A 2UZVA 4J53A 1ATPE 3DLSA 3F5PA 3NW6A 2WMRA 3A7FA 3PPJA 1H1RA 2FYSA 2OJFE 3PZEA 2OWBA 2HW6A 1O6KA 4BWXA 3IKAA 3PVGA 4MXAA 4W9WA 2WEVA 4MXOA 4Y95A 3F66A 3JYAA 4AFEA 3PLSA 3LVPA 4FV3A 5AP0A 5HBHA 4QTEA 4YZNA 5CXZA 2QOFA 1PXIA 2QVSE 3O8PA 3TDVA 3VS7A 2YJSA 2BKKA 3SG8A 4RA5A 4BWKA 3Q6WA 1K9AA 3FAAA 3U6IA 4FKVA 4TYHB 4DFBA 4N4SA 3F82A 2PSQA 4IZAA 5E92A 5FEDA 2JKOA 3WBLA 2KTYA 4P90A 3FDNA 4QD6A 4YJPA 4LGHA 5AIKA 3NRMA 2BIYA 4GRBA 4Y46A 4DH7A 2R9SA 4FYOA 3MN3A 2PVRA 2HY81 4O21A 3V5PA 3MTFA 4NCTC 3D5XA 5AX3A 1G3NA 1W7HA 3DBQA 4RX8A 2XM8A 4AA0A 4DH8A 5AAEA 4ORKA 4PMMA 3COIA 3ULIA 4APPA 3TNHA 2ZM4A 1PMNA 2W1FA 3LM0A 4W8DA 2BFXA 3QUPA 3K3JA 2GS2A 3U6HA 3D2KA 3ITZA 4C0TA 4Z55A 4L6QA 4FNWA 5ETCA 3OC1A 5AADA 3F88A 3UC3A 4DGMA 1WVWA 4XG9A 3IOKA 4QNAA 2OJIA 2RKUA 1M2PA 2YDKA 3QQFA 5K3YA 3MW1A 4IJPA 4RIOA 5KMKA 5L2TA 2W9FB 4YJQA 5A4CA 3NWWA 5M4FA 3ZOSA 3W2SA 3ZBFA 5CEKA 3S95A 1KWPA 4CV8A 4BDBA 3DT1A 5E4HA 3FI3A 3GCQA 2CLQA 3LJ2A 4P2KA 5CI6A 1VZOA 4YU2A 4TXCA 1JKLA 3PJ3A 5J1WA 3C51A 5CASA 3T9IA 4FMQA 2GFSA 4RT7A 4UWBA 4CFVA 3ZO2A 3W32A 4EH7A 5CEPA 5LVLA 5IEXA 3N4TA 2QOLA 4IH8A 4U3ZA 4B8LA 5HVJA 4FVQA 4JL9A 2WTVA 3EN4A 3VUMA 1UNLA 3UO5A 4QRCA 3UDBA 4FTJA 3RPOA 3ODZX 2UZOA 3TG1A 4EORA 5I9UA 2OIDA 3BGZA 2WOUA 4PL3A 5HORA 4C7TA 4V01A 4WG4A 5L8LA 4J98A 4DA5A 1XHAA 5IH6A 3SOCA 2R3NA 4X2FA 5HQ0A 3F9NA 2YCSA 2YIXA 1DAYA 3VBXA 3D94A 3AGLA 2A2AA 4ACHA 3LIJA 1Q41A 1BLXA 4RC4A 1RQQA 1YVJA 3UO4A 4CCBA 2YERA 3B2WA 3BGPA 4ITJA 4RFMA 5GHVA 5I9XA 3Q2JA 3BI6A 3NNVA 4IX4A 2UZNA 5EOLA 3VQHA 4QTAA 2VO3A 3PA4A 4IWOA 3SX9A 4KBKA 5CF6A 3DU8A 2HAKA 1ZYCA 3NNWA 4U81A 4N57A 2ZAZA 4V04A 1XJDA 5EDRA 2UVYA 4FL1A 4ZSJA 2W0JA 4V0GA 3LE6A 4QYHA 5F9EA 2ONLC 3ORMA 4JT3A 4RMZA 4C3PA 2CHLA 1CKJA 4J8NA 3Q9WA 3SA0A 2IVUA 4RBLA 4F9AA 1XBBA 2FSLX 1MRVA 4GSBA 3GUBA 3GU8A 2GS6A 4KNBA 4AGUA 4EK3A 3QWKA 4PX6A 1H01A 2ZB0A 3PXQA 2CN5A 4FSQA 2Y4IC 4BFMA 2BFYA 4ZJJA 3KXNA 5ETIA 5HZNA 4KS8A 2ZMDA 3CQUA 3GC7A 4MBJA 1YDRE 1Z9XA 2R3IA 3DNDA 3UYSA 3FEGA 5FP6A 3DZQA 3CQEA 3CPBA 3FKNA 1ZYLA 1VR2A 2O65A 3BWFA 5LXMA 4OAVB 1YXVA 4BCFA 3R1SA 2WZJA 1ZOGA 4D2VA 4OT6A 5CAUA 4ZOGA 4AZTA 3GBZA 2W1HA 4PMTA 4S30A 1ZY4A 4I6HA 2GNHA 3DOGA 3RZBA 3F61A 4KUJA 2VTJA 3KRJA 2BILB 5AX9A 2HZNA 4FNYA 3F5UA 3IGGA 3CE3A 5L3AA 4CFWA 3BU3A 4PV0A 3LXPA 3D7TB 4ALUA 4DEHA 3Q2MA 1XO2B 4I4EA 4O7LA 4AACA 5JEBA 3OT3A 3MGYA 4BI2A 3DBCA 2IN6A 4FG8A 5EM8A 2XNBA 5ANKA 2X2MA 4WBOA 5A6NA 4BIDA 3F7ZA 4RPVA 1PXNA 3EQGA 2J0KA 3R1NA 4NTTA 4FT3A 3ACJA 2XJ1A 3AC5A 3ENMA 1URWA 3KVWA 2BALA 5LCJA 1DS5A 1Q61A 3ET7A 3F2AA 2XJ0A 1WAKA 1UWHA 4L68A 5AMNA 1OL2A 4WNKA 4CKIA 4S31A 4IB3A 4KS7A 4KINA 3WZDA 5F94A 2WQEA 2JDRA 1U5RA 2XB7A 3F2RA 4CFNA 3AC4A 4CFMA 4KIKA 1DI9A 2XNMA 1CDKA 1OITA 3DFAA 3HRFA 3LLTA 3PXYA 4QYFA 4L67A 3RZFA 3SGCA 2QONA 3NZ0A 4B99A 3D9VA 4WUAA 3ZFYA 4BVUA 2RFNA 2CCHA 2C6IA 4X6QC 4Y83A 1M2RA 5D1JA 2OXYA 3V01A 2G2FA 2BRHA 3PA5A 3BELA 3QGWA 4GEOA 4C02A 3TXOA 1L3RE 3I4BA 3AD4A 5E8UA 3OMVA 2VO0A 4FKWA 5TF9A 4FL3A 3TACA 3GCPA 4A9RA 4X3JA 3SOAA 2OI4X 2XBAA 3NUXA 3DXQA 3C0IA 5C27A 3SKCA 3NUSA 3OT8A 3DBFA 4UALA 4CT2A 2VTNA 4IIRA 3ZSIA 3ZRMA 5HICA 3BHVA 3EN6A 4FZFB 2W5AA 4WSQA 3GCVA 3TV7A 2X7OA 4AGCA 3BYMA 2BR1A 4M0YA 3AMYA 2WTKC 3BEAA 3UYTA 3NUYA 5A54A 4FTUA 4M0ZA 4JRVA 3DQXA 1PMVA 2FO0A 5DVRA 4RJ4A 5FXQA 4PWNA 5HVYA 4CLIA 5JZNA 3GFEA 3V8WA 2B0QA 4W4VA 1OM1A 3KMMA 5AP6A 2VAGA 4CG9A 4Y85A 4EUUA 3DPKA 4YTIA 2YCRA 3RMFA 2NNWB 2VTHA 2XCHA 4BCKA 4J52A 4IM2A 3UO6A 2BTRA 4FIFA 4QTDA 2B9FA 4MWIA 4YBKA 2VGOA 5KCVA 2WPAA 2ZOQA 5JFSA 3A7GA 4JBQA 5BVEA 5BYYA 3N4VA 2P2IA 2C1AA 3LZBA 4FKIA 3DA6A 3A60A 3GU6A 4PQNA 4I4FA 3BCEA 3PY0A 4ZJIA 2WMTA 1B6CB 4I5PA 5CQWA 4CNHA 3A4OX 3OWPA 1QPCA 2DWBA 2XNOA 4FIGA 5DNRA 2VO6A 3UOJA 2I6LA 5JGBA 5HE1A 5AAFA 2XYUA 3Q52A 5LVPA 2BTSA 2Z7SA 5CSXA 4LOPA 3W2OA 4BN1A 4I22A 4P5ZA 5L6OA 1BKXA 2XK4A 2W4KA 3CTJA 4ANBA 1YDSE 3QRUA 3R6XA 3RWPA 5BX0A 2B52A 3FLWA 4R7HA 3L8XA 4BYIA 3WYYA 2HWPA 4UXQA 5CSVA 4DFZE 4E5BA 2JKQA 3NUAA 1LEZA 4OTGA 4F99A 1FINA 3P7AA 4K33A 2BRBA 1IAJA 3O0GA 2QNJA 4BBMA 2QOBA 4ZTSA 4OW8A 4IANA 5JQ8A 2C6MA 4MD9E 4FG9A 4PP7A 3OWJA 4MD7E 1OL6A 5CWZA 3CTHA 3NR9A 4P5QA 2JFLA 4NJDA 2UUEA 4ZTNA 3ELJA 2B1PA 1GJOA 3UVPA 4D9TA 4XLIA 5A9UA 2I40A 3C13A 5LWMA 2YEXA 3FY2A 1WCCA 2PE1A 2BDWA 3GNIB 1AGWA 1PXMA 3DY7A 4XUFA 3GB2A 3VBVA 4BHNA 4DC2A 2OU7A 4U42A 4PMPA 5FEEA 5KMOA 1JAMA 1OBDA 4NFMA 3TKHA 4EWHA 3GP0A 2QU6A 1UNHA 4KSPA 2ZV2A 3PZHA 2C6OA 4RIXA 2BZKB 1JPAA 4JG8A 5IA1A 4U7ZA 2UW0A 4MD8E 3VS6A 1KOBA 3BLQA 4FV7A 4BDJA 4CZTA 3TDWA 4PPAA 1IEPA 4DAWA 1A06A 3QQLA 4DH1A 3GOKA 3MVMA 1Q5KA 1M7QA 3F3WA 4TWCA 3GQLA 4M14A 5AR5A 3MPAA 3RJCA 1YI3A 4G16A 4LL0A 4UV0A 4YJSA 2XIXA 3WILA 3QCSA 1S9JA 1H4LA 2OKRA 4NU1A 3NIZA 3VO3A 4ASXA 1SZMA 3Q04A 1WBNA 2QLQA 3OWKA 5HG9A 5AP2A 3R8VA 2HENA 2Y4IB 4ZJVA 2C0OA 4XYFA 4TT7A 1SMHA 2OW3A 2Q0BA 5DT4A 1U54B 5HBEA 5A3XA 3KXMA 4U44A 4DCEA 3S00A 3SXRA 4FKTA 2XNEA 2PMLX 4FTKA 3I79A 5CXHA 1JQHA 4HYHA 3ZZWA 3QAME 1XBCA 3FLYA 2J0IA 3HMMA 3UQGA 5HD4A 2I0VA 2Z7LA 3N51A 5EI2A 3E8CA 2VWYA 3GU7A 3UP2A 4DH5A 4Z3VA 4NYEA 4I3ZA 4TRLA 4XV2A 3UNJA 4ITHA 3PRIA 4PPCA 4IWDA 1Q8UA 5IZFA 5HLPA 3FI8A 3KREA 3KRXA 3WF5A 2JKMA 5CSPA 2WMQA 5BVFA 3G15A 1ZYDA 3O8UA 2G9XA 3QQJA 4FX3A 4PUZA 2C5OA 1UV5A 2YLEA 4IBMA 4IE9A 4RIYB 5DWRA 4JDJA 2G15A 4B8MA 4CFUA 3MIAA 5HG7A 1Q8ZA 3F3VA 3FL4A 3FYJX 5F95A 4DEGA 4EC8A 3LQ3A 2CPKE 3FV8A 2E9VA 2JIVA 3TZ9A 3P78A 4R6VA 3HAMA 5AR4A 5D11A 3PE1A 5HO6A 1W8CA 1P4OA 3VF8A 2P33A 5GNKA 5KMJA 1WVXA 5DPVA 3AD6A 4ZLYA 5KHWA 4J8MA 5AP3A 3FLSA 3EQRA 4K0YA 1YHWA 2A4LA 5D41A 2V7OA 4EOSA 3FMHA 3G9LX 3PIZA 4MEDA 1OUYA 4O91A 3PJ1A 2JDVA 3P86A 2PMOX 3DKGA 3QLGA 4M67A 1OB3A 1W0XC 3ENHA 3OP5A 2C6LA 2IW9A 1H27A 5J87A 1P2AA 3NVMB 1P14A 1Q4LA 4K11A 3IW4A 3R73A 4JBOA 4UMTA 4H3BA 2JGZA 4QMNA 1OGUA 3RAHA 3EQDA 5AUZA 4CXAA 2OXDA 3VHEA 2YISA 3RGFA 3MIYA 5LQFA 4RWJA 3JR1A 3W16A 2QURA 2R4BA 3DZOA 4C59A 4FZDB 1WBTA 4G6OA 2C6DA 4DLIA 3E7OA 3L9NA 4I92A 4EH9A 3EFLA 4O0SA 4IXPA 4FTLA 3QTRA 3ZRLA 5JFWA 3AC1A 3MPTA 2X9FA 2J51A 4ZTLA 5I9YA 2CKEA 5H2UA 4IZ5A 3IECA 4ZLOA 5C26A 1DAWA 4RZVA 5DFPA 4BDGA 4E20A 5HIEA 3HZTA 2EXEA 2CGVA 3IQ7A 5C8MA 2R3RA 3QCQA 1I44A 4FIJA 3LCDA 2R3PA 4YZDA 2CNQA 1F5QA 4ANOA 2WTCA 3VAPA 3UBDA 5ANDA 3TNPC 3FPMA 3VNTA 2YWVA 3I1AA 4O84A 2WTKB 3RKBA 1VJYA 4AAAA 2YM4A 3QZFA 3MESA 5B2KA 2CDZA 4LV5A 4PPBA 3FBVA 2O8YA 5FG8A 3NW5A 4TYIA 4O6EA 5IQFA 4AGDA 3R02A 5BUJA 4QMSA 4IAIA 5AWMA 5CEQA 3WZKA 5HTCA 4PF4A 1QPDA 4BTKA 5J79A 3UE4A 3ORTA 4RVTA 5BQ0A 2XIRA 5HLWA 4TKSA 3OEFX 3KKVA 3MFUA 3RP9A 4APCA 1E1VA 2GNFA 5M07A 5EI6A 2CMWA 3DDPA 1FVRA 5JSMA 4UX9A 3KRLA 1REKA 3GEQA 4BY9E 4U8ZA 5LJJA 3ULZA 1JKTA 4BYJA 3PIYA 3VW6A 4EOJA 4ZS0A 5BPYA 2BRMA 2UV2A 3PXKA 5LMKC 2CSNA 4O7NA 2WU7A 2VTTA 4AT4A 4DEDA 3ALNA 4A4LA 2AC3A 4WO5A 4XG4A 4MAOA 3SD0A 5AEPA 3QYZA 2R3OA 2FA2A 2W4OA 5LARA 3KMWA 4UMQA 2G2IA 3DAJA 2O63A 4RQVA 4BZOA 5C01A 4JJRA 2WTJA 3Q4CA 4FTIA 3ZO1A 5E1SA 2XKFA 3NYVA 2I0HA 3U87A 4QNYA 2YWPA 1MRYA 2YIYA 2WO6A 4QMTA 1YRPA 4EJ7A 4YPDA 2R5TA 3R63A 4FNXA 4AQCA 4L3PA 4JDHA 2WTIA 4IX3A 4U79A 2WMUA 5AUVA 5H8GA 2PULA 2UW9A 1UU9A 4Z9LA 4YJNA 3OY1A 3H30A 5F1ZA 2A1AB 2V55A 3D0EA 4K9YA 3PJCA 4AP7A 4ASEA 4RG0A 5AUXA 4B0GA 4CTBA 2Y6MA 4FTTA 4QQCA 3RAKA 4XOYA 4I0SA 2OGVA 3ORKA 4KB8A 4YBJA 1MRUA 4FV1A 5AV0A 5HG5A 3WI6A 5M56A 4DG3E 1JOWB 3KA0A 4UYAA 2WIPA 4FEXA 4R3CA 3ZSGA 4C4FA 5M4IA 4RVMA 4R78A 3ERKA 3SG9A 1JWHA 2R3QA 4YJOA 3G6GA 4I5MA 1NY3A 4YSMA 2PUIA 3REPA 1W83A 2GNLA 4BI0A 4C58A 4MWHA 5C4LA 3PFQA 4QMUA 3AMBA 5E91A 5HIDA 4G6NA 1GZNA 1H26A 4RRVA 3TCPA 3TNIA 3LPBA 4EK4A 1WBVA 4CRLA 2JD5A 1Q62A 3R28A 4RJ6A 2XH5A 3RK5A 2VWIA 5FQDC 4UZHA 1J3HA 2UZEA 3L9MA 3IDCA 3NDMA 4L45A 4O7TA 3FSFA 3UOKA 4IM0A 3PP1A 3BYOA 2PVKA 3U9CA 3DJ5A 1Q8YA 4BGHA 5IUHA 5HHWA 3A2CA 4QMVA 4XHKB 5DRBA 1G5SA 3EN5A 3DBDA 4G9CA 2O0UA 2IVTA 4FIHA 2PZIA 3U55A 3AT2A 2XEZA 4FV6A 3CTQA 4C62A 2W1IA 4BDCA 5HU9A 4O86A 4UMPA 2Z02A 5HTBA 5M06A 1PF8A 4FKOA 3GI3A 4K6ZA 4BC6A 4UMUA 3R7IA 3MH2A 4I21A 3RPYA 2VX0A 5EW8A 3Q53A 3QF9A 4IADA 1P4FA 1O6LA 1Y57A 2J90A 4X3FA 1OPLA 4BCQA 3HVCA 4LI5A 5EHLA 5L2WA 2GQRA 3JVRA 3PSBA 5B2MA 3W2RA 5EYDA 4E8AA 3UMXA 2HZ4A 4LUEA 3UIXA 4ANQA 5CNNA 4DINA 5JK3A 4QP4A 3SVVA 1I09A 2ITZA 4RIWB 5DEYA 2GHMA 1UVRA 3BGQA 3VUGA 4O82A 4A9YA 3RM6A 3I0QA 3PJ2A 3NCGA 1XH4A 4FI1A 4UN0C 2RFDA 4L44A 5F4NA 3PIXA 2CN8A 4CMTA 2W1CA 5DR6A 4QP3A 3HV3A 1E1XA 4U80A 2JAVA 4DGLC 4M13A 1J7IA 3QU0A 4MXZA 1G8SA 3EB0A 3FE3A 3AG9A 3Q9YA 4H58A 4JAJA 2QO2A 5KX8A 4R1YA 4BR3A 1GNGA 4EQCA 4RWIA 3TN8A 3CSVA 2BPMA 3BYSA 3VRYA 2OO8X 4XX9A 5BUEA 3FWQA 5L2IA 3NYXA 2XP2A 2UZUE 3WIGA 1IR3A 3CLYA 1TKIA 4I24A 4HPTE 3BQRA 4N0SA 3OD6X 2GNGA 2YIWA 3CCNA 3MY5A 3QKMA 4JG7A 4N70A 1Q3DA 4YO4A 3SW7A 3G0FA 4PRJA 3KU2A 1WBWA 2B9IA 1QPJA 5CYIA 4TNBA 2HXLA 4KKHA 2B9JA 5CANA 3R83A 4JG6A 3WF8A 3FI2A 4C61A 2R3KA 4C34A 2XMYA 4CFXA 2WAJA 5GZAA 2QQ7A 3FZTA 1BMKA 4YTFA 2RGPA 3KF7A 4EOLA 3AGMA 3R30A 3QCYA 5IKWA 4B4LA 4EK8A 2BZHB 4FT5A 4JNWA 4CSVA 4EQMA 5I5ZA 4NIFB 2KULA 4E6AA 4GV1A 4OBOA 3VQUA 4IM3A 4LGDA 1LPUA 5D10A 3BIZA 3ZLSA 5FM2A 4FKJA 4YHJA 3FLQA 4MBLA 4EKLA 3AMAA 3K5UA 3KCFA 4GIIA 4NM3A 4XOZA 5DN3A 1NVQA 3A62A 3P4KA 3PVWA 1BUHA 3QHWA 4DGOA 4FNZA 4FA2A 4G5JA 2JEDA 3VHKA 4N6YA 4R7BA 1XQZA 3IW7A 3SDJA 4FKQA 1ZRZA 2GQGA 3BYVA 5ANIA 1M14A 4IAAA 3FMDA 4JLCA 3R7UA 2C6TA 1OI9A 5LOHA 1RJBA 2C5XA 4XEYA 3KQ7A 1T46A 1F3MC 4MF1A 3GXLA 3D5UA 2EXCX 4PL5A 2UZDA 5J5SA 1FGKA 2C5NA 3DS6A 5JRSA 4YJRA 3UVQA 2R7IA 3FMEA 3DXNA 4W4WA 4JAIA 4ONAA 3E62A 4B7TA 3SXFA 3ZUTA 4E3CA 4GIHA 4OTHA 4FZAB 1JBPE 4FKRA 1TQMA 4ACCA 5KBQA 4AUAA 3PYYA 5EW3A 2I1MA 3DK3A 4XG7A 2W5BA 4QMWA 4W4XA 4O83A 5KZ0A 2WMVA 1OIYA 3KULA 1GIHA 3A7HA 4L3JA 4DN5A 4EKKA 4YJUA 3UZTA 2BHHA 4RC2A 4A06A 4MQ2A 4QO9A 3E64A 4IC7A 3R7YA 4EHZA 4D1SA 3E3PA 1XH5A 4MVFA 3ALOA 1CTPE 2GNIA 2UVXA 3N9XA 4D2TA 3C7QA 1SVEA 4I94A 2R0IA 1CKPA 3MA6A 4ZXTA 4DEAA 4V0GB 4E5WA 2PZ5A 3R9HA 1GZKA 3LMGA 4GJ3A 1IA8A 4JDIA 4JQ7A 4FV0A 2ESMA 3FL5A 1PKGA 3WE8A 1STCE 5JGDA 5BYZA 3RAIA 2B54A 3G51A 2B4SB 1Q97A 4HGLA 5HI2A 4DLJA 3JPVA 5FM3A 4HVHA 3OROA 1TVOA 4II5A 4D0XA 4RWKA 4EH6A 3Q4ZA 5IUIA 3QUDA 4QT1A 4F0GA 5HESA 2X7GA 4TYHA 2XIYA 4TW9A 4CV9A 3QKLA 4TTHB 1IASA 3VRZA 5CU0A 5EQPA 2BKZA 3WIKA 3IDBA 1H1WA 5ETFA 5C1QB 3S4QA 3LCTA 1PY5A 2YJRA 1XH9A 1PXLA 2B53A 3WZUA 4C4EA 5HX6A 1NT2A 2CJMA 5K5NA 2IWIA 3R1YA 4JBPA 4YO6A 5IQAA 2YA9A 2V62A 3CS9A 4JOAA 3AT3A 3W2CA 5KHXA 5I9WA 2DQ7X 1ZMUA 4ARKA 4LQMA 4USFA 3QTXA 5HCYA 4K18A 2OH4A 1GY3A 1KOAA 2F4JA 2H9VA 2QC6A 4K8AA 2VWXA 3P7BA 2RG6A 3QFVA 5GJFA 2C3KA 5FDXA 5J8IA 5DE2A 2GDOA 4JBVA 1KV2A 1AD5A 2BRNA 2Z2WA 5ANGA 3TTJA 3CBLA 2WMXA 4RFYA 3VVHA 4YHTA 2YIQA 3KY2A 4ZAUA 3GVUA 3KXXA 1W84A 1H1QA 1JNKA 1V1KA 4ZSAA 4QMPA 1PXKA 4UWCA 4ANNA 5EQYA 3UTOA 4LG4A 1OUKA 1UWJA 4D4YA 4NL0A 1YW2A 4YHFA 4E4NA 3I6UA 3U8WA 5BUIA 4W4YA 2YCQA 4GU6A 5L6WL 5IQBA 1Q99A 4L00A 3HX4A 1FGIA 3HNGA 3ZUVA 2JFMA 3NW7A 2WQOA 2VV9A 3C0GA 4HNFA 3P08A 1T45A 3I5ZA 5FWKK 4ZTRA 4KIKB 2PMIA 1YWRA 4O7SA 4IDTA 4TYJA 3R7GA 4H1JA 3HRCA 4GL9A 3D5VA 3PJ8A 4EI4A 2BCJA 2IO6A 3OCTA 3V6SA 2XVDA 2R3HA 4GS6A 3TV4A 5ANJA 1H8FA 5M08A 4IAFA 3MPMA 3NX8A 3C4CA 2YCFA 3POOA 2UW4A 3RHXA 3F3ZA 3VS5A 3WF7A 2BAQA 2OF2A 2OIQA 4NW5A 2QKRA 3WOWA 4ANLA 5BVNA 5C4KA 4A9SA 4R8QA 1PYEA 4GG5A 1XH7A 3VS2A 2XBJA 2GSFA 2OICA 2PWLA 4OTPA 1H24A 1H25A 5CU6A 3CJGA 4N6ZA 4BDKA 3HP5A 4X21A 3OOGA 5HKMA 3PY1A 5IUGA 3KN5A 3OHTA 4FSNA 3Q32A 4HYSA 4ERWA 5KNJA 1Y8YA 3SHEA 5EYKA 2GTNA 1QCFA 2OBJA 3ORPA 3QZIA 4UEUA 2A27A 4G2FA 1SVGA 2NRUA 3BHYA 3JVSA 3OXZA 4QMLA 5HGIA 1ZWSA 4ZY4A 5ICPA 2BHEA 3FKOA 2ZMCA 3H0ZA 3UIBA 4EL9A 2YM7A 4H36A 5CU3A 3V5TA 3O7LB 3RK9A 4DH3A 3P9JA 4P7EA 4F6UA 4O7ZA 2VRXA 3VUHA 4ZZOA 4EOQA 2IW6A 4L3LA 4RLLA 5FGKA 2WB8A 5M4CA 4WRGA 3PG1A 4RJ7A 4M66A 4I0TA 1L8TA 2FSMX 2QLUA 1SYKA 3QKKA 2H8HA 2ZDUA 3MDYA 3ZLYA 5IA0A 3Q9ZA 1RE8A 3PRFA 1ZY5A 3PPKA 1R1WA 3OCSA 1M17A 3OUKA 4FGBA 3OTUA 3FXZA 4EK6A 1QL6A 5IPJA 3VUKA 4FKUA 3COMA 4LMNA 5JGAA 4AG8A 2ITWA 3LQ8A 3ATTA 4U43A 2OZOA 4TNDA 4L53A 4HPUE 4XNEA 3MI9A 3T8OA 3R01A 4W8EA 4WNOA 4FKLA 4ENYA 1M7NA 3EN7A 2JBOA 4NTSA 4IVBA 4OTDA 4PY1A 2XRWA 2C5YA 2OXXA 3MVHA 5I3RA 2WQBA 1KE9A 2C3IB 5E7RA 4V05A 3D7TA 2Y6OA 5EYMA 4H39A 2C47A 3DTCA 3EFWA 3KEXA 5D7VA 2JDOA 4M68A 3TV6A 4HVGA 1IA9A 3ORZA 3VS0A 3Q60A 2XJ2A 5HE2A 4HOKA 1KSWA 2BZJA 4EZ5A 1J7LA 2ZDTA 4BBFA 3VW8A 2VNWA 3E3BX 2W5HA 3DGKA 3OXTA 4KA3A 3LFCA 4LFIA 5AUWA 5KKRC 5I9ZA 1M2QA 3JY0A 4J1RA 3AC3A 2B7AA 5LMAA 4AX8A 2BAJA 5FBNC 3ZO3A 1ZOHA 4WG3A 5FBOA 4F65A 3DJ7A 3MB7A 3EFKA 4BCHA 2GFCA 1PRYA 2PZRA 3NPCA 3CIKA 4YLLA 5GIPE 4F64A 2AYPA 4IEBA 3T3VA 3W2PA 4LV8A 4D2SA 1PHKA 3GU5A 3R8ZA 4ASDA 3BU6A 4L46A 3PWYA 2QG5A 3M42A 4NH1A 3JXWA 5JZJA 3D14A 2DS1A 4RIXB 2UW7A 4GFGA 5EK7A 4TZRA 3RVGA 3C0HA 5HG8A 3O50A 1PMUA 2WKMA 3FPQA 2XCKA 3C4XA 5FTQA 3BV2A 5E8SA 1NVSA 4DBNA 3OCBA 3BV3A 3VC4A 3MB6A 5A14A 1W82A 2OZAB 4HVSA 3SRVB 5GINE 2IZRA 2C1BA 4HCTA 2X8DA 4G3GA 4H05A 5L8JA 4R5YA 5GJGA 4F9YA 4CVAA 1ZMVA 3HMPA 4AN2A 3EMGA 3COHA 3MV5A 4MBIA 2ZM1A 4BI1A 4F7LA 3NS9A 3AOXA 5CVGA 4GKHA 4YTHA 3FZSA 3H3CA 5FXRA 2HOGA 4XS2A 4X3FC 2V22A 4HJOA 3V5WA 2JIUA 2IZUA 5CAPA 5JFXA 5CVHA 2JBPA 2CGUA 2IJMA 2F9GA 4RX5A 2R0UA 3V04A 1ZXEA 2JITA 4Y5HA 3PDTA 4NCTA 4F1MA 2JDSA 2WD1A 3TL8A 5CU2A 4AWIA 4DFLA 2DUVA 3A4PA 1S9IA 4AW5A 4CYIA 1XR1A 3L9PA 3PXZA 3MH1A 3VS4A 2VTLA 3BLRA 4WA9A 2QOCA 4AT3A 4G3FA 5CY3A 3DDQA 4EZ7A 4UZDA 4EH4A 2HXQA 3QLFA 3TEIA 4I23A 4BCJA 5GJDA 3LFBA 3D7ZA 2ERKA 3DAEA 3QYWA 3CY3A 4WSYA 4ITIA 2W99B 5CEMA 4TYGA 4JS8A 4D9UA 3UOHA 4IZYA 4CRSA 2ZYBA 2R3GA 3R2BA 4DITA 4YSJA 2IZSA 1U4DA 4GH2A 5K0KA 4EHVA 4ZTMA 2CLXA 4YP8A 1OIRA 4F7JA 5E8TA 5T6KA 4NJ3A 4X2NA 4EUTA 4F6WA 4Y8DA 2F7XE 2VX1A 3K5VA 1JSVA 2BAKA 4OTQA 3HL7A 2C3LA 3P1AA 5CENA 3W8QA 4L01A 4ZY6A 3EL7A 1ZARA 3MY0A 4FYNA 4GYIA 4YZBA 3ROCA 3CGFA 5GIOE 3PVBA 3QA0A 3R8MA 3O17A 3RWQA 3V8TA 3IK3A 3NYOA 4M7IA 5BNJA 3MVLA 4DFXE 4PP9A 4E6QA 4UB7A 2JIIA 3RM7A 5EKOA 4FUXA 2C5VA 3TT0A 3L8PA 4ANSA 2A19B 3LJ1A 4ACDA 5DG5A 5DR9A 5HD7A 5CSWA 3SAYA 4BDEA 3ODYX 4I6QA 3JUHA 5AIRA 5K5XA 2YHVA 4R1VA 2ERZE 4PTEA 3VWAA 3ZFMA 1SNXA 4G17A 4KRDA 4LMUA 5KBRA 3V5JA 5EYCA 2ITVA 5J9YA 3DJ6A 2OF4A 4F7NA 5I4NA 2OH0E 5E8VA 3EWHA 3HA6A 3L1SA 4PTGA 2YM5A 2PPQA 3OOMA 5EM5A 4O2ZA 3E7VA 2V5QA 4GT3A 5EKNA 4QOXA 3TJDA 3QL8A 1SM2A 2ONLA 3D5WA 3ZBXA 3T3UA 4XH6A 5AUUA 4RZWA 2RG5A 5T68A 2PL0A 5L4QA 3FQHA 4QMXA 4E4LA 2X1NA 2QD9A 4FKGA 4QMZA 2QO7A 3ACKA 4GVJA 4ZSGA 1YHSA 4QTCA 1NVRA 4ZMFA 3ORLA 2FB8A 4O2PA 2F2UA 1V0BA 4O27B 3C4WA 4AA4A 3OW4A 1YOMA 2VWBA 4KIQA 3R9OA 4XG6A 3OF0A 4QP8A 1REJA 4EYJA 3FZRA 5JKGA 2J0MB 4BDIA 1HCLA 5BMSA 2RFEA 2O5KA 3TNQB 4M97A 2IG7A 3VULA 2XK7A 2PE0A 3FY0A 4BZNA 4E93A 2REIA 4LYNA 4X7QA 4IDVA 2UW3A 2EWAA 3IS5A 3LQ5A 2QR8A 4WKQA 3QCXA 3BQCA 3WYXA 4AA5A 4Z16A 4TPTA 1ZOEA 2X6EA 3H9OA 4I5CA 1WVYA 4Y5QA 4E4XA 4QYGA 1OL7A 2CKPA 3UZRA 4AT5A 2I0YA 3EYGA 4RIYA 3EH9A 3AXWA 5BVOA 2QKWB 3BLHA 1U5QA 2EB3A 3G33A 4I6FA 5A6OA 3KN6A 3R7OA 2GS7A 4GUEA 2F7EE 4M69B 5IA5A 3RHKA 4JXFA 3JY9A 4X0MA 3VBQA 4AW2A 3OUNB 4E6CA 4FSYA 2G2HA 2YABA 4TWOA 4CCUA 3A99A 4A4OA 2CGWA 4M15A 4QQTA 3II5A 3QQKA 4IW0A 4FEVA 3LMHA 4FK3A 3Q5IA 4RVLA 3DFCB 4O38A 5IG1A 4DCAA 3LCOA 4XV1A 4HZSA 4KBAA 4ALWA 5KKRB 1ZMWA 2UVZA 4FF8A 3OG7A 2XZSA 3F3TA 1Z5MA 1PKDA 3H9FA 2X9EA 2NRYA 3MFTA 3ZDUA 4E7WA 1JLUE 3C5IA 2X4ZA 1FMKA 5IQGA 1R0PA 4QMOA 3TZ8A 3OBJA 3WF9A 3FC1X 2EU9A 4S34A 1IRKA 1APME 1U46A 5EG3A 3A8WA 2PZPA 2GMXA 3CKWA 5A4LA 1MUOA 2B9HA 3FHRA 2PUUA 2G1TA 4G31A 4MF0A 3THBA 2HK5A 3VBYA 3QZGA 3QTZA 4ACMA 4EONA 3V51A 2Z60A 2Y7JA 4KBCA 1JKKA 2ETRA 1KE5A 3E8EA 3QGYA 3OTVA 2YN8A 4O0VA 4U5JA 4AZVA 4CZUA 4ZZNA 3QD2B 4XLVA 4XCUA 3QRJA 3BX5A 4IQ6A 2YZAA 3TNWA 4PNKA 4MXCA 1YQJA 4FIEA 5DOSA 4FG7A 4U0IA 2LAVA 2XK9A 4FTNA 5EQEA 2RIOA 3IOPA 2XNPA 3V8SA 1OIUA 3NAXA 3QWJA 1J1CA 5IMXA 1PXOA 3RBWA 1MQ4A 4KAOA 1UA2A 4MXYA 3O71A 3RCDA 2B55A 4GW8A 4DTAA 1XWSA 2Q0NA 2OLCA 1GOLA 3OW3A 3KK9A 5HCXA 5H8EA 4UBAA 4IAKA 4U41A 4MHAA 3WE4A 4LL5A 1Z57A 5AP7A 1AQ1A 3U51A 5D9HA 3ZMMA 4EZ3A 2W9ZB 1FMOE 4D58A 4D5KA 3DV3A 4X3FB 2VWZA 2C3JA 3R9NA 4CMUA 4RX7A 3QRTA 5DRDA 5AP1A 5E8YA 3UZPA 3NUUA 3TZMA 3Q9XA 2P4IA 2R2PA 3Q3BA 4EHEA 4BICA 5CSHA 4CZYB 1TQPA 4ZK5A 5HU3A 5FTGA 4FKPA 5EHOA 1PXJA 4MYGA 1YI4A 4U97A 4FL2A 5ITAA 4DEEA 5A4TA 3VUDA 4CFFA 2PVHA
chains in the Genus database with same CATH superfamily
4YGAA 3PY3A 4RQKA 2W1GA 3DKOA 4UYNA 2JDTA 4JQ8A 4G1WA 2R7BA 4CTCA 2ZV8A 2OFVA 1QPEA 4C3RA 2YDIA 2AC5A 1LEWA 4PDSA 4O6LA 3AQVA 3KRRA 3ZXTA 2PY3A 2BVAA 4YNEA 3C9WA 4O0RA 3UNZA 3B8RA 5HOAA 1H08A 4GFOA 1Y91A 2JC6A 2YZLA 4S2ZA 1A9UA 4HW7A 4EOOA 4FICA 4J95A 3WZEA 3DB8A 4QP9A 5IDNA 4RLKA 3CPCA 5EW9A 1OKWA 4LOOA 3QC9A 3QALE 3MFRA 5FP5A 4EQUA 1BI7A 1W2CA 2XK8A 3BHHA 3GCSA 1GZOA 1YOJA 4S33A 4MNEA 4ZY5A 5BV3A 2WIHA 3P7CA 3CJFA 2J5EA 1KE8A 1KUTA 2CNUA 2ITUA 3GC8A 3MH3A 4I6BA 2OJGA 4XP0A 4AU8A 4EEVA 2ZV9A 5KMLA 3W1FA 4C4GA 4E5AX 2GCDA 3EZRA 4FIIA 4ASZA 4Y73A 4F6SA 2VX3A 2XK6A 4RGJA 4BTMA 5G1XA 4DYMA 2OSCA 4F9WA 5DGZA 3R7VA 1GIIA 3HYHA 4FT9A 2VWUA 4QP2A 3KIOC 4NKSA 4IVDA 2JAMA 4KABA 4QQJA 4DHFA 3NUPA 4M12A 2CGXA 3FKLA 4QP1A 4W9XA 2ITQA 3ZO4A 4BKZA 3TUDA 3BZ3A 1OIQA 3SQQA 1CSNA 4AF3A 4IFGA 4IC8A 4DG2E 3F2NA 4EOPA 4NFNA 5CVFA 4D28A 4O0WA 3PXFA 4KKEA 3A7JA 3HGKA 3CQWA 2J0JA 2PMNX 4BKYA 4BCMA 4C38A 4D1XA 5I0BA 2J50A 4FSTA 1YHVA 4C57A 2ZM3A 3BYUA 1GZ8A 2QODA 2IPXA 2FH9A 2R3LA 3MVJA 4R3RA 5J5TA 4O7WA 2WELA 2VO7A 5IMEA 2XF0A 3ZU7A 4LRMA 3W0PA 5C8KA 4RFZA 1ERKA 4FSUA 3ZC6A 2X81A 5I9VA 3EQHA 2P2HA 4FV9A 1RW8A 3I7CA 4FZ7A 5CTPA 3QD3A 4G34A 3R7EA 3BEGA 3ZXZA 4FV8A 4AXAA 4F09A 4FTOA 1UNGA 3FSKA 4HCUA 4EHGA 1PJKA 4F4PA 4RWLA 5DLSA 4MQ1A 3HUBA 4HCVA 4IVCA 3UMWA 4GUBA 4C2VA 4EBVA 5C8NA 3FMKA 4YZ9A 4D5HA 4DT8A 1UU8A 4FTMA 3IG7A 5L2SA 3MJ1A 2IF8A 3QTUA 4J97A 2YLFA 5HEZA 4BKJA 5CAVA 3BL7A 5IA3A 5D7AA 3ZDIA 2W1EA 5AA8A 4FVPA 5IDPA 5JFVA 4GU9A 4MCVA 4YPSA 4AW0A 4EOIA 4PDPA 2Q83A 2ZB1A 1BYGA 4ERKA 4C33A 3BL9A 4CKRA 2X8IA 2FSTX 1FBNA 3A7IA 3NVKI 4O1PA 4L42A 4C8BA 3GGFA 4GFMA 2QG7A 1TQIA 5K9IA 5KE0A 3R21A 5CT7A 3V5LA 3CP9A 3KL8A 3L8VA 4KIPA 4EYMA 3U54A 2P0CA 4I5HA 4MTAA 3FZPA 4FEUA 2BDFA 4DBXA 3RPSA 4FOBA 3RPVA 2P3GX 3MH0A 3ZM4A 2UW8A 3VJOA 4Y72A 4AE6A 1YXSA 4A07A 3CD3A 5G6VA 1PYXA 3TIZA 3H9RA 5JH6A 4MH7A 3V3VA 4FT7A 2C30A 1IAHA 1FQ1B 4QPAA 4OLIA 4ZEGA 3C4FA 4K1BA 4FZ6A 4PDYA 3BE2A 5HLNA 3SLSA 4D4RA 4QYYA 3HP2A 3LFDA 4IFCA 1J7UA 3PWDA 5DR2A 4NIFA 4Q2AA 3O7LD 1OL1A 3DB6A 2C6EA 5LVOA 3BKBA 3FHIA 3GQIA 3FQSA 1QMZA 1HCKA 4JIKA 4XP2A 3RCJA 3SXSA 3MTLA 1GIJA 3MYGA 2ITYA 1ZZ2A 3LXKA 4D2PA 1K3AA 4CMOA 4XRJA 1OZ1A 4M8TA 5TT7A 2WMWA 3B8QA 5HNIX 3DK7A 3LFFA 3SV0A 3MFSA 4WUNA 5EDQA 3V6RA 1JSTA 1PXPA 2F7ZE 3M11A 3HECA 3Q6UA 1Q8WA 4I20A 5BYLA 3EL8A 3VUTA 5KUPA 2XALA 4FV5A 5E8ZA 3ZYAA 4QP7A 3HDMA 2XUUA 2ITOA 4LOQA 4C35A 5ETAA 4NT4A 2J0LA 3FLZA 3HMIA 3IW5A 3EHAA 4EH2A 1ZLTA 2PHKA 2VTSA 4ACGA 5DBXA 4F9CA 4L8MA 4EH3A 2GNJA 4O0XA 5IQDA 2WU6A 5HBJA 4RJ5A 3EIDA 2BZIB 4M84A 3EYHA 4IX5A 2C6KA 3UOLA 3ORNA 4ZTQA 3HV6A 4G3DA 5CALA 1XBAA 4XJ0A 4YURA 4R5SA 4TY1A 3PLAE 1G8AA 2O2UA 1MQBA 1ZZLA 2YAAA 2WEIA 4FBXA 4JDKA 4WIHA 4C4JA 3FXWA 2R3JA 3QX4A 3RINA 4BTFA 3LLAA 3VUIA 4QTBA 2QOIA 3HMOA 4NW6A 4BCNA 2H96A 4YLKA 3WF6A 1J1BA 1Y6AA 3R71A 4ZZMA 2LGCA 3Q4TA 5CF8A 5LMKA 4BF2A 2FUMA 4FOCA 3DAKA 5TR6A 5FUTA 1H1SA 2XA4A 5FTOA 3KRWA 5IA4A 1YI6A 4KSQA 2UZWE 2XRUA 4K2RA 3LM5A 4G6LA 3RPRA 5A46A 4EC9A 2YM8A 5K4JA 2F57A 2HELA 3E88A 5EM7A 4AW1A 3AC2A 3W8LA 3TUCA 2H6DA 3FQEA 3R22A 3VS1A 1WBOA 4AXDA 4YR8A 4FTCA 1ST0A 3PTGA 4YLJA 3ETAA 3KVXA 3W10A 4CLJA 1PMEA 4R3PA 1H1PA 5EDPA 5M09A 3F3UA 3ZCLA 4HGSA 5HE3A 3L9LA 2W1ZA 3WARA 1SNUA 4GK3A 4PL4A 3B2TA 2QOKA 3C4EA 4ZLZA 3LKMA 5IQEA 3K54A 1KV1A 3PXRA 4EJNA 5AM7A 4PMSA 1NXKA 1OMWA 5K0XA 5HE0A 4CG8A 2IVSA 5FD2A 5A4EA 2W06A 1H07A 4RSSA 4DGGA 4TWNA 4U6RA 2J5FA 5T3QA 4IZ7A 4GVAA 4IHPA 4LUDA 5E8WA 3VBTA 3NUNA 3I6WA 3LFNA 4F7SA 2WFYA 3DLZA 1XH8A 3P0MA 1HOWA 4I41A 4R7IA 4BTJA 4D4SA 1Q3WA 5E1EA 3TWJA 4DG0E 2ITNA 3ROYA 5TOZA 4D0WA 4IAYA 1V0PA 2VTAA 4FVRA 2C0IA 4XRLA 2CKOA 3UIMA 1URCA 4XG3A 5AV2A 3CXWA 3F6XA 4ZTHA 5HIBA 4F0IA 2JKKA 4TYEA 4YMJA 2Z8CA 5J1VA 2J2IB 3LCSA 4OAUC 2PK9A 4ZS4A 3BWJA 4XG2A 2YAKA 3PSCA 3GENA 2OJ9A 2XS0A 4DFYA 2NO3A 2EXMA 3QC4A 3V5QA 4NM5A 4AE9A 5LMBA 2PUNA 2ETMA 4YJVA 2FVDA 1R0EA 3QTWA 5CEOA 2PVMA 4BDFA 5HX8A 2Y9QA 5IA2A 4Q9SA 2W17A 3BLAA 2VUWA 5CZHA 3HMNA 4GYGA 5AV4A 3RI1A 2WTWA 3DCVA 4FSWA 4WT6A 3HV5A 1OPKA 4IJ9A 3RNYA 4XMOA 3FJQE 3GOPA 3QA8A 4I6LA 2PUPA 1OBGA 3EKNA 2PTKA 5LCKA 4O0UA 3UG1A 1F0QA 4HVDA 2XK3A 4F1OA 4ALVA 3UDZA 2HCKA 2ITXA 4KWPA 3ZS5A 3R8PA 4A9TA 3WZJA 3DBEA 5CF4A 5CT0A 5KMIA 3R8LA 2RL5A 5CZIA 4XV3A 3I5NA 3ZC5A 5DI1A 3FMJA 4OTFA 4FODA 4TN6A 3E93A 5JRQA 4OGRA 4GMYA 2XIKA 4YZMA 4GT4A 5L8KA 3E8DA 3HKOA 5LVMA 2QOOA 4BB4A 2WXVA 3KXZA 5AR3A 5A4QA 5E8XA 3G90X 4ZP5A 5HVKA 2HIWA 4DEIA 2VWVA 3OWLA 3F5GA 2X2KA 2BROA 3RTPA 3UJGA 4J71A 1E9HA 3I7BA 1ZYJA 1K2PA 4LRJA 1YXUA 2R3MA 3FXXA 3IGOA 3ID6C 3S2PA 5HTIA 5M4UA 4WD5A 4CEGA 3QD4A 5CQUA 3KGAA 2Z7RA 5FDPA 2IVVA 5ANEA 2XKCA 2UZBA 5J7HA 4RX9A 5J9LA 4O1OA 2VTPA 4FEQA 4XG8A 2EUFB 3ZM9A 4X2GA 1MP8A 2F2CB 3OY3A 5F20A 4KD1A 2NPQA 4O81A 1OKVA 3OVVA 3QQUA 4JR7A 4AZWA 4NEUA 3DQWA 4WHZA 3NCZA 3UNKA 4R77A 2XKEA 2GPHA 4BRXA 2C69A 1OL5A 3F69A 3UQCA 5TE0A 5AR2A 4GKIA 4C3FA 2G01A 2W05A 3LOKA 2C68A 2VGPA 4RVKA 4Z7HA 3PVUA 4Z7GA 2VTIA 5DA3A 3HRBA 4O7VA 4E4MA 4OTRA 2EB2A 2YIRA 5CU4A 4AXCA 5TKDA 3PUPA 3MBLA 4CYJA 3DNEA 3LCKA 4QQ5A 5GZ8A 4FSMA 3QX2A 3DXPA 4L43A 1UU7A 2WQMA 4OBPA 5DEWA 4E26A 3IO7A 3K2LA 5AP4A 2X2LA 3GC9A 3O2MA 4XBRA 3KFAA 4L7SA 3GU4A 3UP7A 1NA7A 2GTMA 4BZDA 1FVTA 1BI8A 3EQBA 5KMNA 5IQIA 4GK2A 3OCGA 2ITTA 2EVAA 2Y0AA 4IB0A 3G9NA 3NSZA 4NKAA 3UG2A 3D15A 5DT0A 3U9NA 4AS0A 2PVLA 3UODA 2NP8A 1OKZA 1VYWA 1Y8GA 3F5XA 4FKSA 4YZCA 5EHYA 4IX6A 3IDPA 5JQ5A 4X2JA 3R9DA 3LJ0A 5E90A 3SW4A 3I81A 4EH8A 4FEWA 2WOTA 1H28A 5DH3A 4ZIMA 2VZ6A 3ZSHA 2X7FA 5KMMA 1M52A 1TZDA 3BPRA 4BCOA 5I3OA 4F08A 4E73A 4MX9A 1CMKE 2VTQA 2XKDA 2QOQA 4J99A 4OBQA 3R2YA 3N4UA 1WFCA 1EH4A 5IEVA 1ND4A 4HGTA 5H3QA 2J4ZA 3I60A 5DMZA 3RK7A 3EQIA 3BRBA 2Y4PA 3ZHPC 1BL6A 4USDA 4F78A 1GAGA 4AZSA 3NGAA 3CD8A 2XEYA 2PYWA 4D1ZA 2ETKA 3QTSA 4PNIA 4UMRA 3AKKA 3TZ7A 4QPMA 2X0GA 4F1TA 1OVEA 3UGCA 5AR8A 2WMBA 4YJTA 3EJ1A 2UZLA 4YTCA 1BX6A 4YC3A 3F7WA 3QZHA 4LRKA 1B39A 3UQFA 3VJNA 4YC8A 3ANRA 2H34A 3W55A 2IW8A 4FV4A 1LUFA 3TKIA 5JMSA 5KO1A 3RALA 2VU3A 5JT2A 5IEYA 2OZAA 3S0OA 4AOTA 3SRVA 3Q5ZA 4O0TA 5FXSA 3VBWA 3ZZEA 4O7RA 3FI4A 4BIBA 1LR4A 3MA3A 3MS9A 1O6YA 4MKCA 4E6DA 3U6JA 4U9AA 2YDJA 3VF9A 2HW7A 5BMMA 3EFJA 2V0DA 3POZA 4USEA 1Q8TA 1U59A 3NNUA 4FSRA 4AN9A 3K3IA 1XKKA 3LXLA 4FV2A 5AUTA 5CLPA 2SRCA 2VD5A 2C0TA 1YDTE 3CC6A 2YM3A 2GU8A 3O96A 3HV7A 3NYNA 3QQGA 3R04A 4BGGA 2X6DA 4H3QA 3R0TA 3ZTXA 4DF3A 3QD0A 2BDJA 4G3CA 1CM8A 3G6HA 2WMSA 3TKUA 2HY0A 3E63A 3C50A 3FYKX 4FK6A 3ANQA 4GT5A 3AC8A 5EFQA 3UPXA 3ML1A 5AV3A 2R64A 3W18A 4RJ3A 4OT5A 2HZIA 1VEBA 3IW6A 4B6LA 2OFUA 3LW0A 3TM0A 2RFSA 3MY1A 5HNGA 4FTQA 1H0VA 3GFWA 5HNBA 1DI8A 4L52A 1CKIA 1FPUA 4JX7A 5AR7A 2ZJWA 4BCIA 4KIOA 4TWPA 3UIUA 4EOKA 5J7BA 3QQHA 4IAZA 2QI8A 4CQEA 2WHBA 5EI8A 5C03A 5JN2A 4BBEA 2Z7QA 4DEBA 4DHZA 2QO9A 3LAUA 4M3QA 4YNOA 5BVWA 2FGIA 2WMAA 4AOJA 4X2KA 5ANOA 3ZH8A 5LWNA 3I0OA 5H8BA 4FTAA 3ATSA 4L9IA 4U45A 2CNVA 4MXXA 1R78A 3O51A 2VNYA 2XM9A 4ENXA 5EOBA 5M55A 2R3FA 3IONA 4WNMA 4I0RA 4H1MA 4CKJA 2X4FA 4LM5A 3HAVA 3W0OA 1U54A 4WBBB 4AGWA 4LV7A 3HEGA 3NEWA 3P79A 3TUBA 3KXGA 4G9RA 3HUCA 4GJ2A 4FGRA 3ZEWA 2E9UA 2ITPA 2J9MA 3H10A 4O0YA 3KK8A 4RA4A 1YXXA 2VWWA 1FVVA 3D4QA 2YM6A 3LFEA 4U40A 5TO8A 4BDHA 3HV4A 3UPZA 3E8NA 3G2FA 4NWMA 5CNOA 2XNGA 4NM7A 4AOIA 5IH5A 3LFSA 4FSZA 4BL1A 4J7BA 2OK1A 4AZEA 4JI9A 2OJJA 3KXHA 3T9TA 4EK5A 3S1HA 5B2LA 5M53A 4Q5HA 4HYIA 4KKGA 3EKKA 3RAWA 2VTMA 3R9RA 4WNPA 4FUYA 2ZV7A 2YACA 4CT1A 5IISA 5D12A 5IQHA 3FMLA 1G8JA 4JRNA 3LXNA 2BUJA 3ZFXA 5IH4A 2WTDA 1RDQE 4BIEA 5FRIA 3R8UA 4BWPA 4MK0A 3NIEA 4AAYA 1W98A 4BDDA 3OZ6A 3TJCA 3CR0A 1VYZA 4HYUA 3QXPA 5AM6A 5B0XA 4PTCA 1Y6BA 1X8BA 4D2RA 3NLBA 4O4CA 4NM0A 4A9UA 2BRGA 1UU3A 5AA9A 2GHLA 5AP5A 5K4IA 3EZVA 5EH0A 2QCSA 3AT4A 4WG5A 2OIBA 4J96A 4IB5A 3LMIA 2UZTA 4GK4A 2V7AA 3PSDA 3DKCA 3E92A 4DT9A 3KB7A 4HVIA 1R3CA 1XH6A 1YXTA 2PVFA 2YFXA 4LGGA 3U4UA 4U3YA 2A0CX 3GCUA 3E5AA 5AJQA 3P23A 4OTWA 4A4XA 4H3PA 4CQGA 2UW5A 1B38A 3W2QA 4AZFA 1WBSA 2AUHA 1PW2A 2O3PA 3BHTA 3DK6A 5M51A 5LVNA 5DYJA 5M57A 5DIAA 1KE7A 5HCZA 5IU2A 2W7XA 3AD5A 3FC2A 3HA8A 4QYEA 3E87A 3FMNA 3GT8A 3OEZA 4EWQA 1Q24A 4DTBA 2WNTA 2GHGA 3UVRA 3LFAA 2PU8A 4FTRA 1ZYSA 3PG3A 3S3IA 4C2WA 4IACA 3EN9A 3M2WA 4EOMA 3MJ2A 5HO8A 3H4JA 4K77A 2E2BA 4UWYA 2XAOA 3KC3A 1R39A 2DYLA 1A48A 4FR4A 4PDOA 4MNFA 5AUYA 3EQFA 4BGQA 4GG7A 1J91A 1LP4A 3QHRA 4KRCA 5M44A 4O7YA 4M69A 4NK9A 3TI1A 4JIAA 4DHIB 4HNIA 1BL7A 3Q96A 4EH5A 1ZAOA 2QU5A 5FEQA 3FZOA 2NYAA 3C5UA 2XNNA 3FZ1A 3VN9A 3ORXA 1JVPP 4ZSLA 2PVYA 3UC4A 5CAQA 1NW1A 1UKIA 4AFJA 4XBUA 3ZEPA 1FOTA 5BVKA 3RNIA 3O8TA 3R00A 2UW6A 1YKRA 1YOLA 3OFMA 2P55A 5BVDA 4MNEB 3ZLXA 1H00A 4GCJA 2PVJA 2ZVAA 4QDVA 2RF9A 4DTKA 3OBGA 3QTIA 4FC0A 4UXLA 2E9PA 4C36A 4G3EA 2JLDA 2J7TA 5KZIA 3ZLWA 4ANMA 2QHNA 3M1SA 2W4JA 5CX9A 5ACKA 4A7CA 3COKA 3QXOA 3NNXA 3ZRKA 2W1DA 3Q4UA 1DM2A 1UKHA 4QPSA 4C4IA 3ORIA 4D55A 3C4ZA 4ID7A 3CKXA 4X6RA 4D4VA 3BE9A 4Q9ZA 2VTOA 5ACBC 5AFVA 4C37A 3MWUA 3HLLA 3EQPA 2BMCA 1OKYA 2HYYA 5J9ZA 3PPZA 3QBNA 4S32A 2CKQA 4ZSEA 3PA3A 4F70A 5AAGA 4WRSA 1JKSA 3OXIA 3FUPA 4QMYA 3ZUUA 4HZRA 5C9CA 3HDNA 3L8SA 4P4CA 2IZTA 3CY2A 4OUCA 3IW8A 4DFNA 4C4HA 3C1XA 2PE2A 4CGAA 2HZ0A 2W96B 4UY9A 3TIYA 3FMMA 5E9EA 4O22A 2J6MA 4YUQA 4FT0A 4G5PA 1JSUA 2XYNA 5IF1A 3R1QA 2VN9A 4O4EA 3IPHA 3NMUF 5CF5A 4ZMEA 2PVNA 1V0OA 4QMMA 2O64A 2QHMA 3KCKA 4WOVA 3EOCA 3QRKA 5GZ9A 4CD0A 1WZYA 2F49A 5CAOA 1OPJA 3BBWA 3GC0A 4HGEA 4I93A 4IWQA 4NSTA 2CCIA 2WQNA 4IVAA 4OR5A 3VS3A 4BCGA 5IQCA 4BCPA 2XIZA 3QTQA 1SVHA 4OTIA 5DT3A 4BHZA 1YWNA 5H9BA 1YWVA 3W33A 4Q5EA 2OG8A 2X8EA 3KF4A 3QRIA 2RSVA 4L7FA 4XP3A 3KMUA 3A61A 5J95A 4QP6A 2FSOX 3G0EA 5L2QA 1KE6A 1WMKA 2ACXA 2X39A 1O9UA 4JVGA 2Y8OA 2GQSA 3EQCA 5EM6A 4IWPA 5CEIA 4NUSA 4F63A 5HO7A 4D2WA 4TL0A 2WGJA 4B9DA 4F0FA 1WBPA 1H0WA 4IMYA 4YC6A 3CEKA 3SC1A 3PE2A 3BU5A 3JS2A 2E9NA 3TTIA 5DHJA 2C4GA 2YITA 3DKFA 3QUEA 4E1ZA 2BIKB 3LHJA 5L6PA 4EBWA 2VTRA 3CGOA 3ZONA 3G5DA 4AN3A 4JR3A 5FLFA 3LFQA 2E9OA 2PZYA 3D2IA 4AXEA 4DFUA 3P5KA 4RC3A 4JQEA 5CI7A 5CS6A 2QR7A 2I0EA 3D83A 5B7VA 1IG1A 4RJ8A 4BDAA 4XV9A 4DGNA 4IB1A 4RIWA 3DTWA 3VIDA 4QMQA 3H0YA 3KULB 3O23A 2I7QA 3OS3A 4F9BA 3FLNC 2QOHA 3BBTB 4JX3A 4I1ZA 3A8XA 3NAYA 3U4WA 4NZWB 3PP0A 4O96A 4DE4A 4FE2A 1P5EA 1OECA 2HWOA 3MSSA 3W0RA 3BHUA 5AV1A 2UZVA 4J53A 1ATPE 3DLSA 3F5PA 3NW6A 2X0OA 2WMRA 3A7FA 3PPJA 1H1RA 2FYSA 2OJFE 3PZEA 2OWBA 2HW6A 1O6KA 4BWXA 3IKAA 3PVGA 4MXAA 4W9WA 2WEVA 4MXOA 4Y95A 3F66A 3JYAA 4AFEA 3PLSA 3LVPA 4FV3A 5AP0A 5HBHA 4QTEA 4YZNA 5CXZA 4FRFA 2QOFA 1PXIA 2QVSE 3O8PA 3TDVA 3VS7A 2YJSA 2BKKA 3SG8A 4RA5A 4BWKA 3Q6WA 1K9AA 3FAAA 3U6IA 4FKVA 4TYHB 4DFBA 4N4SA 3F82A 2PSQA 4IZAA 5E92A 5FEDA 2JKOA 3WBLA 2KTYA 4P90A 3FDNA 4QD6A 4YJPA 4LGHA 5AIKA 3NRMA 2BIYA 4GRBA 4Y46A 4DH7A 2R9SA 4FYOA 3MN3A 2PVRA 2HY81 4O21A 3V5PA 3MTFA 4NCTC 3D5XA 5AX3A 1G3NA 1W7HA 3DBQA 4RX8A 2XM8A 4AA0A 4DH8A 5AAEA 4ORKA 4PMMA 3COIA 3ULIA 4APPA 3TNHA 2ZM4A 1PMNA 2W1FA 3LM0A 4W8DA 2BFXA 3QUPA 3K3JA 2GS2A 3U6HA 3D2KA 3ITZA 4C0TA 4Z55A 4L6QA 4FNWA 5ETCA 3OC1A 5AADA 3F88A 3UC3A 4DGMA 1WVWA 4XG9A 3IOKA 4QNAA 2OJIA 2RKUA 1M2PA 2YDKA 3QQFA 5K3YA 3MW1A 4IJPA 4RIOA 5KMKA 5L2TA 2W9FB 4YJQA 5A4CA 1W2FA 3NWWA 5M4FA 3ZOSA 3W2SA 3ZBFA 5CEKA 3S95A 1KWPA 4CV8A 4BDBA 3DT1A 5E4HA 3FI3A 3GCQA 2CLQA 3LJ2A 4P2KA 5CI6A 1VZOA 4YU2A 4TXCA 1JKLA 3PJ3A 5J1WA 3C51A 5CASA 3T9IA 4FMQA 2GFSA 4RT7A 4UWBA 4CFVA 3ZO2A 3W32A 4EH7A 5CEPA 5LVLA 5IEXA 3N4TA 2QOLA 4IH8A 4U3ZA 4B8LA 5HVJA 4FVQA 4JL9A 2WTVA 3EN4A 3VUMA 1UNLA 3UO5A 4QRCA 3UDBA 4FTJA 3RPOA 3ODZX 2UZOA 3TG1A 4EORA 5I9UA 2OIDA 3BGZA 2WOUA 4PL3A 5HORA 4C7TA 4V01A 4WG4A 5L8LA 4J98A 4DA5A 1XHAA 5IH6A 3SOCA 2R3NA 4X2FA 5HQ0A 3F9NA 2YCSA 2YIXA 1DAYA 3VBXA 3D94A 3AGLA 2A2AA 4ACHA 3LIJA 1Q41A 1BLXA 4RC4A 1RQQA 1YVJA 3UO4A 4CCBA 2YERA 3B2WA 3BGPA 4ITJA 4RFMA 5GHVA 5I9XA 3Q2JA 3BI6A 3NNVA 4IX4A 2UZNA 5EOLA 4BJJA 3VQHA 4QTAA 2VO3A 3PA4A 4IWOA 3SX9A 4KBKA 5CF6A 3DU8A 2HAKA 1ZYCA 3NNWA 4U81A 4N57A 2ZAZA 4V04A 1XJDA 5EDRA 2UVYA 4FL1A 4ZSJA 2W0JA 4V0GA 3LE6A 4QYHA 5F9EA 2ONLC 3ORMA 4JT3A 4RMZA 4C3PA 2CHLA 1CKJA 4J8NA 3Q9WA 3SA0A 2A98A 2IVUA 4RBLA 1XBBA 2FSLX 4F9AA 1MRVA 4GSBA 3GUBA 3GU8A 2GS6A 4KNBA 4AGUA 4EK3A 3QWKA 4PX6A 4JMQA 1H01A 2ZB0A 3PXQA 2CN5A 4FSQA 2Y4IC 4BFMA 2BFYA 4ZJJA 3KXNA 5ETIA 5HZNA 4KS8A 2ZMDA 3CQUA 3GC7A 4MBJA 1YDRE 1Z9XA 2R3IA 3DNDA 3UYSA 3FEGA 5FP6A 3DZQA 3CQEA 3CPBA 3FKNA 1ZYLA 1VR2A 2O65A 3BWFA 5LXMA 4OAVB 1YXVA 4BCFA 3R1SA 2WZJA 1ZOGA 4D2VA 4OT6A 5CAUA 4ZOGA 4AZTA 3GBZA 2W1HA 4PMTA 4S30A 1ZY4A 4I6HA 2GNHA 3DOGA 3RZBA 3F61A 4KUJA 2VTJA 3KRJA 2BILB 5AX9A 2HZNA 4FNYA 3F5UA 3IGGA 3CE3A 5L3AA 4CFWA 3BU3A 4PV0A 3LXPA 3D7TB 4ALUA 4DEHA 3Q2MA 1XO2B 4I4EA 4O7LA 4AACA 5JEBA 3OT3A 3MGYA 4BI2A 3DBCA 2IN6A 4FG8A 5EM8A 2XNBA 1VLRA 5ANKA 2X2MA 4WBOA 5A6NA 4BIDA 3F7ZA 4RPVA 1PXNA 3EQGA 2J0KA 3R1NA 4NTTA 4FT3A 3ACJA 2XJ1A 3AC5A 3ENMA 1URWA 3KVWA 2BALA 5LCJA 1DS5A 1Q61A 3ET7A 3F2AA 2XJ0A 1WAKA 1UWHA 4L68A 5AMNA 1OL2A 4WNKA 4CKIA 4S31A 4IB3A 4KS7A 4KINA 3WZDA 5F94A 2WQEA 2JDRA 1U5RA 2XB7A 3F2RA 4CFNA 3AC4A 4CFMA 4KIKA 1DI9A 2XNMA 1CDKA 1OITA 3DFAA 3HRFA 3LLTA 3PXYA 4QYFA 4L67A 3RZFA 3SGCA 2QONA 3NZ0A 4B99A 3D9VA 4WUAA 3ZFYA 4BVUA 2RFNA 2CCHA 2C6IA 4X6QC 4Y83A 1M2RA 5D1JA 2OXYA 3V01A 2G2FA 2BRHA 3PA5A 3BELA 3QGWA 4GEOA 4C02A 3TXOA 1L3RE 3I4BA 3AD4A 5E8UA 3OMVA 2VO0A 4FKWA 5TF9A 4FL3A 3TACA 4LDTA 3GCPA 4A9RA 4X3JA 3SOAA 2OI4X 2XBAA 3NUXA 3DXQA 3C0IA 5C27A 3SKCA 3NUSA 3OT8A 3DBFA 4UALA 4CT2A 2VTNA 4IIRA 3W0SA 3ZSIA 3ZRMA 5HICA 3BHVA 3EN6A 4FZFB 2W5AA 4WSQA 3GCVA 3TV7A 2X7OA 4AGCA 3BYMA 2BR1A 4M0YA 3AMYA 2WTKC 3BEAA 3UYTA 3NUYA 5A54A 4FTUA 4M0ZA 4JRVA 3DQXA 1PMVA 2FO0A 5DVRA 4RJ4A 5FXQA 4PWNA 5HVYA 4CLIA 5JZNA 3GFEA 3V8WA 2B0QA 4W4VA 1OM1A 3KMMA 5AP6A 2VAGA 4CG9A 4Y85A 4EUUA