3C4CA

B-raf kinase in complex with plx4720
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
275
structure length
258
Chain Sequence
b'DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Discovery of a selective inhibitor of oncogenic B-Raf kinase with potent antimelanoma activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 258
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c4cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c4cA01
3ZS5A 3HYHA 4O22A 5AR3A 3N4TA 3NUYA 2YCFA 3AQVA 4JBPA 5AR7A 4IB3A 2ZB1A 4OTWA 5GZAA 4G5PA 3RTPA 4FT0A 5M07A 4IAFA 2PVHA 4DFYA 4EH9A 3NSZA 4LL0A 4AS0A 3TL8A 3RM6A 4ZZNA 3ATSA 2YJSA 3FJQE 3GVUA 1O6KA 4EK4A 4FUYA 5HVJA 4KNBA 3VHKA 5EDRA 3VS7A 4EH4A 3EN7A 3K54A 3HA8A 3VS4A 1T46A 1R39A 3FDNA 5EKOA 1XKKA 2E9OA 4D9TA 5M4UA 4EZ3A 3R7UA 5BVOA 1YXXA 3PIZA 3TG1A 3FMMA 4MBLA 4GUBA 4IWQA 5CU3A 1BI8A 1DAWA 3NIZA 2O2UA 4DCEA 5BX0A 4H39A 3C5UA 3V5PA 3DKCA 4UYAA 3VS6A 2F57A 4C3FA 4RFMA 2C4GA 4D2TA 4DFNA 4EOMA 4ASEA 3KREA 4CZUA 3PIXA 3C13A 4U44A 3H9RA 4OGRA 4IW0A 5J9LA 2JGZA 4BCNA 5DHJA 1BUHA 3L9MA 4G16A 1Q62A 4LRMA 4QMXA 4J7BA 3SHEA 3Q5IA 4AWIA 3K3IA 2XCHA 4YP8A 5J9YA 2CKQA 2B9HA 2X4FA 3Q9XA 4A4LA 2WQNA 3TNPC 4G3FA 4CFWA 4A06A 5E8UA 3OXZA 4YR8A 4E6QA 4O7VA 3Q4UA 5EH0A 4O86A 2JKKA 4FTAA 1YQJA 4Y8DA 5DRBA 3GB2A 3E8DA 4BI2A 2GS6A 3HV6A 3NYXA 3RK9A 3FY0A 4IIRA 5EI6A 3UC3A 3HLLA 2I7QA 2NP8A 1JKLA 2YIWA 3FXWA 5EYMA 5CNOA 1XH6A 2YDJA 2I40A 2XK4A 4K2RA 4M0ZA 3BE2A 3RWPA 2PZYA 3PSCA 1H1RA 3QKKA 4FA2A 4DHFA 2QVSE 4C36A 5C1QB 5JN2A 4D4YA 5CU4A 2C5NA 3CLYA 5AMNA 4KRDA 3ZUVA 3VUGA 5IUGA 3FLQA 3SA0A 4X6QC 5C4LA 5A6OA 3RZBA 3VO3A 5FDPA 4FOCA 5AAGA 5AV4A 1ZARA 4MXZA 1A9UA 5D1JA 4QQTA 4IJPA 2CCHA 2PZIA 2WIPA 4IAAA 5EM7A 3AT3A 4X7QA 2X6EA 3HP2A 4EWQA 5DT4A 4GS6A 4ONAA 2UW5A 4QQCA 4LRKA 4M69A 4A9UA 1PF8A 3NRMA 2PYWA 2C6LA 4DG2E 3FZOA 3I81A 4IVCA 3I0QA 3KKVA 4OUCA 3AG9A 3PVWA 3COIA 4A4OA 2ERKA 2R5TA 5D41A 5BVNA 2HZNA 2HENA 4UMTA 1FVTA 2C6KA 5FXRA 1QPEA 2W05A 1R78A 4PV0A 3FMJA 4DC2A 3PTGA 3LFDA 4ALWA 4BZNA 3ORNA 4ERKA 2QG7A 3QTZA 2ZB0A 3HVCA 4L42A 3CGOA 4R5YA 5E8SA 1FVRA 3ZBFA 5AA9A 3UVQA 4JBQA 4BI1A 5CSPA 1NT2A 2YIQA 4JAJA 2CKEA 3VNTA 4NL0A 4P4CA 5E8WA 3MH2A 4I20A 2E9NA 4PNIA 3EB0A 3KB7A 3G9NA 3JVSA 3BKBA 3PUPA 4BDEA 4DEBA 4R77A 2GCDA 5CF4A 4B6LA 3TDWA 3DFCB 2YCQA 2OGVA 2UW8A 5CI7A 3O96A 4MH7A 5IEXA 4L68A 3FMLA 4RT7A 4NFNA 4GFMA 4U45A 3QKMA 4W4XA 3O7LD 1FMOE 3MFSA 4C8BA 4BDAA 3DQXA 4RG0A 3FUPA 3DPKA 4A9SA 2PL0A 5CF5A 1U4DA 5FTOA 4CD0A 5LQFA 1W83A 4YLLA 3C4FA 4AXAA 2OK1A 3P86A 1H26A 2CDZA 5HIEA 2W0JA 1BMKA 3UNJA 3PZHA 2F2UA 3MFUA 4HNFA 5CANA 3L1SA 2VWWA 4K8AA 3H9FA 4I21A 4JXFA 3U9CA 4CTCA 1EH4A 2ZOQA 3D83A 2CGVA 3UBDA 3ZO2A 4QD6A 4F7LA 4DBNA 3KFAA 4L7SA 5C27A 1FPUA 1OKVA 3Q4ZA 3A7IA 2WGJA 2FSTX 3Q32A 3PA3A 3PZEA 1WBPA 5AUVA 3T9IA 5IDPA 4D0XA 4RWJA 3WE4A 1Q8WA 4YJPA 1NVRA 3NNVA 4FEXA 2XK8A 3C4EA 4TN6A 1TQPA 2XK6A 3V5JA 5DWRA 5IEVA 3MVMA 5AADA 5LJJA 3Q6UA 5L2WA 3TIYA 2UW3A 4F70A 5A4QA 5EHLA 4D2SA 4BDCA 4BIBA 4V01A 1JNKA 5HICA 4DTAA 1RQQA 3QXOA 3AMYA 2YLFA 4NYEA 3OCGA 4R6VA 5FTGA 4YLJA 4LYNA 4I5HA 4DGNA 3HRCA 2UW6A 4USDA 4WG5A 5KE0A 3CJFA 3LJ0A 4ACMA 4USFA 4C34A 2E9PA 4FKSA 2CGUA 4F6SA 3Q9YA 5CU0A 2C5OA 2VTHA 4F99A 4JX7A 3DKOA 4I6FA 5EW8A 2J0LA 5JRQA 4QPSA 1WVXA 2J5FA 4ANMA 3G51A 4CLJA 3DBEA 4FZAB 4O82A 5A9UA 2AC3A 4GRBA 5IPJA 2C0TA 3RINA 1BX6A 3KXNA 3D7TA 4H1JA 3V5WA 2JEDA 3MY0A 2ITQA 3KMMA 3AC3A 3R1YA 4FICA 3R63A 2PZPA 4QTBA 2Q0NA 3NR9A 4UMQA 4WNMA 4XP0A 3ZC5A 5KO1A 5JGAA 4AT3A 3HEGA 2BAKA 3QD4A 3CKWA 3K3JA 1J1CA 3OS3A 4FSQA 4U7ZA 4EORA 1SMHA 2CGXA 1L3RE 4HCVA 4IZ7A 5I9VA 2XNBA 1WBSA 2EXCX 3AT4A 1ZMVA 3Q6WA 2XNOA 3H4JA 4AU8A 4IVDA 3UPZA 5BVKA 1J7UA 1W98A 4AAAA 3RVGA 4Y72A 2J0KA 3QCSA 3NPCA 3UMWA 5GIPE 5L6PA 3Q2MA 2JBPA 3HX4A 3OEFX 3PSBA 3UTOA 3JUHA 2J6MA 2ZM4A 2CMWA 4F9CA 4P7EA 2BFYA 2RFSA 3W2PA 1I44A 4QP2A 5CY3A 3JY9A 4MQ1A 5E90A 4F9AA 2G2FA 4D58A 3N9XA 3RCJA 1R1WA 1JKTA 4RX8A 4FSWA 3QUPA 4BBMA 4BCIA 3PIYA 5IMEA 1ATPE 4K77A 3QTUA 3PJ1A 3V8SA 4NCTA 3E5AA 4WG3A 1U5QA 1ZYCA 4AQCA 4S2ZA 4JDIA 1WVWA 3H0YA 4ZY5A 2C6MA 1ZOHA 3KY2A 3TZ9A 5HD4A 1H27A 1M2PA 4FKVA 4AW0A 2ITWA 2YWPA 4I0RA 2GNGA 5HESA 5HG8A 3ZFMA 4A9RA 4Q9SA 4KAOA 3AC1A 3DB8A 2WXVA 2Y8OA 3WBLA 5FXQA 1F5QA 4Z9LA 3ROCA 4EKLA 4PUZA 3VS3A 3RNIA 3REPA 1QPDA 3BE9A 4WA9A 4YHFA 4RJ7A 1O9UA 2JC6A 4F9WA 2PUIA 3C4CA 5CX9A 3CKXA 4YNOA 3FKNA 4DF3A 2VWYA 3K2LA 3A7JA 3R7GA 4DH7A 4KIQA 3SX9A 3VBXA 4BTJA 3PWDA 4DFBA 1FBNA 4JVGA 4KIKA 3R9HA 4ASXA 2GNLA 2YLEA 4CVAA 5DE2A 3D94A 4DA5A 4QPAA 3ZZEA 4TWPA 4D4SA 5KMIA 3I79A 4UXLA 4BHNA 3LPBA 2OH0E 3H0ZA 4LGHA 3T9TA 3KA0A 3EQDA 1YWNA 2VX0A 5BVEA 3U54A 4XOYA 3D14A 5GZ9A 2O0UA 3TNWA 2V5QA 2X39A 4RC3A 1WZYA 3GFEA 2OXYA 4X2KA 1QPCA 4FNWA 3FXXA 4FOBA 4RJ4A 2PUNA 4FR4A 4EQCA 3FQSA 3TZ8A 5A4LA 3OWJA 3L8XA 5CSXA 4FTRA 3MS9A 2X0GA 2BTRA 3VBYA 3W2OA 2LAVA 3LVPA 1YOLA 1E1XA 4WG4A 5EM8A 2R3JA 3C4XA 3MIYA 4QOXA 4M97A 4ZTHA 5K0KA 2J90A 4HGEA 3DK7A 4FV8A 2VTPA 3UZPA 4BR3A 2J0JA 1BLXA 4J53A 1Y6BA 3GXLA 1GIHA 1KWPA 4L00A 4GFGA 4LFIA 1JVPP 1BYGA 2EU9A 2ITVA 5EOLA 2VV9A 3R2YA 3QRIA 3CPBA 2F7EE 3MH3A 2IZSA 3THBA 3TUBA 1W84A 2P2IA 4I4EA 3DNDA 2UZLA 4NIFA 2J50A 4GYGA 4MF1A 4FZ7A 5A4TA 1OKZA 2X7GA 1LEZA 1CKIA 5H2UA 1JKSA 1R3CA 2UVZA 4IM3A 3EQBA 3PSDA 3KCFA 5AX3A 2PVYA 1WBOA 1OL1A 2XUUA 2WMUA 2XMYA 3AC4A 1SYKA 3HZTA 1B38A 3V5LA 3AOXA 4JX3A 4DGGA 4YTCA 5IA3A 2EXEA 2X7FA 5KNJA 3EFKA 5FUTA 5HE0A 1YHVA 3BCEA 4FBXA 3OMVA 3SOAA 3HGKA 2IZUA 4U8ZA 1M7NA 1PKDA 4BCQA 4CFVA 4EOSA 3BU3A 4QMLA 4GMYA 3U6IA 4EBWA 2PVKA 4QP9A 3QYZA 5IQDA 4E6CA 3GFWA 3S1HA 4JDKA 3AD5A 1I09A 3NGAA 2PTKA 5AM7A 3TNQB 3FE3A 4FC0A 5AP4A 4ZJVA 3GU8A 5K5XA 4RVKA 2QI8A 2YABA 4C59A 2QQ7A 2BFXA 3NUNA 1H00A 3KXXA 3A8WA 4D5HA 3BBWA 1ND4A 3BBTB 4YU2A 2GPHA 3ACJA 2PSQA 4PDPA 4XG7A 2CSNA 2QONA 3JYAA 1TQIA 3TN8A 4KWPA 2Z8CA 2ZMCA 3CC6A 3KL8A 4YC8A 4YNEA 4MNEA 3TZ7A 4LQMA 3OY3A 4L44A 3FLWA 3QQGA 4LOQA 4WIHA 3NUAA 2IG7A 3GQLA 2PY3A 3FLYA 2BMCA 3TT0A 4K0YA 2G15A 4F7NA 3IOPA 4EOPA 3GCSA 4O0VA 5CZIA 1KE7A 1V1KA 5CI6A 3LFFA 3IGGA 1V0OA 4RA5A 5CSHA 3AC2A 3G15A 3MTFA 3C51A 3A7GA 1H1QA 3I6WA 3V01A 2A0CX 2IO6A 2R3KA 3E3BX 3HUBA 4IADA 3RM7A 5L2SA 2GNIA 1P14A 2O3PA 4H05A 2JFMA 3QX2A 5BVWA 3LXKA 4ZSJA 4EYJA 3MPMA 4M15A 4C37A 2ITNA 2ITXA 3F5XA 4RWIA 3NUXA 3PPZA 2JDVA 2UZOA 4QP1A 4WD5A 4BDJA 3UPXA 3HMPA 5CENA 4AE6A 4O7TA 3OT3A 1YI4A 3TM0A 2UW7A 3DQWA 4FSZA 1MP8A 2H34A 2JAVA 5KCVA 3B2TA 3QGWA 4CEGA 3P79A 1UV5A 3O71A 2VX1A 1B6CB 4DEHA 1XQZA 2WMTA 2DS1A 3NMUF 3MWUA 3V8TA 4CXAA 3WF8A 4A9TA 2VN9A 2VTNA 3UOKA 3PWYA 3UQGA 4O81A 2R2PA 5GINE 3DBQA 4GUEA 3GC9A 4YJTA 3S4QA 3MH0A 1VEBA 2QOOA 4YPSA 3RWQA 2VTRA 5BPYA 4YO4A 3SDJA 4MWHA 4JG6A 5IH4A 1WVYA 4FG7A 4WRGA 2C6EA 3CTHA 3UOLA 3DU8A 3QC4A 4EQUA 4EL9A 3BLRA 2PZRA 4IAYA 1M2RA 4I41A 3P78A 4WSQA 3ORLA 4GVAA 3W2SA 5I9ZA 2WMRA 3DBDA 4GK2A 4L8MA 3PLSA 3DTWA 5L6OA 1G5SA 3KC3A 4GVJA 5TOZA 4HZRA 2VTIA 3TEIA 3MI9A 1YXTA 4DEEA 2BRGA 5LCKA 2ZMDA 3Q9ZA 3I60A 4BDKA 3EQFA 2A4LA 4DT9A 1KSWA 3Q9WA 1MRYA 2C3LA 4BCGA 2CN5A 3GC0A 4WNPA 1ZWSA 2BZHB 5F4NA 4R1YA 4TYIA 4GJ2A 5CEIA 4RIOA 5IQGA 1S9IA 3OT8A 4YTIA 3VAPA 5K3YA 4CMTA 4DH1A 4ZAUA 4FV9A 4MWIA 1M14A 4WUAA 4FTKA 1PJKA 2YCRA 2JAMA 3G9LX 1KE6A 2XNEA 2BR1A 3A4PA 3BQCA 1AD5A 3IW7A 4GU9A 4L67A 4FT9A 3VRZA 5AP3A 1JAMA 4RX7A 3ZTXA 4NCTC 5AP0A 3F3WA 1GNGA 4HVHA 4XJ0A 2I0HA 4O0WA 4YURA 4KS8A 2R3HA 3CEKA 5HBEA 3LFAA 3HKOA 1OITA 4F08A 1P4FA 1Q99A 3ZM9A 5AV3A 2CKPA 3OY1A 2CPKE 4FI1A 2XNNA 3I4BA 4FZFB 2OKRA 5CTPA 4YJUA 5C01A 1PY5A 3U6HA 5M06A 5B2MA 1M52A 3COMA 3W33A 4IX4A 3KVWA 3NWWA 2QLUA 3IOKA 3KN6A 5EW9A 2IW8A 4DITA 3C7QA 3PY0A 4EQMA 2YDIA 4KKGA 2FUMA 2UW4A 3E92A 1Y8YA 4RLKA 2OG8A 5I9YA 3LFBA 4F9BA 4ZXTA 4RIYA 1GOLA 4XH6A 1H07A 2PVJA 3FAAA 5DBXA 3ODYX 4O0RA 3VHEA 4YTFA 1ZYLA 2ETMA 4YZCA 2WELA 5CAQA 3HAMA 5JFWA 3BHUA 3VBWA 2I0EA 2XNMA 3QTWA 4ACDA 4DH3A 3KULA 2Y4IC 4ANBA 5AUXA 5FBNC 5L2IA 3R8PA 4ZOGA 5EQPA 2IVTA 3I7CA 3DB6A 4BDHA 2VTOA 4PPCA 1Y8GA 4IAKA 2R3RA 3JVRA 3ZRKA 3W18A 3LFEA 4ITJA 5HU3A 2XKFA 3FY2A 5M4FA 2R64A 3G0FA 5IA1A 2VWIA 2R3MA 4L9IA 1MQ4A 3MVHA 1Q24A 3ANQA 4Q5EA 3V6SA 2Z7RA 4MCVA 2WD1A 3NEWA 3OOMA 1V0PA 2BDFA 3WF6A 3QF9A 4CQEA 5BVFA 3EMGA 5CQWA 2PULA 5H8EA 2WEIA 4JJRA 2F9GA 2F2CB 2WQMA 3EH9A 3C0IA 1WAKA 5JRSA 1KE8A 2XIZA 4EJNA 3II5A 3CPCA 1JSUA 4UMRA 3OP5A 4MXAA 3P7CA 4CYIA 4FTJA 4FIGA 4UN0C 4OBOA 4CFNA 2UV2A 4FTLA 5HD7A 4AZVA 3GGFA 5DOSA 2IN6A 4MD7E 4YJOA 1HCKA 2ZV7A 4HPTE 3U4WA 3V5TA 1PXNA 4QMPA 3F2AA 3FSFA 3IECA 3LW0A 4W8EA 5JZNA 3UO4A 3GP0A 3UODA 3MJ2A 3QFVA 1Q8TA 5C03A 4FKOA 3QHWA 4CZYB 3COHA 3PXQA 4FGRA 3FZTA 3I1AA 3QHRA 4KBKA 4TWOA 4XNEA 2WTJA 3WZEA 5CWZA 4BFMA 4F9YA 3OXTA 3F3TA 3FWQA 2VO6A 3FQHA 2WU7A 3EN6A 5E9EA 4JBVA 3MPTA 4XV1A 2YZLA 4OR5A 2RSVA 2XJ1A 2B1PA 3FMNA 3HMNA 4AGCA 4F1MA 5IA4A 4MF0A 5ACKA 4CKRA 1H4LA 4DINA 3D2IA 4IWPA 1PMVA 1Q3DA 4RWKA 5HKMA 1IAHA 2HOGA 4Y5QA 4BCHA 4NUSA 4E6AA 5I9XA 1HOWA 1E9HA 4WT6A 3MJ1A 2XK3A 3GENA 2W17A 4PY1A 5KMLA 2PE0A 3VBTA 4QQJA 4TYEA 4D1ZA 1UKHA 4FEVA 5KBRA 3JPVA 2H9VA 5I3RA 5LWNA 4KINA 5CAOA 5FTQA 4YMJA 2NRYA 4OTDA 4EC9A 1REKA 3VBVA 4BYJA 2OW3A 5AA8A 3NUUA 5KZIA 1K3AA 3KCKA 4NH1A 3KQ7A 4OTFA 5H3QA 5D11A 3RKBA 5C4KA 3NS9A 4C4IA 3TDVA 3OG7A 3P23A 1G8SA 3V8WA 4BZOA 3MBLA 1H1PA 3CY3A 3PG1A 4D28A 1YVJA 1YOMA 4O0YA 3IONA 3F2NA 4PPBA 5IQFA 1LEWA 3HMIA 1JWHA 2DYLA 2VGOA 4KB8A 4YZDA 5C9CA 3T3UA 4CCUA 4AFEA 4C38A 4EOOA 2KTYA 4YSJA 3VC4A 3QCYA 4DEIA 3FHRA 4GG5A 1WFCA 5HX8A 1UU9A 5TKDA 5CYIA 5JH6A 5I9WA 3NDMA 3FKLA 5DR9A 3WZKA 2QOKA 3O8UA 3TCPA 4NM0A 4XG4A 1H0WA 4FKQA 3ORTA 2W4JA 3DA6A 2JITA 3P0MA 1MRVA 4XG2A 3VW6A 4E26A 5K5NA 2UW9A 1UNGA 3E3PA 4HVSA 2NRUA 4U9AA 3VS0A 5LWMA 1YWVA 2W5HA 4FTOA 4LMUA 1RDQE 2HXQA 4QP7A 3VQUA 3EQPA 4E4LA 3IDPA 3CQEA 4IVBA 4S34A 4DFLA 1BL6A 4HGLA 4S32A 5AUWA 3RMFA 3IGOA 3GOKA 3O17A 4OLIA 3WOWA 4DN5A 1FGKA 5J1VA 1OKYA 3G33A 3PA4A 4CNHA 4QQ5A 4DFXE 4O7NA 1OPJA 3NNUA 1OECA 3HDNA 1NA7A 4JS8A 4M3QA 4MAOA 2E2BA 4UWYA 4E4MA 3S00A 3U9NA 4FVPA 4F7JA 5H8GA 5HZNA 3PJ3A 4J1RA 4R3PA 1JLUE 4ZTRA 5FBOA 1OVEA 3RBWA 4RFZA 5EM6A 4YJQA 4HCTA 3ZDUA 4E4NA 4UMPA 3PPJA 4TPTA 5HGIA 3Q2JA 3LQ5A 4AZTA 1Q41A 3TV4A 3RAIA 5HBJA 3NYVA 3W55A 5E7RA 5JK3A 3DCVA 4FT5A 2J5EA 4TYHA 5L2TA 2GDOA 4M66A 5FG8A 2YAKA 1MRUA 3VUDA 3ZUTA 2GTMA 2CGWA 3KK9A 1GJOA 2XNGA 4NW5A 3MPAA 1YI6A 5ACBC 3LKMA 3MA3A 3IDCA 2CLQA 2HYYA 3PXYA 1OL2A 3LCDA 1OIQA 4S30A 4MBJA 3EFWA 4H36A 5CEQA 4ASDA 4AW1A 4Q2AA 3BGPA 3O2MA 2QOHA 4Q5HA 4C35A 2W9ZB 4RVMA 4G9RA 5ANIA 3HV4A 4V0GA 3ZXTA 2A2AA 2I0VA 3QRUA 3LCOA 4CT1A 2FO0A 5AUZA 4FYNA 4DEDA 4TTHB 1AGWA 3QRTA 3FLNC 3R8LA 3C1XA 5CQUA 4X0MA 4YGAA 1F0QA 4EZ7A 1PYXA 4QP4A 3UG2A 3W2CA 4AN9A 3T8OA 1JSVA 3FV8A 5LVLA 4FIIA 1OUYA 4EOIA 4OBQA 3PP0A 2YZAA 3GUBA 3UVRA 1M7QA 1PMNA 3C5IA 2VNYA 3QUDA 2ITZA 4QNAA 2W1IA 2VX3A 4FV2A 4FIFA 4L3JA 4QYEA 2J4ZA 3A4OX 4XRJA 2VUWA 1H1WA 2FSLX 2HK5A 1OL7A 4XOZA 5A46A 5IQBA 3OWKA 4MXCA 4NM3A 5HORA 4M67A 3EQCA 1OIRA 4W4WA 4OTPA 2X81A 2XRWA 5FDXA 3LMHA 3ORPA 4IE9A 1H01A 4BBEA 4Q9ZA 3C50A 2FSMX 3BZ3A 4YUQA 2CKOA 2JLDA 4O1OA 2VZ6A 3UVPA 3R1SA 4JI9A 5CVGA 3VS5A 2REIA 4FZDB 4RA4A 3HRFA 2GQRA 4Y85A 4E4XA 2IVSA 4BICA 2IWIA 2G2HA 4BDIA 3C4WA 1VZOA 3TTJA 4TWCA 4EHVA 3HMOA 2W1DA 3R8VA 5FWKK 2X2KA 4DAWA 4EUUA 4QMZA 3E88A 2H96A 3FMDA 3KRWA 3DTCA 3W10A 3W2RA 4BVUA 4BDGA 4ZSGA 3FZSA 4O7SA 3DGKA 3NAXA 4JQ8A 4FUXA 1H28A 4XHKB 3F3VA 4CSVA 3NVMB 3TV7A 3FQEA 4FODA 3MDYA 5I9UA 5K9IA 4C4JA 3Q53A 3FZPA 2P0CA 3C9WA 5E8YA 4HVDA 4JLCA 3F5GA 3D7ZA 4BKZA 3I5NA 4PMPA 1ZY4A 3B2WA 4X21A 5FP6A 3KK8A 3ANRA 3S3IA 5IQHA 2GS7A 2X9FA 5E8VA 3AGLA 4EHZA 3FBVA 5K4JA 3IW4A 4RC4A 5HNBA 5B2LA 3RP9A 3FLZA 4HYSA 3CIKA 3HA6A 4L46A 3ZM4A 2W4KA 4BCPA 4Z16A 4GJ3A 3M2WA 3NX8A 4E73A 5HG7A 5HI2A 3EN9A 3Q52A 3EHAA 4QYHA 2RFEA 1ZOGA 3MB7A 2A19B 3DK3A 3IQ7A 4ZEGA 3VJNA 4ALUA 4U79A 4IB0A 4J8MA 4ITIA 4M69B 4KKEA 4PTCA 5CU6A 4AFJA 3BLQA 2WTDA 4HCUA 4ANQA 2OU7A 2VTTA 4N57A 4DEGA 5HVKA 5GIOE 3NYNA 3OUNB 3R73A 5T68A 4ZTMA 4C57A 5M57A 4MKCA 4H1MA 3SV0A 3F88A 4FTQA 3CP9A 2JBOA 3LFQA 4M12A 3RALA 4E6DA 4AX8A 2C3KA 3BHTA 2WIHA 4GIHA 4JQEA 4PNKA 3E63A 3QA0A 3QTQA 4I5PA 4OAUC 3NNWA 2VNWA 4O83A 4XUFA 3PJCA 4WHZA 4RZVA 4XLVA 1IRKA 2UVXA 4Z3VA 3PXZA 4RGJA 3IS5A 4GYIA 5EDQA 4DTKA 2HY0A 3VN9A 3ALNA 2OI4X 2QNJA 2VRXA 3KRRA 4LMNA 4PTGA 4TYGA 4NEUA 3NW5A 3PLAE 4FKIA 3PYYA 1DI8A 4BCMA 2VAGA 2WQBA 4YBKA 3EFLA 3IW6A 3OTVA 4CQGA 3WI6A 3D5WA 5GHVA 5FEEA 1OGUA 1UNLA 3G5DA 3HL7A 2R9SA 4QMOA 2O63A 5M09A 4ZS4A 3FLSA 1W0XC 3KF4A 3SKCA 3QZGA 3D5XA 3NW6A 1IR3A 4PL4A 4UZDA 5CVHA 2C6IA 1WMKA 2QLQA 1XH5A 4FL1A 2GHGA 1H8FA 4RJ3A 5DT0A 4IM2A 4WKQA 2C3JA 3LXLA 5DH3A 4J8NA 2ONLA 3KXGA 2XJ0A 4I1ZA 3KXHA 4HVGA 4ZLOA 3EN4A 3BV3A 3I6UA 4FTIA 4F6WA 1FOTA 4JDHA 3UOHA 5HTCA 3LMIA 1GZKA 4C4GA 5IZFA 4XBUA 2GNFA 2R4BA 3BHHA 1QCFA 3SQQA 4YC3A 2Z60A 5HTBA 3DAEA 4FK6A 4Z7GA 3EKKA 5JT2A 4C2WA 5EK7A 2V7OA 1U46A 3LJ2A 4FV3A 4O0XA 4G17A 4QRCA 4D2VA 1OBGA 4FNZA 1M2QA 5C8NA 2BZJA 3ZONA 4PMTA 2Y4PA 3DKGA 4DH5A 2AC5A 2WMXA 2JFLA 2XBJA 4JRVA 3WYYA 3AD4A 3QLGA 3QTXA 4DH8A 4N70A 4TWNA 5M44A 3K5UA 1JKKA 3BQRA 5IUIA 3DXQA 4AW2A 4G31A 2UZBA 2XCKA 2B9FA 2WTCA 3VF9A 3CY2A 1PXPA 5IDNA 3E8NA 3HV3A 2XK7A 4DYMA 3KRJA 5KMMA 3OZ6A 3UQFA 2OSCA 5AP5A 4D0WA 5JKGA 3MY1A 4IFGA 4O91A 5CXZA 5LVNA 2BILB 3TUDA 5FP5A 3ZLXA 4GV1A 3UIUA 4BDFA 4C02A 4I5MA 4ZZOA 3RK5A 1G3NA 4I3ZA 2WB8A 5DNRA 4G3EA 4PL5A 3OW3A 5T6KA 4QMNA 4IJ9A 2Y7JA 5M55A 5E1EA 3ZO1A 4USEA 3D7TB 4M68A 4AUAA 4NU1A 3POZA 1ZOEA 3E7OA 4N4SA 2WQEA 4BI0A 1KE9A 3LJ1A 4O38A 3T3VA 2XP2A 5E8XA 4M8TA 2R0IA 3DXNA 3QU0A 4ZY6A 4IB1A 4ACCA 2IZTA 3ZLYA 4UB7A 5DT3A 2VO7A 2OZOA 2G1TA 3EWHA 4EOQA 5FLFA 4NK9A 4QTCA 4IEBA 5CS6A 3ZBXA 4L6QA 3V51A 4FTUA 2QOFA 3GCQA 4U3YA 3QYWA 3R8ZA 2W06A 2X8IA 2BIKB 2QOIA 4YBJA 1XH8A 3PXRA 4M13A 5HVYA 4EJ7A 5IH6A 4MBIA 2HIWA 2PVNA 3UIMA 4FV6A 4EK5A 4K18A 5EKNA 4DT8A 3BU6A 3H10A 4TZRA 4BGHA 4EC8A 4EOKA 4M84A 4RPVA 4X2JA 2PWLA 3UYTA 3LZBA 3OCBA 3OCTA 4RMZA 1KUTA 3H3CA 4QMTA 2PMNX 4FL3A 3F5PA 3GCPA 4ASZA 4XG3A 4G2FA 1SNXA 2QCSA 3EYGA 2P55A 3QA8A 4ZSAA 3SRVA 3D2KA 3PE2A 3VUHA 2BAJA 2WFYA 2BRHA 3ENMA 5HCYA 5EHOA 1U54A 3A61A 1WBVA 3MYGA 4GT5A 3SXSA 5HHWA 4ZJIA 4TYJA 4WNOA 2WQOA 3FC2A 4GK3A 3S95A 2OBJA 3BYUA 3OHTA 2J7TA 4QTAA 3UP2A 5L2QA 2BRNA 3UGCA 4FKPA 3DJ6A 4QP8A 4CT2A 3CR0A 1IASA 5HOAA 2R3IA 3L8PA 2QOCA 2QHNA 2XZSA 5IUHA 2OXDA 2BCJA 2J0MB 2RFNA 4BZDA 3QC9A 4G3DA 1Y91A 4D4VA 4KIKB 4OTRA 2Z2WA 2R0UA 5JQ8A 2V62A 5HEZA 2IW9A 4XCUA 4LV8A 1Q3WA 5HU9A 1J7LA 3MVJA 5EOBA 2Z02A 4K1BA 2EB3A 3BYOA 4EEVA 2RG6A 3I0OA 2XVDA 2Y4IB 5DYJA 4E5WA 3QD3A 4F6UA 4K6ZA 4FSTA 5DI1A 5IISA 2YCSA 2PVMA 1PMUA 3NZ0A 1OIUA 1IA9A 1YWRA 3AMAA 4XV3A 5AP6A 2J9MA 5DRDA 4DGOA 1XJDA 2QOBA 4OTHA 1YXVA 2IZRA 4RSSA 3IO7A 1KV1A 5HNGA 4GKIA 3TZMA 3ALOA 3CTQA 3F7WA 3S2PA 3OCSA 4W8DA 3PXFA 2Z7QA 3RPVA 4B8MA 1IEPA 1CKJA 3FZRA 2BHEA 4CZTA 4ARKA 3CCNA 3DJ7A 3TKUA 3FI8A 1VR2A 3ZU7A 5TR6A 4CCBA 3TWJA 3W8QA 4GW8A 2GNHA 4WUNA 4FV0A 4RIXA 2W5BA 4U97A 2QR8A 4APPA 2GNJA 4O2ZA 4CMOA 4AE9A 1PXIA 4XBRA 4GL9A 5FXSA 1FVVA 3GI3A 3E87A 3OOGA 3OTUA 4NIFB 2O65A 4FTNA 5ANEA 3FI3A 5KMKA 2GU8A 3HV5A 3EZRA 3V5QA 1UVRA 3TJDA 5AAFA 5AEPA 4QTEA 3WARA 4EK3A 4IC7A 2WMAA 3R9DA 2QU5A 4AA0A 3DBCA 3VIDA 4AZFA 4KSQA 5BQ0A 4AW5A 4JDJA 5IKWA 4U81A 1GZNA 4R1VA 3ZH8A 1Q4LA 5DFPA 1PKGA 5DLSA 3FL4A 3BYMA 3PPKA 4E7WA 2WMWA 3FC1X 4ENYA 3A7HA 3PDTA 2R3OA 1O6LA 5AX9A 1FMKA 4U80A 4ZP5A 2PMIA 3LE6A 4DCAA 1PHKA 4XEYA 3TIZA 5DMZA 1XBBA 3SLSA 1X8BA 2X4ZA 3QQJA 3F82A 4M14A 2HW6A 4YHJA 5BUIA 4D9UA 3O8PA 5HO6A 3SXFA 4LRJA 4FTCA 5I3OA 4BDDA 3F5UA 1RE8A 2J51A 3R9NA 3ZXZA 4CRSA 2NNWB 1PXKA 2C47A 4O96A 3RAHA 2V55A 4X3FA 5J1WA 3LLTA 3ORZA 4ZMEA 2UZWE 4BL1A 3QQHA 3HDMA 1YI3A 2ZM1A 2DQ7X 4FTMA 3IK3A 4MNEB 2W96B 3UNKA 3QAME 4NJ3A 3ZC6A 4BIEA 4CKJA 5KKRC 4FVQA 4PTEA 3IDBA 3R0TA 3BYSA 4G6NA 4NKSA 1WBWA 2OF4A 1ZZLA 2ONLC 5AR8A 5TO8A 3FKOA 3DT1A 5I4NA 3U6JA 3GU5A 3ZO3A 1Q5KA 3ITZA 2WKMA 3FXZA 3B8QA 4CKIA 1KOBA 4C4FA 5EYKA 2YEXA 2V22A 3R83A 4XYFA 5G1XA 3UNZA 2XM8A 2GS2A 5DN3A 2R3GA 4AGWA 2C6DA 4O0SA 5IH5A 4ZZMA 4AA5A 2XIYA 5HTIA 4BN1A 1OL5A 3QZIA 3GNIB 4V05A 1GY3A 5FEDA 4AOTA 1H24A 3OVVA 2HELA 3GU4A 1P2AA 2GFSA 2HZ0A 3I5ZA 3CQUA 1FGIA 3R8MA 3ZFYA 4P5ZA 3UJGA 1OZ1A 3BELA 1DS5A 2UZVA 1SM2A 4OW8A 2CNQA 3H30A 3PE1A 4JR3A 4U41A 4HYIA 2RFDA 2XYUA 2C1BA 2X6DA 4P5QA 4XP3A 3ZEWA 4AA4A 4MXXA 4EH2A 3O51A 2W1ZA 5HCZA 4ANSA 5CALA 1ZYJA 4NTSA 3M1SA 2RG5A 5J79A 3IG7A 2BUJA 2V0DA 4LL5A 2BROA 3FI2A 3FL5A 4QTDA 5ANKA 4FV5A 2Y0AA 3TXOA 3VBQA 1VYWA 2WMVA 3PRIA 2I1MA 1UNHA 4BCOA 3OFMA 5AIRA 3EQHA 3UZRA 2PK9A 1OUKA 4FNXA 5KMOA 4U5JA 2HCKA 4H58A 4F09A 1XHAA 4KABA 4CMUA 4RJ8A 5LVMA 4BY9E 2BRMA 3EQRA 4O27B 4MXYA 3BPRA 3SG8A 4FEWA 1J3HA 1REJA 2XIKA 5DG5A 5F1ZA 3ULZA 5AAEA 5L4QA 3KXMA 4PX6A 4G3GA 3PY3A 2W7XA 4J95A 5LMBA 4FSYA 4G6OA 2V7AA 3ATTA 4ZIMA 5EFQA 1PMEA 3BIZA 4U6RA 2CHLA 3D9VA 4NM7A 4NZWB 3BHVA 1YDTE 3E64A 3JS2A 3LHJA 4D1SA 3ZEPA 1NY3A 4MD9E 4ZY4A 2OH4A 3NCGA 4ANNA 3S0OA 4LGDA 3LFCA 3QD2B 2OXXA 3MSSA 4XMOA 1YOJA 2G01A 4JR7A 5HIBA 3OF0A 1DAYA 4L7FA 2Q83A 2B55A 1R0EA 1GAGA 2QO7A 4ACGA 5L8LA 4D2RA 1OMWA 4IB5A 2Y9QA 5LXMA 4FV1A 2O64A 3NUPA 1CMKE 1YDSE 4KSPA 1IA8A 4R3RA 4C3PA 3CD8A 3CJGA 4EH8A 5L8JA 2QOLA 3HECA 3D5VA 4RIWA 4NJDA 2WMQA 2YIXA 2J0IA 2WTKC 3MIAA 3DY7A 3ORIA 2GHMA 4I6QA 2FYSA 4HJOA 4GU6A 4BTFA 3UZTA 3QD0A 2GMXA 1J91A 4B7TA 5EQEA 4RVTA 3GOPA 2PMOX 2QOQA 3AT2A 4WOVA 3WF7A 4ID7A 2ZDUA 4UWBA 3ORXA 5CT7A 5DPVA 2NO3A 4CG9A 2UZEA 4L3PA 4YZ9A 4W4YA 3FZ1A 3BI6A 2UUEA 3IPHA 1JPAA 1SZMA 3R1QA 3UIBA 5IF1A 4OAVB 2E9VA 2CNUA 4ZTNA 4EHEA 3LM0A 5ETFA 4HVIA 5J7HA 3FPQA 2QKWB 3E62A 4EUTA 2BHHA 4K9YA 4DEAA 4DG0E 2ZM3A 4RIYB 2XKCA 3LFSA 5ETCA 3QQUA 3LIJA 4PQNA 3WZDA 4IDVA 3DXPA 3JR1A 4CFXA 3QWJA 2UZNA 2YM7A 3W1FA 2EUFB 3KRLA 4PMSA 5BMMA 2I0YA 4YPDA 2VO0A 5AUTA 5AR2A 3BHYA 3KULB 1TQMA 2IVVA 2WZJA 3O7LB 4G6LA 3TUCA 3KXZA 2RF9A 5HE1A 2PUUA 4BGGA 4FE2A 2QC6A 4M7IA 5L8KA 4GKHA 4MHAA 3UE4A 4H3QA 1M17A 3G2FA 4FG9A 5AUYA 4S33A 4CFMA 3R7IA 4XV9A 3GT8A 2XBAA 4G9CA 3LQ3A 4LUDA 4RFYA 3R6XA 5AM6A 2VD5A 1SVEA 2IPXA 4J98A 4CYJA 3L8VA 2Q0BA 4ALVA 1VYZA 3QTRA 4G5JA 4IXPA 3GC7A 1KV2A 5LMKA 3FPMA 3VF8A 3OUKA 3QBNA 4FSMA 1UWJA 3VUIA 4FIEA 3UG1A 1Q97A 1W8CA 4HYUA 3SG9A 3BYVA 1XO2B 4D2WA 4RQKA 3BV2A 2ETRA 4PRJA 3BGZA 4TL0A 1LPUA 5AR5A 3R28A 3GC8A 4F0IA 5D7VA 3EQIA 2E9UA 5F20A 4PP7A 4JG8A 5LCJA 4TXCA 3E93A 2ERZE 4IACA 4HOKA 1T45A 2BKKA 4J99A 5ANOA 3CBLA 3QCXA 4QYYA 2BDWA 2HWPA 4H3BA 4V04A 3PXKA 2IVUA 4NTTA 3SW4A 2B7AA 3GEQA 4QP6A 3OD6X 2A1AB 4IANA 4NSTA 5C8MA 2C3IB 4U43A 3G0EA 4RIWB 4FGBA 3PVGA 2B9JA 4RJ6A 3FYJX 4FV4A 5HLNA 1YKRA 4EH3A 5JFVA 4YHTA 4GIIA 5CLPA 5D9HA 2GSFA 3L9PA 4ANOA 2PVRA 5AP7A 3LOKA 2AUHA 3BX5A 3QZHA 4FKWA 5AJQA 2BDJA 2VWXA 4I23A 3D5UA 2YM6A 2X2LA 3KF7A 1PRYA 4U42A 3JXWA 4FKGA 2YHVA 3L9NA 4IAIA 3R9OA 1TKIA 3IKAA 4QT1A 3RHKA 4D5KA 4FIHA 4XLIA 5EYCA 1KOAA 4JT3A 3VULA 4AG8A 5HQ0A 5J5TA 3I7BA 4EHGA 4X3FC 2W4OA 5JQ5A 5IA0A 3KRXA 3LCKA 1PYEA 4QMUA 1G8AA 3DV3A 2C6OA 4LOPA 3N51A 2JDSA 2HWOA 5J95A 4UYNA 4R78A 4YZNA 4GK4A 3QLFA 3VUKA 4C61A 3F7ZA 5LVPA 3O8TA 2YDKA 4KRCA 5DA3A 1Z57A 2C5YA 3ERKA 2EWAA 3SW7A 3SD0A 4ZTLA 3DLZA 1YXSA 5CEMA 2GQGA 4IM0A 4Y5HA 5AUUA 4FKTA 4PWNA 5IQEA 1PXOA 3PJ2A 5BUJA 3VJOA 5ANJA 2VTLA 4XX9A 4AZSA 1NW1A 1ZRZA 2C6TA 2QG5A 4EH6A 4UMUA 2UZUE 1A48A 3DZQA 3FSKA 3DDQA 3PVBA 3MESA 2B4SB 3Q4TA 2YERA 4BKYA 4AT4A 4BWPA 1UKIA 1UU7A 2P4IA 3F66A 3DBFA 4WNKA 5JMSA 4S31A 4NM5A 5E8TA 3DS6A 3G6HA 3PA5A 1S9JA 4BYIA 1GIJA 2P33A 2PHKA 4AZEA 3B8RA 3F61A 4O7RA 3MV5A 4MQ2A 4AP7A 4AOJA 3U55A 4YC6A 4AF3A 4D1XA 2RGPA 3PP1A 4BIDA 3W8LA 2PE2A 4KUJA 4IH8A 4XG6A 3EJ1A 2KULA 4FYOA 4AACA 1YDRE 3F2RA 4IX5A 1U59A 2B52A 2BAQA 5HIDA 3P7BA 2VU3A 4N6YA 3NVKI 2I6LA 4OBPA 4I24A 4J96A 3VWAA 4F0GA 4M0YA 2UVYA 2OJGA 2X7OA 3L8SA 4MNFA 3BEGA 5EI2A 2WAJA 4BGQA 1PW2A 1Q8UA 2JDTA 3U51A 2BVAA 4GT4A 4LI5A 3D0EA 5DVRA 4CFUA 2JKMA 4X2GA 3ELJA 2YISA 2XKEA 4KIOA 2WHBA 5FEQA 2ZAZA 2EXMA 5E8ZA 2WMSA 5CU2A 3W2QA 3WIGA 4OT5A 5F95A 4N6ZA 2X8EA 3JY0A 3BWFA 1BL7A 3TKHA 4TYHB 3DOGA 4FKLA 2NPQA 4FZ6A 5CAUA 5HO8A 4TKSA 5KUPA 1XR1A 2G2IA 4KKHA 4Z7HA 2F4JA 2PVFA 2C68A 3KEXA 4EZ5A 5JSMA 2F7ZE 1MQBA 4WRSA 1OPKA 3A8XA 3BWJA 3MGYA 3NCZA 4QMWA 4YZBA 4RX5A 3C0HA 4FMQA 2QHMA 4O21A 3H9OA 4GSBA 2FSOX 4OTQA 4EWHA 2VGPA 3KMUA 2XIXA 2XS0A 3Q4CA 3RNYA 4R7BA 1BI7A 2FVDA 3AC5A 4LOOA 3SC1A 4DLIA 4V0GB 4C4HA 2VWUA 2XA4A 4Y73A 3EOCA 3BGQA 3TTIA 4ZSLA 3AGMA 4QO9A 2PPQA 3VVHA 2JD5A 3ID6C 4Y95A 4A9YA 2C0IA 4FSRA 3ZZWA 5LVOA 3CGFA 4DTBA 5KMJA 3UO6A 3VS2A 4FG8A 5GJDA 1P5EA 5BUEA 3Q3BA 3VQHA 4CV8A 3R1NA 4K33A 2ZYBA 4W9XA 4ZLZA 2QR7A 3A60A 3UDBA 4OTGA 5M51A 4ITHA 2WTWA 1XWSA 5E92A 2W99B 3RAKA 5BYLA 2ZDTA 3VUMA 2YWVA 1XBCA 4KA3A 4AOIA 3QCQA 2YN8A 3Q96A 2ITOA 5M4CA 4EH5A 1V0BA 5CF6A 3VW8A 3CSVA 1NXKA 5CAVA 4FT7A 3ORMA 4L43A 2BZKB 5JEBA 5EQYA 5M53A 4L52A 2R7BA 4WBBB 1NVSA 4O84A 4ZTSA 5HE2A 2FGIA 5AFVA 2VTSA 3WF5A 3LAUA 4IZ5A 4I92A 2VWVA 4FNYA 5HCXA 5IG1A 5TE0A 2OJIA 4E5AX 1BKXA 2OIQA 4R3CA 4LG4A 2P2HA 2WPAA 2PU8A 2ITPA 4O0UA 5IMXA 1JQHA 3WILA 4TNDA 3ZCLA 2JDOA 2BALA 5A4CA 4FVRA 4JQ7A 2EB2A 4FX3A 1URCA 3UIXA 3O23A 1LUFA 3E7VA 3WZJA 5JFSA 5HG5A 4X6RA 4KBCA 5IEYA 3CD3A 1CDKA 5LMAA 2R3NA 4DG3E 3ZSIA 3WYXA 4FEUA 3DZOA 1Z9XA 4JAIA 4NT4A 4R8QA 5AP1A 3RI1A 2YACA 1L8TA 5LMKC 3QX4A 5CZHA 3ULIA 5B2KA 4CFFA 3PFQA 4I6HA 4BTMA 4E3CA 3G90X 3R04A 3ZUUA 2RIOA 5M08A 2XKDA 3MN3A 1U5RA 4TNBA 4DBXA 4RC2A 1WBNA 2W1CA 4JOAA 2IJMA 3R7YA 3KU2A 3NW7A 4PDYA 2OICA 2GTNA 4CTBA 2X8DA 2WMBA 2BKZA 4EBVA 2DUVA 4RWLA 2CNVA 4QYGA 5E1SA 5ETIA 3ZSHA 5JFXA 3PVUA 5H9BA 2ITTA 4C4EA 1LP4A 5CASA 4YSMA 2UZDA 3GCVA 4UZHA 4YO6A 4BWKA 3VRYA 4Z55A 5HX6A 3DDPA 3MB6A 4XP2A 3R21A 1LR4A 3F6XA 4IAZA 4K11A 4C0TA 4NW6A 5M4IA 4EK6A 1SVGA 1H1SA 3IW5A 2PVLA 1ZLTA 3QUEA 5C26A 1UWHA 2BPMA 3AXWA 2W9FB 3WIKA 4B0GA 4ZLYA 4DFUA 2X9EA 4G3CA 5HE3A 4DGLC 5IQIA 1UU3A 2JDRA 3CQWA 3MH1A 4TY1A 5E91A 3ZRLA 2CLXA 2QU6A 5CSWA 3DJ5A 5CNNA 3E8EA 3R7EA 1B39A 2WOUA 3G6GA 3RGFA 4FSNA 3EYHA 3OBJA 3W16A 4NWMA 4W4VA 5D7AA 1GZ8A 2HAKA 3ENHA 3O0GA 5D10A 2UZTA 5EYDA 4UALA 5EG3A 3LCSA 5IQCA 4GFOA 3P9JA 2WEVA 1CSNA 3EKNA 2C1AA 3R2BA 4DLJA 3V6RA 2R7IA 4U3ZA 1Q8YA 2QO9A 3LM5A 4FIJA 4I0TA 5BYZA 5F9EA 2QODA 1ZAOA 2ETKA 2HZ4A 3NIEA 3TNIA 2PZ5A 1UA2A 2XB7A 4FL2A 4O7LA 4IFCA 4J97A 4KD1A 2ZVAA 3CTJA 3P1AA 4GEOA 4IMYA 2B9IA 5J87A 5J7BA 2CN8A 5DEWA 3QGYA 4JBOA 2YFXA 3QKLA 2CJMA 4OT6A 2W1EA 3SAYA 4HPUE 2IW6A 2ZJWA 3P08A 5H8BA 3VUTA 4AGDA 1XH7A 1W82A 4YJNA 1H0VA 1AQ1A 2BTSA 4GT3A 5KKRB 4I0SA 3ZDIA 4EYMA 3GU6A 1H25A 5K0XA 2R3LA 5KX8A 3A7FA 2YM3A 3EL7A 4BTKA 3RCDA 2VWBA 4IZYA 3ROYA 2W1FA 4QPMA 5A14A 5KBQA 3PJ8A 4RVLA 3ETAA 4A7CA 2XNPA 1WBTA 4PPAA 2ZV8A 4O7WA 1SVHA 1ZMWA 4IQ6A 1YRPA 3QQFA 1Z5MA 4PMMA 2C30A 4I5CA 1OB3A 4E1ZA 3U4UA 1Q61A 2YA9A 1YXUA 5I5ZA 4F1OA 1XH4A 3CE3A 5DR2A 4B8LA 4C33A 1W7HA 4IVAA 2YM4A 4A4XA 3DFAA 4HGTA 4WSYA 5EW3A 2R3PA 3QWKA 5AIKA 4FV7A 4LUEA 4I93A 5M56A 4BCJA 5A6NA 2OIDA 4IWDA 1Y57A 2A27A 1MUOA 3MA6A 2FH9A 3O50A 4JNWA 4QMSA 4XG9A 2WU6A 5T3QA 3UYSA 4ACHA 5EM5A 3PY1A 5KZ0A 5CF8A 5J9ZA 3UOJA 3FMHA 3U87A 5B0XA 3F9NA 4FSUA 3CXWA 3P5KA 4O0TA 3R7VA 1DI9A 2F49A 2JKQA 2HXLA 4GG7A 4UV0A 3PRFA 4YJRA 5ANDA 2XF0A 2XEZA 1VJYA 4UEUA 4RJ5A 5J5SA 4APCA 4IC8A 1GIIA 5GNKA 3ZLWA 5CEKA 5AV2A 2WNTA 4W9WA 4EOLA 4NKAA 1KE5A 3QRKA 3ACKA 5IA5A 4ERWA 5CEPA 3KMWA 3ZYAA 1CM8A 4D4RA 3RPYA 4F65A 5KHXA 5CT0A 5G6VA 1J7IA 2QD9A 4D2PA 4UX9A 1R0PA 3UP7A 3A62A 3ORKA 2HW7A 1DM2A 4GCJA 2Z7SA 3ZRMA 4C62A 1PXJA 4G1WA 2LGCA 3LXPA 1STCE 2OZAA 1UU8A 3MFRA 3LQ8A 5IQAA 2OFVA 4TW9A 3SOCA 5D12A 1QPJA 3D15A 4F7SA 2G9XA 1YHSA 2W1GA 3QTSA 4A07A 2C5VA 4O2PA 2OFUA 4Y46A 5CVFA 3RK7A 2ACXA 3ZO4A 4WO5A 1OI9A 3KGAA 4CG8A 2HZIA 4RX9A 4JRNA 3COKA 3RJCA 5HLPA 4E5BA 1OPLA 3QXPA 3IW8A 1OM1A 4I4FA 3DK6A 3QQKA 2YITA 4DE4A 2OJJA 2YIYA 2AYPA 4MTAA 2OJFE 4TRLA 3QL8A 4DGMA 1CTPE 4FK3A 4MXOA 1QL6A 5EHYA 4C3RA 2FB8A 1CKPA 4MYGA 4BC6A 4XG8A 4TT7A 5FM2A 3W32A 4AN2A 2ITUA 5AWMA 5BMSA 5AV0A 4B99A 2C0OA 3POOA 2YIRA 4MX9A 2RL5A 2PE1A 3HMMA 4X2FA 3D4QA 4XV2A 2R3FA 4FEQA 4O6EA 1E1VA 3SRVB 3R30A 2WTKB 5A54A 2UW0A 4PDSA 5FM3A 2SRCA 1U54B 1JBPE 1ZZ2A 4U40A 4AN3A 5AR4A 4EOJA 5DEYA 2ZV9A 3R22A 4FT3A 3OWLA 4IDTA 5DR6A 2XEYA 2QO2A 2XJ2A 4FKJA 5HLWA 4EH7A 2GFCA 3MFTA 3N4VA 4G34A 1YHWA 3QRJA 5TT7A 4EK8A 3SVVA 1APME 1XH9A 2XK9A 4C58A 3LLAA 2B0QA 5LOHA 1PXMA 2F7XE 2WO6A 3N4UA 3DAKA 4ZJJA 4F4PA 3AC8A 1ZMUA 3LFNA 4F1TA 3FYKX 4BB4A 5J8IA 3ZFXA 4BCKA 1NVQA 5IA2A 2OLCA 5FGKA 4BHZA 3FEGA 3DLSA 3MVLA 2ITYA 5DGZA 4XRLA 4C7TA 3GU7A 4HW7A 4DFZE 4IX3A 2OIBA 4WBOA 1GZOA 3OC1A 2XRUA 4PP9A 3F3ZA 4I94A 4QP3A 4ZK5A 2VO3A 3V3VA 4BDBA 4L3LA 5CAPA 4BRXA 5JZJA 3HP5A 2XIRA 4J52A 3ET7A 5FD2A 5A4EA 4YLKA 3GBZA 2C5XA 4H3PA 5BYYA 2FA2A 4O1PA 3C4ZA 4UWCA 4YZMA 4EI4A 4BKJA 2H6DA 2JIIA 2YAAA 2CCIA 4RQVA 3SXRA 4ENXA 1H08A 3RAWA 5BNJA 5JGBA 4ZMFA 3R00A 4E93A 4N0SA 3KVXA 2XYNA 1IAJA 3NNXA 4IX6A 5ICPA 2OZAB 4EKKA 3TNHA 4I22A 1TVOA 2RKUA 5EI8A 5HBHA 4ZTQA 4F0FA 3NUSA 1OKWA 1K2PA 4QMYA 4L53A 5BVDA 2XH5A 3TV6A 5C8KA 4KBAA 3ODZX 3OROA 2J2IB 3OEZA 4KS7A 3AMBA 4R7IA 2BRBA 4RIXB 2BIYA 2W1HA 3R71A 4FF8A 2WTIA 5FQDC 3ZHPC 4RBLA 1ZXEA 4OTIA 2VTMA 4AZWA 4RLLA 4UBAA 3RPRA 2OO8X 3OXIA 3EIDA 4PDOA 3ZOSA 3R02A 1WCCA 3DKFA 1FINA 2ZV2A 3FMEA 3FMKA 2VTAA 4QMMA 4RZWA 1PXLA 1QMZA 3OBGA 3FI4A 1Y6AA 3ZSGA 4I6BA 2VWZA 3BEAA 4BBFA 3NLBA 3TJCA 2R3QA 4PL3A 5E4HA 3M42A 4CLIA 4L45A 1HCLA 2W5AA 3NYOA 5EDPA 2B53A 4BWXA 3BLHA 2Y6MA 3A2CA 2WOTA 2VTQA 3LXNA 3QQLA 4C2VA 5K4IA 4FKUA 4CGAA 3GCUA 3BRBA 3EN5A 3V04A 1JSTA 3RPOA 2VTJA 3TACA 1J1BA 4O7YA 3M11A 4JIKA 1A06A 4HYHA 4RRVA 5ITAA 2Z7LA 4HZSA 3A99A 3P4KA 3UQCA 4P2KA 1O6YA 1ZY5A 1IG1A 3HUCA 2QKRA 1ZYDA 3NAYA 4LM5A 3VS1A 5HO7A 3Q5ZA 3CS9A 3MW1A 4FTTA 3TKIA 4YJVA 5ANGA 4ZSEA 4YJSA 4MK0A 2H8HA 3QALE 4IBMA 4R5SA 4X3JA 5CXHA 3ZMMA 5L3AA 4CV9A 4P90A 2GHLA 2YM8A 4X3FB 5CSVA 1RJBA 3R8UA 4B9DA 3OWPA 4CRLA 5LARA 3QZFA 3QTIA 5DIAA 3WZUA 4B4LA 3Q60A 3U8WA 4O7ZA 3EFJA 1JOWB 3E8CA 3UC4A 3KN5A 4AT5A 1ERKA 2B54A 2O8YA 5AP2A 4HNIA 4U0IA 2GQSA 3MTLA 3AD6A 4QMVA 3RHXA 4D55A 5KMNA 1URWA 4AGUA 2JKOA 2JIVA 3Q04A 4IZAA 4R7HA 3SGCA 4LV5A 2EVAA 3R7OA 3TI1A 4O6LA 1OIYA 2YJRA 3RPSA 4KIPA 3UMXA 4IHPA 3DNEA 4UY9A 4QMQA 4MVFA 3HRBA 5L6WL 5TF9A 4MD8E 1K9AA 4F64A 5HG9A 3F3UA 2XM9A 4ANLA 1XBAA 1FQ1B 3HV7A 3FHIA 2C69A 4UXQA 3WF9A 4E8AA 2OJ9A 4XS2A 4J71A 3LMGA 4QNYA 1F3MC 4X2NA 2PMLX 1ZYSA 3K5VA 3OW4A 4MEDA 1SNUA 4EONA 2QURA 3F69A 5KHWA 3HAVA 3P7AA 2YM5A 4NFMA 3RZFA 4BF2A 4F63A 5GJFA 2O5KA 5IU2A 4YTHA 3GQIA 4QYFA 2WTVA 2OWBA 5B7VA 1OBDA 1P4OA 5FRIA 4II5A 4E20A 4IWOA 2JIUA 1OL6A 3DAJA 4JG7A 5ETAA 5A3XA 3ZLSA 3C0GA 5GJGA 3R01A 3LCTA 3WE8A 4FKRA 3BU5A 4HGSA 3UO5A 5CEOA 4L01A 3HNGA 4Y83A 1RW8A 3EL8A 4GH2A 3R9RA 1YW2A 3EQGA 4JIAA 4PF4A 4BCFA 2ESMA 3EZVA 4LGGA 2HY81 5F94A 2X1NA 5HNIX 2OF2A 5JGDA 5I0BA 2BZIB 2DWBA 5AV1A 2X2MA 2PUPA 2Y6OA 2P3GX 4ORKA 3PG3A 3MY5A 3L9LA 4ZS0A 1Q8ZA 4JL9A 5GZ8A
chains in the Genus database with same CATH superfamily
3ZS5A 3HYHA 2XANA 4O22A 5AR3A 3N4TA 3NUYA 2YCFA 3AQVA 4JBPA 5AR7A 4IB3A 2ZB1A 4OTWA 5GZAA 4G5PA 3RTPA 4FT0A 5M07A 4IAFA 2PVHA 4AXCA 4DFYA 4EH9A 3NSZA 4LL0A 4AS0A 3TL8A 3RM6A 4ZZNA 3ATSA 2YJSA 3FJQE 3GVUA 1O6KA 4EK4A 4FUYA 5HVJA 4KNBA 3VHKA 5EDRA 3VS7A 4EH4A 3EN7A 3K54A 3HA8A 3VS4A 1T46A 1R39A 3FDNA 5EKOA 1XKKA 2E9OA 4D9TA 5M4UA 4EZ3A 3R7UA 5BVOA 1YXXA 3PIZA 3TG1A 3FMMA 4MBLA 4GUBA 4IWQA 5CU3A 1BI8A 1DAWA 3NIZA 2O2UA 4DCEA 5BX0A 4H39A 3C5UA 3V5PA 3DKCA 4UYAA 3VS6A 2F57A 4C3FA 4RFMA 2C4GA 4D2TA 4DFNA 4EOMA 4ASEA 3KREA 4CZUA 3PIXA 3C13A 4U44A 3H9RA 4OGRA 4IW0A 5J9LA 2JGZA 4BCNA 5DHJA 1BUHA 3L9MA 4G16A 1Q62A 4LRMA 4QMXA 4J7BA 3SHEA 3Q5IA 4AWIA 3K3IA 2XCHA 4YP8A 5J9YA 2CKQA 2B9HA 2X4FA 3Q9XA 4A4LA 2WQNA 3TNPC 4G3FA 4CFWA 4A06A 5E8UA 3OXZA 4YR8A 4E6QA 4O7VA 3Q4UA 5EH0A 4O86A 2JKKA 4FTAA 1YQJA 4Y8DA 5DRBA 3GB2A 3E8DA 4BI2A 2GS6A 3HV6A 3NYXA 3RK9A 3FY0A 4IIRA 5EI6A 3UC3A 3HLLA 2I7QA 2NP8A 1JKLA 2YIWA 3FXWA 5EYMA 5CNOA 3O5AA 4AXEA 1XH6A 2YDJA 2I40A 2XK4A 4K2RA 4M0ZA 3BE2A 3RWPA 2PZYA 3PSCA 1H1RA 3QKKA 4FA2A 4DHFA 2QVSE 4C36A 5C1QB 5JN2A 4D4YA 5CU4A 2C5NA 3CLYA 5AMNA 4KRDA 3ZUVA 3VUGA 5IUGA 3FLQA 3SA0A 4X6QC 5C4LA 5A6OA 3RZBA 3VO3A 5FDPA 4FOCA 5AAGA 5AV4A 1ZARA 4MXZA 1A9UA 5D1JA 4QQTA 4IJPA 2CCHA 2PZIA 2WIPA 4IAAA 5EM7A 3AT3A 4X7QA 2X6EA 3HP2A 4EWQA 5DT4A 4GS6A 4ONAA 2UW5A 4QQCA 4LRKA 4M69A 4A9UA 4MUQA 1PF8A 3NRMA 2PYWA 2C6LA 4DG2E 3FZOA 3I81A 4IVCA 3I0QA 3KKVA 4OUCA 3AG9A 3PVWA 3COIA 4A4OA 2ERKA 2R5TA 5D41A 5BVNA 2HZNA 2HENA 4UMTA 1FVTA 2C6KA 5FXRA 1QPEA 2W05A 1R78A 4PV0A 3FMJA 4DC2A 3PTGA 3LFDA 4ALWA 4BZNA 3ORNA 4ERKA 2QG7A 3QTZA 2ZB0A 3HVCA 4L42A 3CGOA 4R5YA 5E8SA 1FVRA 3BL9A 3ZBFA 5AA9A 3UVQA 4JBQA 4BI1A 5CSPA 1NT2A 2YIQA 4JAJA 2CKEA 3VNTA 4NL0A 4P4CA 5E8WA 3MH2A 3W0PA 4I20A 2E9NA 4PNIA 3EB0A 3KB7A 3G9NA 3JVSA 3BKBA 3PUPA 4BDEA 4DEBA 4R77A 2GCDA 5CF4A 4B6LA 3TDWA 3DFCB 2YCQA 2OGVA 2UW8A 5CI7A 3O96A 4MH7A 5IEXA 4L68A 3FMLA 4RT7A 4NFNA 4GFMA 4U45A 3QKMA 4W4XA 3O7LD 1FMOE 3MFSA 4C8BA 4BDAA 3DQXA 4RG0A 3FUPA 3DPKA 4A9SA 2PL0A 5CF5A 1U4DA 5FTOA 4CD0A 5LQFA 1W83A 4YLLA 3C4FA 4AXAA 2OK1A 3P86A 1H26A 2CDZA 5HIEA 2W0JA 1BMKA 3UNJA 3PZHA 2F2UA 3MFUA 4HNFA 5CANA 3L1SA 2VWWA 4K8AA 3H9FA 4I21A 4JXFA 3U9CA 4CTCA 1EH4A 2ZOQA 3D83A 2CGVA 3UBDA 3ZO2A 4QD6A 4F7LA 4DBNA 3KFAA 4L7SA 5C27A 1FPUA 1OKVA 3Q4ZA 3A7IA 2WGJA 2FSTX 3Q32A 3PA3A 3PZEA 1WBPA 5AUVA 3T9IA 3ML1A 5IDPA 4D0XA 4RWJA 3WE4A 1Q8WA 4YJPA 1NVRA 3NNVA 4FEXA 2XK8A 3C4EA 4TN6A 1TQPA 2XK6A 3V5JA 5DWRA 5IEVA 3MVMA 5AADA 5LJJA 3Q6UA 5L2WA 3TIYA 2UW3A 4F70A 5A4QA 5EHLA 4D2SA 4BDCA 4BIBA 4V01A 1JNKA 5HICA 4DTAA 1RQQA 3QXOA 3AMYA 2YLFA 4NYEA 3OCGA 4R6VA 5FTGA 4YLJA 4LYNA 4I5HA 4DGNA 3HRCA 2UW6A 4USDA 4WG5A 5KE0A 3CJFA 3LJ0A 4ACMA 4USFA 4C34A 2E9PA 4FKSA 2CGUA 4F6SA 3Q9YA 5CU0A 2C5OA 2VTHA 4F99A 4JX7A 3DKOA 4I6FA 5EW8A 2J0LA 5JRQA 4QPSA 1WVXA 2J5FA 4ANMA 3G51A 4CLJA 3DBEA 4FZAB 4O82A 5A9UA 2AC3A 4GRBA 5IPJA 2C0TA 3RINA 1BX6A 3KXNA 3D7TA 4H1JA 3V5WA 2JEDA 3MY0A 2ITQA 3KMMA 3AC3A 3R1YA 4FICA 3R63A 2PZPA 4QTBA 2Q0NA 3NR9A 4UMQA 4WNMA 4XP0A 3ZC5A 5KO1A 5JGAA 4AT3A 3HEGA 2BAKA 3QD4A 3CKWA 3K3JA 1J1CA 3OS3A 4FSQA 4U7ZA 4EORA 1SMHA 2CGXA 1L3RE 4HCVA 4IZ7A 5I9VA 2XNBA 1WBSA 2EXCX 3AT4A 1ZMVA 3Q6WA 2XNOA 3H4JA 4AU8A 4IVDA 3UPZA 5BVKA 1J7UA 1W98A 4AAAA 3RVGA 4Y72A 2J0KA 3QCSA 3NPCA 3UMWA 2AEGA 5GIPE 5L6PA 3Q2MA 2JBPA 3HX4A 3OEFX 3PSBA 3UTOA 3JUHA 2J6MA 2ZM4A 2CMWA 4F9CA 4P7EA 2BFYA 2RFSA 3W2PA 1I44A 4QP2A 5CY3A 3JY9A 4MQ1A 5E90A 4F9AA 2G2FA 4D58A 3N9XA 3RCJA 1R1WA 1JKTA 4RX8A 4FSWA 3QUPA 4BBMA 4BCIA 3PIYA 5IMEA 1ATPE 4LV7A 4K77A 3QTUA 3PJ1A 3V8SA 4NCTA 3E5AA 4WG3A 1U5QA 1ZYCA 4AQCA 4S2ZA 4JDIA 1WVWA 3H0YA 4ZY5A 2C6MA 1ZOHA 3KY2A 3TZ9A 5HD4A 1H27A 1M2PA 4FKVA 4AW0A 2ITWA 2YWPA 4I0RA 2GNGA 5HESA 5HG8A 3ZFMA 4A9RA 4Q9SA 4KAOA 3AC1A 3DB8A 2WXVA 2Y8OA 3WBLA 5FXQA 1F5QA 4Z9LA 3ROCA 4EKLA 4PUZA 3VS3A 3RNIA 3REPA 1QPDA 3BE9A 4WA9A 4YHFA 4RJ7A 1O9UA 2JC6A 4F9WA 2PUIA 3C4CA 5CX9A 3CKXA 4YNOA 3FKNA 4DF3A 2VWYA 3K2LA 3A7JA 3R7GA 4DH7A 4KIQA 3SX9A 3VBXA 4BTJA 3PWDA 3W0OA 1FBNA 4JVGA 4KIKA 3R9HA 4ASXA 2GNLA 2YLEA 4CVAA 5DE2A 3D94A 4DA5A 4QPAA 3ZZEA 4TWPA 4D4SA 5KMIA 3I79A 4UXLA 4BHNA 3LPBA 2OH0E 3H0ZA 4LGHA 3T9TA 3KA0A 3EQDA 1YWNA 2VX0A 5BVEA 3U54A 4XOYA 3D14A 5GZ9A 2O0UA 3TNWA 2V5QA 2X39A 4DDIA 4RC3A 1WZYA 3GFEA 2OXYA 4X2KA 1QPCA 4FNWA 3FXXA 4FOBA 4RJ4A 2PUNA 4FR4A 4EQCA 3FQSA 3TZ8A 5A4LA 3OWJA 3L8XA 5CSXA 4FTRA 3MS9A 2X0GA 2BTRA 3VBYA 3W2OA 2LAVA 3LVPA 1YOLA 1E1XA 4WG4A 5EM8A 2R3JA 3C4XA 3MIYA 4QOXA 4M97A 4ZTHA 5K0KA 2J90A 4HGEA 3DK7A 4FV8A 2VTPA 3UZPA 4BR3A 2J0JA 1BLXA 4J53A 1Y6BA 3GXLA 1GIHA 1KWPA 4L00A 4GFGA 4LFIA 1JVPP 1BYGA 2EU9A 2ITVA 5EOLA 3BLAA 2VV9A 3R2YA 3QRIA 3CPBA 2F7EE 3MH3A 2IZSA 3THBA 3TUBA 1W84A 2P2IA 4I4EA 3DNDA 2UZLA 4NIFA 2J50A 4GYGA 4MF1A 4FZ7A 5A4TA 1OKZA 2X7GA 1LEZA 1CKIA 5H2UA 1JKSA 1R3CA 2UVZA 4IM3A 3EQBA 3PSDA 3KCFA 5AX3A 2PVYA 2XAOA 1WBOA 1OL1A 2XUUA 2WMUA 2XMYA 3AC4A 1SYKA 3HZTA 1B38A 3V5LA 3AOXA 4JX3A 4DGGA 4YTCA 5IA3A 2EXEA 2X7FA 5KNJA 3EFKA 1XMLA 5FUTA 3W0QA 5HE0A 1YHVA 3BCEA 4FBXA 3OMVA 3SOAA 3HGKA 2IZUA 4U8ZA 1M7NA 1PKDA 4BCQA 4CFVA 4EOSA 3BU3A 4QMLA 4GMYA 3U6IA 4EBWA 2PVKA 4QP9A 3QYZA 5IQDA 4E6CA 3GFWA 3S1HA 4JDKA 3AD5A 1I09A 3NGAA 2PTKA 5AM7A 3TNQB 3FE3A 4FC0A 5AP4A 4ZJVA 3GU8A 5K5XA 4RVKA 2QI8A 2YABA 4C59A 2QQ7A 2BFXA 3NUNA 1H00A 3KXXA 3A8WA 4D5HA 3BBWA 3AKJA 1ND4A 3BBTB 4YU2A 2GPHA 3ACJA 2PSQA 4PDPA 4XG7A 2CSNA 2QONA 3JYAA 1TQIA 3TN8A 4KWPA 2Z8CA 2ZMCA 3CC6A 3KL8A 4YC8A 4YNEA 4MNEA 3TZ7A 1VLRA 2X0OA 4LQMA 3OY3A 4L44A 3FLWA 3QQGA 4LOQA 4WIHA 3NUAA 2IG7A 3GQLA 2PY3A 3FLYA 2BMCA 3TT0A 4K0YA 2G15A 4F7NA 3IOPA 4EOPA 3GCSA 4O0VA 5CZIA 1KE7A 1V1KA 5CI6A 3LFFA 3IGGA 1V0OA 3BL7A 4RA5A 5CSHA 3AC2A 3G15A 3MTFA 3C51A 3A7GA 1H1QA 3I6WA 3V01A 2A0CX 2IO6A 3P5JC 2R3KA 3E3BX 3HUBA 4IADA 3RM7A 5L2SA 2GNIA 1P14A 2O3PA 4H05A 2JFMA 3QX2A 5BVWA 3LXKA 4ZSJA 4EYJA 3MPMA 4M15A 4C37A 2ITNA 2ITXA 3F5XA 4RWIA 3NUXA 3PPZA 2JDVA 2UZOA 4QP1A 4WD5A 4BDJA 3UPXA 3HMPA 5CENA 4AE6A 4O7TA 3OT3A 1YI4A 3TM0A 2UW7A 3DQWA 4FSZA 1MP8A 2H34A 2JAVA 5KCVA 3B2TA 3QGWA 4CEGA 3P79A 1UV5A 3O71A 2VX1A 1B6CB 4DEHA 1XQZA 2WMTA 2DS1A 3NMUF 3MWUA 3V8TA 4CXAA 3WF8A 4A9TA 2VN9A 2VTNA 3UOKA 3PWYA 3UQGA 4O81A 2R2PA 4LDTA 5GINE 3DBQA 4GUEA 3GC9A 4YJTA 3S4QA 3MH0A 1VEBA 2QOOA 4YPSA 3RWQA 2VTRA 5BPYA 4YO4A 3SDJA 4MWHA 4JG6A 5IH4A 1WVYA 4FG7A 4WRGA 2C6EA 3CTHA 3UOLA 3DU8A 3QC4A 4EQUA 4EL9A 3BLRA 2PZRA 4IAYA 1M2RA 4I41A 3P78A 4WSQA 3ORLA 4GVAA 3W2SA 5I9ZA 2WMRA 3DBDA 4GK2A 4L8MA 3PLSA 3DTWA 5L6OA 1G5SA 3KC3A 4GVJA 5TOZA 4HZRA 2VTIA 3TEIA 3MI9A 1YXTA 4DEEA 2BRGA 5LCKA 2ZMDA 3TMOA 3Q9ZA 3I60A 4BDKA 3EQFA 2A4LA 4DT9A 1KSWA 3Q9WA 1MRYA 2C3LA 4BCGA 2CN5A 3GC0A 4WNPA 1ZWSA 2BZHB 5F4NA 4R1YA 4TYIA 4GJ2A 5CEIA 4RIOA 5IQGA 3W0SA 1S9IA 3OT8A 4YTIA 3VAPA 5K3YA 4CMTA 4DH1A 4ZAUA 4FV9A 4MWIA 1M14A 4WUAA 4FTKA 1PJKA 2YCRA 2JAMA 3G9LX 1KE6A 2XNEA 2BR1A 3A4PA 3BQCA 1AD5A 3IW7A 4GU9A 4L67A 4FT9A 3VRZA 5AP3A 1JAMA 4RX7A 3ZTXA 4NCTC 5AP0A 3F3WA 1GNGA 4HVHA 4XJ0A 2I0HA 4O0WA 4YURA 4KS8A 2R3HA 3CEKA 5HBEA 3LFAA 3HKOA 1OITA 4F08A 1P4FA 1Q99A 3ZM9A 5AV3A 2CKPA 3OY1A 2CPKE 4FI1A 2XNNA 3I4BA 4FZFB 2OKRA 5CTPA 4YJUA 5C01A 1PY5A 3U6HA 5M06A 5B2MA 1M52A 3COMA 3W33A 4IX4A 3KVWA 3NWWA 2QLUA 3IOKA 3KN6A 5EW9A 2IW8A 4DITA 3C7QA 3PY0A 4EQMA 2YDIA 4KKGA 2FUMA 4AAYA 2UW4A 3E92A 1Y8YA 4RLKA 2OG8A 5I9YA 3LFBA 4F9BA 4ZXTA 4RIYA 1GOLA 4XH6A 1H07A 3PFYA 2PVJA 3FAAA 5DBXA 3ODYX 4O0RA 3VHEA 4YTFA 1ZYLA 2ETMA 4YZCA 2WELA 5CAQA 3HAMA 5JFWA 3BHUA 3VBWA 2I0EA 2XNMA 3QTWA 4ACDA 4DH3A 3KULA 2Y4IC 4ANBA 5AUXA 5FBNC 5L2IA 3R8PA 4ZOGA 5EQPA 2IVTA 3I7CA 3DB6A 4BDHA 2VTOA 4PPCA 1Y8GA 4IAKA 2R3RA 3JVRA 3ZRKA 3W18A 3LFEA 4ITJA 5HU3A 2XKFA 3FY2A 5M4FA 2R64A 3G0FA 5IA1A 2VWIA 2R3MA 4L9IA 1MQ4A 3MVHA 1Q24A 3ANQA 4Q5EA 3V6SA 2Z7RA 3UDSA 4MCVA 2WD1A 3NEWA 3OOMA 1V0PA 2BDFA 3WF6A 3QF9A 4CQEA 5BVFA 3EMGA 5CQWA 2PULA 5H8EA 2WEIA 4JJRA 2F9GA 2F2CB 2WQMA 3EH9A 3C0IA 1WAKA 5JRSA 1KE8A 2XIZA 4EJNA 3II5A 3CPCA 1JSUA 4UMRA 3OP5A 4MXAA 3P7CA 4CYIA 4FTJA 4FIGA 4UN0C 4OBOA 4CFNA 2UV2A 4FTLA 5HD7A 4AZVA 3GGFA 5DOSA 2IN6A 4MD7E 4YJOA 1HCKA 2ZV7A 4HPTE 3U4WA 3V5TA 1PXNA 4QMPA 3F2AA 3FSFA 3IECA 3LW0A 4W8EA 5JZNA 3UO4A 3GP0A 3UODA 3MJ2A 3QFVA 1Q8TA 5C03A 4FKOA 3QHWA 4CZYB 3COHA 3PXQA 4FGRA 3FZTA 3I1AA 3QHRA 4KBKA 4TWOA 4XNEA 2WTJA 3WZEA 5CWZA 4BFMA 4F9YA 3OXTA 3F3TA 3FWQA 2VO6A 3FQHA 2WU7A 3EN6A 5E9EA 4JBVA 3MPTA 4XV1A 2YZLA 4OR5A 2RSVA 2XJ1A 2B1PA 3FMNA 3HMNA 4AGCA 4F1MA 5IA4A 4MF0A 5ACKA 4CKRA 3VONA 3W0MA 1H4LA 4DINA 3D2IA 4IWPA 1PMVA 1Q3DA 4RWKA 5HKMA 1IAHA 2HOGA 4Y5QA 4BCHA 4NUSA 4E6AA 5I9XA 1HOWA 1E9HA 4WT6A 3MJ1A 2XK3A 3GENA 2W17A 4PY1A 5KMLA 2PE0A 3VBTA 4QQJA 4TYEA 4D1ZA 1UKHA 4FEVA 5KBRA 3JPVA 2H9VA 5I3RA 5LWNA 4KINA 5CAOA 5FTQA 4YMJA 2NRYA 4OTDA 4EC9A 1REKA 4JMQA 3VBVA 2X0PA 4BYJA 2OW3A 5AA8A 3NUUA 5KZIA 1K3AA 3KCKA 4NH1A 3KQ7A 4OTFA 5H3QA 5D11A 3RKBA 5C4KA 3NS9A 4C4IA 3TDVA 3OG7A 3P23A 1G8SA 3V8WA 4BZOA 3MBLA 1H1PA 3CY3A 3PG1A 4D28A 1YVJA 1YOMA 4O0YA 3IONA 3F2NA 4PPBA 5IQFA 1LEWA 3HMIA 1JWHA 2DYLA 2VGOA 4KB8A 4YZDA 5C9CA 3T3UA 4CCUA 4AFEA 4C38A 4EOOA 2KTYA 4YSJA 3VC4A 3QCYA 4DEIA 3FHRA 4GG5A 1WFCA 5HX8A 1UU9A 5TKDA 5CYIA 5JH6A 5I9WA 3NDMA 3FKLA 5DR9A 3WZKA 2QOKA 3O8UA 3TCPA 4NM0A 4XG4A 1H0WA 4FKQA 3ORTA 2W4JA 3DA6A 2JITA 3P0MA 1MRVA 4XG2A 3VW6A 4E26A 5K5NA 2UW9A 1UNGA 3E3PA 4HVSA 2NRUA 4U9AA 3VS0A 5LWMA 1YWVA 2W5HA 4FTOA 4LMUA 1RDQE 2HXQA 4QP7A 3VQUA 3EQPA 4E4LA 3IDPA 3CQEA 4IVBA 4S34A 4DFLA 1BL6A 4HGLA 4S32A 5AUWA 3RMFA 3UDZA 3IGOA 3GOKA 3O17A 4OLIA 3WOWA 4DN5A 1FGKA 5J1VA 1OKYA 3G33A 3PA4A 4CNHA 4QQ5A 4DFXE 4O7NA 1OPJA 3NNUA 1OECA 3HDNA 1NA7A 4JS8A 4M3QA 4MAOA 2E2BA 4UWYA 4E4MA 3S00A 3U9NA 4FVPA 4F7JA 5H8GA 5HZNA 3PJ3A 4J1RA 4R3PA 1JLUE 4ZTRA 5FBOA 1OVEA 3RBWA 4RFZA 5EM6A 4YJQA 4HCTA 4O4CA 3ZDUA 4E4NA 4UMPA 3PPJA 4TPTA 5HGIA 3Q2JA 3LQ5A 4FRFA 4AZTA 1Q41A 3TV4A 3RAIA 5HBJA 3NYVA 3W55A 5E7RA 5JK3A 3DCVA 4FT5A 2J5EA 4TYHA 5L2TA 2GDOA 4M66A 5FG8A 2YAKA 1MRUA 3VUDA 3ZUTA 2GTMA 2CGWA 3KK9A 1GJOA 2XNGA 4NW5A 3MPAA 1YI6A 5ACBC 3LKMA 3MA3A 3IDCA 2CLQA 2HYYA 3PXYA 1OL2A 3LCDA 1OIQA 4S30A 4MBJA 3EFWA 4H36A 5CEQA 4ASDA 4AW1A 4Q2AA 3BGPA 3O2MA 2QOHA 4Q5HA 4C35A 2W9ZB 4RVMA 4G9RA 5ANIA 3HV4A 4V0GA 3ZXTA 2A2AA 2I0VA 3QRUA 3LCOA 4CT1A 2FO0A 5AUZA 4FYNA 4DEDA 4TTHB 1AGWA 3QRTA 3FLNC 3R8LA 3C1XA 5CQUA 4X0MA 4YGAA 1F0QA 4EZ7A 1PYXA 4QP4A 3UG2A 3W2CA 4AN9A 3T8OA 1JSVA 3FV8A 5LVLA 4FIIA 1OUYA 4EOIA 4OBQA 3PP0A 2YZAA 3GUBA 3UVRA 1M7QA 1PMNA 3C5IA 2VNYA 3QUDA 2ITZA 4QNAA 2W1IA 2VX3A 4FV2A 4FIFA 4L3JA 4QYEA 2J4ZA 3A4OX 4XRJA 2VUWA 1H1WA 2FSLX 2HK5A 1OL7A 4XOZA 5A46A 5IQBA 3OWKA 4MXCA 4NM3A 5HORA 4M67A 3EQCA 1OIRA 4W4WA 4OTPA 2X81A 2XRWA 5FDXA 3LMHA 3ORPA 4IE9A 1H01A 4BBEA 4Q9ZA 3C50A 2FSMX 3BZ3A 4YUQA 2CKOA 2JLDA 4O1OA 2VZ6A 3UVPA 3R1SA 4JI9A 5CVGA 3VS5A 2REIA 4FZDB 4RA4A 3HRFA 2GQRA 4Y85A 4E4XA 2IVSA 4BICA 2IWIA 2G2HA 4BDIA 3C4WA 1VZOA 3TTJA 4TWCA 4EHVA 3HMOA 2W1DA 3R8VA 5FWKK 2X2KA 4DAWA 4EUUA 4QMZA 3E88A 2H96A 3FMDA 3KRWA 3DTCA 3W10A 3W2RA 4BVUA 4BDGA 4ZSGA 3FZSA 4O7SA 3DGKA 3NAXA 4JQ8A 4FUXA 1H28A 4XHKB 3F3VA 4CSVA 3NVMB 3TV7A 3FQEA 4FODA 3MDYA 5I9UA 5K9IA 4C4JA 3Q53A 3FZPA 2P0CA 3C9WA 5E8YA 4HVDA 4JLCA 3F5GA 3D7ZA 4BKZA 3I5NA 4PMPA 1ZY4A 3B2WA 4X21A 5FP6A 3KK8A 3ANRA 3S3IA 5IQHA 2GS7A 2X9FA 5E8VA 3AGLA 4EHZA 3FBVA 5K4JA 3IW4A 1W2FA 4RC4A 5HNBA 3RP9A 3FLZA 4HYSA 3CIKA 3HA6A 4L46A 3ZM4A 5B2LA 2W4KA 4BCPA 4F78A 1W2DA 4Z16A 4GJ3A 3M2WA 3NX8A 4E73A 4DHJA 5HG7A 5HI2A 3EN9A 3Q52A 3EHAA 4QYHA 2RFEA 1ZOGA 3MB7A 2A19B 3DK3A 3IQ7A 4ZEGA 3VJNA 4ALUA 4U79A 4IB0A 4J8MA 4ITIA 4M69B 4KKEA 4PTCA 5CU6A 4AFJA 3BLQA 2WTDA 4HCUA 4ANQA 2OU7A 2VTTA 4N57A 4DEGA 5HVKA 5GIOE 3NYNA 3OUNB 3R73A 5T68A 4ZTMA 4C57A 5M57A 4MKCA 4H1MA 3SV0A 3F88A 4FTQA 3CP9A 2JBOA 3LFQA 4M12A 3RALA 4E6DA 4AX8A 2C3KA 3BHTA 2WIHA 4GIHA 4JQEA 4PNKA 3E63A 3QA0A 3QTQA 4I5PA 4OAUC 3NNWA 2VNWA 4O83A 4XUFA 3PJCA 4WHZA 4RZVA 4XLVA 1IRKA 2UVXA 4Z3VA 3PXZA 4RGJA 3IS5A 4GYIA 5EDQA 4DTKA 2HY0A 3VN9A 3ALNA 2OI4X 2QNJA 2VRXA 3KRRA 4LMNA 4PTGA 1TFFA 4TYGA 4NEUA 3NW5A 3PLAE 4FKIA 3PYYA 1DI8A 4BCMA 2VAGA 2WQBA 4YBKA 3EFLA 3IW6A 3OTVA 4CQGA 3WI6A 3D5WA 5GHVA 5FEEA 1OGUA 1UNLA 3G5DA 3HL7A 2R9SA 4QMOA 2O63A 5M09A 4ZS4A 3FLSA 1W0XC 3KF4A 3SKCA 3QZGA 3D5XA 3NW6A 1IR3A 4PL4A 4UZDA 5CVHA 2C6IA 1WMKA 2QLQA 1XH5A 4FL1A 2GHGA 1H8FA 4RJ3A 5DT0A 4IM2A 4WKQA 2C3JA 3LXLA 5DH3A 4J8NA 2ONLA 3KXGA 2XJ0A 4I1ZA 3KXHA 4HVGA 4ZLOA 3EN4A 3BV3A 3I6UA 4FTIA 4F6WA 1FOTA 4JDHA 3UOHA 5HTCA 3LMIA 1GZKA 4C4GA 5IZFA 4XBUA 2GNFA 2R4BA 3BHHA 1QCFA 3SQQA 4YC3A 2Z60A 5HTBA 3DAEA 4FK6A 4Z7GA 3EKKA 5JT2A 4C2WA 5EK7A 2V7OA 1U46A 3LJ2A 4FV3A 4O0XA 4G17A 4QRCA 4D2VA 1OBGA 4FNZA 1M2QA 5C8NA 2BZJA 3ZONA 4PMTA 2Y4PA 3DKGA 4DH5A 2AC5A 2WMXA 2JFLA 2XBJA 4JRVA 3WYYA 3AD4A 3QLGA 3QTXA 4DH8A 4N70A 4TWNA 5M44A 3K5UA 1JKKA 3BQRA 5IUIA 3DXQA 4AW2A 4G31A 2XCKA 2UZBA 1W2CA 2B9FA 2WTCA 3VF9A 3CY2A 1PXPA 5IDNA 3E8NA 3HV3A 2XK7A 4DYMA 3KRJA 5KMMA 3OZ6A 3UQFA 2OSCA 5AP5A 4D0WA 5JKGA 3MY1A 4IFGA 4O91A 5CXZA 5LVNA 2BILB 3TUDA 5FP5A 3ZLXA 4GV1A 3UIUA 4BDFA 4C02A 3AKKA 4I5MA 4ZZOA 3RK5A 1G3NA 4I3ZA 2WB8A 5DNRA 4G3EA 4PL5A 3OW3A 5T6KA 2X0QA 4QMNA 4IJ9A 2Y7JA 5M55A 5E1EA 3ZO1A 4USEA 3D7TB 4M68A 4AUAA 4NU1A 3POZA 1ZOEA 3E7OA 4N4SA 2WQEA 4BI0A 1KE9A 3LJ1A 4O38A 3T3VA 2XP2A 5E8XA 4M8TA 2R0IA 3DXNA 3QU0A 4ZY6A 4IB1A 4ACCA 2IZTA 3ZLYA 4UB7A 5DT3A 2VO7A 2OZOA 2G1TA 3EWHA 4EOQA 5FLFA 4NK9A 4QTCA 4IEBA 5CS6A 3ZBXA 4L6QA 3V51A 4FTUA 2QOFA 3GCQA 4U3YA 3QYWA 3R8ZA 2W06A 2X8IA 2BIKB 2QOIA 4YBJA 1XH8A 3PXRA 4M13A 5HVYA 4EJ7A 5IH6A 4MBIA 2HIWA 2PVNA 3UIMA 4FV6A 4EK5A 4K18A 5EKNA 4DT8A 3BU6A 3H10A 4TZRA 4BGHA 4EC8A 4O4BB 4M84A 4RPVA 4X2JA 2PWLA 3UYTA 4EOKA 3LZBA 3OCBA 3OCTA 4RMZA 1KUTA 3H3CA 4QMTA 2PMNX 4FL3A 3F5PA