5TE0A

Crystal structure of adaptor protein 2 associated kinase (aak1) in complex with bibf 1120
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
320
structure length
316
Chain Sequence
MTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Adaptor Protein 2 Associated Kinase (AAK1) in complex with BIBF 1120
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords AP2-associated protein kinase 1
total genus 92
structure length 316
sequence length 320
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5te0A00
3DQXA 3TNPC 5LVMA 3TTIA 2BR1A 4TYEA 4C2VA 1UU3A 4E6DA 2VTPA 4PUZA 2PVNA 4YHTA 4U9AA 4NFMA 4BDFA 3MSSA 4DEBA 3A99A 1K2PA 3QTIA 1PMNA 2J0IA 2JAMA 3HRCA 4UMTA 3QTWA 5GZ9A 4AGWA 5ICPA 3QA8A 3FBVA 3AG9A 3ORZA 3M42A 4O0TA 1APME 1V0OA 4YJRA 3HGKA 3PFQA 1FGIA 1M52A 2BDFA 3R01A 4FBXA 3QHRA 4IAKA 4U79A 3E5AA 4IEBA 3S2PA 3ZFXA 1JKLA 4BB4A 3MWUA 2YIXA 5B2LA 1U54B 4C58A 3CXWA 2HCKA 4BCPA 4RJ8A 3WYYA 4RLLA 3UOHA 4FKJA 4EOIA 4RFMA 4NW6A 1Q3DA 3KK9A 4FSYA 5JFWA 3MV5A 1Z5MA 1BI7A 5KCVA 3BHVA 4W9WA 2PUUA 1IRKA 3AD4A 4CXAA 4ACMA 4KWPA 2J5EA 2RG6A 4NJ3A 3KVWA 2FYSA 2YABA 3A7JA 4S33A 5KZ0A 3B2TA 4LI5A 4DFNA 1TVOA 4RWJA 3D83A 5I9VA 4DINA 3CE3A 4XLIA 5J1WA 3PZHA 3UQGA 3SW7A 3ZBFA 4YHFA 4E26A 3O0GA 5AJQA 2CGWA 5TE0A 3W16A 3AC8A 3MB7A 2CMWA 1S9JA 2OU7A 2X6EA 3R2BA 3KXGA 1Y8GA 3FZTA 2X1NA 3HMOA 3KXNA 2JKOA 4DEIA 4G3GA 4Y83A 5C8KA 2W06A 4JI9A 4UXLA 4B9DA 2FSOX 3QGWA 4E7WA 4AZTA 4TL0A 1MRYA 2JIVA 5IH5A 4I6HA 1CMKE 2VGPA 1Q5KA 1VEBA 2EUFB 1UWJA 3RMFA 1LEZA 3SLSA 4E20A 5EKNA 3WE8A 4V0GA 2QHNA 4QTEA 4BZOA 3POOA 3OXIA 1YHWA 3BWFA 3TZ9A 5DRBA 3IW7A 3QL8A 1UU9A 3W10A 5HU9A 3ZO2A 3ZLYA 3PY3A 3U6HA 3Q5ZA 3S1HA 4GRBA 3WZKA 1R0PA 2H6DA 5AR3A 2OI4X 2KULA 4XG6A 3RPOA 3PPKA 3ZXTA 5C27A 1H4LA 4HCVA 5DWRA 4O6LA 4BGGA 4ITHA 5JT2A 4O96A 3PVWA 3W2OA 2WQNA 1FGKA 4ZOGA 5J9LA 3PXYA 3EN6A 1UU7A 2V0DA 4EUTA 4RMZA 2R7IA 1I44A 2JLDA 5KZIA 3UVQA 3R83A 4ACCA 3Q9ZA 4UB7A 4QTDA 5FWKK 5EH0A 4KRDA 1E1XA 5HX8A 5AUXA 2C68A 3HV6A 3POZA 3EB0A 4EH2A 3UP2A 2VD5A 3HUCA 3WZEA 3BCEA 3REPA 1MRUA 3VQUA 2BAKA 4EWHA 3QQUA 3QKLA 4MX9A 3K54A 2WU6A 4YC6A 5D7AA 4HVIA 2OF2A 3ERKA 3QC9A 1Q8YA 3EN4A 2B1PA 2CJMA 3QTSA 4MEDA 5HE3A 3BQCA 4E5WA 3U6IA 3OEFX 3GENA 1PXJA 2PHKA 3DS6A 3GCPA 1OUYA 5DNRA 4XP3A 3SOCA 4IIRA 3VS5A 3UQFA 4JX3A 3NW5A 3QQFA 4FVQA 3QD3A 4GCJA 5JMSA 3SC1A 1YXXA 4FT7A 3P7CA 3V04A 1PW2A 3CEKA 4XV3A 1BYGA 4AE6A 3ZUVA 4LL5A 5DH3A 4Y85A 4Y46A 3P7BA 4QQCA 3LCKA 4QYHA 4YPSA 5HIDA 5DMZA 2BRGA 5HVJA 2ETMA 3DJ7A 1GIHA 1GOLA 2YCQA 4C37A 4YO4A 3IS5A 5C8NA 2BIYA 2BPMA 2OZAA 2WNTA 4FIFA 4BDKA 3I5NA 3NIEA 4WBBB 4JOAA 4EK8A 1OVEA 5JQ5A 3NYNA 4OGRA 3B8QA 3OROA 4D1XA 2ITUA 4ASXA 3PJ8A 4FZFB 4JL9A 4M68A 4F4PA 4YSMA 3DGKA 4A4XA 2XKCA 2PZRA 2AYPA 4EHZA 2JEDA 3F7WA 5HO8A 4F9BA 4XLVA 4ASEA 5CNNA 1XH8A 3LM5A 2RFSA 4LG4A 3TZ7A 3GU8A 4GG5A 3F69A 2B9JA 3JS2A 4I22A 4I4FA 4PL4A 4AZWA 3VS3A 2XJ1A 5FXQA 4U45A 4ANOA 3FMKA 3D4QA 3MY0A 4RZWA 4IJPA 5DFPA 4TZRA 3FMMA 3RPYA 4LMNA 1Q97A 4M0ZA 4O91A 4UY9A 2UW3A 3H3CA 3BHHA 3E88A 1XH6A 4M3QA 3RAWA 3KA0A 5H8EA 4QMTA 2XM9A 3OG7A 3SOAA 4ZLZA 4M8TA 1NA7A 5KKRC 3E63A 2PL0A 5LMKA 4ZZOA 2XA4A 5HO6A 4AG8A 1YOLA 4KIQA 4BDIA 4TTHB 1JSVA 3PA5A 5DOSA 3OS3A 4MXYA 5M57A 3QZHA 5EOBA 4D28A 5FP6A 4WO5A 3FC1X 3PY1A 3ULZA 3SD0A 3EQDA 3I1AA 5H2UA 2WHBA 1CSNA 4FI1A 5TO8A 4EQUA 4YGAA 3DAKA 5AIRA 3OCTA 2W1FA 4R5SA 4W9XA 3ORKA 3ZRMA 1PMUA 1OKZA 3KF4A 3ZC6A 2W1EA 4CD0A 3WF7A 4BFMA 3F5GA 3DZOA 1OPKA 4AZVA 2C1AA 2HY81 3E7VA 4F7LA 2WQBA 2W5AA 3E3BX 3K5VA 4GVJA 1OECA 5ACKA 4L00A 5J87A 3WOWA 2J50A 1YXVA 2W7XA 4LUDA 3UIMA 3WARA 4GUBA 3BGPA 4HVSA 3MFUA 3QWJA 4RWIA 3EOCA 4G34A 3DBCA 3OTUA 5AM6A 5D1JA 4E6QA 3JXWA 4CKJA 1KSWA 3VULA 2GSFA 2UZBA 2WTCA 2R5TA 3QQJA 3UO6A 4EOOA 1YXUA 1UNHA 2OJ9A 4KS7A 5A9UA 3JYAA 3P79A 2P2IA 5HCXA 1LEWA 4MBIA 4IVDA 2H34A 4AGUA 3E8NA 4S34A 3R1NA 2CSNA 4HNIA 3PPZA 2ITVA 4CFXA 4PMPA 1OL6A 4YU2A 2F4JA 3EHAA 5HG5A 3R7VA 2OGVA 2NRUA 4FTRA 3C50A 4QTCA 4U44A 5ETIA 4J1RA 3QRUA 3V01A 3Q3BA 3RAKA 4HGTA 1H8FA 3VIDA 2GHMA 2PZYA 2QO7A 2WIHA 4FNXA 5AUZA 3UNZA 4IE9A 4BBFA 4FNZA 1OIQA 3IW5A 4JNWA 3DQWA 5IA4A 4HYIA 5L6WL 3EQFA 2VTQA 3VS2A 3UPZA 4IW0A 2C6IA 3IONA 4FG7A 2XNOA 4B4LA 3CD3A 3AMYA 3AT2A 2WQEA 5CAUA 3TACA 3V51A 4Z7HA 4JDKA 2XEZA 3P9JA 4AAAA 3D9VA 1M2PA 3DOGA 4FKUA 4PDSA 5CAPA 4U43A 1XJDA 5AV4A 4AW1A 2HZ0A 4BCGA 4I21A 3QUEA 1O6LA 3AD5A 5CEKA 3DV3A 4G9RA 4EOLA 3GQLA 5EI8A 3H0YA 3C51A 1XWSA 2VO3A 3LCSA 4OT5A 4R5YA 3BYMA 2FSTX 3QZFA 3K5UA 5HNGA 3G9NA 1H0VA 4TN6A 5I9YA 2Y7JA 2BZJA 4FTNA 4B7TA 4OBOA 3NLBA 2X9FA 2QC6A 1IASA 2A27A 4V0GB 5K9IA 5F94A 2OZAB 2PZIA 2B9HA 3OD6X 3OW4A 3P7AA 2J0KA 4I24A 4GFOA 1MRVA 5AP4A 2XM8A 2AC5A 4PNKA 4K8AA 2WEVA 2XK7A 4IZ5A 3R1YA 2IZRA 2R3NA 4MBJA 3L8PA 3CC6A 2BMCA 2Z7SA 4BCNA 4S31A 4FZ7A 1YOMA 3UVPA 3IOPA 2PMLX 2QO2A 2ZAZA 5H8BA 5CF6A 4G1WA 4IADA 5C9CA 3C9WA 4MK0A 5HX6A 3CJGA 4FT0A 5L3AA 3QA0A 2ZV9A 3F3TA 4XBRA 3UPXA 5LJJA 1GIIA 3ALOA 4FL2A 3CQEA 1A9UA 4FIGA 4AWIA 4FA2A 1ZMUA 4CFMA 5AX9A 3UYSA 3A8WA 3PRIA 4OTWA 3V8SA 2QR7A 1OIYA 1YDSE 2W1DA 2GTNA 3HMNA 4FKOA 3HA8A 4TYHB 3MA3A 3GNIB 1ATPE 2VWWA 4KIKA 4Y5QA 5HD4A 4H3BA 4O21A 2CN5A 1OPLA 3L1SA 1HOWA 3V6RA 3R28A 3MFSA 5EI2A 5LVPA 1T46A 4E5AX 4LFIA 3HRFA 3EN9A 4IMYA 4UWYA 4NU1A 2YM7A 3UOLA 1B38A 2F7ZE 4FV8A 2JGZA 3UC4A 3ZHPC 4F64A 3RK9A 3ZFMA 3ZZEA 4I0SA 3PZEA 4UWBA 4QYYA 5AUWA 4E1ZA 3FSFA 5D12A 5HD7A 2IVTA 2YIQA 3MIYA 1H25A 1SYKA 4YJSA 3TWJA 4C3PA 5T6KA 2PVMA 4FIJA 1G3NA 2CPKE 2OXXA 4CKRA 3ZMMA 3M1SA 4K2RA 3O23A 3PVBA 5L8LA 4FTLA 4BWPA 4F7SA 5AP2A 4Z7GA 5IA2A 3DCVA 5L8JA 3FLNC 2GDOA 4QPAA 4RC4A 4MXAA 4PWNA 2JD5A 1ZXEA 4MD9E 3ZU7A 5FXRA 1K3AA 3QWKA 3EQCA 2QLQA 3BV2A 5IU2A 3LXKA 3ROCA 3R30A 5HNIX 4IZAA 5ITAA 2EU9A 2ZM1A 3I6WA 3CCNA 3OY3A 4FKTA 1UVRA 2WMUA 5CAVA 3P1AA 3Q6UA 4KAOA 4D55A 4QMZA 2IZSA 3AGLA 4FTJA 3VF9A 5AADA 3NNXA 4TWCA 1AD5A 2W1CA 4BN1A 4DEAA 1BKXA 4E6AA 3NWWA 4L45A 1YDTE 3S3IA 4GU9A 3NSZA 4OTHA 4PMTA 4YUQA 1PHKA 3VRYA 4EYJA 3LFDA 2ZB0A 3ZLSA 4DH1A 1MP8A 1I09A 4MXXA 4C4HA 3UMXA 4X2KA 2CCHA 4ITIA 3F88A 4QMMA 3TKUA 3AC4A 3SXSA 3VBXA 1EH4A 4EOSA 4FTQA 3RNYA 2PMIA 3THBA 4O0SA 3ZEPA 3WZUA 4BHZA 3BLQA 4UV0A 4ZY6A 3VBWA 1W83A 1WBNA 3O96A 5CU0A 1SVEA 2C5NA 1KE6A 1TQPA 5FLFA 4MXZA 5HE1A 3OWJA 3LCDA 3DY7A 3Q60A 1H24A 3PE1A 2XIXA 5ANJA 2G2IA 2C4GA 2OW3A 1E9HA 3MPTA 2QLUA 5JSMA 4HGLA 4M97A 5HG8A 4WT6A 5CENA 4ENXA 3D5WA 2RFDA 4JDHA 4JDIA 1O9UA 5KMNA 3V5QA 4DN5A 3T3VA 1J1CA 3FY2A 4EH3A 3R71A 4YJUA 2GMXA 3HV3A 4JBQA 4X3FC 5HEZA 4RIXA 3SVVA 2UZTA 3KVXA 5C01A 4EOMA 4QMWA 2CLQA 3FAAA 1WZYA 3GC7A 4DFLA 5IUIA 3U87A 2GQGA 1Y8YA 2UW6A 4RA4A 4BWKA 3DK6A 5CNOA 3F2NA 3C4ZA 2NP8A 3KKVA 3PRFA 3VQHA 1BMKA 3M11A 1HCLA 2EXEA 3BYUA 3Q2MA 3GU5A 2VN9A 5CQUA 2OFUA 3R21A 4IB0A 4G6NA 5CU3A 3VHEA 4FTOA 3R8MA 2DWBA 3PYYA 1IG1A 1P4FA 2E9NA 3A7HA 4LOPA 4CVAA 4UX9A 3AXWA 2HY0A 1DI8A 3GCUA 2F2CB 4DHFA 2I1MA 5I3RA 3FMHA 5TKDA 2CGUA 1F0QA 4FV4A 3U9NA 4QP1A 4W4WA 4YNEA 4B8LA 4FYNA 2IW9A 3W32A 4CRSA 3R9OA 4JRNA 5AR4A 4XCUA 4HYHA 2OBJA 4ZTNA 3EYHA 3G9LX 3IQ7A 4DFYA 1PXMA 2YJSA 5E8ZA 3AGMA 1XH5A 3I0OA 4JT3A 2DQ7X 1RW8A 4FKLA 1KOBA 2YDJA 3EL8A 3TKHA 1BL6A 2ZV7A 3HMMA 3KRWA 5E8YA 5CT0A 4JX7A 4KIPA 3UQCA 3CR0A 3O71A 3FXXA 5F20A 5IKWA 4LGHA 1JSUA 4D58A 5M4FA 3FQEA 2A2AA 2BTRA 3BBWA 2PVJA 3NNVA 1WAKA 3C0GA 2HK5A 3G0EA 5AUYA 3VBYA 4J8NA 1H28A 3VUMA 4QP2A 2WTWA 4WSQA 3EFJA 3ORXA 4YP8A 3NUXA 4ZJVA 4KSQA 1H00A 1UA2A 2JITA 1Q41A 3E92A 4APPA 2ITWA 4QMUA 4UBAA 4C36A 1QPDA 4CTBA 3HMPA 5FM2A 2Y4IC 4FG8A 4KINA 4OAVB 4ZSEA 2ZMCA 3FKNA 5CALA 3ZUUA 1ZYLA 1W82A 4A9TA 4IVCA 2R3PA 4BTJA 3O8TA 4FVPA 5HU3A 2BFYA 4BL1A 1KE7A 2R3JA 5G1XA 1PKGA 5CXHA 4F65A 2QOKA 3BKBA 3T3UA 3MY1A 4L67A 5HLPA 4X0MA 3OBJA 3VWAA 5JZJA 2YZAA 4WG4A 1E1VA 1QMZA 3UBDA 2A1AB 3RI1A 2XRWA 3DJ5A 3PWDA 4BI1A 1XBBA 4ALWA 5CSPA 4USFA 2OXYA 3ZFYA 2VO0A 2E9VA 3FSKA 4TWNA 5IUGA 3QHWA 1MQ4A 1XHAA 4L53A 5AP3A 4IDVA 4O0XA 5AV1A 4BCFA 1IR3A 3OW3A 1BI8A 3VS0A 2OO8X 5ANKA 5KMLA 4G6LA 3TZMA 3AQVA 3ZXZA 3HDNA 3CLYA 1S9IA 4EOKA 3ZO1A 3RM6A 1PXOA 3FLYA 3NAYA 2I6LA 4FTMA 4I41A 4ZK5A 3LIJA 3ALNA 3COIA 5ANEA 1Y57A 4TYJA 4I6QA 4EZ7A 2WKMA 1RE8A 1GZNA 4D0XA 1VZOA 1VJYA 2UZNA 3QTRA 1REKA 4DH5A 3TNWA 2R3FA 3GC8A 4NM3A 5E1SA 1WVYA 3FQSA 2RF9A 4O0WA 5B0XA 4NK9A 4QP4A 1YDRE 4QYGA 4BCOA 4AE9A 5AIKA 4DCEA 3E8DA 1H08A 3BU3A 1ZYJA 3GUBA 4L01A 4CFWA 3JY9A 4D5KA 3A2CA 5DR2A 2PZPA 1XO2B 4OTDA 3W2RA 1JKTA 5DT3A 4BDCA 5LXMA 3QALE 1PMEA 5D9HA 3ZC5A 2OJIA 3S0OA 3EYGA 4K18A 5JH6A 4YTFA 1CKJA 1JSTA 2R4BA 2UUEA 1W7HA 3NAXA 3NNWA 4G3FA 3PIZA 4YC8A 1G5SA 4L3JA 4NUSA 5A3XA 4MAOA 3UIUA 3KN5A 1U5RA 5AR7A 5AWMA 2BHHA 5J9YA 1H07A 4U7ZA 5LVOA 4JBPA 3PJ1A 4CKIA 4EONA 2ONLC 2QOLA 3BYVA 2Z2WA 3DBQA 2OICA 4KKGA 2HZIA 2C5XA 4KSPA 4L8MA 3S95A 5JGBA 5DEYA 3HV4A 3N9XA 4EC8A 5CQWA 3QLGA 3DT1A 4FL3A 4XG9A 3RBWA 3MVJA 3W8QA 3JVSA 4IX6A 3I81A 3RTPA 4RIWB 4GIHA 2PVFA 3FHRA 2WZJA 4RWKA 4CEGA 3R8PA 5K4IA 5HTBA 1XH7A 2C5YA 4A9UA 3Q04A 5HTIA 4ZZMA 3LFNA 1WBSA 5AM7A 3RALA 3R22A 5EYMA 4DGOA 1YRPA 3DJ6A 4XHKB 4RVTA 1P4OA 1U54A 4MYGA 5E90A 3EZVA 3WIGA 1QCFA 1TQIA 2OWBA 2VV9A 2UZEA 4FV7A 1WVWA 4GV1A 1WBWA 4RX7A 2W1HA 4KS8A 2QD9A 4YTIA 5J95A 2CDZA 4YJTA 1IA8A 4Q9SA 5M4UA 2QU6A 1PYXA 4AS0A 4EQCA 5FDXA 3C4XA 3BBTB 4NSTA 2RIOA 3ORLA 5CI7A 4DYMA 1BUHA 4RT7A 2XKEA 4U5JA 4F0FA 5A4CA 5AUTA 3ZCLA 1NVSA 2QI8A 2YM6A 4GH2A 5EHYA 4X2FA 5E8VA 3WBLA 4ERWA 5B2KA 3FI4A 4E4MA 3F7ZA 3UMWA 3HNGA 3U8WA 3VJOA 4CFVA 2NPQA 3ZSGA 3U4UA 3EZRA 3GFEA 1PKDA 4NTTA 5AA8A 2A4LA 4JR7A 4KD1A 3I7CA 3V8TA 1DAWA 5EYCA 4ZZNA 2Y8OA 2UZUE 2XKDA 4JG7A 2XMYA 1H01A 3IW4A 5HGIA 3R7YA 4G3CA 4MBLA 3DK3A 4LMUA 2VWBA 4LOOA 3ROYA 4FKPA 1JKSA 2Y0AA 1FVVA 2CGVA 3KU2A 4C59A 4NH1A 2JFLA 5HLWA 5DR6A 4QPSA 4P2KA 5EK7A 2R3OA 2WMAA 3MA6A 4PDPA 4AZFA 4J53A 4ANMA 1U59A 3L8SA 2VZ6A 3LQ8A 5CANA 5CYIA 3II5A 4C4JA 4E5BA 5L6OA 3MPAA 2Z7LA 4NFNA 4EH4A 2HXLA 5EI6A 4ZP5A 3C7QA 4TWPA 4RBLA 3A7GA 3NR9A 1H27A 3U51A 5LCKA 4EI4A 4YZBA 1KV2A 4QP6A 4AF3A 2ERKA 2X6DA 2O0UA 4LOQA 3KB7A 5CY3A 5AR5A 3RWPA 5BQ0A 5CF8A 4QD6A 4XV9A 4CSVA 4QO9A 2LAVA 3R9NA 1XKKA 3HV7A 1DAYA 2ZV8A 4AA4A 4BI0A 3DZQA 3Q53A 4LM5A 3QRKA 1JWHA 4XYFA 1OZ1A 3H4JA 4HPTE 4C0TA 4CCBA 3OMVA 2YM8A 4R3PA 1OL2A 4C61A 4I5HA 5TOZA 3FZ1A 5AV2A 5IG1A 5DPVA 4EC9A 3MVHA 5AEPA 1WFCA 4UEUA 4EBWA 3GP0A 2JIIA 2W4JA 3SA0A 2E9UA 2GS7A 4GEOA 1PXKA 3DXNA 3SKCA 4ENYA 5F9EA 5L2WA 3FPMA 3FJQE 4BICA 5CSXA 3D14A 3KULB 3QYWA 4RGJA 3I4BA 1WMKA 2VX1A 4F7NA 2YCFA 3V5LA 1DS5A 3OXTA 3P08A 3RVGA 3F5UA 4XJ0A 5FBNC 5IF1A 5FEEA 4OLIA 2ZJWA 4AT4A 4CYIA 2CGXA 5IEVA 3W2PA 2JC6A 5DIAA 3K3IA 1GZKA 3T9IA 5IUHA 4P7EA 5A14A 2C5VA 4ERKA 3Q4TA 5GJDA 3QQLA 5CVGA 1OITA 3MJ1A 3VS7A 4U81A 1NVQA 2DUVA 2E9PA 2YDKA 2YIWA 5FM3A 4CT2A 3EN5A 4HNFA 1ZRZA 2GFCA 3R2YA 1XH9A 4FNYA 3E93A 5T68A 4E4XA 5IPJA 3GCVA 1UV5A 1QL6A 3QF9A 2KTYA 1W8CA 3VN9A 4FV2A 3SQQA 2NRYA 2X8DA 2IVUA 3QD0A 2OF4A 4WNMA 4ITJA 3EQRA 4CQGA 3R04A 3CY3A 4WRSA 3ZSHA 4RIWA 2XK6A 2XYUA 4IWDA 4RRVA 4LRJA 3FZOA 2XJ2A 4XRLA 5FQDC 4EK5A 2VO6A 3DDPA 3FV8A 2YIRA 2UZLA 4PRJA 2GCDA 3HP2A 3DB8A 3FDNA 3SW4A 4BKZA 4CMOA 2ESMA 4R7HA 4CQEA 4PQNA 4U42A 2UZVA 3F3WA 4MF0A 2FVDA 2UW5A 4L7FA 4XOZA 4C33A 2VTLA 4FSTA 4J8MA 4RPVA 3U6JA 4YNOA 4G3DA 4IX3A 1OB3A 3AOXA 3A4OX 3CS9A 5HG9A 5AR8A 3JY0A 3UC3A 2R3HA 2XK8A 3VS1A 5K0KA 2VTOA 4AW0A 3RWQA 4WSYA 5HI2A 3H9FA 3QRIA 4J98A 4HZSA 2B52A 3BI6A 2C6DA 4JS8A 2X7OA 5EDPA 5HICA 4I93A 3DB6A 3R0TA 2F49A 3M2WA 4LL0A 4FKQA 4BYIA 4M69A 4QMSA 2G2FA 3ORNA 4JBVA 5M56A 2ZOQA 2XNBA 4NM7A 1R1WA 2J6MA 3PP1A 4X3FB 3VUGA 5AP0A 4EK3A 5D11A 4DH7A 5FD2A 1SZMA 4RC3A 4K77A 4BTKA 2IZTA 4OTIA 3O51A 1DI9A 5AV0A 4E3CA 5AP7A 2W9ZB 4RIOA 4QMOA 3A7FA 2WMRA 3TIYA 4C3FA 1OGUA 2F9GA 3Q52A 4PTCA 3R7IA 4CRLA 3QC4A 4QP3A 2BALA 2E9OA 2HAKA 4AXAA 2WD1A 4EK6A 2ACXA 1FMOE 2DYLA 1AGWA 2XJ0A 5T3QA 4C62A 5I9UA 4EZ3A 3BU6A 5FEQA 4B8MA 4ZTQA 2C6LA 2X39A 5BVWA 4PMMA 3KRXA 4MWIA 4MWHA 3VUDA 4U3ZA 1O6YA 2J7TA 4QMNA 2X7FA 4Q9ZA 4XBUA 2BZIB 5ETAA 4R1YA 4WG5A 3KK8A 4P90A 3CGFA 4ANQA 4WIHA 5E92A 4XG7A 3F2AA 1LP4A 3Q4UA 3QX2A 4ACGA 3DBDA 5DGZA 1PMVA 4BHNA 2OG8A 2PK9A 3C13A 5ANGA 5AA9A 4IVBA 5HBJA 3MPMA 2R0UA 2X0GA 1M14A 2WTJA 1NVRA 4OTFA 2WMVA 3CTJA 3ZTXA 3RM7A 4HVHA 2B54A 3AC2A 4FNWA 5FRIA 3VJNA 4J7BA 4KBCA 3QRJA 5IISA 2H9VA 2QKRA 3LXLA 1A06A 5LWMA 4P5QA 1Q61A 2W99B 1P5EA 3KC3A 4DBNA 2XB7A 4H3QA 1YWRA 2BZKB 3FL4A 3KXZA 4U0IA 4BYJA 3I79A 4DLIA 4EEVA 3GB2A 5CVFA 1P14A 3EQHA 2JBOA 3VS4A 3O17A 1OL7A 3CPCA 5A4TA 3QXPA 2W1ZA 2ETKA 5IH6A 2WMXA 3KRRA 3V3VA 4W4YA 5L6PA 2R3QA 5EW9A 4AT5A 3VW8A 4IB5A 4V04A 4RX5A 4NZWB 1P2AA 5CSVA 5KNJA 3BLHA 2C3JA 3PTGA 4EYMA 4K33A 4W4XA 3LFCA 2XF0A 4JJRA 4RX8A 2J0MB 5TR6A 4C57A 4O0RA 3MS9A 3GOKA 2BRHA 3JUHA 3QKKA 4R3CA 2C30A 4O1OA 5DEWA 3TZ8A 4O22A 4D9TA 2XIYA 1FPUA 4FTUA 3QQHA 1JLUE 1QPCA 3TL8A 1M17A 1UKHA 3RHXA 1XR1A 4O2PA 4C7TA 3E3PA 4RWLA 4C34A 3U4WA 3KGAA 5I3OA 2WIPA 3VUIA 5CEMA 3BYOA 3HVCA 1RQQA 2R64A 2UVZA 3O8PA 4QNAA 2RL5A 2C3KA 3I6UA 3T9TA 2QHMA 3QAME 5F4NA 5HO7A 3Q5IA 3TV7A 3NEWA 4MCVA 5L2TA 2GHLA 1CDKA 4YPDA 2CCIA 2CKEA 2W4OA 1RJBA 4IB3A 3NYVA 3NUUA 4W8DA 1V0BA 4JXFA 3L8VA 3C0HA 1AQ1A 2GNHA 4X6RA 4BCHA 5A6NA 1U4DA 1JOWB 4IVAA 3OVVA 5GZAA 2XCHA 5LCJA 2X2KA 2V7AA 2GNIA 3GFWA 4ACHA 4UMPA 3AD6A 2WOUA 1W0XC 3QD4A 2QO9A 3C4CA 1OI9A 4G6OA 3BEGA 3FMJA 4NIFB 3NIZA 5E8WA 3LLTA 1WBVA 5M55A 4FSUA 5ANOA 2UW7A 4F0GA 2G2HA 3LJ0A 5IMXA 4F99A 3RNIA 4CLJA 2BUJA 4QP7A 5E1EA 2GPHA 2W05A 3IGGA 5K0XA 1OIRA 2HZNA 4F09A 3EIDA 4F1TA 4C4IA 2ITOA 3FWQA 4QQTA 4J52A 3FI2A 3QXOA 2I0HA 4N0SA 2BRNA 4TWOA 3Q4ZA 3O50A 5BMSA 2QR8A 4XG3A 4RX9A 3FXWA 4QYEA 4TW9A 3DKFA 3PIXA 4Y73A 2HWPA 4IAYA 5DVRA 5B7VA 2YITA 4C4GA 5KE0A 1NY3A 4GJ3A 3PVUA 5AAGA 3UDBA 2W1GA 4IBMA 4GT3A 2VTAA 4AOJA 4YHJA 5HLNA 3FPQA 4QTAA 3QTUA 1KOAA 3A8XA 2QG5A 3DFAA 3FYJX 3GU7A 4FK3A 5ETCA 2P55A 3QQKA 4F9YA 3CPBA 4X3FA 4UYNA 4F9WA 3F82A 2HW6A 4NJDA 5CEQA 1WBOA 3IGOA 4ALVA 3WF9A 5K4JA 2R3GA 3KXMA 3NUYA 2V55A 3PP0A 4O6EA 4U40A 4D1ZA 2P4IA 3ELJA 3VF8A 4DEGA 3PY0A 3QU0A 1R3CA 3GC0A 5AP1A 3I7BA 4O2ZA 4BTFA 4E4LA 3OWLA 4QMLA 2PVHA 2QOOA 5K5XA 4YJPA 4WHZA 3AT4A 3MH3A 4DG3E 2GS6A 5KBRA 1YKRA 2R3RA 3QZIA 4KKEA 3IOKA 3RPSA 1PXIA 3KRLA 2WTKB 3LQ5A 2C6MA 4BDGA 4KBKA 4BC6A 2UW9A 2FSLX 4U41A 3P4KA 4FSNA 4FSWA 4GFGA 2VTTA 3NUSA 2C3IB 2JFMA 2OK1A 4YTCA 5K5NA 3EFLA 5DT4A 3O2MA 3TUBA 3EQPA 1YWNA 2PVRA 2R9SA 2Y6OA 4PNIA 3P86A 1JKKA 3BE2A 2C47A 2DS1A 3OEZA 4LV5A 3MJ2A 2ZM4A 3DPKA 2JDSA 3KCFA 4EH5A 4DG0E 5CEPA 3A62A 4FV5A 5HCYA 3DBFA 5KUPA 4OTQA 2ZV2A 5CU2A 2FSMX 2YIYA 2IN6A 2X9EA 1WBTA 2Y4PA 3NS9A 4FSZA 4WD5A 5HVYA 2IVSA 2R2PA 3MDYA 4MKCA 3W1FA 4UMQA 4II5A 4DC2A 5EM7A 2UW4A 2Y4IB 3VO3A 4F7JA 4XS2A 2JKKA 4GYGA 1Y6BA 1GIJA 2BROA 3GCQA 4X3JA 4E93A 3G2FA 2J0LA 4FODA 4RJ5A 4M0YA 5CF4A 3OHTA 4QQ5A 3RCDA 4K6ZA 4M66A 2X2MA 3TNHA 3BX5A 4KB8A 3Q4CA 2J90A 5GNKA 3ZO3A 3B8RA 2EXMA 2WMBA 3UE4A 4EHGA 5FTOA 3D94A 4EK4A 1PXNA 4PPCA 3QCQA 2X8IA 4EQMA 3UIBA 3H9OA 5C1QB 4Z55A 4MQ2A 1F5QA 1YWVA 4IC8A 5HVKA 5KMOA 4S32A 4LV8A 2PWLA 1ZZ2A 2J4ZA 5IZFA 1YI4A 3P23A 4LGGA 4JG8A 5HKMA 5CU4A 4DEHA 4HVGA 4I1ZA 3UG2A 5BPYA 3TCPA 2BFXA 3GU6A 4KBAA 4FKSA 4IWPA 5M44A 2VTMA 1GAGA 1PF8A 4EOQA 3V5PA 3OP5A 3D2KA 2QOHA 3BEAA 2ZM3A 1H26A 4EH8A 4KA3A 1PY5A 5D41A 4D2WA 5J7BA 4HYUA 4A9YA 3P5KA 4JQEA 5GJFA 4AFEA 3DNEA 2R7BA 1Z57A 4H1JA 2OIQA 2RFNA 5FEDA 3TV6A 2GHGA 2O63A 3F61A 4PPAA 5F1ZA 3R9DA 2Y6MA 3SRVB 3GT8A 4M7IA 2F57A 1B6CB 4ZLOA 2ZVAA 2WQMA 1ZMWA 4FTCA 4N6YA 3EJ1A 1M2QA 1ZY5A 4PTEA 5DG5A 5LVNA 2EWAA 3F3VA 4BCJA 3E8CA 3FKOA 2IW6A 4AOIA 3HRBA 4OTGA 4ZSAA 1H0WA 2B9IA 2Z7QA 4BDAA 4FICA 3BQRA 5EHLA 2AUHA 3NYXA 1YXTA 3BGZA 4D9UA 4F0IA 4WOVA 2QODA 3MB6A 5LARA 1R39A 2C0IA 5HIEA 1OIUA 3F9NA 1M2RA 1FVTA 3IPHA 4E73A 4HGEA 5A4LA 4G17A 2ETRA 3U9CA 2WMSA 2Z8CA 3RAIA 3HDMA 5HTCA 5LMAA 4FT9A 5BVNA 3O8UA 4I5PA 4GVAA 3PXKA 4RIXB 5LQFA 5HCZA 4FOBA 4JBOA 4PPBA 3BE9A 4ZTRA 4EJNA 5FXSA 4MQ1A 3LFSA 4D5HA 5BVDA 5GJGA 3R8LA 3V5WA 2ITPA 2PSQA 4DFXE 2B55A 4YTHA 3VBVA 4C38A 3SXFA 2BRMA 3OWKA 4FK6A 4YLKA 4DH8A 2XKFA 3NCZA 3NDMA 4ZY4A 4OUCA 4FIEA 4L43A 4IDTA 5KHWA 5GZ8A 3ORPA 5CX9A 4YJQA 4I6FA 3ENHA 4ANSA 2PE0A 1PXLA 2X4FA 2OKRA 3NX8A 3KRJA 2V5QA 2OJFE 2XNEA 3ODYX 2XNMA 4PP7A 4PMSA 5EKOA 5KMJA 2ITQA 3PJ3A 4RJ6A 2O3PA 3UIXA 3HYHA 2B7AA 4N6ZA 4LRKA 4TNDA 5A4QA 2YCRA 4FKVA 3P0MA 3CKWA 4CCUA 2WFYA 2ZMDA 3LCOA 1L3RE 4CZYB 4QNYA 1PJKA 3C0IA 4MXOA 1MQBA 4JIKA 4Y5HA 3BIZA 4WUNA 5I9ZA 4FUYA 4QT1A 2WEIA 1ZLTA 2I0YA 4FUXA 4F6UA 4LGDA 4QMVA 4BDBA 4TYGA 3KY2A 4Y8DA 4AACA 2JBPA 4PY1A 1YW2A 4CYJA 4ZXTA 4DH3A 2XCKA 2PE2A 4FTTA 4JLCA 4FKWA 4FTKA 4P4CA 3LM0A 4FX3A 5D10A 2HOGA 3LW0A 1Y91A 3OY1A 4H36A 1KWPA 1JNKA 4HZRA 4EHVA 2HYYA 2BRBA 5AV3A 2OXDA 4IM2A 3OT3A 4BCKA 3UZPA 4DAWA 2I0EA 5HBEA 2F2UA 3C4FA 4FSQA 4O38A 4L46A 4EHEA 5BVFA 3E8EA 3SHEA 1M7QA 3C4EA 3PWYA 5L2SA 4H58A 2BTSA 3L9MA 4XG8A 3RK7A 3G5DA 4USEA 5J79A 4ZSJA 2G15A 5J8IA 3OUKA 4M67A 4N4SA 3HEGA 5CAQA 5AAEA 3EKKA 2PMNX 4R6VA 3QYZA 2WU7A 4G5JA 3KMWA 4YLJA 5A46A 3I60A 1WVXA 3GI3A 2Z60A 2GNLA 5EFQA 2HW7A 4D4SA 2ZDTA 1BL7A 3LPBA 4RFYA 3ZOSA 4G31A 4IACA 5EYDA 2CLXA 3FMNA 4M15A 4F9AA 3AMAA 3ANQA 3G6GA 4BZNA 2YWPA 4XV2A 4AA0A 4J97A 3FI3A 3IDBA 4KIKB 4XP2A 3DTCA 3D5VA 4BIBA 4FEQA 1Y6AA 1J91A 2YERA 4I0RA 4BDJA 3ZM4A 2VAGA 1T45A 1W98A 2R0IA 2QURA 4FOCA 2YM5A 3LJ2A 1CKIA 1VYZA 1KE5A 2OJJA 4FC0A 3WYXA 3VHKA 3MYGA 3LXNA 4RC2A 4V05A 3TIZA 4Z3VA 3N51A 5J1VA 4KIOA 2QOQA 5FBOA 3E62A 1LPUA 2PZ5A 4QRCA 4U6RA 2HENA 4F63A 2Q0NA 4MD8E 3RINA 4CMTA 4I92A 1YHVA 4DGLC 4I5CA 4UZHA 2XZSA 3QCXA 4BRXA 3I0QA 5BVOA 3OFMA 3UZTA 1YI6A 3D7ZA 2XBAA 4L44A 3R9HA 2RG5A 3COMA 4QTBA 1TQMA 1OKVA 2BHEA 2P0CA 2JDRA 4WBOA 4HCUA 5AP5A 4BDHA 1PXPA 1ZAOA 2V62A 4GSBA 3KFAA 5IDPA 3HLLA 2HXQA 3VBTA 3Q9WA 4M14A 5FGKA 1PYEA 3BPRA 3PLSA 2IO6A 5AAFA 2R3IA 3QQGA 4IZ7A 2VX0A 3FYKX 5JRSA 3MFTA 3NW7A 4MXCA 3FL5A 3Q9YA 4DEEA 2BZHB 2JDVA 5CAOA 2IZUA 2PE1A 4O1PA 1RDQE 1VR2A 2J51A 3KCKA 4A9RA 2G1TA 4MNEA 4S2ZA 4NCTC 5L2QA 3VW6A 3DLSA 2VTIA 4KNBA 4ANNA 4D2VA 3OT8A 1U46A 3ACJA 3Q96A 4E4NA 3TEIA 3KMMA 4QP8A 5JK3A 2IW8A 3RPVA 1Q24A 4RJ3A 4DITA 2AC3A 2C3LA 3EFWA 3KXHA 4PL3A 2O65A 2C69A 3QTQA 3R63A 1H1SA 2EXCX 2VNWA 4O0UA 4OBQA 4CFUA 3W2SA 4D4RA 4YZDA 1VYWA 2I40A 4OTRA 2JIUA 3TJCA 5JGDA 4BGHA 2IWIA 3W2CA 5CZHA 4IANA 4PF4A 2VRXA 2VX3A 4YJOA 4DG2E 4AN3A 2WMWA 4ASZA 2XIRA 4IM0A 4H39A 2JKQA 4G9CA 5FP5A 3IKAA 5CVHA 2REIA 4XUFA 3MVMA 3TI1A 5LMKC 3F5PA 4XX9A 2EB2A 2WELA 4PX6A 3ZLWA 4BBEA 5CASA 3TNQB 4YJNA 3L9PA 3ZLXA 1ZWSA 3B2WA 5E8SA 4I94A 1H1PA 4EH9A 3L9LA 3SRVA 2XNPA 3MH2A 5CEOA 5I4NA 5CEIA 4HGSA 2UW8A 2A19B 5EM5A 3GU4A 4M84A 5K3YA 4A06A 4M13A 3S00A 3HMIA 3FUPA 4D0WA 3OXZA 1F3MC 4ALUA 4D2TA 3IDPA 4IB1A 4AGDA 3FMDA 4TRLA 5A6OA 1NXKA 1ZOHA 4NEUA 5ACBC 3W18A 5JFVA 4CT1A 3R6XA 4YBJA 5CXZA 4UMRA 2BKZA 4IX5A 4HVDA 5BUEA 3MTFA 3W55A 3GEQA 4ANLA 4I23A 2C0TA 4ZY5A 1YHSA 2PMOX 2GNFA 2WB8A 2C5OA 3G51A 1JBPE 3UGCA 4BCIA 5I9WA 1UKIA 2FB8A 5HG7A 2ZB1A 5TT7A 2YM3A 3MN3A 4KKHA 2VGOA 4KRCA 3UTOA 4AGCA 5IA3A 5M4CA 3PSDA 4FR4A 5BX0A 1OUKA 4C4FA 2UZDA 3LAUA 4IHPA 5BUIA 3LZBA 4X6QC 5ANIA 3GVUA 3CQWA 3DLZA 5BNJA 3ZUTA 2ONLA 3R8VA 4CMUA 3ZONA 2ITNA 4JIAA 4G2FA 4H3PA 4X2NA 5EM8A 5HOAA 3UOKA 4O0YA 4NTSA 4XOYA 4BKYA 4RZVA 2Q0BA 5I9XA 3TG1A 1Q8WA 3GC9A 1O6KA 4FV6A 4PP9A 1FINA 3WZDA 4C4EA 4RSSA 3RCJA 3Q9XA 4K9YA 4BZDA 2UVXA 2WXVA 1H1WA 4WNKA 3QD2B 3D5XA 2C1BA 5JZNA 1SNXA 4QMXA 4ZTLA 3NGAA 4I6BA 3FZRA 2GTMA 2W17A 4NT4A 5ETFA 4C02A 5E8XA 3LMGA 4Q5HA 4FV9A 4D1SA 3D15A 3R7GA 4J96A 5CF5A 2X7GA 3ZDIA 4A9SA 5HQ0A 3OTVA 2J9MA 2WQOA 1ZARA 2W96B 3K2LA 4TYHA 1ZOGA 3AT3A 3DKOA 5HHWA 4R8QA 5IA1A 2Z7RA 5EOLA 4UWCA 1BLXA 1YVJA 1ZMVA 3R02A 1SM2A 5IDNA 5BVKA 4D2SA 4ZSGA 4AQCA 2X2LA 4GT5A 4DGMA 4C8BA 1U5QA 3QRTA 2PVYA 3FMLA 4GL9A 1JQHA 3MGYA 4P5ZA 4FGBA 2YN8A 4CZTA 5KX8A 3GOPA 4K11A 2LGCA 3H10A 4FV1A 1Q8TA 3VBQA 3OBGA 2JDTA 4AU8A 3R8ZA 2W1IA 3GCSA 3COHA 4IH8A 3QZGA 2YJRA 5CI6A 3SX9A 4AN9A 3BHYA 3LCTA 2VU3A 1R0EA 3NYOA 4RG0A 4TKSA 4RVLA 3Q6WA 4A7CA 4JRVA 2Y9QA 2P3GX 3LFQA 4X21A 5M51A 3G90X 2VNYA 3NCGA 4U80A 5GHVA 3RJCA 5CSWA 5FDPA 3RZFA 5JN2A 2XEYA 3E64A 2XK9A 4K0YA 4L3LA 1SMHA 4C2WA 4YC3A 3ORMA 5F95A 3WIKA 1YI3A 5AMNA 3WILA 2XUUA 2VWZA 3DFCB 2WTVA 4IFCA 4RQKA 3IW6A 4WNOA 4LRMA 5AP6A 1Q8UA 3CKXA 2FO0A 2YCSA 2JAVA 1REJA 3HL7A 4ID7A 4XG2A 2YLEA 5LOHA 2VWVA 4YO6A 2J2IB 3UODA 4L7SA 4ZAUA 4XH6A 4GU6A 4R7IA 4USDA 3I5ZA 3D5UA 4MTAA 4AP7A 2OH0E 1TKIA 2XIZA 4EH7A 2PY3A 4WUAA 3EQBA 1SVHA 3R73A 4YJVA 4BCMA 3A61A 2R3KA 3IO7A 4R3RA 5DLSA 4IC7A 3TN8A 4IM3A 5IH4A 4MD7E 3NUNA 1XBAA 4BTMA 3HUBA 2ITYA 3QX4A 3KL8A 2YLFA 4NKSA 4TYIA 3CY2A 4GJ2A 3F3ZA 3LVPA 3HECA 5JQ8A 4YZ9A 1MUOA 3NPCA 1FQ1B 4IWOA 4NM5A 3CQUA 3PXQA 5KHXA 3CTHA 2WO6A 1YQJA 3V5TA 4BKJA 1Q4LA 4EWQA 3OCBA 2SRCA 3OOMA 2XBJA 4RA5A 4EKLA 4YZCA 3ACKA 4UALA 2XNNA 2BDJA 4F9CA 2QVSE 2VWIA 1BX6A 3ULIA 4X7QA 5AUUA 3CBLA 5KO1A 2VO7A 4CV9A 1ZYSA 1ZYDA 1URCA 3RKBA 2WPAA 5DRDA 5KKRB 1SVGA 4UXQA 4NIFA 5DI1A 5TF9A 5E7RA 3ZO4A 1SNUA 4F6SA 2W0JA 2WGJA 4UN0C 4ZJIA 5H9BA 4PL5A 1V1KA 4CV8A 3O7LD 4BI2A 4JDJA 5C26A 3TUDA 2ERZE 3ENMA 3FXZA 3W33A 2H96A 4H1MA 4FT3A 5KMIA 5JFSA 4I4EA 5M53A 4JAIA 4PDOA 4FG9A 4RFZA 2W5HA 2W9FB 1H1QA 5KBQA 4WKQA 3DDQA 3FLQA 5J5SA 2IJMA 2BIKB 3D0EA 1UWHA 3BHUA 3V8WA 4FZ6A 3WE4A 4YMJA 3AC3A 1CM8A 2FA2A 4AX8A 4ZTMA 2ITZA 4Q2AA 4B6LA 2QQ7A 3NZ0A 4I0TA 1IEPA 5CU6A 4G16A 3AMBA 3GBZA 4TXCA 3EH9A 3UNJA 3ZS5A 3A60A 4ZTSA 4WNPA 4D2RA 4FYOA 4I20A 4ASDA 4HPUE 3VUKA 4JQ7A 3TT0A 4E6CA 1JVPP 2J0JA 4RQVA 2OIDA 3OOGA 3VVHA 3QTZA 3EL7A 4HJOA 3W8LA 2QCSA 3QBNA 2YEXA 5DN3A 4YR8A 3IG7A 4DLJA 3ZEWA 3G6HA 2B53A 4ACDA 4CNHA 4DFZE 1UU8A 2BCJA 3UP7A 4QMQA 3TV4A 4PV0A 2W4KA 2WTDA 1ERKA 4A07A 1UNGA 3EWHA 2ZYBA 3AC1A 3FLZA 4AOTA 3G33A 3CIKA 3LHJA 3WZJA 2UW0A 2VWXA 3EQIA 5IA5A 5BUJA 4EL9A 2XK3A 5B2MA 3CGOA 2OH4A 5HZNA 3DAEA 3PUPA 3HP5A 3MI9A 4FMQA 2A0CX 5EW3A 3R1SA 3ZDUA 3QLFA 3RPRA 3DKCA 4GS6A 4IWQA 4TNBA 5DR9A 2GNGA 1GZOA 5LMBA 3SAYA 3KN6A 2OJGA 4IJ9A 3OF0A 4YURA 2HWOA 3WI6A 3KXXA 4ARKA 4X2GA 1HCKA 1JPAA 5EG3A 3DK7A 3DU8A 3D2IA 3R8UA 4ANBA 2XIKA 4AT3A 2XVDA 3R7UA 2G01A 2YAKA 4RVKA 3SV0A 3H9RA 4J71A 4O27B 2WMTA 3EFKA 5FG8A 1GZ8A 1H1RA 2XNGA 4EORA 4RJ7A 1CKPA 4AZEA 3NW6A 4XV1A 2XH5A 3ZRKA 2P2HA 4BDDA 3MH0A 3C4WA 2GFSA 2YM4A 3PJCA 2YAAA 2BILB 3PA3A 3GGFA 3TNIA 2QKWB 2ZDUA 4BDEA 2B4SB 5JRQA 4APCA 4GMYA 4EOPA 4FT5A 4BBMA 4GT4A 5D7VA 5HE2A 3QUPA 5DE2A 5KMMA 1JAMA 2HELA 5JKGA 2XS0A 4AUAA 4YZMA 4I3ZA 4BIDA 5J5TA 2XP2A 4PTGA 2QU5A 2QONA 3DTWA 4AA5A 4EUUA 4FIIA 4AFJA 1OMWA 2PVLA 2QNJA 2YHVA 3UO5A 3S4QA 4WG3A 3RP9A 1QPEA 2RGPA 4YZNA 5ANDA 4CLIA 1GNGA 4BIEA 3V6SA 4X2JA 3LOKA 2YFXA 4QYFA 2QOFA 4W4VA 4YBKA 2WOTA 3DA6A 3PG1A 1GJOA 4EKKA 3KMUA 2XRUA 4AZSA 5IEXA 4F08A 3RAHA 3WF8A 3ETAA 4TY1A 4FVRA 3TJDA 2BAQA 2F7EE 5HIBA 4OT6A 3RK5A 3VUHA 4AW2A 4FTAA 3LFFA 2BVAA 4FSRA 4ZTHA 5HE0A 3DKGA 5DHJA 1KV1A 5E8UA 4GYIA 2OFVA 3EMGA 3EQGA 3SDJA 4FKIA 4AN2A 4EBVA 3TUCA 2CN8A 2VWYA 4TT7A 4DGGA 4IAFA 4J95A 3FZPA 1V0PA 4R1VA 2HIWA 3ANRA 3BGQA 4J99A 4OAUC 2NO3A 3PXZA 1GY3A 4D2PA 3FLWA 4W8EA 1FOTA 3IDCA 5JGAA 3VS6A 2O64A 3VNTA 3MBLA 4XRJA 3NUPA 1KE8A 5BYZA 3CTQA 5C03A 4QMPA 3RZBA 1LR4A 1OPJA 4C3RA 4UYAA 3PPJA 2X8EA 4XNEA 3KF7A 1J3HA 3FHIA 5BYYA 2XYNA 3UVRA 2YISA 1ZZLA 3BU5A 3V5JA 5DT0A 3KEXA 2JKMA 3FZSA 1FVRA 3WF6A 3BYSA 2VTRA 4LYNA 4U97A 2RKUA 3ZZWA 3QCYA 1YXSA 4QOXA 4NCTA 1LUFA 1M7NA 3CP9A 5FTQA 5EM6A 1ZOEA 3FQHA 1FMKA 5IMEA 1W84A 1OKYA 2WAJA 3R7EA 3R7OA 2UZWE 1Q99A 2P33A 2VWUA 1ZY4A 3ITZA 3OWPA 4L52A 5I5ZA 5HNBA 4ZS0A 3VC4A 4DEDA 2GNJA 4K1BA 2O5KA 5EW8A 2C6EA 2HZ4A 3O7LB 3QCSA 3PIYA 3ZRLA 2C0OA 3AC5A 1OL5A 3COKA 3OC1A 4HW7A 4JAJA 4ZLYA 4Z16A 3TKIA 3R1QA 5CT7A 4O0VA 2YDIA 3TTJA 4DGNA 3TXOA 4I5MA 5H8GA 3IECA 4BVUA 3K3JA 3KQ7A 4MHAA 4IQ6A 4IXPA 5HESA 1J1BA 5KMKA 5IA0A 3LFBA 4FSMA 4C35A 1B39A 3VRZA 2FUMA 4EH6A 2YACA 4XG4A 2C6KA 3F66A 5J9ZA 3GXLA 2FH9A 3E7OA 2QOCA 4MVFA 3BRBA 3IK3A 5CZIA 3KULA 3D7TB 3ORIA 2WTKC 3HA6A 4GK3A 3ZSIA 4CFFA 3MTLA 4M69B 4JG6A 4Q5EA 3MW1A 3D7TA 3PJ2A 2E2BA 4RIYB 3PVGA 4HYSA 4IX4A 2GU8A 2UV2A 4N70A 4NKAA 4F1MA 3OCGA 2JDOA 4IFGA 5BVEA 1DM2A 4RIYA 3FLSA 5C8MA 2G9XA 3DBEA 4XMOA 4A4LA 4BCQA 3FMEA 5EDQA 2R3LA 2IVVA 4IAAA 2VTNA 5M4IA 2ITXA 5EHOA 3OCSA 3H30A 3E87A 4GFMA 4QP9A 3SXRA 4GG7A 4IAIA 3HZTA 4L9IA 1UNLA 1ZYCA 2GS2A 2XK4A 3UO4A 3ORTA 3C1XA 5E8TA 4CZUA 2VUWA 1Z9XA 2FGIA 5CTPA 4UMUA 4D4YA 2PTKA 4OW8A 4Y72A 4MNEB 2BAJA 3BWJA 5AR2A 3BZ3A 3EN7A 4BWXA 4JQ8A 4M12A 3PA4A 4BGQA 2X4ZA 3NNUA 3CJFA 3T8OA 4F70A 3HV5A 1Q8ZA 4FV0A 4FZDB 5DBXA 3W2QA 3QFVA 3PSBA 2OIBA 4QQJA 4CTCA 1URWA 4YSJA 3UNKA 4F6WA 3MY5A 3ZH8A 5JFXA 4NWMA 4MNFA 2CHLA 3OZ6A 3DAJA 4L6QA 1Q62A 4RVMA 3UJGA 4MH7A 3EKNA 3LFEA 4XP0A 4FKRA 4OTPA 5HBHA 2V7OA 3JPVA 4KABA 5I0BA 5CLPA 2UVYA 4B99A 3HKOA 4L42A 3LXPA 3HX4A 3F3UA 4WRGA 4IAZA 3ODZX 4Y95A 5J7HA 2EVAA 4L3PA 3PXRA 4AW5A 3PXFA 3Q32A 4U3YA 1WCCA 4FL1A 3FKLA 4FV3A 1R78A 3FY0A 5LWNA 2B9FA 2J5FA 3GQIA 2RFEA 5A54A 2RSVA 4RLKA 3UOJA 2VTJA 2W5BA 2V22A 4GIIA 4ZIMA 1OKWA 2OZOA 3CD8A 3LFAA 2WMQA 1Q3WA 4YLLA 4ZJJA 1XBCA 4G3EA 3A4PA 3L8XA 3L9NA 5CWZA 3FE3A 3PG3A 3FC2A 4RJ4A 5CSHA 3ZYAA 2OSCA 4UZDA 5E91A 4JR3A 5HORA 3LJ1A 1OM1A 3QGYA 5EYKA 2C6OA 2UZOA 5L2IA 3MIAA 2F7XE 3RGFA 5AUVA 2ITTA 4FIHA 4HOKA 3BLRA 2I0VA 2PVKA 1CTPE 5L8KA 2H8HA 3QKMA 4FZAB 4QMYA 5BMMA 4S30A 2BDWA 1STCE 1XH4A 2EB3A 3IW8A 4CFNA 1WBPA 4EZ5A 3QTXA 3F5XA 1X8BA 4U8ZA 1K9AA 4ZSLA 3H0ZA 1XQZA 3QUDA 3RHKA 4FTIA 3A7IA 4GK4A 3LE6A 2QOBA 2VTSA 2WTIA 3G0FA 3MH1A 5CS6A 2YA9A 5H3QA 3BHTA 5A4EA 4WA9A 5DA3A 4E8AA 4TPTA 3ZBXA 4A4OA 2O8YA 4D4VA 3VUTA 3NRMA 4EOJA 3ET7A 4XEYA 5EDRA 3PE2A 3BV3A 5AX3A 3OUNB 4MF1A 4OBPA 3BELA 3MFRA 2X81A 3P78A 4ZEGA 4BF2A 4F1OA 4ONAA 2QOIA 4GW8A 4QPMA 1OL1A 2VTHA 4V01A 4GUEA 3UG1A 4IZYA 5JEBA 3UYTA 2O2UA 3DNDA 1YOJA 4LUEA 5L4QA 4HCTA 3F6XA 4L68A 4NW5A 4FKGA 4Z9LA 3MVLA 4B0GA 1QPJA 4FF8A 5IEYA 3WF5A 1KE9A 3JVRA 2R3MA 5G6VA 5LVLA 3VAPA 3C5UA 4GK2A 4G5PA 4JVGA 4NM0A 4OR5A 2C6TA 3R00A 4LQMA 4DTKA 3PSCA
chains in the Genus database with same CATH superfamily
3DQXA 3TNPC 5LVMA 3TTIA 2BR1A 4TYEA 4C2VA 1UU3A 4E6DA 2VTPA 4PUZA 2PVNA 4YHTA 4U9AA 4NFMA 4BDFA 3MSSA 4DEBA 2X0QA 3A99A 1K2PA 3QTIA 1PMNA 2J0IA 2JAMA 3HRCA 4UMTA 3QTWA 5GZ9A 4AGWA 5ICPA 3QA8A 3FBVA 3AG9A 3ORZA 3M42A 4O0TA 1APME 1V0OA 4YJRA 3HGKA 3PFQA 1FGIA 1M52A 2BDFA 3R01A 4FBXA 3QHRA 4IAKA 4U79A 3E5AA 4IEBA 3S2PA 3ZFXA 1JKLA 4BB4A 3MWUA 2YIXA 5B2LA 1U54B 4C58A 3CXWA 2HCKA 4BCPA 4RJ8A 3WYYA 4RLLA 3UOHA 4FKJA 4EOIA 4RFMA 4NW6A 1Q3DA 3KK9A 4FSYA 5JFWA 3MV5A 1Z5MA 1BI7A 5KCVA 3BHVA 4W9WA 2PUUA 1IRKA 3AD4A 4CXAA 4ACMA 4KWPA 2J5EA 2RG6A 4NJ3A 3KVWA 2FYSA 2YABA 3A7JA 4S33A 5KZ0A 3B2TA 4LI5A 4DFNA 1TVOA 4RWJA 3D83A 5I9VA 4DINA 3CE3A 4XLIA 5J1WA 3PZHA 3UQGA 3SW7A 3ZBFA 4YHFA 4E26A 3O0GA 5AJQA 2CGWA 5TE0A 3W16A 3AC8A 3MB7A 2CMWA 1S9JA 2OU7A 2X6EA 3R2BA 3KXGA 1Y8GA 3FZTA 2X1NA 3HMOA 3KXNA 2JKOA 4DEIA 4G3GA 4Y83A 5C8KA 2W06A 4JI9A 4UXLA 4B9DA 2FSOX 3QGWA 4E7WA 4AZTA 4TL0A 1MRYA 2JIVA 5IH5A 4I6HA 1CMKE 2VGPA 1Q5KA 1VEBA 2EUFB 1UWJA 3RMFA 1LEZA 3SLSA 4E20A 5EKNA 3WE8A 4V0GA 2QHNA 4QTEA 4BZOA 3POOA 3OXIA 1YHWA 3BWFA 3TZ9A 5DRBA 3IW7A 3QL8A 1UU9A 3W10A 5HU9A 3ZO2A 3ZLYA 3PY3A 3U6HA 3Q5ZA 3S1HA 4GRBA 3WZKA 1R0PA 2H6DA 5AR3A 2OI4X 2KULA 4XG6A 3RPOA 3PPKA 3ZXTA 5C27A 1H4LA 4HCVA 5DWRA 4O6LA 4BGGA 4ITHA 5JT2A 4O96A 3PVWA 3W2OA 2WQNA 1FGKA 4ZOGA 5J9LA 3PXYA 3EN6A 1UU7A 2V0DA 4EUTA 4RMZA 2R7IA 1I44A 2JLDA 5KZIA 3UVQA 3R83A 4ACCA 3Q9ZA 4UB7A 4QTDA 5FWKK 5EH0A 4KRDA 1E1XA 5HX8A 5AUXA 2C68A 3HV6A 3POZA 3EB0A 4EH2A 3UP2A 2VD5A 3HUCA 3WZEA 3BCEA 3REPA 1MRUA 3VQUA 2BAKA 4EWHA 3QQUA 3QKLA 4MX9A 3K54A 2WU6A 4YC6A 5D7AA 4HVIA 2OF2A 3ERKA 3QC9A 1Q8YA 3EN4A 2B1PA 2CJMA 3QTSA 4MEDA 5HE3A 3BQCA 4E5WA 3U6IA 3OEFX 3GENA 1PXJA 2PHKA 3DS6A 3GCPA 1OUYA 5DNRA 4XP3A 3SOCA 4IIRA 3VS5A 3UQFA 4JX3A 3NW5A 3QQFA 4FVQA 3QD3A 4GCJA 5JMSA 3SC1A 1YXXA 4FT7A 3P7CA 3V04A 1PW2A 3CEKA 4XV3A 1BYGA 4AE6A 3ZUVA 4LL5A 5DH3A 4Y85A 4Y46A 3P7BA 4QQCA 3LCKA 4QYHA 4YPSA 5HIDA 5DMZA 2BRGA 5HVJA 2ETMA 3DJ7A 1GIHA 1GOLA 2YCQA 4C37A 4YO4A 3IS5A 5C8NA 2BIYA 2BPMA 2OZAA 2WNTA 4FIFA 4BDKA 3I5NA 3NIEA 4WBBB 4JOAA 4EK8A 1OVEA 5JQ5A 3NYNA 4OGRA 3B8QA 3OROA 4D1XA 2ITUA 4ASXA 3PJ8A 4FZFB 4JL9A 4M68A 4F4PA 4YSMA 3DGKA 4A4XA 2XKCA 2PZRA 2AYPA 4EHZA 2JEDA 3F7WA 5HO8A 4F9BA 4XLVA 4ASEA 5CNNA 1XH8A 3LM5A 2RFSA 4LG4A 3TZ7A 3GU8A 4GG5A 3F69A 2B9JA 3JS2A 4I22A 4I4FA 4PL4A 4AZWA 3VS3A 2XJ1A 5FXQA 4U45A 4ANOA 3FMKA 3D4QA 3MY0A 4RZWA 4IJPA 5DFPA 4TZRA 3FMMA 3RPYA 4LMNA 1Q97A 4M0ZA 4O91A 4UY9A 2UW3A 3H3CA 3BHHA 3E88A 1XH6A 4M3QA 3RAWA 3KA0A 5H8EA 4QMTA 2XM9A 3OG7A 3SOAA 4ZLZA 4M8TA 1NA7A 5KKRC 3E63A 2PL0A 5LMKA 4ZZOA 2XA4A 5HO6A 4AG8A 1YOLA 4KIQA 4BDIA 4TTHB 1JSVA 2IF8A 3PA5A 3OS3A 4MXYA 5DOSA 5M57A 3QZHA 5EOBA 4D28A 5FP6A 4WO5A 3FC1X 3PY1A 3ULZA 3SD0A 3EQDA 3I1AA 5H2UA 2WHBA 1CSNA 4FI1A 5TO8A 4EQUA 4YGAA 3DAKA 5AIRA 3OCTA 2W1FA 4R5SA 4W9XA 3ORKA 3ZRMA 1PMUA 1OKZA 3KF4A 3ZC6A 2W1EA 4CD0A 3WF7A 4BFMA 3F5GA 3DZOA 1OPKA 4AZVA 2C1AA 2HY81 3E7VA 4F7LA 2WQBA 2W5AA 3E3BX 3K5VA 4GVJA 1OECA 5ACKA 4L00A 5J87A 3WOWA 2J50A 1YXVA 2W7XA 4LUDA 3UIMA 3WARA 4GUBA 3BGPA 4HVSA 3MFUA 3QWJA 4RWIA 3EOCA 4G34A 3DBCA 3OTUA 5AM6A 5D1JA 4E6QA 3JXWA 4CKJA 1KSWA 3VULA 2GSFA 2UZBA 2WTCA 2R5TA 3QQJA 3UO6A 4EOOA 1YXUA 1UNHA 2OJ9A 4KS7A 5A9UA 3JYAA 3P79A 2P2IA 5HCXA 1LEWA 4MBIA 4IVDA 2H34A 4AGUA 3E8NA 4S34A 3R1NA 2CSNA 4HNIA 3PPZA 2ITVA 4CFXA 4PMPA 1OL6A 4YU2A 2F4JA 3EHAA 5HG5A 3R7VA 2OGVA 2NRUA 4FTRA 3C50A 4QTCA 4U44A 5ETIA 4J1RA 3QRUA 3V01A 3Q3BA 3RAKA 4HGTA 1H8FA 3VIDA 2GHMA 2PZYA 2QO7A 2WIHA 4FNXA 5AUZA 3UNZA 4IE9A 4BBFA 4FNZA 1OIQA 3IW5A 4JNWA 3DQWA 5IA4A 4HYIA 5L6WL 3EQFA 2VTQA 3VS2A 3UPZA 4IW0A 2C6IA 3IONA 4FG7A 2XNOA 4B4LA 3CD3A 3AMYA 3AT2A 2WQEA 5CAUA 3TACA 3V51A 4Z7HA 4JDKA 2XEZA 3P9JA 4AAAA 3D9VA 1M2PA 3DOGA 4FKUA 4PDSA 5CAPA 4U43A 1XJDA 5AV4A 4AW1A 2HZ0A 4BCGA 4I21A 3QUEA 1O6LA 3AD5A 5CEKA 3DV3A 4G9RA 4EOLA 3GQLA 5EI8A 3H0YA 3C51A 1XWSA 2VO3A 3LCSA 4OT5A 4R5YA 3BYMA 2FSTX 3QZFA 3K5UA 5HNGA 3G9NA 1H0VA 4TN6A 5I9YA 2Y7JA 2BZJA 4FTNA 4B7TA 4OBOA 3NLBA 2X9FA 2QC6A 1IASA 2A27A 4V0GB 5K9IA 5F94A 2OZAB 2PZIA 2B9HA 3OD6X 3OW4A 3P7AA 2J0KA 4I24A 4GFOA 1MRVA 5AP4A 2XM8A 2AC5A 4PNKA 4K8AA 2WEVA 2XK7A 4IZ5A 3R1YA 2IZRA 2R3NA 4MBJA 3L8PA 3CC6A 2BMCA 2Z7SA 4BCNA 4S31A 4FZ7A 1YOMA 3UVPA 3IOPA 2PMLX 2QO2A 2ZAZA 5H8BA 5CF6A 4G1WA 4IADA 5C9CA 3C9WA 4MK0A 5HX6A 3CJGA 4FT0A 5L3AA 3QA0A 2ZV9A 3F3TA 4XBRA 3UPXA 5LJJA 1GIIA 3ALOA 4FL2A 3CQEA 1A9UA 4FIGA 4AWIA 4FA2A 1ZMUA 4CFMA 5AX9A 3UYSA 3A8WA 3PRIA 4OTWA 3V8SA 2QR7A 1OIYA 1YDSE 2W1DA 2GTNA 3HMNA 4FKOA 3HA8A 4TYHB 3MA3A 3GNIB 1ATPE 2VWWA 4KIKA 4Y5QA 5HD4A 4H3BA 4O21A 2CN5A 1OPLA 3L1SA 1HOWA 3V6RA 3R28A 3MFSA 5EI2A 5LVPA 1T46A 4E5AX 4LFIA 3HRFA 3EN9A 4IMYA 4UWYA 4NU1A 2YM7A 3UOLA 1B38A 2F7ZE 4FV8A 2JGZA 3UC4A 3ZHPC 4F64A 3RK9A 3ZFMA 3ZZEA 4I0SA 3PZEA 4UWBA 4QYYA 5AUWA 4E1ZA 3FSFA 5D12A 5HD7A 2IVTA 2YIQA 3MIYA 1H25A 1SYKA 4YJSA 3TWJA 4C3PA 5T6KA 2PVMA 4FIJA 1G3NA 2CPKE 2OXXA 4CKRA 3ZMMA 3M1SA 4K2RA 3O23A 3PVBA 5L8LA 4FTLA 4BWPA 4F7SA 5AP2A 4Z7GA 5IA2A 3DCVA 5L8JA 3FLNC 2GDOA 4QPAA 4RC4A 4MXAA 4PWNA 2JD5A 1ZXEA 4MD9E 3ZU7A 5FXRA 1K3AA 3QWKA 3EQCA 2QLQA 3BV2A 5IU2A 3LXKA 3ROCA 3R30A 5HNIX 4IZAA 5ITAA 2EU9A 2ZM1A 3I6WA 3CCNA 3OY3A 4FKTA 1UVRA 2WMUA 5CAVA 3P1AA 3Q6UA 4KAOA 4D55A 4QMZA 2IZSA 3AGLA 4FTJA 3VF9A 5AADA 3NNXA 4TWCA 1AD5A 2W1CA 4BN1A 4DEAA 1BKXA 4E6AA 3NWWA 4L45A 1YDTE 3S3IA 4GU9A 3NSZA 4OTHA 4PMTA 4YUQA 1PHKA 3VRYA 4EYJA 3LFDA 2ZB0A 3ZLSA 4DH1A 1MP8A 1I09A 4MXXA 4C4HA 3UMXA 4X2KA 2CCHA 4ITIA 3F88A 4QMMA 3TKUA 3AC4A 3SXSA 3VBXA 1EH4A 4EOSA 4FTQA 3RNYA 2PMIA 3THBA 4O0SA 3ZEPA 3WZUA 4BHZA 3BLQA 4UV0A 4ZY6A 3VBWA 1W83A 1WBNA 3O96A 5CU0A 1SVEA 2C5NA 1KE6A 1TQPA 5FLFA 4MXZA 5HE1A 3OWJA 3LCDA 3DY7A 3Q60A 1H24A 3PE1A 2XIXA 5ANJA 2G2IA 2C4GA 2OW3A 1E9HA 3MPTA 2QLUA 5JSMA 4HGLA 4M97A 5HG8A 4WT6A 5CENA 4ENXA 3D5WA 2RFDA 4JDHA 4JDIA 1O9UA 5KMNA 3V5QA 4DN5A 3T3VA 1J1CA 3FY2A 4EH3A 3R71A 4YJUA 2GMXA 3HV3A 4JBQA 4X3FC 5HEZA 4RIXA 3SVVA 2UZTA 3KVXA 5C01A 4EOMA 4QMWA 2CLQA 3FAAA 1WZYA 3GC7A 4DFLA 5IUIA 3U87A 2GQGA 1Y8YA 2UW6A 4RA4A 4BWKA 3DK6A 5CNOA 3F2NA 3C4ZA 2NP8A 3KKVA 3PRFA 3VQHA 1BMKA 3M11A 1HCLA 2EXEA 3BYUA 3Q2MA 3GU5A 2VN9A 5CQUA 2OFUA 3R21A 4IB0A 4G6NA 5CU3A 3VHEA 4FTOA 3R8MA 2DWBA 3PYYA 1IG1A 1P4FA 2E9NA 3A7HA 4LOPA 4CVAA 4UX9A 3AXWA 2HY0A 1DI8A 3GCUA 2F2CB 4DHFA 2I1MA 5I3RA 3FMHA 5TKDA 2CGUA 1F0QA 4FV4A 3U9NA 4QP1A 4W4WA 4YNEA 4B8LA 4FYNA 2IW9A 3W32A 4CRSA 3R9OA 4JRNA 5AR4A 4XCUA 4HYHA 2OBJA 4ZTNA 3EYHA 3G9LX 3IQ7A 4DFYA 1PXMA 2YJSA 5E8ZA 3AGMA 1XH5A 3I0OA 4JT3A 2DQ7X 1RW8A 4FKLA 1KOBA 2YDJA 3EL8A 3TKHA 1BL6A 2ZV7A 3HMMA 3KRWA 5E8YA 5CT0A 4JX7A 4KIPA 3UQCA 3CR0A 3O71A 3FXXA 5F20A 5IKWA 4LGHA 1JSUA 4D58A 5M4FA 3FQEA 2A2AA 2BTRA 3BBWA 2PVJA 3NNVA 1WAKA 3C0GA 2HK5A 3G0EA 5AUYA 3VBYA 4J8NA 1H28A 3VUMA 4QP2A 2WTWA 4WSQA 3EFJA 3ORXA 4YP8A 3NUXA 4ZJVA 4KSQA 1H00A 1UA2A 2JITA 1Q41A 3E92A 4APPA 2ITWA 4QMUA 4UBAA 4C36A 1QPDA 4CTBA 3HMPA 5FM2A 2Y4IC 4FG8A 4KINA 4OAVB 4ZSEA 2ZMCA 3FKNA 5CALA 3ZUUA 1ZYLA 1W82A 4A9TA 4IVCA 2R3PA 4BTJA 3O8TA 4FVPA 5HU3A 2BFYA 4BL1A 1KE7A 2R3JA 5G1XA 1PKGA 5CXHA 4F65A 2QOKA 3BKBA 3T3UA 3MY1A 4L67A 5HLPA 4X0MA 3OBJA 3VWAA 5JZJA 2YZAA 4WG4A 1E1VA 1QMZA 3UBDA 2A1AB 3RI1A 2XRWA 3DJ5A 3PWDA 4BI1A 1XBBA 4ALWA 5CSPA 4USFA 2OXYA 3ZFYA 2VO0A 2E9VA 3FSKA 4TWNA 5IUGA 3QHWA 1MQ4A 1XHAA 4L53A 5AP3A 4IDVA 4O0XA 5AV1A 4BCFA 1IR3A 3OW3A 1BI8A 3VS0A 2OO8X 5ANKA 5KMLA 4G6LA 3TZMA 3AQVA 3ZXZA 3HDNA 3CLYA 1S9IA 4EOKA 3ZO1A 3RM6A 1PXOA 3FLYA 3NAYA 2I6LA 4FTMA 4I41A 4ZK5A 3LIJA 3ALNA 3COIA 5ANEA 1Y57A 4TYJA 4I6QA 4EZ7A 2WKMA 1RE8A 1GZNA 4D0XA 1VZOA 1VJYA 2UZNA 3QTRA 1REKA 4DH5A 3TNWA 2R3FA 3GC8A 4NM3A 5E1SA 1WVYA 3FQSA 2RF9A 4O0WA 5B0XA 4NK9A 4QP4A 1YDRE 4QYGA 4BCOA 4AE9A 5AIKA 4DCEA 3E8DA 1H08A 3BU3A 1ZYJA 3GUBA 4L01A 4CFWA 3JY9A 4D5KA 3A2CA 5DR2A 2PZPA 1XO2B 4OTDA 3W2RA 1JKTA 5DT3A 4BDCA 5LXMA 3QALE 1PMEA 5D9HA 3ZC5A 2OJIA 3S0OA 3EYGA 4K18A 5JH6A 4YTFA 1CKJA 1JSTA 2R4BA 2UUEA 1W7HA 3NAXA 3NNWA 4G3FA 3PIZA 4YC8A 1G5SA 4L3JA 4NUSA 5A3XA 4MAOA 3UIUA 3KN5A 1U5RA 5AR7A 5AWMA 2BHHA 5J9YA 1H07A 4U7ZA 5LVOA 4JBPA 3PJ1A 4CKIA 4EONA 2ONLC 2QOLA 3BYVA 2Z2WA 3DBQA 2OICA 4KKGA 2HZIA 2C5XA 4KSPA 4L8MA 3S95A 5JGBA 5DEYA 3HV4A 3N9XA 4EC8A 5CQWA 3QLGA 3DT1A 4FL3A 4XG9A 3RBWA 3MVJA 3W8QA 3JVSA 4IX6A 3I81A 3RTPA 4RIWB 4GIHA 2PVFA 3FHRA 2WZJA 4RWKA 4CEGA 3R8PA 5K4IA 5HTBA 1XH7A 2C5YA 4A9UA 3Q04A 5HTIA 4ZZMA 3LFNA 1WBSA 5AM7A 3RALA 3R22A 5EYMA 4DGOA 1YRPA 3DJ6A 4XHKB 4RVTA 1P4OA 1U54A 4MYGA 5E90A 3EZVA 3WIGA 1QCFA 1TQIA 2OWBA 2VV9A 2UZEA 4FV7A 1WVWA 4GV1A 1WBWA 4RX7A 2W1HA 4KS8A 2QD9A 4YTIA 5J95A 2CDZA 4YJTA 1IA8A 4Q9SA 5M4UA 2QU6A 2IEWA 1PYXA 4AS0A 4EQCA 5FDXA 3C4XA 3BBTB 4NSTA 2RIOA 3ORLA 5CI7A 4DYMA 1BUHA 4RT7A 2XKEA 4U5JA 4F0FA 5A4CA 5AUTA 3ZCLA 1NVSA 2QI8A 2YM6A 4GH2A 5EHYA 4X2FA 5E8VA 3WBLA 4ERWA 5B2KA 3FI4A 4E4MA 3F7ZA 3UMWA 3HNGA 3U8WA 3VJOA 4CFVA 2NPQA 3ZSGA 3U4UA 3EZRA 3GFEA 1PKDA 4NTTA 5AA8A 2A4LA 4JR7A 4KD1A 3I7CA 3V8TA 1DAWA 5EYCA 4ZZNA 2Y8OA 2UZUE 2XKDA 4JG7A 2XMYA 1H01A 3IW4A 5HGIA 3R7YA 4G3CA 4MBLA 3DK3A 4LMUA 2VWBA 4LOOA 3ROYA 4FKPA 1JKSA 2Y0AA 1FVVA 2CGVA 3KU2A 4C59A 4NH1A 2JFLA 5HLWA 5DR6A 4QPSA 4O4DA 4P2KA 5EK7A 2R3OA 2WMAA 3MA6A 4PDPA 4AZFA 4J53A 4ANMA 1U59A 3L8SA 2VZ6A 3LQ8A 5CANA 5CYIA 1W2FA 3II5A 4C4JA 4E5BA 5L6OA 3MPAA 2Z7LA 4NFNA 4EH4A 2HXLA 5EI6A 4ZP5A 3C7QA 4TWPA 4RBLA 3A7GA 3NR9A 1H27A 3U51A 5LCKA 4EI4A 4YZBA 1KV2A 4QP6A 4AF3A 2ERKA 2X6DA 2O0UA 4LOQA 3KB7A 5CY3A 5AR5A 3RWPA 5BQ0A 5CF8A 4QD6A 4XV9A 4CSVA 4QO9A 2LAVA 3R9NA 1XKKA 3HV7A 1DAYA 2ZV8A 4AA4A 4BI0A 3DZQA 3Q53A 4LM5A 3QRKA 1JWHA 4XYFA 1OZ1A 3H4JA 4HPTE 4C0TA 4CCBA 3OMVA 2YM8A 4R3PA 1OL2A 4C61A 4I5HA 5TOZA 3FZ1A 5AV2A 5IG1A 5DPVA 4EC9A 3MVHA 5AEPA 1WFCA 4UEUA 4EBWA 3GP0A 2JIIA 2W4JA 3SA0A 2E9UA 2GS7A 4GEOA 1PXKA 3DXNA 3SKCA 4ENYA 5F9EA 5L2WA 3FPMA 3FJQE 4BICA 5CSXA 3D14A 3KULB 3QYWA 4RGJA 3I4BA 1WMKA 2VX1A 4F7NA 2YCFA 3V5LA 1DS5A 3OXTA 3P08A 3RVGA 3F5UA 4XJ0A 5FBNC 5IF1A 1TZDA 5FEEA 4OLIA 2ZJWA 4AT4A 4CYIA 2CGXA 5IEVA 3W2PA 2JC6A 5DIAA 3K3IA 1GZKA 3T9IA 5IUHA 4P7EA 5A14A 2C5VA 4ERKA 3Q4TA 5GJDA 3QQLA 5CVGA 1OITA 3MJ1A 3VS7A 4U81A 1NVQA 2DUVA 2E9PA 2YDKA 2YIWA 5FM3A 4CT2A 3EN5A 4HNFA 1ZRZA 2GFCA 3R2YA 1XH9A 4FNYA 3E93A 5T68A 4E4XA 5IPJA 3GCVA 1UV5A 1QL6A 3QF9A 2KTYA 1W8CA 3VN9A 4FV2A 3SQQA 2NRYA 2X8DA 2IVUA 3QD0A 2OF4A 4WNMA 4ITJA 3EQRA 4CQGA 3R04A 3CY3A 4WRSA 3ZSHA 4RIWA 2XK6A 2XYUA 4IWDA 4RRVA 4LRJA 3FZOA 2XJ2A 4XRLA 5FQDC 4EK5A 2VO6A 3DDPA 3FV8A 2YIRA 2UZLA 4PRJA 2GCDA 3HP2A 3DB8A 3FDNA 3SW4A 4BKZA 4CMOA 2ESMA 4R7HA 4CQEA 4PQNA 4U42A 2UZVA 3F3WA 4MF0A 2FVDA 2UW5A 4L7FA 4XOZA 4C33A 2VTLA 4FSTA 4J8MA 4RPVA 3U6JA 4YNOA 4G3DA 4IX3A 1OB3A 3AOXA 3A4OX 3CS9A 5HG9A 5AR8A 3JY0A 3UC3A 2R3HA 2XK8A 3VS1A 5K0KA 2VTOA 4AW0A 3RWQA 4WSYA 5HI2A 3H9FA 3QRIA 4J98A 4HZSA 2B52A 3BI6A 2C6DA 4JS8A 2X7OA 5EDPA 5HICA 4I93A 3DB6A 3R0TA 2F49A 3M2WA 4LL0A 4FKQA 4BYIA 4M69A 4QMSA 2G2FA 3ORNA 4JBVA 5M56A 2ZOQA 2XNBA 4NM7A 1R1WA 2J6MA 3PP1A 4X3FB 3VUGA 5AP0A 4EK3A 5D11A 4DH7A 5FD2A 1SZMA 4RC3A 4K77A 4BTKA 2IZTA 4OTIA 3O51A 1DI9A 5AV0A 4E3CA 5AP7A 2W9ZB 4RIOA 4QMOA 3A7FA 2WMRA 3TIYA 4C3FA 1OGUA 2F9GA 3Q52A 4PTCA 3R7IA 4CRLA 3QC4A 4QP3A 2BALA 2E9OA 2HAKA 4AXAA 2WD1A 4EK6A 2ACXA 1FMOE 2DYLA 1AGWA 2XJ0A 5T3QA 4C62A 5I9UA 4EZ3A 3BU6A 5FEQA 4B8MA 4ZTQA 2C6LA 2X39A 5BVWA 4PMMA 3KRXA 4MWIA 4MWHA 3VUDA 4U3ZA 1O6YA 2J7TA 4QMNA 2X7FA 4Q9ZA 4XBUA 2BZIB 5ETAA 4R1YA 4WG5A 3KK8A 4P90A 3CGFA 4ANQA 4WIHA 5E92A 4XG7A 3F2AA 1LP4A 3Q4UA 3QX2A 4ACGA 3DBDA 5DGZA 1PMVA 4BHNA 2OG8A 2PK9A 3C13A 5ANGA 5AA9A 4IVBA 5HBJA 3MPMA 2R0UA 2X0GA 1M14A 2WTJA 1NVRA 4OTFA 2WMVA 3CTJA 3ZTXA 3RM7A 4HVHA 2B54A 3AC2A 4FNWA 5FRIA 3VJNA 4J7BA 4KBCA 3QRJA 5IISA 2H9VA 2QKRA 3LXLA 1A06A 5LWMA 4P5QA 1Q61A 2W99B 1P5EA 3KC3A 4DBNA 2XB7A 2X0OA 4H3QA 1YWRA 2BZKB 3FL4A 3KXZA 4U0IA 4BYJA 3I79A 4DLIA 4EEVA 3GB2A 5CVFA 1P14A 3EQHA 2JBOA 3VS4A 3O17A 1OL7A 3CPCA 5A4TA 3QXPA 2W1ZA 2ETKA 5IH6A 2WMXA 3KRRA 3V3VA 4W4YA 5L6PA 2R3QA 5EW9A 4AT5A 3VW8A 4IB5A 4V04A 4RX5A 4NZWB 1P2AA 5CSVA 5KNJA 3BLHA 2C3JA 3PTGA 4EYMA 4K33A 4W4XA 3LFCA 2XF0A 4JJRA 4RX8A 2J0MB 5TR6A 4C57A 4O0RA 3MS9A 3GOKA 2BRHA 3JUHA 3QKKA 4R3CA 2C30A 4O1OA 5DEWA 3TZ8A 4O22A 4D9TA 2XIYA 1FPUA 4FTUA 3QQHA 1JLUE 1QPCA 3TL8A 1M17A 1UKHA 3RHXA 1XR1A 4O2PA 4C7TA 3E3PA 4RWLA 4C34A 3U4WA 3KGAA 5I3OA 2WIPA 3VUIA 5CEMA 3BYOA 3HVCA 1RQQA 2R64A 2UVZA 3O8PA 4QNAA 2RL5A 2C3KA 3I6UA 3T9TA 2QHMA 3QAME 5F4NA 5HO7A 3Q5IA 3TV7A 3NEWA 4MCVA 5L2TA 2GHLA 1CDKA 4YPDA 2CCIA 2CKEA 2W4OA 1RJBA 4IB3A 3NYVA 3NUUA 4W8DA 1V0BA 4JXFA 3L8VA 3C0HA 1AQ1A 2GNHA 4X6RA 4BCHA 5A6NA 1U4DA 1JOWB 4IVAA 3OVVA 5GZAA 2XCHA 5LCJA 2X2KA 2V7AA 2GNIA 3GFWA 4ACHA 4UMPA 3AD6A 2WOUA 1W0XC 3QD4A 2QO9A 3C4CA 1OI9A 1W2CA 3BEGA 3FMJA 4G6OA 3NIZA 4NIFB 3LLTA 1WBVA 5E8WA 4FSUA 5ANOA 2UW7A 5M55A 4F0GA 2G2HA 3LJ0A 5IMXA 4F99A 3RNIA 4CLJA 2BUJA 4QP7A 5E1EA 2GPHA 2W05A 3IGGA 5K0XA 1OIRA 2HZNA 4F09A 3EIDA 4F1TA 4C4IA 2ITOA 3FWQA 4QQTA 4J52A 3FI2A 3QXOA 2I0HA 4N0SA 2BRNA 4TWOA 3Q4ZA 3O50A 5BMSA 2QR8A 4XG3A 4RX9A 3FXWA 4QYEA 4TW9A 3DKFA 3PIXA 4Y73A 2HWPA 4IAYA 5DVRA 5B7VA 2YITA 4C4GA 5KE0A 1NY3A 4GJ3A 3PVUA 5AAGA 3UDBA 2W1GA 4IBMA 4GT3A 2VTAA 4AOJA 4YHJA 5HLNA 3FPQA 4QTAA 3QTUA 1KOAA 3A8XA 2QG5A 3DFAA 3FYJX 3GU7A 4FK3A 5ETCA 2P55A 3QQKA 4F9YA 3CPBA 4X3FA 4UYNA 4F9WA 3F82A 2HW6A 4NJDA 5CEQA 1WBOA 3IGOA 4ALVA 3WF9A 5K4JA 2R3GA 3KXMA 3NUYA 2V55A 3PP0A 4O6EA 4U40A 4D1ZA 2P4IA 3ELJA 3VF8A 4DEGA 3PY0A 3QU0A 1R3CA 3GC0A 5AP1A 3I7BA 4O2ZA 4BTFA 4E4LA 3OWLA 4QMLA 2PVHA 2QOOA 5K5XA 4YJPA 4WHZA 3AT4A 3MH3A 4DG3E 2GS6A 5KBRA 1YKRA 2R3RA 3QZIA 4KKEA 3IOKA 3RPSA 1PXIA 3KRLA 2WTKB 3LQ5A 2C6MA 4BDGA 4KBKA 4BC6A 2UW9A 2FSLX 4U41A 3P4KA 4FSNA 4FSWA 4GFGA 2VTTA 3NUSA 2C3IB 2JFMA 2OK1A 4YTCA 5K5NA 3EFLA 5DT4A 3O2MA 3TUBA 3EQPA 1YWNA 2PVRA 2R9SA 2Y6OA 4PNIA 3P86A 1JKKA 3BE2A 2C47A 2DS1A 3OEZA 4LV5A 3MJ2A 2ZM4A 3DPKA 2JDSA 3KCFA 4EH5A 4DG0E 5CEPA 3A62A 4FV5A 5HCYA 3DBFA 5KUPA 4OTQA 2ZV2A 5CU2A 2FSMX 2YIYA 2IN6A 2X9EA 1WBTA 2Y4PA 3NS9A 4FSZA 4WD5A 5HVYA 2IVSA 2R2PA 3MDYA 4MKCA 3W1FA 4UMQA 4II5A 4DC2A 5EM7A 2UW4A 2Y4IB 3VO3A 4F7JA 4XS2A 2JKKA 4GYGA 1Y6BA 1GIJA 2BROA 3GCQA 4X3JA 4E93A 3G2FA 2J0LA 4FODA 4RJ5A 4M0YA 5CF4A 3OHTA 4QQ5A 3RCDA 4K6ZA 4M66A 2X2MA 3TNHA 3BX5A 4KB8A 3Q4CA 2J90A 5GNKA 3ZO3A 3B8RA 2EXMA 2WMBA 3UE4A 4EHGA 5FTOA 3D94A 4EK4A 1PXNA 4PPCA 3QCQA 2X8IA 4EQMA 3UIBA 3H9OA 5C1QB 4Z55A 4MQ2A 1F5QA 1YWVA 4IC8A 5HVKA 5KMOA 4S32A 4LV8A 2PWLA 1ZZ2A 2J4ZA 5IZFA 1YI4A 3P23A 4LGGA 4JG8A 5HKMA 5CU4A 4DEHA 4HVGA 4I1ZA 3UG2A 5BPYA 3TCPA 2BFXA 3GU6A 4KBAA 4FKSA 4IWPA 5M44A 2VTMA 1GAGA 1PF8A 4EOQA 3V5PA 3OP5A 3D2KA 2QOHA 3BEAA 2ZM3A 1H26A 4EH8A 4KA3A 1PY5A 5D41A 4D2WA 5J7BA 4HYUA 4A9YA 3P5KA 4JQEA 5GJFA 4AFEA 3DNEA 2R7BA 1Z57A 4H1JA 2OIQA 2RFNA 5FEDA 3TV6A