5TE0A

Crystal structure of adaptor protein 2 associated kinase (aak1) in complex with bibf 1120
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
320
structure length
316
Chain Sequence
MTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords AP2-associated protein kinase 1
publication title Crystal Structure of Adaptor Protein 2 Associated Kinase (AAK1) in complex with BIBF 1120
rcsb
source organism Homo sapiens
total genus 92
structure length 316
sequence length 320
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5te0A00
5AADA 3OXZA 2YCSA 3T3VA 1JSTA 4M8TA 1YHVA 3DKCA 4WUAA 1JQHA 2WTKB 3F5PA 5CSHA 4YZMA 3O7LD 5ETFA 3SQQA 4FG8A 2R3OA 4U45A 4XG7A 4D2VA 2C6IA 4RJ5A 2W1GA 3D5VA 3F7WA 4C4GA 5AV3A 2R7IA 3DAKA 1KOBA 2GNIA 3PLSA 2PWLA 4HPTE 3ULIA 4NKSA 2OBJA 1BYGA 2ITPA 3WF9A 2PL0A 4TYHB 3UQGA 1GIJA 5HHWA 4ZSJA 4YMJA 3FC1X 4BHZA 3NAXA 3MSSA 3V8TA 2J0IA 5EDQA 4J95A 2QLUA 3PIXA 4TKSA 4E5WA 4O91A 4KKGA 3VRZA 3QTXA 4YZ9A 4YPDA 3BWFA 4MXYA 3QKMA 2FO0A 3KXNA 5CZHA 4UN0C 3KMWA 4EEVA 3MTFA 3OS3A 4WKQA 3II5A 4F7JA 3A99A 4BKYA 5FBNC 2B52A 5AAFA 5HCYA 3HDMA 4G1WA 3DZOA 4YJRA 4A07A 3MGYA 4QMNA 2IWIA 5TF9A 4C4IA 4GJ3A 4IANA 1YXUA 4DEDA 2F7ZE 4D0XA 1PMUA 3VF9A 3R9HA 4OW8A 4G16A 5CVHA 3WIGA 2YIWA 4MXXA 4X3FB 3PY1A 3E7VA 1VJYA 5AP7A 4BTJA 5LWMA 3AT3A 5KHWA 3ODYX 4IB1A 4I21A 3V5TA 3FSFA 4MTAA 3H9OA 4JDJA 3ZO3A 4EWQA 3R1YA 5M4UA 4KKEA 3BBTB 4Q5HA 3CCNA 4Y5HA 2C6MA 3QTQA 4BCJA 2BRNA 4F1MA 3WI6A 1XH7A 1IR3A 2BZKB 2C3IB 3AC2A 3PVUA 4WUNA 3UNZA 4YO4A 2O2UA 4IZ7A 3QFVA 4ZY4A 4EOIA 3SRVA 2XS0A 3GC8A 5AMNA 2WU7A 2GNGA 3Q9WA 4AW2A 5A4EA 3PYYA 5IH6A 3KVXA 2E9PA 1Q8UA 2YERA 2ITQA 4BN1A 4ZTSA 4ANLA 3DB6A 3KXHA 3OCGA 4CEGA 4RWJA 3ZO2A 1BKXA 3NGAA 2VWVA 4O21A 4E26A 4CKRA 3QC4A 5M44A 4OTHA 3BIZA 1XJDA 3F6XA 4HVDA 3ZOSA 4NM0A 1URWA 2EB3A 5DR6A 1ZY4A 4BYIA 2X6EA 1F3MC 3AC8A 3FQHA 4GK3A 5HTIA 3IW6A 3OF0A 3NW7A 4I20A 4HYIA 4IVAA 4DH7A 2ERZE 3PPJA 3O23A 5CLPA 4QRCA 4QP1A 3ZTXA 5KE0A 1YI3A 5E8UA 1JSVA 2UZNA 1OKWA 4CKJA 2BZIB 2YACA 5DR9A 3TV7A 2JIVA 5ANJA 5D1JA 3W2QA 3C51A 4TWNA 4I1ZA 1L3RE 2JKMA 3VUTA 4O2PA 3ENHA 4ZIMA 4EZ7A 1Y8YA 4BDAA 2E9VA 2ZB0A 5M4CA 1GOLA 3SW7A 2F2UA 3RK5A 5KX8A 5KUPA 3KRLA 4Z16A 2R2PA 5L3AA 3BHTA 4RIXA 5BUEA 2B9FA 3BV2A 2X8IA 3O17A 4AZFA 3GC7A 2YN8A 5A3XA 4PV0A 3ZRKA 4BDKA 2Y4IC 5CEKA 4QMVA 3PPZA 3KA0A 5AM7A 5DMZA 3VBTA 2H34A 5CSXA 5T3QA 4AGWA 4U97A 4DGGA 4OAVB 3DNDA 4M68A 4M67A 5E8WA 3FLSA 3FZTA 5I9YA 2W1EA 4QP3A 4NUSA 4TL0A 3U9CA 3FMNA 2QONA 4J97A 3ZDUA 5E8YA 3GI3A 2YCQA 4TPTA 5D10A 5HO8A 1JKTA 1YXXA 2O65A 4B8LA 4ZTMA 5LARA 4RLLA 3ORIA 3QL8A 4MH7A 2PZRA 4E8AA 3G33A 4ONAA 4YJVA 4ZJJA 1BLXA 3RBWA 4C2VA 5CXHA 3VRYA 4C4JA 5AIRA 2I0HA 2FYSA 1E1VA 5HNBA 2HIWA 3PVBA 3KFAA 4TYHA 4AG8A 3U6JA 5AV2A 2X2LA 3KU2A 4FKPA 3WF5A 2RFNA 3R2BA 3QCQA 4GVAA 2I0YA 4W9WA 3R8LA 2B9JA 4R3PA 3PWYA 4BF2A 3Q60A 1H25A 2ZM1A 5EKNA 3PP0A 1SVGA 1YWRA 3ZFXA 2A0CX 2LGCA 1FINA 2WOTA 2BKZA 2BRGA 4XUFA 2R3HA 3PA4A 3BU5A 3G51A 3GCUA 3D7TB 5EW9A 2FUMA 5JRSA 4AT3A 3R1SA 5CXZA 3C1XA 4BC6A 4CV9A 1AGWA 4XP0A 4BZNA 4BBMA 1XR1A 5I9XA 4A06A 4QYEA 2E9UA 4G3EA 4YR8A 3EWHA 5FDPA 1OL1A 3KCKA 3SXFA 4A9UA 4A4OA 5JH6A 3TXOA 5HICA 1H0WA 4I5MA 4Y95A 2Z2WA 2ZOQA 3F3VA 4C4HA 4LGHA 4KINA 3Q4ZA 4FSNA 2VWYA 4L3JA 3NS9A 4M0ZA 3M2WA 2CGXA 4FV7A 2QOHA 4L3LA 2F2CB 4X3FA 4YNOA 5CEQA 3SKCA 1YOMA 3C4FA 3AGMA 3UIBA 2REIA 4CSVA 4QO9A 3SD0A 3M11A 2ITOA 2PZPA 4IC7A 5A4CA 3SXRA 4NTTA 1R78A 4IAYA 2Y6MA 3Q96A 4RX8A 5BMMA 3H10A 1K3AA 1EH4A 3DKOA 4UMQA 2C68A 3WF8A 4I5CA 5FEDA 4E20A 2ITTA 4EC9A 3FE3A 3BPRA 4LGGA 3L8XA 5E8TA 5G6VA 3NUYA 3BYSA 4LMNA 4FSRA 2VUWA 5KMKA 2V7OA 4NJ3A 1XKKA 2E2BA 3DAEA 4D1XA 2PVMA 2YZAA 3A7FA 3WIKA 5GZ8A 3L1SA 3AG9A 3OG7A 2FB8A 3R7IA 1M17A 5HLNA 4KIPA 3LXKA 4QQ5A 3RPOA 4WRGA 5HGIA 3WE4A 3CR0A 2ZJWA 2B4SB 1XBCA 4G9RA 2PMNX 4GFGA 2C69A 4IAIA 3HL7A 5DNRA 5HE0A 5FM2A 2X39A 4QQJA 5LOHA 2Q0BA 3NUNA 4RC3A 1PMEA 1Q3DA 1APME 3KC3A 5F1ZA 4DLJA 3FZPA 1KE8A 3LM5A 3RALA 3BGZA 4FL1A 3U51A 2BDWA 5A4LA 1UNLA 2YDIA 5L6WL 3IG7A 1I44A 2IVUA 3QALE 2J9MA 4GUEA 4KIKA 1NVQA 5C27A 3VS6A 2BIYA 4P90A 4XG3A 4U7ZA 2AYPA 3AC1A 4EOOA 3IW8A 4YZBA 3T8OA 3EL7A 4U9AA 4R7IA 2VTOA 3V8WA 4EOPA 2BILB 1PYEA 4B6LA 2OSCA 4FV4A 4IZAA 4DGLC 5JRQA 5LCKA 3ZSGA 2XK3A 4D9TA 3CPCA 3BGPA 4U42A 3FUPA 2JBPA 1PJKA 4LL5A 3GC9A 3JUHA 2FA2A 5AP5A 2W5AA 3DGKA 2RFEA 1IASA 4IDTA 3ALOA 2YJRA 3EN5A 2GNFA 3K3IA 4L53A 4AOJA 3FQEA 4FV1A 3B8RA 4RT7A 3QTRA 3M1SA 4MWIA 3GT8A 3QHWA 2OXXA 4JAJA 4KD1A 5EI2A 4DH5A 4LUDA 4BBEA 5CAUA 2ZDTA 1Q4LA 5M56A 5D11A 5E1EA 4IVDA 4F7NA 1WBTA 3ZZWA 4K8AA 4EHEA 4FF8A 4F7SA 4UY9A 4NM5A 2YHVA 4LG4A 5HO6A 4W8DA 3UDBA 4F9YA 3ZRMA 4AOTA 3FLQA 3ZMMA 4CXAA 2XYUA 3NNVA 1NA7A 2OU7A 1YWVA 3BELA 2RFSA 3R9OA 4OUCA 4QMQA 2J90A 5E8XA 5L2SA 5DHJA 5LVOA 4PDOA 5CEPA 4BTMA 4E73A 3MB7A 1YDSE 2C4GA 4YJSA 3DK7A 4LUEA 4N6YA 2JDSA 2XNGA 4JLCA 1OIRA 1JKKA 3E64A 2J5EA 4MNEA 5ANKA 2VTMA 3OT3A 3CD8A 2YM3A 4MK0A 1OB3A 4O6EA 5AJQA 5FDXA 2YM7A 1W7HA 4AT5A 3BHUA 4IBMA 4F64A 5I5ZA 2PZYA 3G5DA 4OBQA 5IISA 4O1PA 5CY3A 5HNGA 2PVHA 3NYVA 4HCUA 4YTHA 4I6QA 1WVXA 1M2RA 4IDVA 4FV0A 2VO0A 5DFPA 1FMKA 2UZTA 4UYNA 1YHWA 2FSOX 3FZOA 2J0JA 3CY3A 3NIEA 4QTCA 1Q99A 3K2LA 4H1JA 4PPCA 5BVKA 4L44A 5HG7A 2QOKA 4BCHA 2R9SA 2UVZA 4RIOA 2XJ0A 2PY3A 3OC1A 3HV4A 4GW8A 1Y57A 5CS6A 3KXGA 4DFYA 4PMMA 5K5XA 4WNOA 1M2PA 5TR6A 5L8KA 4V05A 4ZOGA 5AUZA 4MHAA 3HRBA 4FSWA 1JLUE 3KQ7A 2ITNA 3BU6A 4TXCA 3RHXA 1H4LA 3OWLA 5EYKA 3FYKX 1H1PA 4L42A 4D2TA 4N0SA 4YHJA 3B2WA 5IA0A 4W4YA 1M52A 4GUBA 4ZLOA 2X81A 4NZWB 4RWLA 3RM7A 3HZTA 4F9CA 4AN9A 3UOKA 4D4YA 1BL6A 1UVRA 2A1AB 4UALA 4FVRA 2P55A 3TNIA 3ZDIA 4OTFA 1YI6A 3PJ8A 3QQUA 3DS6A 3RM6A 4BDJA 2CLQA 4RLKA 4TY1A 2A2AA 4IFCA 1DI8A 4GU6A 1PXKA 4ASDA 2WZJA 3FMHA 2J4ZA 2ITUA 3JY9A 2PMLX 4EOKA 2B55A 4Y72A 4KKHA 3UVQA 2YIXA 3I81A 5LVMA 4QP6A 4IX5A 2VWUA 4MXOA 4D58A 4ZSEA 3ZUUA 3SVVA 4QQCA 2CN8A 2BZHB 4BGHA 3GCSA 4O6LA 4TYEA 3D4QA 3G9NA 5FXQA 3KKVA 5DVRA 5JFXA 4PP9A 5L6OA 4RIWA 4O27B 2WGJA 4IQ6A 1MRVA 4IJ9A 5AP0A 3QTZA 4FUYA 2XM8A 2FGIA 3GUBA 1CKJA 3ZS5A 5HE3A 4ZJIA 4NCTA 4DEHA 4DH3A 4FK6A 4UMTA 4EZ3A 4NW6A 2VNYA 2GTMA 3RNYA 4FT5A 4XV3A 5AR5A 3V5QA 4AZEA 3DLZA 3R22A 4RVKA 4LGDA 5BVWA 4CFVA 2W5BA 3UYTA 1QCFA 1E1XA 2O5KA 4CKIA 4OBOA 3W8QA 4EOMA 4BTFA 3NNWA 4CZYB 3EQPA 2ITYA 3Q3BA 3BEGA 1PKDA 2B54A 4EORA 2ZM4A 4FMQA 4AAAA 4BDCA 2V62A 4NM3A 4BVUA 4UZHA 5ANDA 3VIDA 3LQ8A 4BRXA 3C4XA 3C4ZA 4IXPA 4IWOA 3EOCA 4ZTHA 1XBAA 3C5UA 4J1RA 4QMPA 2CKEA 4UWCA 4ZTNA 2X4FA 4IX3A 2J5FA 3ROCA 3F61A 3ZBFA 4D2WA 4EK5A 2UZBA 4ANBA 3F2NA 5FLFA 3FL5A 5LQFA 4OT6A 4D0WA 2ZAZA 4Z7GA 2X2MA 3LJ0A 3Q9YA 4XH6A 4IVCA 4L7FA 2QURA 2YM6A 2HY0A 4QPAA 5EM5A 2W1HA 3TZ9A 5D12A 5HI2A 3L9LA 4CMTA 4F6UA 2ACXA 4EHZA 3OCBA 3QRIA 3DDPA 5HESA 4I92A 3U8WA 3ZLSA 4ACDA 3FLNC 3R9NA 3PFQA 1PW2A 3KRJA 4RPVA 4IFGA 5L2IA 5FG8A 2O63A 1DM2A 5A4TA 2DS1A 3NW6A 3QQLA 3D2KA 5M55A 3TT0A 1KV1A 4JG8A 2OJIA 3FMJA 3E8DA 5DE2A 3ZFYA 4FKOA 3LFQA 3O51A 4I93A 3TG1A 4D4SA 4I0TA 3VO3A 5KMOA 4BB4A 4B7TA 3TWJA 1FQ1B 5IA2A 2P2HA 2VTRA 1UWJA 3FQSA 4PRJA 3ORXA 4BCMA 3KK9A 3ZLWA 3FYJX 3QX2A 3D83A 5FTQA 3Q2MA 4AT4A 2VTQA 3HEGA 2XK7A 1OITA 3G9LX 3TZ7A 3D7ZA 4GT3A 2HAKA 5TOZA 2EXCX 4WG3A 1P2AA 3ZUVA 3TZMA 2R4BA 1CKPA 3MI9A 3VVHA 4D55A 4HCTA 4C3PA 3SLSA 3ITZA 4F0IA 3RVGA 2WQNA 2BVAA 4DINA 4YTCA 1OUYA 3R0TA 4KIQA 3VBYA 3RAHA 4CQGA 3OVVA 3I4BA 1STCE 4FIIA 3NDMA 4PPAA 2J7TA 2BTSA 2QR8A 2XZSA 3LLTA 1V1KA 2UVYA 2I0EA 4NH1A 4QP7A 5CEMA 1GZKA 5HBHA 1FPUA 1B39A 4UB7A 4ZJVA 4JT3A 2EVAA 3V5LA 3ULZA 4JBPA 5BQ0A 2JKQA 3BYMA 3EJ1A 4GFOA 3SOCA 1YHSA 4PTGA 2YDJA 4XBRA 4XG6A 3ZBXA 3HMNA 3KK8A 2HOGA 3OD6X 3NIZA 2A4LA 2OJ9A 4KB8A 3W2OA 3QTUA 3HV7A 5CU6A 2C6OA 5J5TA 2VNWA 4JBVA 3K5UA 4EK6A 4C38A 4UBAA 3ZYAA 2YIYA 3NR9A 3R8PA 2XEZA 4OTPA 3TV4A 5LMAA 3VS5A 3BHVA 4RFZA 2X8EA 1UNGA 4U41A 5IPJA 1LR4A 3C4EA 3QCYA 3FWQA 5HD7A 3QD3A 3MJ2A 3HV3A 5A54A 1SVEA 2EB2A 1IG1A 5ANOA 3DKFA 1OM1A 4FZDB 2Z7QA 4C3RA 1CTPE 4FEQA 4RX7A 3E63A 2GHMA 2JGZA 4EOJA 4W4VA 4JQ7A 4L01A 4BDFA 5JZNA 4GL9A 3QUDA 3ZLXA 4O38A 4Q5EA 3TIYA 4ZY6A 3TTJA 3UOHA 3QTWA 2B9HA 3JVSA 2XIXA 3KRXA 4FSTA 4R5YA 2C0OA 2G9XA 4FODA 4D2SA 1U5QA 3PXQA 5J87A 4BCQA 5HTCA 3TV6A 2WD1A 4ANQA 4IAFA 3FI3A 2ONLC 3CC6A 3L8PA 4XS2A 4IIRA 5A6OA 2O3PA 1FGKA 5H2UA 2VTHA 3RPRA 4FKVA 3MFTA 3W2PA 4RQKA 3AC4A 5AR7A 1H00A 4ZLZA 4JIKA 1YRPA 4Y8DA 4BGGA 4I4EA 5AWMA 3LFAA 4FKIA 3OW4A 4QYHA 1UV5A 4C57A 3PJ2A 4JQ8A 4BL1A 5J7BA 2LAVA 5J7HA 3CJFA 2YCFA 3UC3A 1Z9XA 3MVMA 2QOFA 3VW8A 4EUUA 4JBQA 5BX0A 2WIPA 2EXEA 4HNFA 5HCXA 4C33A 1LP4A 5F4NA 2XIYA 3C9WA 3DB8A 2P2IA 4FTUA 3O8PA 1ERKA 5H8EA 4ENXA 4L7SA 1REJA 2XNNA 3C13A 1IEPA 4DEIA 2XIRA 5EHYA 3P4KA 4EYMA 3P7CA 2FVDA 5H8BA 3I79A 2ONLA 4QMOA 5T68A 4V0GA 2W96B 1OKYA 2F9GA 2R3QA 2HWPA 3BE2A 4FTRA 3GFWA 4EK3A 2QD9A 2FSTX 4J96A 3O96A 2AUHA 4F9WA 4EUTA 4Y46A 5E92A 4UV0A 4XBUA 5AV0A 5ACKA 3VJNA 3LFSA 3AT4A 1V0PA 2BAKA 3C0HA 4TWPA 5FXRA 4MYGA 3DA6A 3D14A 4HJOA 3NWWA 4O0YA 4WT6A 4DEAA 4ANMA 4Y5QA 5CF4A 3UBDA 1RJBA 3POZA 3A62A 4BWKA 4YSJA 2WMSA 3H9FA 3S00A 3JY0A 3R6XA 4MVFA 5GJFA 3VBVA 5JMSA 4K6ZA 3KXXA 1FVRA 3GU4A 4MKCA 5DLSA 3V5PA 2XCKA 3FBVA 4HGEA 4YTIA 3R8VA 4Q9SA 3VBWA 3QQFA 5HIEA 5JQ8A 2C30A 1NVRA 2XJ2A 1MQBA 2HW7A 4IZ5A 3DLSA 1FMOE 3BLHA 3RINA 4X6QC 5DBXA 2QCSA 3E8CA 4AS0A 5HVKA 4YHFA 4M66A 3C50A 5FD2A 3V6SA 4K33A 4D1SA 5AP1A 4HZRA 5DA3A 4EBWA 2A19B 4L46A 4O22A 4IEBA 2PE1A 4UYAA 3ORLA 4YZCA 5AX9A 5L2QA 3T9TA 5IUHA 4ACHA 3HKOA 4U79A 4DTKA 4A9YA 3HX4A 3UMWA 4FZ6A 4QT1A 4XG2A 1REKA 3QZHA 3DBDA 5K9IA 4Y85A 3VS7A 1UKIA 2C3JA 3EB0A 3CIKA 1R0PA 2PVFA 3MH3A 2PZ5A 3P9JA 4XJ0A 4DG2E 2JLDA 2XIKA 5ETIA 4ALWA 1KE6A 3F3UA 4RA4A 4CFXA 1PXIA 3UODA 5BVDA 3T9IA 2C5XA 5AR8A 4GG5A 1W84A 2DQ7X 4F9BA 4U80A 3LJ1A 3P86A 5CQUA 4DFXE 3PXYA 4L9IA 5IDNA 1ZXEA 3L9MA 4GH2A 4I24A 2W7XA 4L45A 3LFDA 3BLRA 3TKHA 4RQVA 3G90X 3ETAA 2HY81 1AD5A 3IPHA 3OTUA 4I0SA 4KS8A 1ZMWA 3FXWA 5ANIA 3PY0A 5EOBA 4ZLYA 3UZPA 5BMSA 3EFJA 1I09A 4C62A 5HX8A 2EU9A 3EKKA 3GENA 3TEIA 5C1QB 3I0OA 4DH8A 1SNXA 2CMWA 2ZV7A 4C61A 2CLXA 4IWDA 1OL6A 2VWWA 5DR2A 5I9VA 3Q9ZA 3QKLA 2YLEA 5AUTA 2UV2A 3CKXA 2J0MB 2OIBA 4NWMA 4O0WA 4FNWA 3PG1A 3NSZA 1P4FA 4LV5A 4NFNA 2JIUA 3EYHA 2XNMA 1H07A 2EXMA 4FTNA 3VQHA 2OKRA 2R3KA 3FC2A 3RWQA 3UP7A 4HNIA 5CAVA 2W1IA 3F5XA 3I5NA 3P5KA 3IW7A 3FL4A 3QXOA 3LMGA 2VD5A 2R0IA 3MH2A 3W18A 4K2RA 4IX6A 1J91A 1RDQE 3LIJA 1KE9A 3DK3A 4YO6A 3A7JA 3ZLYA 4J52A 3RJCA 3EHAA 3R1QA 3Q53A 4TWCA 4KRDA 4GYGA 3COMA 3Q32A 3KF4A 4RX9A 3SOAA 3WZUA 1H27A 4AZSA 4KIOA 2BDFA 3GOKA 4M12A 4RIYA 4FYNA 1SM2A 2WMVA 3TJCA 3IOPA 5BYYA 3DFAA 3KMUA 4WBBB 3LFFA 3V04A 2H8HA 2WMAA 2XA4A 5HE1A 1U54B 4M97A 2P3GX 2IW6A 4MD7E 4MXZA 4PDPA 1Z5MA 5F94A 4BWXA 1JKSA 3E5AA 4G3CA 4CYJA 3LHJA 2X9EA 5H8GA 2XVDA 3EQCA 5DRDA 2JIIA 4L68A 2IZSA 4V01A 1YXSA 3L8SA 4CMUA 3VULA 1WBNA 2W9FB 5K3YA 4KSQA 4C8BA 1KWPA 3ENMA 2UZUE 2WIHA 1NY3A 3NCZA 3WYYA 4D2PA 5L8JA 2WTKC 3QTSA 4AN2A 4DH1A 5CANA 3D5WA 1J1BA 2BCJA 2IZUA 5KMJA 3ORNA 2OFUA 3FMLA 5LXMA 5J1WA 3EQBA 2OK1A 1LEZA 4APCA 2XJ1A 4LFIA 4W9XA 4X2FA 3OXTA 4TWOA 4M3QA 3KRRA 2I40A 1U59A 1S9IA 3MW1A 4NT4A 5LVNA 3REPA 5HBEA 4FSYA 4UWBA 5K4IA 4E4NA 3I60A 2C6KA 3NRMA 4WRSA 3MB6A 4H36A 3VHEA 3U9NA 2ITWA 2WO6A 2CGWA 4D4RA 3IGOA 4QMZA 2PVKA 1P4OA 3BE9A 3E3PA 5CQWA 5ITAA 3OW3A 2AC3A 2F4JA 4GK4A 2VWXA 3LCOA 5IA5A 3OEFX 1CKIA 1XWSA 2PE2A 4QYFA 5DH3A 4EYJA 4D4VA 3R71A 3CTHA 3JPVA 4TYIA 2OZOA 3G6GA 3F9NA 3AMBA 3GP0A 2C5YA 2R7BA 4I0RA 4EK4A 3PIYA 1RQQA 3HA6A 3H9RA 2B9IA 2JDRA 3EQIA 4FSQA 4B99A 4CZUA 4GRBA 5CU3A 3KN6A 3R00A 4CNHA 3QHRA 4FV3A 5EHOA 4YJTA 5A14A 5CASA 2ETMA 3KL8A 2OIDA 4BIEA 4X3FC 3ZSIA 3NYXA 4C58A 2QO7A 4HCVA 4H3BA 3VUIA 4Y83A 3SAYA 2BTRA 1CMKE 1Q5KA 1U4DA 2H9VA 3AD5A 4L52A 4AX8A 5AUXA 1V0BA 5EKOA 3UPZA 2WEVA 3R73A 4FTLA 3WE8A 3EFLA 4EH3A 5JQ5A 4A9RA 2R3FA 4GSBA 4FV6A 3COIA 3ZCLA 3LFEA 3ZEPA 4CT2A 1DI9A 5AA9A 1ZOEA 2XUUA 5CT7A 2YITA 4WOVA 3HV5A 3IW4A 3QAME 4QTDA 2A27A 3QKKA 2C0TA 4HGLA 2P0CA 4PTEA 4QTBA 3P0MA 1UU9A 4V04A 3DKGA 5AM6A 4ARKA 4BDBA 5F95A 3MN3A 4JAIA 5IA3A 2BIKB 5CI6A 3PUPA 4YBKA 4C36A 4RFMA 4HZSA 1OL7A 2AC5A 4HVHA 2JC6A 5FTOA 3VUHA 2OO8X 4JR7A 2CHLA 2IVVA 4TNDA 2UZOA 3UVPA 5D9HA 4ZXTA 1PXPA 2H6DA 3OWJA 4FVQA 3KULB 3RI1A 2PMOX 3O0GA 4FA2A 4R6VA 4W8EA 2PTKA 5L6PA 4ZEGA 1HCLA 4BDHA 4ZSAA 3E7OA 2PMIA 3FAAA 3UYSA 4IAZA 4FTQA 4U43A 3IECA 3S2PA 4E6DA 1WBOA 3EN4A 5J9ZA 2ETKA 5JFWA 4BFMA 3ACJA 1YI4A 4O96A 3I6UA 5EG3A 3QZFA 4EJNA 3FZ1A 4TTHB 1UWHA 4I22A 2GHLA 3E3BX 1T46A 3PSDA 1JAMA 5HLPA 2OIQA 3BI6A 2V22A 5HE2A 2OF2A 2OICA 2WQOA 4PMSA 3R7UA 2RF9A 2OFVA 3F5GA 1H24A 4RVLA 1U54A 2NPQA 3DJ6A 4AF3A 5L8LA 2B1PA 1M7QA 3PJ3A 3MY1A 4X7QA 4G3DA 2GNLA 5I3RA 1ZOHA 3POOA 3FKNA 3VS3A 2ZV8A 5CENA 5IEVA 5M53A 3A2CA 3R83A 5C03A 3ZO4A 4RJ7A 2BR1A 4JG7A 3HV6A 5DOSA 4ALVA 4DFLA 5M4FA 2W99B 3G0EA 4QYYA 4L00A 4IM2A 4MBIA 1G5SA 4M69B 4UX9A 3BYUA 1XQZA 2QC6A 3TTIA 5IA1A 2BDJA 3CKWA 3O71A 2J50A 3HGKA 1KOAA 4X0MA 1J1CA 1BMKA 1Q97A 4GJ2A 4BCPA 1Q61A 5JGDA 1RW8A 4RC2A 3Q4TA 4NK9A 3F82A 3P1AA 5BVEA 5CEIA 4BIBA 2WB8A 1V0OA 3E93A 1NVSA 5HVYA 4IE9A 1PHKA 1W0XC 2UVXA 3DJ7A 1TQMA 3DV3A 3PSCA 1VEBA 4FIJA 1Q41A 2XNPA 2YISA 3GU5A 5I4NA 4QMUA 1H08A 3EFKA 3CTJA 3EQFA 4F9AA 5AAEA 2XH5A 3BLQA 4WG5A 3TACA 5IH4A 1B38A 2VO6A 4TT7A 3F3WA 4LL0A 5FBOA 1TQPA 1URCA 2WTJA 4EL9A 3EL8A 3EKNA 1JPAA 4I94A 2RSVA 2W06A 3MTLA 3IKAA 4FICA 2XK8A 3VUDA 3F88A 1K2PA 5EYMA 2R64A 3PPKA 1GJOA 2X9FA 3KXMA 1A06A 4A9SA 5K5NA 2CJMA 4FNXA 2WNTA 4AZWA 3RK9A 3WILA 4AFEA 2PHKA 5HO7A 4OTGA 2W0JA 2WMQA 3MWUA 3KEXA 2WHBA 5AX3A 4WNMA 2BHHA 2J51A 4FK3A 5LMBA 4I6FA 1QMZA 1ZARA 5IA4A 5TO8A 1H01A 2X0GA 5HIBA 1DAWA 3LFNA 3QX4A 4WHZA 4PPBA 2O8YA 1YOJA 3OT8A 2E9NA 3QRJA 1H8FA 3D7TA 4ZS0A 2BRBA 5J95A 2Z60A 2IZTA 3NPCA 4RBLA 4KS7A 5GJDA 4YJUA 4CZTA 3NNUA 4C4FA 5JN2A 2JDTA 2ZB1A 2DUVA 3FLWA 4PX6A 5CYIA 4LRKA 3M42A 3QLGA 4U3YA 5AP3A 4D28A 3FJQE 3LM0A 5I9WA 1Q24A 4F63A 5DIAA 1PMNA 1OUKA 5CVGA 1FOTA 1Y91A 1XO2B 2IVTA 2NRYA 4YBJA 2RG6A 2YFXA 3WF7A 4TN6A 4EQMA 5IEXA 3EN6A 3AD4A 3BYOA 1YWNA 5F20A 5CSWA 2UZDA 4FI1A 3QWJA 2VTNA 5J8IA 1WFCA 4OBPA 2ITZA 3UG2A 1MRYA 3PJCA 1MP8A 3UQFA 4OAUC 2HWOA 1FVTA 2EUFB 4BCKA 3LOKA 4NCTC 4XNEA 3HVCA 4JR3A 3OTVA 5KKRB 1SNUA 3K54A 1ZLTA 2G2FA 3MH1A 2G2HA 4F99A 4JG6A 4S32A 4I41A 4DHFA 5B2LA 4IAKA 4EOLA 3KN5A 5EW8A 4FKJA 4FT9A 4BYJA 3QBNA 4FV9A 2OJGA 2NRUA 5C8MA 3QYZA 1U46A 1O6YA 3TL8A 5AUWA 4JVGA 2VU3A 4RVTA 5LVPA 3NW5A 3R8ZA 1A9UA 3O8UA 5DI1A 3CGOA 3FPQA 3ZONA 4BDIA 2Y0AA 2JAVA 1OL2A 5CI7A 4F7LA 3HMPA 4FIGA 4IJPA 5HORA 2J0KA 1K9AA 2C1AA 4U81A 3HRCA 2W05A 4LYNA 4X21A 5BVNA 5GZAA 4X3JA 2VTPA 4I4FA 5L2TA 2C5OA 4LOOA 4MF0A 2HZ4A 4E5BA 2WTIA 2WU6A 3P7AA 4MXCA 5CAQA 2G01A 4L43A 4NKAA 3MVLA 2UW0A 4OLIA 4ITJA 4FG7A 1OIQA 4NTSA 1G3NA 4TZRA 3R30A 1PF8A 4XP3A 4XV2A 5D41A 4ZSLA 4XLVA 4ZSGA 2QQ7A 5IUGA 3FDNA 2KTYA 4FTMA 1OKVA 3GCPA 4PL4A 5DPVA 1B6CB 1H1QA 2FSLX 3GC0A 4WBOA 3ZO1A 3IGGA 1O6KA 3B8QA 4X2KA 5AEPA 3LCTA 2ZDUA 5EM8A 4DGOA 2ZYBA 3F3ZA 4PF4A 4CT1A 1PY5A 4OTIA 3DTWA 4EH7A 4FG9A 2BFXA 2Z7RA 2BUJA 4R5SA 5CVFA 4FT0A 5A6NA 3GQLA 5K0XA 4YZDA 3BQRA 1FVVA 3OUKA 4IMYA 4S33A 4JBOA 5CTPA 2Q0NA 2R0UA 4MBLA 4AU8A 4F6SA 5JEBA 2WPAA 4GEOA 3Q4UA 2JD5A 3SC1A 3DTCA 4FZ7A 4HVIA 5HX6A 5JGAA 4ZZNA 4OR5A 5EH0A 4AFJA 1OIYA 5K4JA 1WBVA 5FEQA 2ZMCA 3PXZA 4IWQA 3NLBA 1W98A 4RWIA 3D94A 3U4UA 3UOJA 5HTBA 4BI1A 2W1CA 4HW7A 2JFLA 3Q9XA 4QQTA 3DBCA 1WMKA 3IOKA 5L2WA 4LRJA 3TUBA 3E8NA 4C59A 3PA5A 2UW7A 4AQCA 4IB0A 3ZUTA 4ZK5A 1ZYJA 2VTSA 3O50A 4M14A 2KULA 4C35A 5J1VA 3E92A 4UMUA 3JXWA 3ROYA 2QU6A 4QP2A 2YCRA 2YDKA 4CYIA 3DY7A 4WSQA 4UMPA 5IF1A 4P7EA 3AMAA 4S34A 5CSPA 3ZHPC 3LAUA 3W2SA 5BVFA 4UXQA 4QMSA 1OL5A 3DBFA 3I0QA 1F0QA 4FOCA 3OHTA 3HP2A 5D7AA 4YNEA 4NM7A 3MY5A 2YM4A 2VWIA 3F66A 1VZOA 3K5VA 3TUCA 3OY1A 2B53A 1XH4A 2W4OA 3C0IA 4AOIA 5JK3A 4C37A 4AW5A 4D2RA 4GG7A 3MIYA 4O0UA 2VTAA 3WOWA 5HQ0A 3CGFA 1MRUA 4GS6A 1TKIA 2O64A 3QU0A 4QTAA 5CF5A 3MBLA 3OMVA 3RZBA 3DU8A 3SX9A 2C6EA 3LVPA 3PVWA 4OTRA 5HG8A 3CJGA 2QODA 3CPBA 5G1XA 1Y6BA 4M13A 2V55A 4HGTA 3WF6A 2XBJA 3C4CA 3QLFA 1BL7A 5EYDA 3F7ZA 3UIXA 2ERKA 2WAJA 3UP2A 3D15A 3TCPA 5KBQA 1JVPP 4YTFA 5ETCA 5A4QA 2BROA 5K0KA 3PE1A 3JVRA 1ZOGA 4C34A 3CLYA 2XCHA 3G2FA 3W16A 2F7XE 4APPA 3PRFA 3CBLA 1JWHA 5EDPA 3RGFA 5AR3A 3ZRLA 4ANOA 3VQUA 3ORPA 5HIDA 4DFZE 4MXAA 4E4XA 1YOLA 2SRCA 1WVWA 2XRWA 3DCVA 3PZEA 3VC4A 3P7BA 3UE4A 4FR4A 2BHEA 4Q9ZA 4WD5A 5CT0A 2YABA 1AQ1A 1OGUA 3QD4A 3QA8A 3ERKA 3H4JA 3QUPA 3I6WA 5AUUA 2QNJA 5FGKA 5ICPA 4FV8A 4IWPA 5HZNA 4QMLA 5DT4A 5M57A 3ALNA 3KGAA 4C7TA 2GS2A 2VGPA 5KMNA 2FSMX 4RZVA 3FXZA 1OPLA 3N51A 4H1MA 4N4SA 4JNWA 1GAGA 4G3GA 3R8MA 4FKLA 5DG5A 4PTCA 4MWHA 5KO1A 3PIZA 3QC9A 4F4PA 2EWAA 2QO2A 3QD0A 2W4KA 5CF8A 3PY3A 4BGQA 4EQUA 3MS9A 3RAWA 4ITIA 2VO3A 3MDYA 4YJPA 5IH5A 4PMTA 5DEWA 3ORMA 4GT5A 5HU3A 3UC4A 4FKSA 2UZVA 3N9XA 3CQEA 3Q52A 4J71A 3GCVA 5C9CA 4YLJA 3BQCA 3HMIA 3QGYA 5HLWA 5J9LA 4FTIA 2VRXA 3FSKA 3P08A 4QMMA 3P78A 4G2FA 4JL9A 2OI4X 2R3NA 4GYIA 5AR4A 2C0IA 4WSYA 4CFWA 3HRFA 4F65A 4XRLA 5AA8A 1CSNA 1PXJA 4GCJA 2WXVA 2C3KA 3FHIA 4RGJA 2IJMA 4YJNA 3ZZEA 1UKHA 4IZYA 1QPDA 2HCKA 3D5XA 3NCGA 3NX8A 3QQHA 4F0GA 3CD3A 3FMMA 4FGBA 4KABA 5AUVA 4DCEA 5CX9A 1UU8A 2GU8A 3V5WA 2CSNA 4IHPA 5GJGA 5KHXA 2W4JA 3PXFA 3NAYA 4R3RA 2GHGA 4CFNA 2UW4A 4RJ8A 1DAYA 2OG8A 3ZC6A 4DG3E 4FVPA 3QQKA 3GNIB 4HYUA 4M15A 3DJ5A 4HVSA 3QQGA 4JRVA 4RIXB 5LMKA 2NP8A 1JBPE 5J9YA 5LJJA 4LRMA 4IX4A 4D5KA 1YVJA 3FZSA 2V7AA 3QRUA 2OW3A 3Q4CA 4JS8A 4MNFA 2JEDA 2YEXA 3K3JA 4XMOA 3AC5A 4EH9A 4UWYA 3DBEA 4J98A 2J6MA 4H3PA 2GNJA 1ZY5A 2QG5A 3FZRA 4XOYA 4RWKA 5I9ZA 3AT2A 4K11A 3C0GA 4QMWA 1WBPA 3UNJA 4BDEA 4CFMA 4I6BA 5JKGA 3MV5A 4RJ4A 2C5VA 4EH4A 4NEUA 1Z57A 4RJ6A 1ZYLA 5KMLA 3TI1A 1X8BA 3CEKA 2X8DA 3WZKA 2RFDA 5JFSA 3VW6A 4QMTA 4AXAA 3R01A 4J53A 4DITA 4AZVA 4R3CA 4H58A 2PVRA 2I6LA 3R7GA 4AGCA 1SMHA 3LXNA 3OCTA 5ANGA 4RC4A 4B0GA 4JQEA 3CY2A 4IACA 4G31A 4QNYA 4DC2A 4J99A 4RFYA 4O0SA 4LM5A 4ZAUA 5M51A 2WOUA 2WMUA 2OZAB 3LXLA 2V5QA 4EHGA 2OXYA 2Y4IB 3AD6A 4BICA 5B0XA 4ZTRA 3UPXA 5FXSA 5IG1A 3WZEA 4EOQA 5J79A 1HOWA 4YJOA 2QOIA 1SYKA 3BGQA 4YC8A 4BCFA 1JKLA 2JKKA 5FP5A 1KSWA 3VS2A 5B2MA 2VX0A 2HK5A 5E7RA 4PNIA 5I3OA 4TNBA 3U87A 5HCZA 3WARA 3BWJA 3QUEA 3BU3A 4PDSA 4CTCA 3GOPA 4QPMA 3TJDA 3RP9A 4OTDA 5KNJA 3S3IA 4JJRA 5HNIX 2BPMA 3TKUA 4USFA 3BCEA 5BUIA 3W32A 3ZFMA 4BZDA 1OKZA 4CQEA 4EQCA 2HW6A 4U3ZA 3VWAA 3IO7A 3RMFA 4YJQA 5LCJA 2ZVAA 3EQHA 3FI2A 5HKMA 4AGDA 4AN3A 4FTAA 1SZMA 3MH0A 4FSZA 4N70A 5FEEA 1XH5A 4I3ZA 4EOSA 2XK9A 2YA9A 2X7OA 4UXLA 2IVSA 4X2NA 1IA8A 5CNOA 4ENYA 1ZAOA 2ZV2A 5LWNA 3QGWA 4F6WA 3UNKA 1GIIA 4FTTA 3EIDA 3EZVA 3OCSA 4OGRA 5IMEA 3OBGA 3AOXA 3NEWA 4GIHA 4JDKA 5HD4A 4CVAA 1ZZLA 3ORZA 4A4LA 5EYCA 4O0RA 2Y6OA 4H39A 3GB2A 3EZRA 4E4LA 3BBWA 4YPSA 2HYYA 1SVHA 4G6LA 5AP6A 4Q2AA 1ZZ2A 3DNEA 4ITHA 4YLKA 4ACMA 5D7VA 3Q04A 3QA0A 1M7NA 2VO7A 3LCDA 5KMMA 4LOPA 2F49A 2CCIA 3MVHA 3RK7A 2VWZA 4FNZA 3F5UA 2GMXA 3GU7A 4GMYA 2QO9A 3GU6A 4HYHA 3CE3A 2I0VA 1H1SA 1HCKA 2Y9QA 4ASZA 1PKGA 3UIUA 4EH8A 2WEIA 3VS4A 3MJ1A 4E6QA 3ANRA 3PSBA 3PXKA 3QCXA 4DEBA 1P14A 4GIIA 4FV5A 3C4WA 3BHHA 5EI6A 3UVRA 2P4IA 1O6LA 4I6HA 5CU4A 1KE7A 3OWPA 4U44A 3R02A 1R39A 2VX3A 5JT2A 4MD9E 2XRUA 2HELA 4KIKB 5HU9A 4BI0A 1JNKA 1J3HA 5IMXA 5CALA 3HUCA 3OOMA 4JDIA 3MFSA 5BPYA 4D1ZA 3PVGA 3OXIA 5BUJA 4FT7A 4FYOA 3HUBA 1ZYCA 4I23A 4F1OA 1PXLA 4XLIA 4CD0A 3KF7A 3H0YA 4FKRA 2QOBA 5CSVA 4O0VA 2F57A 2W5HA 4GT4A 1GZOA 1OIUA 1CDKA 2QOOA 4GV1A 2R3MA 5IDPA 2BAQA 3A8XA 4K1BA 4EH2A 2W17A 2W9ZB 4IB3A 4R8QA 3F3TA 3W1FA 3MVJA 4BDDA 2CDZA 2CPKE 4USEA 4JDHA 3QQJA 4O0XA 3R21A 5GZ9A 4DEGA 4RVMA 4G3FA 3W55A 2XP2A 3P79A 1NXKA 5TT7A 3B2TA 4FUXA 5EDRA 4PMPA 2VV9A 4JX7A 3S1HA 2GFCA 3HA8A 2OH0E 2FH9A 5JSMA 3I1AA 3VHKA 2WELA 4PUZA 1H28A 4JXFA 3A61A 4EWHA 4DBNA 4FKWA 3Q6UA 4FZFB 2Z7LA 4NJDA 4QTEA 4EZ5A 3A60A 2I1MA 2XB7A 4F1TA 1ZYSA 1O9UA 4XG8A 2OZAA 2YAAA 4AA5A 3UMXA 1OI9A 1H1RA 3R63A 2ETRA 2PE0A 2W1ZA 4MNEB 5LVLA 4R1YA 3ACKA 2BRMA 2UW5A 5E90A 4ACGA 4RZWA 4FSMA 4TRLA 4AA4A 4GFMA 4M0YA 3HECA 5EI8A 4CCUA 4D5HA 2QHNA 1BUHA 4MBJA 4C2WA 3OUNB 1OPJA 4DGNA 3BKBA 3DAJA 5M4IA 4G17A 2GCDA 2PVLA 2R3PA 3EFWA 1XBBA 5AV1A 4EHVA 2RKUA 3GBZA 5TKDA 4A4XA 4EH5A 1Q8WA 3PRIA 3SV0A 4OTWA 3ZEWA 4CMOA 3I7CA 3G6HA 4HGSA 3ELJA 2BAJA 3JS2A 2YIQA 4FL3A 3VNTA 4G6OA 3L9PA 4ANSA 4B8MA 5CNNA 5KBRA 2G15A 3H30A 5DEYA 4EH6A 5DWRA 4NW5A 3MPMA 3BV3A 2UW9A 4PWNA 5A46A 3KVWA 3UO6A 4Z55A 2WMWA 3FI4A 3W2RA 4DEEA 5AAGA 1QPCA 3ET7A 1PYXA 3E62A 5AV4A 3DDQA 2YLFA 1PXMA 3KY2A 4KWPA 3DQWA 4LI5A 2C6LA 2R3IA 1PXOA 4XV9A 4JRNA 5HEZA 2C47A 4IW0A 4RA5A 5C01A 3R7EA 5GHVA 2OH4A 2X6DA 3FY2A 3MA3A 1W82A 2OJJA 4BBFA 3PWDA 3LFCA 3QRKA 5FP6A 2Y7JA 4E1ZA 4QP8A 4UZDA 3VUGA 3GQIA 3R7YA 4YU2A 1WZYA 3CS9A 3T3UA 2XKFA 3VUMA 3DBQA 4B4LA 1YXTA 2XKEA 5AR2A 3RNIA 4AACA 4OT5A 2NO3A 2QOCA 4C3FA 4CFUA 2GS6A 3O2MA 3MFRA 3RAKA 1WBWA 2WFYA 4E6AA 2X7GA 2CCHA 1YKRA 2GSFA 4FV2A 2C6DA 4FKUA 5H9BA 4RIWB 3OEZA 3ORKA 5DGZA 4U0IA 4D9UA 2VN9A 2PSQA 3FY0A 3QRTA 3UTOA 1GZ8A 4LQMA 2IN6A 3KRWA 2PVJA 3VBXA 3OOGA 3QF9A 4QYGA 3EYGA 3GGFA 4NIFB 3TN8A 1Q8YA 1XH9A 4QNAA 4AZTA 2YJSA 3O7LB 4DGMA 3LXPA 5HOAA 4ERWA 1H26A 3U4WA 2PZIA 3UQCA 2ZM3A 4MEDA 5KMIA 5JZJA 1GIHA 4II5A 2ZMDA 4S31A 2RIOA 4CTBA 4ZTLA 5T6KA 2CGUA 3W33A 2XYNA 3FPMA 4EC8A 1KE5A 2QKWB 2YIRA 5E91A 4F70A 4IH8A 1QL6A 3QYWA 4TW9A 4FKQA 1RE8A 4XYFA 2BFYA 5EHLA 4E5AX 3GU8A 3R04A 3LFBA 2JAMA 4IAAA 3FLZA 4BCIA 4W4WA 4O2ZA 2VGOA 2V0DA 3GXLA 3MY0A 3HMMA 4PL5A 3L8VA 4BDGA 4QD6A 4TYGA 2R3JA 4OTQA 3RCJA 2JKOA 1GNGA 4QMYA 3GFEA 4J8MA 4X6RA 2R3LA 2QLQA 3Q5IA 4KBAA 3WZDA 2YM8A 3BZ3A 2RG5A 3OROA 4JOAA 4CRLA 5BNJA 4K0YA 3CXWA 2OWBA 3V01A 2B7AA 4R1VA 2IZRA 2CGVA 3L9NA 3UO5A 3EMGA 4KBKA 4XG4A 4S2ZA 3V8SA 4FKGA 4YGAA 3F2AA 3D2IA 3LZBA 4YC6A 3AC3A 4DFNA 1PMVA 4RSSA 2X2KA 2WTCA 3EH9A 3LCSA 3RCDA 4WIHA 3E87A 4FSUA 3S0OA 1Q8TA 2UZEA 3GVUA 2G1TA 2HZIA 2JFMA 2HXQA 3NUUA 4IC8A 2WQMA 2XMYA 3R7OA 4KSPA 4DN5A 5HVJA 4F09A 5KZ0A 1U5RA 3DOGA 4H3QA 2WTVA 2Y8OA 2BZJA 4JX3A 4DYMA 3FV8A 2G2IA 4FZAB 3RTPA 2HENA 3LQ5A 3V6RA 3DK6A 3FMDA 2QKRA 3C7QA 4L67A 4YP8A 3QTIA 2UW3A 3CQWA 2XM9A 3NNXA 1OZ1A 5CEOA 3FHRA 1UNHA 4MQ1A 3QWKA 4Z9LA 4E93A 4G9CA 3ZSHA 3KULA 1LEWA 4MX9A 4AUAA 2GS7A 3KB7A 2XK4A 4J7BA 4AWIA 4WNPA 4MAOA 4LMUA 4CRSA 4ACCA 3R28A 4E4MA 2GFSA 5CU0A 2HZ0A 2HXLA 3D5UA 4G5PA 3BYVA 4ID7A 4MF1A 4ALUA 1VYZA 2XK6A 4E6CA 3VJOA 2WMBA 2R3RA 4M7IA 2ESMA 2WTWA 3BEAA 1Q3WA 1YXVA 3R1NA 3V3VA 3VS1A 3IW5A 4B9DA 1UA2A 2GTNA 2PVYA 5E1SA 2XKCA 5IUIA 4YZNA 3TNWA 4GK2A 4CV8A 4AW0A 3OBJA 4KAOA 5C8NA 4IM0A 2VTLA 5GNKA 4E3CA 4ERKA 5IEYA 1KV2A 1UU3A 3H0ZA 3PE2A 5AUYA 3E8EA 3FKLA 1M2QA 4FIFA 3UG1A 1BX6A 5HG5A 3SXSA 1OPKA 5E8SA 3EN7A 4G6NA 3R8UA 3IONA 4XEYA 1WBSA 4F08A 3DT1A 2R3GA 2RL5A 4GU9A 4O1OA 4QMXA 4XP2A 3P23A 5DT3A 3UIMA 3TUDA 5CAPA 3LE6A 4ASEA 4P5QA 3A7IA 3A7GA 2CN5A 2XNBA 4FIEA 4K9YA 4AP7A 4FIHA 1M14A 3AQVA 4E7WA 2YAKA 4RG0A 3U6IA 3FKOA 4NU1A 2JBOA 2PK9A 4U5JA 1WVYA 1LUFA 2XF0A 3IDPA 3PXRA 5ETAA 3UJGA 4AE9A 3NUPA 4G5JA 3ZU7A 3TNHA 3DQXA 3LJ2A 3AXWA 2QVSE 1JSUA 4M69A 3CQUA 5C8KA 4ZZMA 2UZLA 4S30A 3R7VA 3IQ7A 4FBXA 4X2GA 4P4CA 1Q62A 1TVOA 4BWPA 2JDVA 3HLLA 4RX5A 5JGBA 3IDCA 5B2KA 2VTIA 4Z3VA 4FKTA 3FXXA 4L6QA 2ZV9A 3D0EA 5KCVA 4EK8A 3Q5ZA 4FTJA 2GDOA 3ORTA 3TKIA 4WA9A 3U6HA 3ZM4A 3AGLA 2BRHA 4NIFA 4YLLA 1OVEA 4DAWA 2HZNA 4XV1A 5B7VA 2WMRA 4O0TA 2X7FA 2WMTA 4HVGA 2J0LA 4CFFA 3W8LA 4YURA 2QI8A 1ZYDA 3UZTA 1XH8A 5E8VA 4ASXA 3A4PA 2BALA 3WZJA 4RMZA 4BHNA 4NSTA 1BI8A 4N6ZA 4UMRA 4K18A 3PJ1A 5TE0A 3R2YA 4QOXA 4C4EA 2ITXA 2XBAA 3HDNA 3OZ6A 3OFMA 2OF4A 4A9TA 4HOKA 2XKDA 2VAGA 3SA0A 4R7HA 2VTTA 3F69A 4V0GB 2C5NA 1S9JA 3RHKA 1LPUA 2QR7A 3BX5A 3IS5A 3O8TA 4EKLA 1GY3A 1PXNA 2P33A 2YM5A 4G34A 5EM7A 1ATPE 1YDTE 4RJ3A 3MPAA 5CWZA 5FWKK 3TNPC 4LOQA 2WQBA 2X1NA 4M84A 4I5PA 2O0UA 3TNQB 4EONA 4A7CA 1YDRE 3WBLA 3S4QA 4C0TA 4XG9A 4P2KA 2QOLA 2IW9A 3G0FA 4FTCA 3BHYA 3R9DA 3LCKA 4XCUA 1R1WA 3MYGA 5BVOA 3W2CA 4IVBA 4BKJA 4BTKA 1OMWA 2UW6A 2C3LA 3COKA 5KKRC 5F9EA 4XX9A 2Z8CA 5IU2A 3VBQA 5HG9A 3UOLA 3HMOA 5DT0A 3UGCA 1UU7A 3PZHA 5E8ZA 3GCQA 1WCCA 4XOZA 1H1WA 4PL3A 2X4ZA 3MA6A 4EBVA 2BMCA 2YWPA 5ANEA 5I9UA 3EQRA 5ACBC 2GPHA 5FM3A 3AMYA 4K77A 1CM8A 4MCVA 2JITA 3OWKA 4WO5A 1Q8ZA 3ODZX 4PP7A 5CAOA 3MIAA 1W8CA 3EQDA 1ZMVA 5L4QA 1R3CA 4FTKA 3W10A 5AP4A 2VWBA 3GEQA 3IDBA 4UEUA 5EK7A 5HBJA 3PA3A 2XEYA 4ZTQA 3DFCB 1H0VA 3CTQA 4AE6A 3VN9A 4FX3A 4FT3A 5IZFA 5J5SA 3SW4A 2XNOA 1XH6A 4FC0A 4ZY5A 2PUUA 2QHMA 3RZFA 4ZZOA 3D9VA 5AP2A 1JOWB 2Y4PA 4FNYA 4USDA 4EKKA 2Z7SA 2ITVA 3KXZA 3VAPA 3VUKA 4IB5A 4QPSA 3JYAA 4BZOA 3DXNA 3HP5A 4YUQA 3THBA 2R5TA 4XRJA 3RPSA 1YQJA 4WNKA 1QPJA 5CF6A 3QXPA 1W83A 1TQIA 2DYLA 1QPEA 4BCOA 1R0EA 3NZ0A 3OP5A 4BCGA 3H3CA 1P5EA 4PQNA 4L8MA 4FL2A 4HYSA 4TYJA 2OJFE 4RRVA 5FQDC 3UO4A 5KZIA 3DZQA 3Q6WA 4Z7HA 2UW8A 3NUSA 3COHA 3FLYA 3OY3A 3QZGA 2VZ6A 2W1FA 1MUOA 3KCFA 4KRCA 4EI4A 4YHTA 3RKBA 3QCSA 5BYZA 4BI2A 1Y8GA 5H3QA 1E9HA 5DN3A 3TIZA 2OGVA 2JDOA 4U40A 1ZWSA 3VS0A 3S95A 3NYOA 3A4OX 3FMKA 4HPUE 3SRVB 4AGUA 4LV8A 4CLIA 1BI7A 1VR2A 2PVNA 1IRKA 2XNEA 4NFMA 3V51A 4BKZA 3RPVA 4KA3A 1ZMUA 3I5ZA 1GZNA 3BRBA 3CP9A 4FOBA 1XHAA 4P5ZA 1MQ4A 4XHKB 3V5JA 3IK3A 4BIDA 1WAKA 3SHEA 4JIAA 3DPKA 2WQEA 4X2JA 1T45A 3RPYA 3EN9A 4KNBA 4RIYB 4GVJA 3WYXA 3RWPA 5LMKC 3PP1A 3QD2B 2C6TA 2OXDA 3QZIA 2E9OA 2F7EE 3VF8A 4C02A 2QU5A 3HYHA 4MQ2A 1VYWA 4YSMA 3NUXA 5JFVA 2GNHA 3ZXTA 5CU2A 5EM6A 1F5QA 4I5HA 2WTDA 1DS5A 2WKMA 4DLIA 4MD8E 3A7HA 4CCBA 1OECA 1Y6AA 2QOQA 5FRIA 2C1BA 2VTJA 4JI9A 4L3PA 2DWBA 3E88A 5DRBA 3FMEA 4J8NA 5C26A 5EW3A 4ZP5A 3I7BA 2XIZA 2IO6A 3ZC5A 4DG0E 5A9UA 4CLJA 2GQGA 3LPBA 5EFQA 2WMXA 1YW2A 5EOLA 2W1DA 3MFUA 4QP9A 4KBCA 2UUEA 4PNKA 2VX1A 3MPTA 3NYNA 2UZWE 3KMMA 4PY1A 4Y73A 3LW0A 4U8ZA 3ZXZA 3ZH8A 5CZIA 3ANQA 2H96A 2IW8A 4IADA 2RGPA 3PTGA 4FTOA 3PG3A 3RAIA 4QP4A 4YC3A 4AW1A 1ZRZA 4BCNA 1FGIA 4AA0A 5IKWA 3EQGA 5AIKA 3HNGA 4WG4A 3TZ8A 4W4XA 3SDJA 2J2IB 5I0BA 4ANNA 4F0FA 3A8WA 4IM3A 4U6RA
chains in the Genus database with same CATH superfamily
5AADA 3OXZA 2YCSA 3T3VA 1JSTA 4M8TA 1YHVA 3DKCA 4WUAA 1JQHA 2WTKB 3F5PA 5CSHA 4YZMA 3O7LD 5ETFA 3SQQA 4FG8A 2R3OA 4U45A 4XG7A 4D2VA 2C6IA 4RJ5A 2W1GA 3D5VA 3F7WA 4C4GA 5AV3A 2R7IA 3DAKA 1KOBA 2GNIA 3PLSA 2PWLA 4HPTE 3ULIA 4NKSA 2OBJA 1BYGA 2ITPA 3WF9A 2PL0A 4TYHB 3UQGA 1GIJA 5HHWA 4ZSJA 4YMJA 3FC1X 4O4BB 4BHZA 3NAXA 3MSSA 3V8TA 2J0IA 5EDQA 4J95A 2QLUA 3PIXA 4TKSA 4E5WA 4O91A 4KKGA 3VRZA 3QTXA 4YZ9A 4YPDA 3BWFA 4MXYA 3QKMA 2FO0A 3KXNA 5CZHA 4UN0C 3KMWA 4EEVA 3MTFA 3OS3A 4WKQA 3II5A 4F7JA 3A99A 4BKYA 5FBNC 2B52A 5AAFA 5HCYA 3HDMA 4G1WA 3DZOA 4YJRA 4A07A 3MGYA 4QMNA 2IWIA 5TF9A 4C4IA 4GJ3A 4IANA 1YXUA 4DEDA 2F7ZE 4D0XA 1PMUA 3VF9A 3R9HA 4OW8A 4G16A 5CVHA 3WIGA 2YIWA 4MXXA 2X0PA 4X3FB 3PY1A 3E7VA 1VJYA 5AP7A 4BTJA 5LWMA 3AT3A 5KHWA 3ODYX 4IB1A 4I21A 3V5TA 4FRFA 3FSFA 4MTAA 3H9OA 4JDJA 3ZO3A 4EWQA 3R1YA 5M4UA 4KKEA 3BBTB 4Q5HA 3CCNA 4Y5HA 2C6MA 3QTQA 4BCJA 2BRNA 4F1MA 3WI6A 1XH7A 1IR3A 2BZKB 2C3IB 3AC2A 3PVUA 4WUNA 3UNZA 4YO4A 2O2UA 4IZ7A 3QFVA 4ZY4A 4EOIA 3SRVA 2XS0A 3GC8A 5AMNA 2WU7A 2GNGA 3Q9WA 4AW2A 5A4EA 3PYYA 5IH6A 3KVXA 2E9PA 1Q8UA 2YERA 2ITQA 4BN1A 4ZTSA 4ANLA 3DB6A 3KXHA 3OCGA 4CEGA 4RWJA 3ZO2A 1BKXA 3NGAA 2VWVA 4O21A 4E26A 4CKRA 3QC4A 5M44A 4OTHA 3BIZA 1XJDA 3F6XA 4HVDA 3ZOSA 4NM0A 1URWA 2EB3A 5DR6A 1ZY4A 4BYIA 2X6EA 1F3MC 3AC8A 3FQHA 4GK3A 5HTIA 3IW6A 3OF0A 3NW7A 4I20A 4HYIA 4IVAA 4DH7A 2ERZE 3PPJA 3O23A 5CLPA 4QRCA 4QP1A 3ZTXA 5KE0A 1YI3A 5E8UA 1JSVA 2UZNA 1OKWA 4CKJA 2BZIB 2YACA 5DR9A 3TV7A 2JIVA 5ANJA 5D1JA 3W2QA 3C51A 4TWNA 4I1ZA 1L3RE 2JKMA 3VUTA 4O2PA 3ENHA 4ZIMA 4EZ7A 1Y8YA 4BDAA 2E9VA 2ZB0A 5M4CA 1GOLA 3SW7A 2F2UA 3RK5A 5KX8A 5KUPA 3KRLA 4Z16A 2R2PA 5L3AA 3BHTA 4RIXA 5BUEA 2B9FA 3BV2A 2X8IA 3O17A 4AZFA 3GC7A 2YN8A 5A3XA 4PV0A 3ZRKA 4BDKA 2Y4IC 5CEKA 4QMVA 3PPZA 3KA0A 5AM7A 5DMZA 3VBTA 2H34A 5CSXA 5T3QA 4AGWA 4U97A 4DGGA 4OAVB 2A98A 3DNDA 4M68A 4M67A 5E8WA 3FLSA 3FZTA 5I9YA 2W1EA 4QP3A 4NUSA 1W2DA 3U9CA 4TL0A 3FMNA 2QONA 4J97A 3ZDUA 5E8YA 3GI3A 2YCQA 4TPTA 5D10A 5HO8A 1JKTA 1YXXA 2O65A 4B8LA 4ZTMA 5LARA 4RLLA 3ORIA 3QL8A 4MH7A 2PZRA 4E8AA 3G33A 4ONAA 4YJVA 4ZJJA 1BLXA 3RBWA 4C2VA 5CXHA 3VRYA 4C4JA 5AIRA 2I0HA 2FYSA 1E1VA 5HNBA 2HIWA 3PVBA 3KFAA 4TYHA 4AG8A 3U6JA 5AV2A 2X2LA 3KU2A 4FKPA 3WF5A 2RFNA 3R2BA 3QCQA 4GVAA 2I0YA 4W9WA 3R8LA 2B9JA 4R3PA 3PWYA 4BF2A 3Q60A 1H25A 2ZM1A 5EKNA 3PP0A 1SVGA 1YWRA 3ZFXA 2A0CX 2LGCA 1FINA 2WOTA 2BKZA 2BRGA 4XUFA 2R3HA 3PA4A 3BU5A 3G51A 3GCUA 3D7TB 5EW9A 2FUMA 5JRSA 4AT3A 3R1SA 5CXZA 3C1XA 4BC6A 4CV9A 1AGWA 4XP0A 4BZNA 4BBMA 1XR1A 5I9XA 4A06A 4QYEA 2E9UA 4G3EA 4YR8A 3EWHA 5FDPA 1OL1A 3KCKA 3SXFA 4A9UA 4A4OA 5JH6A 3TXOA 5HICA 1H0WA 4I5MA 4Y95A 2Z2WA 2ZOQA 3F3VA 4C4HA 4LGHA 4KINA 3Q4ZA 4FSNA 2VWYA 4L3JA 3NS9A 4M0ZA 3M2WA 2CGXA 4FV7A 2QOHA 4L3LA 2F2CB 4X3FA 4YNOA 5CEQA 3SKCA 1YOMA 3C4FA 3AGMA 3UIBA 2REIA 4CSVA 4QO9A 3SD0A 3M11A 2ITOA 2PZPA 4IC7A 5A4CA 3SXRA 4NTTA 1R78A 4IAYA 2Y6MA 3Q96A 4RX8A 5BMMA 3H10A 1K3AA 1EH4A 3DKOA 4UMQA 2C68A 3WF8A 4I5CA 5FEDA 4E20A 2ITTA 4EC9A 3FE3A 3BPRA 4LGGA 3L8XA 5E8TA 5G6VA 3NUYA 3BYSA 4LMNA 4FSRA 2VUWA 5KMKA 2V7OA 4NJ3A 1XKKA 2E2BA 3DAEA 4D1XA 2PVMA 2YZAA 3A7FA 3WIKA 5GZ8A 3L1SA 3AG9A 3OG7A 2FB8A 3R7IA 1M17A 5HLNA 4KIPA 3LXKA 4QQ5A 3RPOA 4WRGA 5HGIA 3WE4A 3CR0A 2ZJWA 2B4SB 1XBCA 4G9RA 2PMNX 4GFGA 2C69A 4IAIA 3HL7A 5DNRA 5HE0A 5FM2A 2X39A 4QQJA 5LOHA 2Q0BA 3NUNA 4RC3A 1PMEA 1Q3DA 1APME 3KC3A 5F1ZA 4DLJA 2IEWA 1KE8A 3FZPA 3LM5A 3RALA 3BGZA 4FL1A 3U51A 2BDWA 5A4LA 1UNLA 2YDIA 5L6WL 3IG7A 1I44A 2IVUA 3QALE 2J9MA 4GUEA 4KIKA 1NVQA 5C27A 1TZDA 3VS6A 2BIYA 4P90A 4XG3A 4U7ZA 2AYPA 3AC1A 4EOOA 3IW8A 4YZBA 3T8OA 3EL7A 4U9AA 4R7IA 2VTOA 3V8WA 4EOPA 2BILB 1PYEA 4B6LA 2OSCA 4FV4A 4IZAA 4DGLC 5JRQA 5LCKA 3ZSGA 2XK3A 4D9TA 3CPCA 3BGPA 4U42A 3FUPA 2X0OA 2JBPA 1PJKA 4LL5A 3GC9A 1W2FA 3JUHA 2FA2A 5AP5A 2W5AA 3DGKA 2RFEA 1IASA 4IDTA 3ALOA 2YJRA 3EN5A 2GNFA 3K3IA 4L53A 4AOJA 3FQEA 4FV1A 3B8RA 4RT7A 3QTRA 3M1SA 4MWIA 3GT8A 3QHWA 2OXXA 4JAJA 4KD1A 5EI2A 4DH5A 4LUDA 4BBEA 5CAUA 2ZDTA 1Q4LA 5M56A 5D11A 5E1EA 4IVDA 4F7NA 1WBTA 3ZZWA 4K8AA 4EHEA 4FF8A 4F7SA 4UY9A 4NM5A 2YHVA 4LG4A 5HO6A 4W8DA 3UDBA 4F9YA 3ZRMA 4AOTA 3FLQA 3ZMMA 4CXAA 2XYUA 3NNVA 1NA7A 2OU7A 1YWVA 3BELA 2RFSA 3R9OA 4OUCA 4QMQA 2J90A 5E8XA 5L2SA 5DHJA 5LVOA 4PDOA 5CEPA 4BTMA 4E73A 3MB7A 1YDSE 2C4GA 4YJSA 3DK7A 4LUEA 4N6YA 2JDSA 2XNGA 4JLCA 1OIRA 1JKKA 3E64A 2J5EA 4MNEA 5ANKA 2VTMA 3OT3A 3CD8A 2YM3A 4MK0A 1OB3A 4O6EA 5AJQA 5FDXA 2YM7A 1W7HA 4AT5A 3BHUA 4IBMA 4F64A 5I5ZA 2PZYA 3G5DA 4OBQA 5IISA 4O1PA 5CY3A 5HNGA 2PVHA 3NYVA 4HCUA 4YTHA 4I6QA 1WVXA 1M2RA 4IDVA 4FV0A 2VO0A 5DFPA 1FMKA 2UZTA 4UYNA 1YHWA 2FSOX 3FZOA 2J0JA 3CY3A 3NIEA 4QTCA 1Q99A 3K2LA 4H1JA 4PPCA 5BVKA 4L44A 5HG7A 2QOKA 4BCHA 2R9SA 2UVZA 4RIOA 2XJ0A 2PY3A 3OC1A 3HV4A 4GW8A 1Y57A 5CS6A 3KXGA 4DFYA 4PMMA 5K5XA 4WNOA 1M2PA 5TR6A 5L8KA 4V05A 4ZOGA 5AUZA 4MHAA 3HRBA 4FSWA 1JLUE 3KQ7A 2ITNA 3BU6A 4TXCA 3RHXA 1H4LA 3OWLA 5EYKA 3FYKX 1H1PA 4L42A 4D2TA 4N0SA 4YHJA 3B2WA 5IA0A 4W4YA 1M52A 1W2CA 4GUBA 2X81A 4NZWB 4RWLA 4ZLOA 3RM7A 3HZTA 4F9CA 4AN9A 3UOKA 4D4YA 1BL6A 1UVRA 2A1AB 4UALA 4FVRA 2P55A 3TNIA 3ZDIA 4OTFA 1YI6A 3PJ8A 3QQUA 3DS6A 3RM6A 4BDJA 2CLQA 4RLKA 4TY1A 2A2AA 4IFCA 1DI8A 4GU6A 1PXKA 4ASDA 2WZJA 3FMHA 2J4ZA 2ITUA 3JY9A 2PMLX 4EOKA 2B55A 4Y72A 4KKHA 3UVQA 2YIXA 3I81A 5LVMA 4QP6A 4IX5A 2VWUA 4MXOA 4D58A 4ZSEA 3ZUUA 3SVVA 4QQCA 2CN8A 2BZHB 4BGHA 3GCSA 4O6LA 4TYEA 3D4QA 3G9NA 5FXQA 3KKVA 5DVRA 5JFXA 4PP9A 5L6OA 4RIWA 4O27B 2WGJA 4IQ6A 1MRVA 4IJ9A 5AP0A 3QTZA 4FUYA 2XM8A 2FGIA 3GUBA 1CKJA 3ZS5A 5HE3A 4ZJIA 4NCTA 4DEHA 4DH3A 4FK6A 4UMTA 4EZ3A 4NW6A 2VNYA 2GTMA 3RNYA 4FT5A 4XV3A 5AR5A 3V5QA 4AZEA 3DLZA 3R22A 4RVKA 4LGDA 5BVWA 4CFVA 2W5BA 3UYTA 1QCFA 1E1XA 2O5KA 4CKIA 4OBOA 3W8QA 4EOMA 4BTFA 3NNWA 4CZYB 3EQPA 2ITYA 3Q3BA 3BEGA 1PKDA 2B54A 4EORA 2ZM4A 4FMQA 4AAAA 4BDCA 2V62A 4NM3A 4BVUA 4UZHA 5ANDA 3VIDA 3LQ8A 4BRXA 3C4XA 3C4ZA 4IXPA 4IWOA 3EOCA 4ZTHA 1XBAA 3C5UA 4J1RA 4QMPA 2CKEA 4UWCA 4ZTNA 2X4FA 4IX3A 2J5FA 3ROCA 3F61A 3ZBFA 4D2WA 4EK5A 2UZBA 4ANBA 3F2NA 5FLFA 3FL5A 5LQFA 4OT6A 4D0WA 2ZAZA 4Z7GA 2X2MA 3LJ0A 3Q9YA 4XH6A 4IVCA 4L7FA 2QURA 2YM6A 2HY0A 4QPAA 5EM5A 2W1HA 3TZ9A 5D12A 5HI2A 3L9LA 4CMTA 4F6UA 2ACXA 4EHZA 3OCBA 3QRIA 3DDPA 5HESA 4I92A 3U8WA 3ZLSA 4ACDA 3FLNC 3R9NA 3PFQA 1PW2A 3KRJA 4RPVA 4IFGA 5L2IA 5FG8A 2O63A 1DM2A 5A4TA 2DS1A 3NW6A 3QQLA 3D2KA 5M55A 3TT0A 1KV1A 4JG8A 2OJIA 3FMJA 3E8DA 5DE2A 3ZFYA 4FKOA 3LFQA 3O51A 4I93A 3TG1A 4D4SA 4I0TA 3VO3A 5KMOA 4BB4A 4B7TA 3TWJA 1FQ1B 5IA2A 2P2HA 2VTRA 1UWJA 3FQSA 4PRJA 3ORXA 4BCMA 3KK9A 3ZLWA 3FYJX 3QX2A 3D83A 5FTQA 3Q2MA 4AT4A 2VTQA 3HEGA 2XK7A 1OITA 3G9LX 3TZ7A 3D7ZA 4GT3A 2HAKA 5TOZA 2EXCX 4WG3A 1P2AA 3ZUVA 3TZMA 2R4BA 1CKPA 3MI9A 3VVHA 4D55A 4HCTA 4C3PA 3SLSA 3ITZA 4F0IA 3RVGA 2WQNA 2BVAA 4DINA 4YTCA 1OUYA 3R0TA 4KIQA 3VBYA 3RAHA 4CQGA 3OVVA 3I4BA 1STCE 4FIIA 3NDMA 4PPAA 2J7TA 2BTSA 2QR8A 2XZSA 3LLTA 1V1KA 2UVYA 2I0EA 4NH1A 4QP7A 5CEMA 1GZKA 5HBHA 1FPUA 1B39A 4UB7A 4ZJVA 4JT3A 2EVAA 3V5LA 3ULZA 4JBPA 5BQ0A 2JKQA 3BYMA 3EJ1A 4GFOA 3SOCA 1YHSA 4PTGA 2YDJA 4XBRA 4XG6A 3ZBXA 3HMNA 3KK8A 2HOGA 3OD6X 3NIZA 2A4LA 2OJ9A 4KB8A 3W2OA 3QTUA 3HV7A 5CU6A 2C6OA 5J5TA 2VNWA 4JBVA 3K5UA 4EK6A 4C38A 4UBAA 3ZYAA 2YIYA 3NR9A 3R8PA 2XEZA 4OTPA 3TV4A 5LMAA 3VS5A 3BHVA 4RFZA 2X8EA 1UNGA 4U41A 5IPJA 1LR4A 3C4EA 3QCYA 3FWQA 5HD7A 3QD3A 3MJ2A 3HV3A 5A54A 1SVEA 2EB2A 1IG1A 5ANOA 3DKFA 1OM1A 4FZDB 2Z7QA 4C3RA 1CTPE 4FEQA 4RX7A 3E63A 2GHMA 2JGZA 4EOJA 4W4VA 4JQ7A 4L01A 4BDFA 5JZNA 4GL9A 3QUDA 3ZLXA 4O38A 4Q5EA 3TIYA 4ZY6A 3TTJA 3UOHA 3QTWA 2B9HA 3JVSA 2XIXA 3KRXA 4FSTA 4R5YA 2C0OA 2G9XA 4FODA 4D2SA 1U5QA 3PXQA 5J87A 4BCQA 5HTCA 3TV6A 2WD1A 4ANQA 4IAFA 3FI3A 2ONLC 3CC6A 3L8PA 4XS2A 4IIRA 5A6OA 2O3PA 1FGKA 5H2UA 2VTHA 3RPRA 4FKVA 3MFTA 3W2PA 4RQKA 3AC4A 5AR7A 1H00A 4ZLZA 4JIKA 1YRPA 4Y8DA 4BGGA 4I4EA 5AWMA 3LFAA 4FKIA 3OW4A 4QYHA 1UV5A 4C57A 3PJ2A 4JQ8A 4BL1A 5J7BA 2LAVA 5J7HA 3CJFA 2YCFA 3UC3A 1Z9XA 3MVMA 2QOFA 3VW8A 4EUUA 4JBQA 5BX0A 2IF8A 2WIPA 2EXEA 4HNFA 5HCXA 4C33A 1LP4A 5F4NA 2XIYA 3C9WA 3DB8A 2P2IA 4FTUA 3O8PA 1ERKA 5H8EA 4ENXA 4L7SA 1REJA 2XNNA 3C13A 1IEPA 4DEIA 2XIRA 5EHYA 3P4KA 4EYMA 3P7CA 2FVDA 5H8BA 3I79A 2ONLA 4QMOA 5T68A 4V0GA 2W96B 1OKYA 2F9GA 2R3QA 2HWPA 3BE2A 4FTRA 3GFWA 4EK3A 2QD9A 2FSTX 4J96A 3O96A 2AUHA 4F9WA 4EUTA 4Y46A 5E92A 4UV0A 4XBUA 5AV0A 5ACKA 3VJNA 3LFSA 3AT4A 1V0PA 2BAKA 3C0HA 4TWPA 5FXRA 4MYGA 3DA6A 3D14A 4HJOA 3NWWA 4O0YA 4WT6A 4DEAA 4ANMA 4Y5QA 5CF4A 3UBDA 1RJBA 3POZA 3A62A 4BWKA 4YSJA 2WMSA 3H9FA 3S00A 3JY0A 3R6XA 4MVFA 5GJFA 3VBVA 5JMSA 4K6ZA 3KXXA 1FVRA 3GU4A 4MKCA 5DLSA 3V5PA 2XCKA 3FBVA 4HGEA 4YTIA 3R8VA 4Q9SA 3VBWA 3QQFA 5HIEA 5JQ8A 2C30A 1NVRA 2XJ2A 1MQBA 2HW7A 4IZ5A 3DLSA 1FMOE 3BLHA 3RINA 4X6QC 5DBXA 2QCSA 3E8CA 4AS0A 5HVKA 4YHFA 4M66A 3C50A 5FD2A 3V6SA 4K33A 4D1SA 5AP1A 4HZRA 5DA3A 4EBWA 2A19B 4L46A 4O22A 4IEBA 2PE1A 4UYAA 3ORLA 4YZCA 5AX9A 5L2QA 3T9TA 5IUHA 4ACHA 3HKOA 4U79A 4DTKA 4A9YA 3HX4A 3UMWA 4FZ6A 4QT1A 4XG2A 1REKA 3QZHA 3DBDA 5K9IA 4Y85A 3VS7A 1UKIA 2C3JA 3EB0A 3CIKA 1R0PA 2PVFA 3MH3A 2PZ5A 3P9JA 4XJ0A 4DG2E 2JLDA 2XIKA 5ETIA 4ALWA 1KE6A 3F3UA 4RA4A 4CFXA 1PXIA 3UODA 5BVDA 3T9IA 2C5XA 5AR8A 4GG5A 1W84A 2DQ7X 4F9BA 4U80A 3LJ1A 3P86A 5CQUA 4DFXE 3PXYA 4L9IA 5IDNA 1ZXEA 3L9MA 4GH2A 4I24A 2W7XA 4L45A 3LFDA 3BLRA 3TKHA 4RQVA 3G90X 3ETAA 2HY81 1AD5A 3IPHA 3OTUA 4I0SA 4KS8A 1ZMWA 3FXWA 5ANIA 3PY0A 5EOBA 4ZLYA 3UZPA 5BMSA 3EFJA 1I09A 4C62A 5HX8A 2EU9A 3EKKA 3GENA 3TEIA 5C1QB 3I0OA 4DH8A 1SNXA 2CMWA 2ZV7A 4C61A 2CLXA 4IWDA 1OL6A 2VWWA 5DR2A 5I9VA 3Q9ZA 3QKLA 2YLEA 5AUTA 2UV2A 3CKXA 2J0MB 2OIBA 4NWMA 4O0WA 4FNWA 3PG1A 3NSZA 1P4FA 4LV5A 4NFNA 2JIUA 3EYHA 2XNMA 1H07A 2EXMA 4FTNA 3VQHA 2OKRA 2R3KA 3FC2A 3RWQA 3UP7A 4HNIA 5CAVA 2W1IA 3F5XA 3I5NA 3P5KA 3IW7A 3FL4A 3QXOA 3LMGA 2VD5A 2R0IA 3MH2A 3W18A 4K2RA 4IX6A 1J91A 1RDQE 3LIJA 1KE9A 3DK3A 4YO6A 3A7JA 3ZLYA 4J52A 3RJCA 3EHAA 3R1QA 3Q53A 4TWCA 4KRDA 4GYGA 3COMA 3Q32A 3KF4A 4RX9A 3SOAA 3WZUA 1H27A 4AZSA 4KIOA 2BDFA 3GOKA 4M12A 4RIYA 4FYNA 1SM2A 2WMVA 3TJCA 3IOPA 5BYYA 3DFAA 3KMUA 4WBBB 3LFFA 3V04A 2H8HA 2WMAA 2XA4A 5HE1A 1U54B 4M97A 2P3GX 2IW6A 4MD7E 4MXZA 4PDPA 1Z5MA 5F94A 4BWXA 1JKSA 3E5AA 4G3CA 4CYJA 3LHJA 2X9EA 5H8GA 2XVDA 3EQCA 5DRDA 2JIIA 4L68A 2IZSA 4V01A 1YXSA 3L8SA 4CMUA 3VULA 1WBNA 2W9FB 5K3YA 4KSQA 4C8BA 1KWPA 3ENMA 2UZUE 2WIHA 1NY3A 3NCZA 3WYYA 4D2PA 5L8JA 2WTKC 3QTSA 4AN2A 4DH1A 5CANA 3D5WA 1J1BA 2BCJA 2IZUA 5KMJA 3ORNA 2OFUA 3FMLA 5LXMA 5J1WA 3EQBA 2OK1A 1LEZA 4APCA 2XJ1A 4LFIA 4W9XA 4X2FA 3OXTA 4TWOA 4M3QA 3KRRA 2I40A 1U59A 1S9IA 3MW1A 4NT4A 5LVNA 3REPA 5HBEA 4FSYA 4UWBA 5K4IA 4E4NA 3I60A 2C6KA 3NRMA 4WRSA 3MB6A 4H36A 3VHEA 3U9NA 2ITWA 2WO6A 2CGWA 4D4RA 3IGOA 4QMZA 2PVKA 1P4OA 3BE9A 3E3PA 5CQWA 5ITAA 3OW3A 2AC3A 2F4JA 4GK4A 2VWXA 3LCOA 5IA5A 3OEFX 1CKIA 1XWSA 2PE2A 4QYFA 5DH3A 4EYJA 4D4VA 3R71A 3CTHA 3JPVA 4TYIA 2OZOA 3G6GA 3F9NA 3AMBA 3GP0A 2C5YA 2R7BA 4I0RA 4EK4A 3PIYA 1RQQA 3HA6A 3H9RA 2B9IA 2JDRA 3EQIA 4FSQA 4B99A 4CZUA 4GRBA 5CU3A 3KN6A 3R00A 4CNHA 3QHRA 4FV3A 5EHOA 4YJTA 5A14A 5CASA 2ETMA 3KL8A 2OIDA 4BIEA 4X3FC 3ZSIA 3NYXA 4C58A 2QO7A 4HCVA 4H3BA 3VUIA 4Y83A 3SAYA 2BTRA 1CMKE 1Q5KA 1U4DA 2H9VA 3AD5A 4L52A 4AX8A 5AUXA 1V0BA 5EKOA 3UPZA 2WEVA 3R73A 4FTLA 3WE8A 3EFLA 4EH3A 5JQ5A 4A9RA 2R3FA 4GSBA 4FV6A 3COIA 3ZCLA 3LFEA 3ZEPA 4CT2A 1DI9A 5AA9A 1ZOEA 2XUUA 5CT7A 2YITA 4WOVA 3HV5A 3IW4A 3QAME 4QTDA 2A27A 3QKKA 2C0TA 4HGLA 2P0CA 4PTEA 4QTBA 3P0MA 1UU9A 4V04A 3DKGA 5AM6A 4ARKA 4BDBA 5F95A 3MN3A 4JAIA 5IA3A 2BIKB 5CI6A 3PUPA 4YBKA 4C36A 4RFMA 4HZSA 1OL7A 2AC5A 4HVHA 2JC6A 5FTOA 3VUHA 2OO8X 4JR7A 2CHLA 2IVVA 4TNDA 2UZOA 3UVPA 5D9HA 4ZXTA 1PXPA 2H6DA 3OWJA 4FVQA 3KULB 3RI1A 2PMOX 3O0GA 4FA2A 4R6VA 4W8EA 2PTKA 5L6PA 4ZEGA 1HCLA 4BDHA 4ZSAA 3E7OA 2PMIA 3FAAA 3UYSA 4IAZA 4FTQA 4U43A 3IECA 3S2PA 4E6DA 1WBOA 3EN4A 5J9ZA 2ETKA 5JFWA 4BFMA 3ACJA 1YI4A 4O96A 3I6UA 5EG3A 3QZFA 4EJNA 3FZ1A 4TTHB 1UWHA 4I22A 2GHLA 3E3BX 1T46A 3PSDA 1JAMA 5HLPA 2OIQA 3BI6A 2V22A 5HE2A 2OF2A 2OICA 2WQOA 4PMSA 3R7UA 2RF9A 2OFVA 3F5GA 1H24A 4RVLA 1U54A 2NPQA 3DJ6A 4AF3A 5L8LA 2B1PA 1M7QA 3PJ3A 3MY1A 4X7QA 4G3DA 2GNLA 5I3RA 1ZOHA 3POOA 3FKNA 4O4DA 2ZV8A 5CENA 3VS3A 5IEVA 5M53A 3A2CA 3R83A 5C03A 3ZO4A 4RJ7A 2BR1A 4JG7A 3HV6A 5DOSA 4ALVA 4DFLA 5M4FA 2W99B 3G0EA 4QYYA 4L00A 4IM2A 4MBIA 1G5SA 4M69B 4UX9A 3BYUA 1XQZA 2QC6A 3TTIA 5IA1A 2BDJA 3CKWA 3O71A 2J50A 3HGKA 1KOAA 4X0MA 1J1CA 1BMKA 1Q97A 4GJ2A 4BCPA 1Q61A 5JGDA 1RW8A 4RC2A 3Q4TA 4NK9A 3F82A 3P1AA 5BVEA 5CEIA 4BIBA 2WB8A 1V0OA 3E93A 1NVSA 5HVYA 4IE9A 1PHKA 1W0XC 2UVXA 3DJ7A 1TQMA 3DV3A 3PSCA 1VEBA 4FIJA 1Q41A 2XNPA 2YISA 3GU5A 5I4NA 4QMUA 1H08A 3EFKA 3CTJA 3EQFA 4F9AA 5AAEA 2XH5A 3BLQA 4WG5A 3TACA 5IH4A 1B38A 2VO6A 4TT7A 3F3WA 4LL0A 5FBOA 1TQPA 1URCA 2WTJA 4EL9A 3EL8A 3EKNA 1JPAA 4I94A 2RSVA 2W06A 3MTLA 3IKAA 4FICA 2XK8A 3VUDA 3F88A 1K2PA 4O4CA 5EYMA 2R64A 4O4FA 3PPKA 1GJOA 2X9FA 3KXMA 1A06A 4A9SA 5K5NA 2CJMA 4FNXA 2WNTA 4AZWA 3RK9A 3WILA 4AFEA 2PHKA 5HO7A 4OTGA 2W0JA 2WMQA 3MWUA 3KEXA 2WHBA 5AX3A 4WNMA 2BHHA 2J51A 4FK3A 5LMBA 4I6FA 1QMZA 1ZARA 5IA4A 5TO8A 1H01A 2X0GA 5HIBA 1DAWA 3LFNA 3QX4A 4WHZA 4PPBA 2O8YA 1YOJA 3OT8A 2E9NA 3QRJA 1H8FA 3D7TA 4ZS0A 2BRBA 5J95A 2Z60A 2IZTA 3NPCA 4RBLA 4KS7A 5GJDA 4YJUA 4CZTA 3NNUA 4C4FA 5JN2A 2JDTA 2ZB1A 2DUVA 3FLWA 4PX6A 5CYIA 4LRKA 3M42A 3QLGA 4U3YA 5AP3A 4D28A 3FJQE 3LM0A 5I9WA 1Q24A 4F63A 5DIAA 1PMNA 1OUKA 5CVGA 1FOTA 1Y91A 1XO2B 2IVTA 2NRYA 4YBJA 2RG6A 2YFXA 3WF7A 4TN6A 4EQMA 5IEXA 3EN6A 3AD4A 3BYOA 1YWNA 5F20A 5CSWA 2UZDA 4FI1A 3QWJA 2VTNA 5J8IA 1WFCA 4OBPA 2ITZA 3UG2A 1MRYA 3PJCA 1MP8A 3UQFA 4OAUC 2HWOA 1FVTA 2EUFB 4BCKA 3LOKA 4NCTC 4XNEA 3HVCA 4JR3A 3OTVA 5KKRB 1SNUA 3K54A 1ZLTA 2G2FA 3MH1A 2G2HA 4F99A 4JG6A 4S32A 4I41A 4DHFA 5B2LA 4IAKA 4EOLA 3KN5A 5EW8A 4FKJA 4FT9A 4BYJA 3QBNA 4FV9A 2OJGA 2NRUA 5C8MA 3QYZA 1U46A 1O6YA 3TL8A 5AUWA 4JVGA 2VU3A 4RVTA 5LVPA 3NW5A 3R8ZA 1A9UA 3O8UA 5DI1A 3CGOA 3FPQA 3ZONA 4BDIA 2Y0AA 2JAVA 1OL2A 5CI7A 4F7LA 3HMPA 4FIGA 4IJPA 5HORA 2J0KA 1K9AA 2C1AA 4U81A 3HRCA 2W05A 4LYNA 4X21A 5BVNA 5GZAA 4X3JA 2VTPA 4I4FA 5L2TA 2C5OA 4LOOA 4MF0A 2HZ4A 4E5BA 2WTIA 2WU6A 3P7AA 4MXCA 5CAQA 2G01A 4L43A 4NKAA 3MVLA 2UW0A 4OLIA 4ITJA 4FG7A 1OIQA 4NTSA 1G3NA 4TZRA 3R30A 1PF8A 4XP3A 4XV2A 5D41A 4ZSLA 4XLVA 4O4EA 4ZSGA 2QQ7A 5IUGA 3FDNA 2KTYA 4FTMA 1OKVA 3GCPA 4PL4A 5DPVA 1B6CB 1H1QA 2FSLX 3GC0A 4WBOA 3ZO1A 3IGGA 1O6KA 3B8QA 4X2KA 5AEPA 3LCTA 2ZDUA 5EM8A 4DGOA 2ZYBA 3F3ZA 4PF4A 4CT1A 1PY5A 4OTIA 3DTWA 4EH7A 4FG9A 2BFXA 2Z7RA 2BUJA 4R5SA 5CVFA 4FT0A 5A6NA 3GQLA 5K0XA 4YZDA 3BQRA 1FVVA 3OUKA 4IMYA 4S33A 4JBOA 5CTPA 2Q0NA 2R0UA 4MBLA 4AU8A 4F6SA 5JEBA 2WPAA 4GEOA 3Q4UA 2JD5A 3SC1A 3DTCA 4FZ7A 4HVIA 5HX6A 5JGAA 4ZZNA 4OR5A 5EH0A 4AFJA 1OIYA 5K4JA 1WBVA 5FEQA 2ZMCA 3PXZA