2J7TA

Crystal structure of human serine threonine kinase-10 bound to su11274
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
293
structure length
285
Chain Sequence
HVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Activation Segment Dimerization: A Mechanism for Kinase Autophosphorylation of Non-Consensus Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2j7tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2j7tA01
1WBVA 1WFCA 4N57A 2J4ZA 5CF6A 3WARA 4TXCA 2F7ZE 5CU3A 2O63A 4EH8A 2BZJA 1CKPA 3KXGA 5CALA 3LM5A 4MK0A 4I41A 5DT4A 1P14A 4EH4A 4FGRA 4RVKA 4CTBA 3PY3A 2A0CX 2X6EA 5TOZA 3ZDIA 2ITXA 1GIHA 2YERA 4W4WA 5HGIA 3OCGA 1R3CA 2OH4A 5C01A 4ACCA 1PJKA 3R71A 4P4CA 3HKOA 3D94A 3QWJA 3Q9WA 3UJGA 3WIKA 2QURA 3HMIA 4NW5A 4K18A 2XH5A 3F2AA 4NZWB 3UQGA 3L8VA 2ETKA 4I20A 5KCVA 1GZ8A 3FSKA 4LI5A 4C4FA 3F5XA 4QMWA 3NZ0A 2GPHA 4N0SA 3H10A 3DXNA 4D55A 4R7IA 4EC9A 3CKXA 3EQFA 4MKCA 1ZZLA 3R1NA 4FKLA 4IAFA 4O6LA 4ANMA 5L6OA 4PMTA 1CKJA 5LQFA 5A54A 5AV0A 1Y6AA 4Z7HA 5LXMA 2WZJA 2V0DA 4JVGA 4LMUA 1TVOA 3LLTA 3GU4A 4FTRA 3BX5A 4FIHA 3UOKA 3ITZA 2OJJA 5M53A 3E8EA 3WZDA 3C51A 5F1ZA 4UMQA 5L2SA 2BR1A 3W10A 4AT3A 2XKEA 2R3KA 1PMNA 2FO0A 2X0GA 4W4XA 2V62A 4AU8A 2ITZA 3D0EA 3WF6A 4CZTA 4IX4A 3OXZA 2JC6A 3P4KA 4PPCA 3OROA 2PZRA 2IZUA 3CQUA 3PJ1A 4R5YA 3GCSA 2X9FA 5E1EA 3UMXA 5LWMA 4Q2AA 3U6JA 3NSZA 4ZTLA 1WBTA 3JPVA 3TUCA 4DLIA 2F9GA 4KBAA 1OPLA 3GOKA 3VW8A 1DAYA 2QO9A 4H05A 4TZRA 3OBGA 3C13A 3AC8A 4FEVA 2OXDA 4DF3A 4CZYB 5FM2A 3EQBA 4YO4A 2QU6A 2VTLA 3R04A 2KULA 3MH0A 3HP5A 3MY1A 3GC8A 4YJPA 4I24A 4MCVA 2IWIA 3SXRA 4KKEA 3FPMA 3VBQA 3HMOA 3ELJA 4C3RA 1MRYA 3G0EA 4USDA 3WOWA 2E2BA 5HG9A 5LWNA 4XOYA 5D1JA 5JN2A 4F6UA 4GKIA 4JAIA 3OG7A 4EHZA 3FXWA 3A2CA 4NM3A 3UC4A 3NVKI 2UZDA 5AP3A 2B53A 3ZC6A 4NJDA 4O38A 5HE3A 3KEXA 4RC3A 4Z7GA 1L8TA 4FZ6A 2GMXA 4U6RA 4G16A 3V01A 4F7SA 3WE8A 4QMYA 4M12A 1U5RA 3V5WA 2WOUA 2VO7A 2ITNA 3DOGA 3SG9A 2HZIA 4O91A 1H25A 4IZAA 4BDHA 2HCKA 1XWSA 3CC6A 4CNHA 4KS7A 2W1EA 5EFQA 2UW3A 5M4CA 2HY0A 4MBJA 4JIAA 4OUCA 4ZY5A 3I81A 3MSSA 2HW6A 3TJDA 1H1SA 3QUPA 5KKRC 1IAHA 3DY7A 4FSMA 2PU8A 3RBWA 1UWJA 1TQMA 5HO7A 4C34A 4I6BA 3BBWA 2ZB1A 3TCPA 2GNGA 3QA8A 2WIPA 3OW4A 4FNYA 4JL9A 2HZ0A 1P4FA 4K1BA 2GSFA 2X7OA 5GJGA 4F99A 2J2IB 3P86A 4RRVA 5CZIA 1DI9A 2VWXA 3R00A 4JDJA 2I6LA 2R3PA 2C3IB 4FZAB 3U4UA 4PL3A 2J5FA 5ETIA 3QD4A 1FPUA 3LFBA 1H28A 4XP2A 2IO6A 3VS2A 4W9WA 4PRJA 3E8NA 3TV4A 3LXPA 2VU3A 1P4OA 2VX1A 4A9YA 3R0TA 4C4HA 4FKRA 2VX3A 3NCZA 3PXQA 5LVMA 3K2LA 5EYDA 2EVAA 3ZLSA 3CGOA 3G33A 4C59A 5KUPA 1OBDA 4S34A 4BF2A 4FKUA 2WMXA 4DFZE 4JT3A 4RC2A 2XA4A 1G3NA 4EH9A 3BELA 3ATTA 4O22A 3RCJA 4ZP5A 4ZLZA 5J1WA 4F7JA 5AAFA 4BICA 1QL6A 1FGKA 3LFFA 4NTTA 4EK5A 1ND4A 3MFTA 4D0WA 1YXVA 3JVSA 4JBPA 4RWLA 2UZBA 3HV3A 4TYHB 2W1ZA 3ACJA 1UWHA 4UB7A 4YZ9A 4PDSA 5BVOA 1BMKA 2IVTA 3BCEA 3F9NA 4BCPA 1IA8A 1Q8TA 1R39A 4PPBA 5F20A 4BZOA 3PP1A 1ZXEA 3SOCA 5HZNA 5TR6A 5AR8A 2W0JA 1GJOA 4MXXA 1NW1A 1DAWA 1VZOA 5DRBA 2VTAA 2WMBA 3LJ1A 4FTQA 5DLSA 4E93A 4DT8A 1OPJA 4JI9A 2VWUA 2OO8X 1H8FA 3DQWA 2ZJWA 3DAKA 4NH1A 5AV4A 3VS6A 5IA3A 1M7QA 5HX8A 3LFAA 3QXPA 2XUUA 5GNKA 3UO6A 3ZM4A 5M09A 1YI3A 2JDOA 4FSYA 5EYCA 2REIA 5FD2A 5G1XA 3TV6A 3I1AA 5IH4A 3U54A 3MB7A 3P78A 3ROYA 5CT7A 5DEYA 4G34A 3CSVA 5L6PA 2CLQA 1UNLA 2UV2A 3MI9A 4R77A 3EN4A 3PVBA 3DKOA 2R2PA 4FTKA 4ZEGA 3AT4A 3FL5A 3TNWA 1M17A 4IAYA 3KREA 4G3EA 4P2KA 5K5XA 5IQBA 4TYEA 3ZRMA 4GK4A 3RAKA 3D7TA 4FOBA 3O71A 3P23A 2IPXA 4DFLA 5H8GA 4AZFA 2FGIA 4GS6A 4XV2A 1R0PA 3BLQA 2YLEA 4BDBA 2WIHA 5LMBA 2I1MA 5E8SA 1A48A 2WQEA 3H0YA 5DIAA 5IUGA 2W9FB 3W2PA 3P0MA 3LFEA 4OLIA 4WG5A 2NPQA 3CD8A 5HHWA 5CWZA 4BWPA 3EN5A 2I0YA 3I5ZA 3LQ8A 3AOXA 5CENA 2WAJA 3RK9A 3TNPC 3OCBA 5H2UA 2YIQA 3QHRA 1IAJA 1B38A 2OK1A 3R01A 4BKYA 4RMZA 5J5SA 2YN8A 4QD6A 3O50A 2BAJA 3F69A 2VTOA 2R3QA 3VBTA 2JAVA 3QUEA 1M14A 5HBHA 5AEPA 3AMAA 2WEIA 5HLWA 3QKMA 4OBQA 5IA4A 1IASA 3REPA 2YEXA 4EHVA 2VWYA 4FVRA 3V3VA 5AP0A 3P7AA 2C0IA 3S4QA 4X3FB 3LCKA 5ANGA 3UQCA 4FG8A 4ZIMA 1FVVA 2JFLA 4QP6A 3T3UA 1FGIA 4NUSA 4K0YA 4BCGA 2VWZA 3RGFA 4FYOA 1FVTA 1MQ4A 1YHVA 1OKYA 4KRDA 2C6EA 2ZOQA 3G9LX 2PHKA 5AP5A 3RMFA 4GSBA 4C4JA 2W99B 3ZDUA 5BYLA 3P7BA 4AW1A 3MIYA 2P2HA 3KVWA 4MYGA 3FMEA 2X39A 2RGPA 3DNEA 5IUIA 2XVDA 1Q61A 2ITVA 2YDKA 4ACGA 2XF0A 4MD7E 4ZSJA 1OMWA 4QTEA 2C6MA 3NEWA 4KBCA 2YM5A 4BC6A 2G15A 4BCNA 4YUQA 5LCJA 1UA2A 2YFXA 2GU8A 2XJ0A 4M67A 4AT5A 5E8VA 3ZFYA 1Q8ZA 4IAZA 5FXQA 1BL6A 4D1ZA 5ANJA 3ZRLA 5JGDA 4BDAA 3MW1A 5IQIA 2HOGA 5FQDC 1K3AA 5JQ8A 3KXHA 5IEXA 3GFWA 5AWMA 4CGAA 2QOIA 3KRRA 3PG1A 3DAEA 2BRBA 3KL8A 4F9YA 4X2NA 4WRSA 2QOKA 5HKMA 4ANOA 3GP0A 2BVAA 2ITWA 5LMKA 4V05A 5F94A 3K54A 3ZBXA 3UPXA 5EQPA 1QPEA 3FMMA 2BUJA 3I0OA 1IEPA 4DBNA 1NA7A 3K5VA 2QOQA 3QTXA 4A4LA 2UZVA 5IMEA 2G1TA 5JKGA 5EOBA 3L9NA 5I5ZA 5B0XA 1REKA 3BYVA 2PULA 4Q5EA 3NYVA 5TT7A 3EQGA 1YI6A 4H39A 3P1AA 4J98A 4E5AX 2UW7A 3SXSA 4L3PA 5EG3A 2W05A 4RIYB 3RALA 3R7YA 2PWLA 3OT3A 3O51A 3VF9A 4LOPA 2FSMX 2PZPA 4XX9A 1JSTA 3HUCA 4MNEB 4RJ3A 3Q53A 3ZC5A 2W96B 3E63A 1JKKA 2YDJA 3R30A 2XNEA 4RX5A 3FEGA 2KTYA 4UXLA 5I9ZA 4FKQA 1H26A 5C8KA 2OF2A 4YLLA 3BHTA 4FV2A 4BVUA 2EB2A 4DHFA 2FVDA 5IA1A 1PXOA 1W0XC 3NLBA 2DYLA 3H4JA 3KULA 5C8MA 3ZONA 4Y46A 5C4LA 2VTIA 5ETAA 4N6YA 2XYUA 3QCSA 2VZ6A 3FZPA 4OTPA 3EN9A 3TKUA 3WE4A 4DG0E 3AC4A 2HWPA 5BX0A 4D2TA 3MY5A 5FUTA 3ORXA 2GNHA 3HMNA 4YR8A 4JOAA 5KMJA 1NY3A 4JRVA 2CKEA 2OF4A 4BDFA 4CRLA 2J9MA 4QNYA 3ZUUA 2Y8OA 2GQSA 4IBMA 4C8BA 5JT2A 1X8BA 3FYKX 5KZ0A 4YPSA 4FV1A 3ZFMA 5E8YA 4DEIA 1PXMA 4D28A 4RZWA 5GJFA 2HAKA 4YTIA 5B2LA 4IADA 3FKOA 1QPCA 2IZRA 3G15A 4YGAA 4F7NA 3LOKA 5HD4A 4EH3A 5E92A 3W8LA 4LM5A 2IZTA 2WEVA 4KAOA 3UO4A 3K3IA 1URWA 2ZV2A 4BCOA 5FDPA 1YXXA 3DXQA 4XLIA 2ZDTA 4GIIA 5GJDA 3HYHA 4GK2A 5EHOA 4ASXA 2H9VA 3BU3A 4PDYA 3FPQA 4M3QA 5A4QA 4G2FA 4FTLA 3CPCA 1H08A 5E8WA 5M56A 2B0QA 4C61A 3NNXA 4V01A 4DFNA 3R7UA 3IKAA 4C02A 2VX0A 2Y0AA 2DWBA 2C5VA 5AAEA 2RFSA 3EQIA 4PP7A 1DM2A 1H0WA 4EOIA 3DK3A 4FUYA 4YJOA 5EM7A 5HIDA 4CFUA 5CXZA 3QLFA 4YURA 5AA8A 4ASDA 5HTBA 2R4BA 3FUPA 3KF4A 4FV5A 3ZEPA 5BYZA 2WQMA 5HBEA 4FL3A 2JDTA 2GTNA 5BNJA 3BGQA 1VR2A 4C4EA 4OAVB 3VQUA 5EHLA 3OF0A 4I5MA 4JRNA 3ZZEA 2CGWA 2BAQA 4FTTA 1FOTA 3BPRA 3C5UA 4O0TA 3QD0A 2XKCA 4I94A 2Z60A 5EHYA 3TIZA 3ORMA 4EZ3A 1LPUA 1JVPP 1CSNA 5I3OA 3SV0A 1LP4A 4ZZOA 3C5IA 3OEZA 2ZM3A 3IDPA 3POZA 5JRQA 5AV1A 3HL7A 1GZNA 3WF5A 4E73A 4BRXA 3HRFA 4BDJA 4GU9A 4CYIA 3HAMA 4QQTA 3SOAA 3FI8A 4TYHA 1Z9XA 2C5YA 1JNKA 2OZAB 3GCPA 3SKCA 1UU7A 4L00A 3Q9ZA 3ZFXA 4BBMA 4ASZA 2XM9A 1GZOA 3D4QA 3QRKA 5ANEA 5FBOA 3IPHA 4E3CA 1OBGA 5E9EA 3ZTXA 4YNOA 4EOJA 4L6QA 2VN9A 3PTGA 4RPVA 5BVWA 1FMOE 4H3PA 4XG3A 4YPDA 4RFZA 5BVEA 5CSPA 2RFEA 2XK3A 4QMNA 3R6XA 4CV8A 4MWIA 3WIGA 5LVPA 3HV4A 5K0KA 4GMYA 3GCVA 5BUIA 1KE7A 5KKRB 2WTKB 2Q83A 3MH3A 4U45A 4FEXA 4O7TA 5M57A 5ANDA 4I5PA 3G2FA 5HCXA 4QT1A 3RPOA 1PF8A 2YM8A 4AE6A 2GNJA 3KCFA 3S00A 3ODZX 1ZMWA 1LUFA 3T9IA 2EUFB 3WF9A 4BKJA 3MV5A 3EQPA 4BGQA 4ZSLA 3ZYAA 4IX6A 3O8PA 5DRDA 4EC8A 2HYYA 3F66A 4G3FA 2J7TA 3AMYA 5IEVA 4DINA 4M0YA 3EWHA 5CEKA 1W8CA 3NUYA 2CNVA 1OUKA 2JAMA 4GT3A 4BYIA 4U44A 4BTFA 4EH6A 1H1QA 5FEDA 4QP4A 4DH8A 1SMHA 5ETCA 4EOMA 2W1DA 4FICA 4LGDA 1XH5A 3N9XA 3QBNA 1RE8A 2O64A 3EZRA 3QQGA 4E6AA 3F3VA 3QD2B 1ZWSA 3UQFA 3MPTA 2A4LA 1WVXA 3PY1A 4J8MA 4U5JA 5FLFA 4FEWA 1Y8GA 5M55A 1XJDA 3OWJA 3R7EA 1GAGA 3KB7A 4IB0A 4FIGA 2PVFA 3KY2A 4O6EA 3U8WA 3UODA 5HQ0A 4WD5A 4ZTSA 4A7CA 4CXAA 2GQRA 2V7AA 2VO0A 3OOGA 1WBWA 2X8EA 4B8MA 4NM7A 5AV2A 5JSMA 3JUHA 3ZO2A 4F9AA 3HEGA 2BPMA 2F7XE 3MDYA 4ZSEA 2C6OA 4KINA 2QO2A 2C5XA 5TKDA 3GC0A 3TN8A 3KA0A 4HGLA 3UOLA 5AV3A 3PPZA 5JQ5A 1E1VA 3LMIA 3MYGA 4KWPA 4PNKA 4KIQA 3RZFA 3A7JA 3RINA 4AGWA 3CCNA 4EH5A 4Y8DA 4PTCA 3KFAA 2F49A 4BGHA 4FG9A 4FIIA 2C0OA 4FBXA 2OFVA 3A4PA 5CAUA 3RKBA 2B54A 2OIQA 3BEAA 3MB6A 1PXIA 1Q3DA 5L8KA 1ZYJA 3EKKA 3NUXA 4IX5A 2X2LA 5CF8A 4UZDA 4XG9A 2QG5A 2O0UA 4U9AA 2PVNA 4DG2E 4R8QA 3QCQA 4O1PA 3CBLA 3UOJA 5DE2A 4R1VA 5AP4A 4QPSA 4GJ2A 2EXMA 2Y6MA 1UV5A 4G1WA 1GOLA 2JKKA 5A4TA 4L7SA 4YJTA 4Y5HA 4M69A 3SQQA 3V5JA 1IG1A 1XBBA 3OXIA 1BYGA 3PJ3A 2GNFA 4G9CA 4ERKA 3C4FA 2UZWE 2C68A 4D9UA 4FTUA 4P90A 3MA3A 4DEEA 1Q41A 4RSSA 1EH4A 2UW6A 4ZLYA 4HOKA 5LCKA 2BHHA 5IA2A 4JQ8A 5KBRA 3IW6A 3LQ3A 2W1IA 1S9IA 2WMSA 4HYUA 2YIYA 2J5EA 5J9LA 1TQPA 3MJ1A 5IQGA 1HOWA 3TKIA 2R3RA 4HZRA 3IG7A 4RWKA 4C62A 2E9VA 2QNJA 3IGGA 3QCYA 5CVGA 5JEBA 3UG2A 2BCJA 3AQVA 3Q04A 1G5SA 5IG1A 4BTKA 1RQQA 3DA6A 5IF1A 4G3DA 2VD5A 3P9JA 4RIYA 5IQCA 3OD6X 1Q99A 2E9PA 2FSTX 5HTCA 3D7TB 4I92A 2BIKB 2QLQA 3ORNA 4MNEA 3KRWA 3FMDA 4F1TA 2PK9A 1BX6A 4F1MA 3BEGA 3HLLA 2VNWA 4O0XA 2R0UA 3QYWA 4ITHA 5I9YA 4NFNA 3NPCA 2YA9A 3ACKA 3I6UA 3QTZA 4QTDA 3D2KA 4WNPA 2OBJA 1YXUA 4UYAA 3KXMA 3S1HA 3Q4CA 4O7VA 3DTCA 1S9JA 1Q4LA 2C1BA 3QKKA 4R1YA 4AGDA 3QTSA 5D9HA 3DKCA 4YZMA 3P08A 4Z55A 3D5VA 3NYOA 4DFUA 4JG8A 5AUWA 2EU9A 4GFGA 3O7LB 2QOOA 3PJ2A 3KXXA 4JG6A 4BYJA 3GUBA 1O9UA 3FHIA 2V5QA 4TYJA 3ENMA 5DPVA 2XMYA 5CSVA 4C2WA 4YMJA 2PVHA 1AQ1A 3QF9A 3BWFA 2HW7A 2WU7A 3FZOA 3E8DA 3C4CA 3ODYX 4QPAA 3CIKA 4GVJA 4QYGA 4M13A 1Q24A 3VS0A 2OICA 3AGMA 5JK3A 4CRSA 2ZM1A 3AGLA 4XJ0A 3ZOSA 3R83A 4YSJA 3W32A 3MTFA 2FUMA 4FIFA 5JFXA 3R1YA 5DG5A 4CCUA 5L2TA 3QTUA 3WZEA 3W16A 4FMQA 4QMXA 2G2HA 2P3GX 4I6QA 4RX9A 2BRGA 1O6LA 1JBPE 3QD3A 4WUNA 2R7IA 3Q96A 1PKDA 1PXLA 4FSZA 5CEPA 1APME 2QU5A 4M15A 2WD1A 4WO5A 2PZ5A 2ERZE 3IW5A 1FQ1B 2VWIA 3NIEA 4E4MA 2VV9A 2YZAA 3TUDA 3AD5A 4QMLA 4E6QA 3C4EA 4H3QA 4DC2A 1BI7A 5ANKA 2BZHB 4HCTA 5IA5A 4FA2A 4RJ4A 4AW2A 3TZ7A 4F9WA 5HG8A 4ZSAA 4BGGA 2GS2A 3SVVA 5DT3A 2C6KA 4E6CA 3U6HA 5AR3A 4ZJVA 4HGSA 4I1ZA 3NW7A 5EKNA 2PVRA 4Q9ZA 1ZOEA 4U42A 5DHJA 4AN2A 4FK3A 3R7IA 4YU2A 2ZMCA 5A9UA 4CTCA 2UZTA 3HX4A 4BTJA 4R7HA 4IC7A 3KRJA 3VUKA 3WZKA 3DK6A 2YCRA 1UKHA 4JBOA 3ZXTA 4OBPA 1JOWB 2FYSA 2BILB 4MVFA 5EW8A 3UVRA 3DAJA 3QL8A 4IMYA 4O7NA 5FBNC 2B9JA 1B39A 4RC4A 1YRPA 3FL4A 2WTJA 2P33A 2GHGA 4MXZA 1UU3A 3R7OA 3ZSIA 2GFSA 4KABA 1Q8YA 3ZEWA 1KSWA 5J8IA 2ACXA 3N4VA 1J91A 3L8PA 4B7TA 2OZAA 4O0RA 4QMMA 2IVSA 2OI4X 4G5PA 4M14A 4HPUE 4IWQA 4AFEA 5J7BA 4DFYA 5AMNA 3E88A 4HVDA 4ZS4A 3H9FA 5CEMA 1QCFA 3F3WA 3VRYA 5HNIX 4F63A 1ERKA 1XR1A 4XHKB 3QA0A 3UO5A 5FM3A 5K0XA 1BI8A 2YAKA 2W06A 3DBEA 3QQLA 4G6LA 4JR3A 5DR6A 3DKGA 2O3PA 3SLSA 4FGBA 4QMPA 4RIOA 2HIWA 3GFEA 1IR3A 4PMSA 5KHWA 3KULB 1F3MC 1NVRA 2WTCA 3EHAA 4AN9A 3AT2A 4EK3A 4Q5HA 2X2MA 4LFIA 5A6NA 1DI8A 5HCYA 3E64A 5HG7A 3BV2A 2PE1A 4BR3A 3GBZA 3I4BA 4RFMA 4O2ZA 2IG7A 4O7YA 3SG8A 4G3CA 1VYZA 4J97A 5CASA 5HCZA 3UDBA 4O7LA 4YC3A 1Y6BA 3I7CA 4FSUA 2NRYA 4QP8A 5TF9A 3Q6UA 3LFDA 4LGGA 1UVRA 3CJFA 2B52A 4QTBA 3Q60A 4R6VA 2PE2A 3RTPA 3TTIA 4KKGA 5DYJA 3FLZA 4FL2A 3PVUA 3KK8A 1KE6A 2W4JA 4UBAA 3PP0A 2PMLX 2I7QA 4NM0A 4S32A 2A27A 3BU6A 3C4ZA 1PXPA 1UU9A 1WAKA 2WMWA 4AA0A 3N4TA 3IW7A 5CLPA 1YHSA 2LGCA 2WTKC 4DEDA 5H9BA 4YTHA 3BWJA 3OWKA 4EHEA 1XQZA 4I4FA 5HE2A 3RVGA 3LPBA 4UWBA 3ALNA 4YO6A 4FV7A 5EM6A 4CFVA 2C6DA 3OC1A 3C7QA 3S95A 1WMKA 4ZAUA 2QR8A 2W4KA 4A9RA 4RZVA 2XZSA 1XH4A 1SZMA 3NUUA 4FTNA 3HZTA 4BCMA 1G8SA 5IEYA 3MFUA 3LCSA 5E4HA 4DN5A 3SW4A 3COMA 4FKWA 4RIWB 5AUUA 5CU2A 3G9NA 4G6OA 5FG8A 3MFSA 4LL0A 4U3ZA 4KSPA 1JKLA 2UZEA 2OW3A 4Y72A 2BHEA 4D0XA 3A7HA 3PE2A 3CQWA 4S30A 3BZ3A 4FTOA 3AXWA 2EB3A 4E8AA 4IWDA 4J53A 5AFVA 4CMUA 3GOPA 3WF7A 4Y73A 5GZ9A 3R9OA 5K9IA 5AADA 4YHJA 3NUAA 4IAAA 3LZBA 1H1WA 3MVLA 3EYHA 4YJVA 2XYNA 3BHHA 4K8AA 1W84A 3TJCA 3R2YA 2RIOA 4C4IA 2OXXA 4OTGA 3OXTA 4U97A 3R9HA 3WZUA 2OG8A 2JDRA 5HLPA 5F9EA 4RG0A 4BZDA 4DLJA 1WBNA 3ANQA 3DT1A 1RDQE 4C7TA 4YTCA 2PPQA 3TM0A 4X2JA 4B99A 4E5WA 3HMMA 3Q4TA 4AZEA 4TY1A 4QMVA 5AUXA 2QOHA 5CI7A 4TWPA 4DITA 3MS9A 3W2OA 2HZ4A 3V04A 2EXCX 1KV2A 3LCOA 2CNQA 2JKOA 4WG4A 4F7LA 4APCA 2NP8A 5TE0A 4I0SA 4I3ZA 3BU5A 2XIKA 4ZK5A 4EYJA 2BKKA 3TWJA 3GC7A 4O1OA 1ZOGA 2JIUA 3LXNA 4GK3A 3F88A 2IN6A 2LAVA 3MPMA 3KF7A 4BB4A 3A8WA 3R2BA 2GCDA 5CYIA 5DGZA 1KOAA 3EFLA 1LEZA 2UUEA 3Q52A 4CQEA 4ZY4A 4QTCA 3LFNA 5CQUA 3UBDA 5CVHA 5FWKK 4W8EA 2AC5A 3R7GA 2XNPA 3HA8A 3RHKA 4DH7A 3CGFA 4DH3A 4E20A 4IVCA 2W7XA 2BAKA 4O0WA 5CU6A 1UU8A 3IW8A 1XHAA 4N70A 4DEBA 4MHAA 1PMUA 3MWUA 4H36A 4YJQA 3UNJA 4IVBA 3F2RA 5I9UA 3TZ9A 4FR4A 4ALUA 5BVDA 2J50A 5JH6A 3E93A 3IOPA 3QHWA 4JXFA 1JWHA 3PE1A 5EW3A 2V55A 3NIZA 4AZTA 3GC9A 5BQ0A 5IZFA 4ACHA 2VWBA 4IAIA 4LRJA 4EJNA 4CKJA 4GVAA 4KA3A 1T45A 2BKZA 2WQNA 3PFQA 4G3GA 4L68A 2E9OA 3U9CA 2WNTA 4CD0A 1JPAA 2Q0NA 4CQGA 5HE0A 3OW3A 2PUPA 3PA3A 3EB0A 4B8LA 3RAHA 1KOBA 2YISA 4HPTE 2RG6A 4PWNA 2BIYA 3PXYA 1AGWA 4QP7A 4F0FA 2XNBA 2JDSA 3AC2A 3UIXA 4BWXA 4EBWA 4A06A 4EK8A 3NUPA 3AC1A 2XK9A 5HLNA 1PHKA 4HW7A 5JFSA 2O8YA 5GZ8A 1MRVA 3IOKA 2XIYA 4BDGA 1JSUA 4HVSA 3KN6A 5JRSA 4BDEA 3OUNB 3RAWA 1PXKA 2GHLA 2EXEA 3FYJX 3E7VA 3FXZA 3JXWA 3NWWA 3F3TA 4UY9A 4Y5QA 4H1JA 2QOLA 4E26A 4AS0A 5M07A 5BPYA 1OPKA 4ITIA 3OHTA 2C0TA 2DS1A 4FK6A 4J1RA 4K77A 2WTVA 4MWHA 4GCJA 4WHZA 2E9NA 2XK4A 3GU6A 3RK5A 1GIJA 2HENA 4UV0A 4ENXA 5ACKA 3P5KA 1NVSA 2UW0A 4AP7A 4MNFA 4FV6A 4D2RA 3BYUA 3LFSA 3NDMA 1OZ1A 1ZYSA 3HV5A 1PMVA 3FKNA 3MFRA 3FY0A 4YP8A 3ZHPC 4BTMA 2CKPA 2R3LA 3R8UA 1JQHA 1OL2A 4KIOA 4WRGA 3CY2A 4S31A 4N6ZA 2XK8A 4HYSA 4HNIA 4M69B 5JZNA 4EQUA 4YC8A 4MAOA 3RWQA 3A60A 1YWRA 3KXZA 4A4XA 3VUDA 5BUEA 3B2WA 4KSQA 1OKVA 3W2QA 3UMWA 2VTPA 3PXKA 5L8LA 5FGKA 4ZMEA 3R1QA 4I4EA 4EJ7A 2OZOA 2WU6A 3E5AA 4G17A 3K5UA 4FZDB 4C57A 1J7UA 2CGXA 3OP5A 4XRLA 4PY1A 3LLAA 5M4UA 3DDQA 2BALA 2WPAA 4EYMA 2PTKA 4IB5A 4BL1A 5J9YA 1H00A 4JR7A 2R3IA 2GS6A 2BDJA 3JYAA 1OL7A 4JBQA 4ZJIA 5C27A 5ACBC 2HXQA 4LG4A 3CXWA 3FI4A 4UYNA 4D1XA 3RCDA 4BCJA 3S2PA 4UEUA 4BN1A 4DGLC 4II5A 3CR0A 2YM6A 1OL6A 3TDVA 3UVQA 4F09A 2RKUA 3PLSA 2JDVA 3GT8A 2WQBA 4RX7A 3BHUA 4F0IA 3LIJA 4FUXA 2QOCA 3TV7A 2YWPA 3ZM9A 1DS5A 4DG3E 4OGRA 5M06A 4L9IA 3SGCA 1E9HA 4W4VA 5KMOA 4BCIA 2Y4IC 3TNQB 2RF9A 4CT1A 1Q3WA 3CE3A 5LJJA 4ACDA 2QHNA 4KRCA 3HV7A 4ZXTA 3IONA 1XH6A 3HNGA 5EM5A 1H0VA 2P4IA 3V8WA 3U6IA 4FKPA 4QYEA 5KHXA 2ZMDA 2A1AB 3EJ1A 1LEWA 4RJ5A 2ZB0A 1VJYA 3ERKA 4TYGA 1V1KA 4NEUA 4A4OA 5AUZA 5ANOA 2XIXA 4EZ5A 3KKVA 4BHNA 4K11A 4U43A 3R8MA 3SAYA 3GB2A 2WTIA 2X7FA 2W1CA 1PXNA 3SA0A 5LARA 5BMSA 1Q8WA 4DTAA 3DJ7A 4FSQA 3VW6A 3PY0A 3C1XA 1YQJA 5IMXA 1SM2A 4AOIA 4XP0A 4IIRA 5IKWA 3ZRKA 3WBLA 3W1FA 2W4OA 2PMOX 3OWLA 3PG3A 4USEA 3O96A 5KBQA 1OECA 3LMGA 4FNXA 3ORZA 4C0TA 2R3JA 3RP9A 4DGGA 1J7IA 1Y8YA 4D4RA 2I0EA 1M52A 4HGTA 3BRBA 1M7NA 1XO2B 3EL8A 4I93A 4RQKA 5HICA 2G2IA 3QTQA 3RI1A 4O7RA 2R3OA 2PE0A 4MF0A 3RM7A 1FINA 2PUUA 4MD9E 3TTJA 4U80A 5LMAA 3QLGA 1IRKA 2R9SA 4R3CA 4D4VA 2C6TA 5HU9A 3OEFX 3G0FA 5HNGA 3UNZA 3RM6A 4NCTA 3QC9A 3I6WA 1B6CB 2UW8A 4RIWA 3E92A 4DEAA 2YM4A 3R9DA 3ZUTA 4L8MA 3EQHA 3O23A 4JS8A 4O7WA 4HGEA 3JVRA 3Q3BA 4BCFA 2C5OA 4AACA 4BCQA 4DFXE 4GUBA 2FSOX 3A61A 4I0TA 1CDKA 3FY2A 1YDRE 3NR9A 4FNZA 2X7GA 2G01A 1P2AA 3CTQA 1GNGA 5JFWA 2H8HA 2X9EA 3AT3A 4WNMA 3VF8A 3PIYA 3RK7A 4MXCA 5CVFA 3UIMA 3PA5A 2YCFA 4YJUA 4AUAA 4NM5A 4UMUA 3HVCA 3GVUA 5BUJA 2IVUA 4BHZA 3EFKA 4NCTC 4QMQA 3GI3A 3SHEA 3P7CA 4U79A 1Q8UA 4CKRA 2XIRA 1I44A 2NRUA 3AC3A 4FTMA 4QPMA 5IDPA 2NNWB 3FSFA 4EOKA 2XIZA 5CAOA 3HRBA 2GTMA 4G5JA 1U4DA 4DYMA 3UTOA 5DWRA 2ITTA 2V7OA 3LE6A 1O6KA 5EYKA 3F82A 5B2KA 2XB7A 2QR7A 2AYPA 5FXRA 2VNYA 2ZV8A 4NK9A 4FKTA 4EOLA 3DZOA 5T68A 5KMLA 2Q0BA 4XBRA 2OU7A 3KU2A 3ID6C 3ATSA 5K3YA 4QYHA 3GNIB 3MH1A 4QO9A 3W2SA 3R9RA 2YHVA 4CFXA 3BHVA 4QMSA 4DH1A 2UZLA 3NVMB 3MIAA 4JDHA 5C9CA 3RJCA 3SD0A 3FZ1A 5D10A 3C4XA 5IA0A 4IM2A 4WA9A 4AXAA 5IISA 3LM0A 3DNDA 4ALVA 2B9HA 4WT6A 2J0IA 2C4GA 3H9OA 2HY81 5HIEA 4O0YA 3R7VA 2GS7A 2IW6A 2P55A 3H0ZA 4LRMA 3VNTA 4DTKA 5C4KA 1KWPA 2WELA 4AA5A 4MD8E 3B2TA 2YJSA 3GU8A 3Q6WA 3UVPA 3JY0A 3VUMA 2OFUA 3GGFA 4RVMA 1WBSA 4J96A 1AD5A 1ZOHA 3BI6A 3QRJA 4FTCA 2P0CA 2W17A 4L42A 4RJ7A 4UWCA 4YSMA 4B4LA 5I3RA 4FKOA 4L67A 3QCXA 4MH7A 1H01A 3BYOA 5EOLA 3FZSA 1PY5A 4MEDA 2VTTA 3ORLA 3CS9A 4IX3A 1Q97A 5KE0A 1M2PA 4DCAA 3VHEA 3ZMMA 2X2KA 4F70A 5E7RA 2WO6A 1V0OA 3BHYA 5L6WL 4GRBA 1OITA 2YIXA 3PWDA 3GU5A 2QLUA 3ZLXA 3R9NA 4IAKA 3W2CA 4DTBA 5KNJA 4TN6A 4FF8A 4V04A 4ZTNA 3QALE 4EQCA 5EM8A 1OB3A 3QUDA 1U54B 4H58A 1KUTA 1U46A 3HRCA 3ZZWA 4TRLA 2WXVA 5E8TA 4EQMA 1PYXA 5HVYA 3MVJA 4OR5A 5CEIA 1VEBA 4HVHA 5IQFA 3O0GA 5I9XA 4FX3A 4ARKA 1JAMA 4IJPA 5CEOA 3MGYA 4FV4A 4JNWA 2IVVA 2YLFA 3EQDA 4XG7A 3NW6A 4EOPA 1U5QA 4KBKA 4ITJA 1R1WA 2A19B 1BKXA 4QQ5A 2B9FA 4IANA 4PNIA 4X2GA 5DR9A 5K5NA 2QD9A 3H3CA 4BCKA 4O84A 4KB8A 2BZIB 4M0ZA 1JSVA 4O7SA 2OJFE 4WSQA 5CI6A 4ANBA 2PVKA 4IC8A 3KQ7A 3MTLA 5I9WA 3KXNA 4RJ8A 1J3HA 2CHLA 1OIYA 2GHMA 3LJ0A 1Z5MA 4CLIA 2YIRA 4EL9A 1IA9A 2C6LA 4KKHA 2HWOA 5EKOA 4XOZA 4YLJA 5AIRA 4KIPA 1J1CA 4KIKA 3FBVA 5HESA 3W8QA 1A9UA 4FIJA 4FT5A 4USFA 2JEDA 2J0JA 4YHFA 5J1VA 1YXTA 3AG9A 4FSWA 1URCA 3BBTB 2VWWA 3R8ZA 4C3PA 3DQXA 4JDKA 2CCHA 3FLQA 4BDIA 1OIUA 1Z57A 3FMLA 3I5NA 3VVHA 1ATPE 4LYNA 3ORKA 2VGPA 4QOXA 4D9TA 3MBLA 4M68A 5TO8A 5DFPA 3TG1A 4UMPA 3OZ6A 4QTAA 4RWJA 2UZOA 3GENA 3VS3A 2BRNA 3UNKA 3F3UA 1FVRA 4ZZMA 2YZLA 3I60A 5ITAA 5KMMA 4FT7A 3PIXA 3DS6A 4MBIA 4UMTA 4XYFA 3W33A 4JG7A 4FSTA 2H6DA 2J6MA 3ZLWA 4C33A 5J79A 4YZNA 3VUHA 3TIYA 4FODA 3TNHA 4LQMA 4C35A 5C1QB 3UOHA 3PVGA 2VTSA 4PDPA 3ZO4A 3R28A 1CTPE 4ERWA 4QP9A 4PL4A 5HG5A 4IWOA 4J71A 4RJ6A 2F2CB 3NNVA 4MX9A 4AA4A 3MJ2A 2JKMA 2R7BA 3MY0A 4YJSA 4TL0A 2WB8A 2XRUA 3H30A 3CTJA 3C4WA 4I0RA 5HE1A 1CKIA 4C4GA 5K4IA 4CLJA 3UG1A 3G51A 3LW0A 3TL8A 4BZNA 5FTQA 4R7BA 3IDCA 5T6KA 1GY3A 4RLLA 3EH9A 3W55A 3PLAE 5AP7A 4EKLA 3FLSA 1XH7A 4QP2A 4XCUA 3W2RA 4X21A 4F64A 2PZYA 4EHGA 2X81A 1ZRZA 2VO3A 3FC2A 3CPBA 5HD7A 2O65A 4FSNA 5CZHA 1RJBA 4FYNA 4FC0A 3RWPA 3VJOA 5HX6A 5G6VA 4U41A 1OUYA 2Z8CA 3DBQA 4QNAA 2QODA 3LMHA 3ETAA 4EUTA 3QAME 4U0IA 1OKZA 3R1SA 2YM7A 4F0GA 4EORA 4EOOA 4WG3A 4PF4A 3VULA 3VS4A 4H3BA 2UW5A 5CAPA 3NUNA 4YJRA 4CG8A 3IQ7A 3PRIA 4C58A 3NYNA 4F6WA 2QKRA 5CNOA 4AF3A 3OTUA 1M2QA 5GHVA 2PUNA 5F4NA 1KE8A 4O2PA 4AW5A 3NX8A 4HVIA 5D11A 1FBNA 2RG5A 4RIXB 2ETMA 3CKWA 4GUEA 5HEZA 4HCVA 4ANLA 4AAAA 3MVMA 3FE3A 1PW2A 3OS3A 3DBFA 3O17A 4YZCA 3A7GA 2IW8A 3VN9A 2JD5A 4W4YA 4Z3VA 1YWNA 2XCHA 3LJ2A 4HYIA 3FMJA 4QMTA 2XKDA 1SVGA 4CKIA 4D58A 1ZYDA 2JIIA 2ESMA 4O7ZA 4U40A 4YC6A 2CDZA 3R8VA 4OW8A 4ENYA 4PTEA 1Q5KA 2BTRA 3QZFA 3PDTA 2GQGA 2Y4IB 4QMZA 3UGCA 4E7WA 2PY3A 1OIQA 4XV9A 3BGZA 5IDNA 3Q5IA 4LRKA 4OTIA 1UKIA 2C47A 4TPTA 2YCSA 3BE9A 3F2NA 4GU6A 1YOJA 1QPDA 5E90A 3TNIA 4RVTA 4M97A 4GFOA 3UP7A 3QX2A 1PKGA 3Q32A 2HELA 4L53A 1H4LA 2W5AA 3GCUA 3QZHA 2Y9QA 3DB6A 4ZLOA 3OMVA 4L3LA 5BYYA 1BUHA 3LXLA 2BMCA 3QTWA 3D5WA 4ZY6A 4XNEA 2UVZA 1QMZA 3R8PA 1OIRA 3N51A 4BI0A 4FI1A 2XEYA 2ZDUA 2WTWA 3QC4A 5CSHA 2X4ZA 2W5HA 4CFWA 4HYHA 4IDVA 3NMUF 4I5CA 5GINE 3FHRA 4L01A 5JGBA 2R3NA 3OCTA 4IEBA 5FXSA 3U87A 4UMRA 3NS9A 5CU0A 4IJ9A 5M44A 1Q62A 3KCKA 5E1SA 5EDRA 5AUYA 2C3KA 3LQ5A 3Q4ZA 4HNFA 3V8SA 5HTIA 4DEHA 3DU8A 5FRIA 4ZS0A 2RFNA 4YNEA 5CU4A 5DA3A 4QYFA 5M4FA 4FEQA 3FC1X 2WFYA 3MVHA 5AM7A 3RZBA 5EI6A 5EYMA 2J0MB 4J7BA 4NWMA 2YABA 2PVJA 4AFJA 3EL7A 3QWKA 3FZRA 2OIDA 4WKQA 4E6DA 4FV3A 3ZBFA 3ROCA 4PMMA 1BLXA 4TNBA 3QQHA 5M51A 4IVAA 3GXLA 4O21A 1MUOA 3DJ5A 1GZKA 5EDPA 4NL0A 4M84A 4QP1A 1ZY4A 2XBAA 3DGKA 4ZOGA 3M2WA 3DBDA 3RPVA 4ZJJA 4FIEA 3TACA 4ZZNA 3UZTA 2JLDA 2BRHA 5DBXA 2VTRA 4AGCA 1MP8A 3THBA 2WMTA 4V0GB 5IQAA 4NIFB 3PXFA 3R21A 1H1PA 4MBLA 1GIIA 5KMNA 3GQLA 2Y7JA 3RPSA 2CJMA 3SXFA 5DEWA 3F5UA 5T3QA 3EOCA 2YJRA 4YBJA 4E4LA 3T3VA 1L3RE 4Y85A 5DVRA 3TT0A 3VIDA 3ORPA 5BMMA 3DPKA 3ORTA 3CY3A 4IFCA 1PXJA 2WMQA 4EI4A 1NT2A 4ACMA 4X6QC 5E8XA 4F4PA 3TUBA 2R3FA 3IDBA 1F5QA 3DB8A 3UYSA 1WCCA 1JKTA 4GFMA 2OH0E 4PV0A 4DE4A 4DFBA 1HCLA 3OBJA 4WBOA 5H8BA 1U54A 2VAGA 4GEOA 3IECA 4IM0A 1KE9A 2XS0A 5ANIA 3O2MA 3AD4A 3RAIA 3A99A 1OM1A 4RA5A 5F95A 3VAPA 1XH9A 4D4SA 4U81A 2OWBA 2BDFA 3QZIA 4CYJA 4OBOA 3I79A 2W5BA 3PSCA 2BZKB 5J5TA 5K4JA 3A7FA 4J99A 3QQFA 4LOOA 5FDXA 4X3JA 5DI1A 3UE4A 4KS8A 1MQBA 4ONAA 4P5QA 4CEGA 5KX8A 1ZYCA 4HJOA 4AOTA 1H24A 3GEQA 3O7LD 2YDIA 5CQWA 3KN5A 4FL1A 2OSCA 4NYEA 2XJ2A 4CSVA 3H9RA 4K33A 3L9LA 3TEIA 4D2WA 5JMSA 4GV1A 2ZM4A 2J0KA 3FQSA 2I0HA 4N4SA 4XP3A 5AR4A 4AT4A 2DUVA 4E1ZA 5EQEA 5AA9A 3D9VA 5E8ZA 1W83A 1SYKA 4IZYA 4AG8A 2VTNA 5D7VA 2PVLA 1W82A 3OY3A 2NO3A 4IWPA 3BE2A 4IB3A 2CSNA 5HI2A 2UW9A 3SRVA 4HVGA 4G9RA 4I21A 3F3ZA 4BI2A 1H27A 1NXKA 1OKWA 3M1SA 1MRUA 2AC3A 2ZAZA 4G31A 4L7FA 2ETRA 3VQHA 3NRMA 3ULIA 4BDCA 5JGAA 2B4SB 4GH2A 1O6YA 2XNNA 4PX6A 2F2UA 3GQIA 5BVKA 3OTVA 3WYYA 4JQ7A 1J1BA 2VTQA 5AM6A 1YW2A 1UNHA 2OGVA 3GU7A 4K9YA 4EK4A 3RPYA 5AX9A 4PDOA 2Z7LA 4FKSA 4FV8A 3PYYA 4AQCA 5AP6A 5AAGA 4FZ7A 4XH6A 3QZGA 4NTSA 3DTWA 2C5NA 2VTJA 1K9AA 4DCEA 5AUTA 4L43A 4FSRA 4MTAA 2YM3A 5DNRA 3G90X 1XH8A 2OIBA 3KK9A 4AZSA 4RVLA 2QOFA 2XCKA 3P79A 4FKVA 4X6RA 4ZTHA 2UZUE 2WGJA 4O0SA 5A4CA 2QOBA 2H96A 5A4EA 5DH3A 3UC3A 1XBAA 3ZSHA 2WMRA 4TTHB 3L9PA 4R78A 4EH2A 2E9UA 5GZAA 2G9XA 2CGVA 4FV0A 3POOA 2R3GA 2ITUA 3NGAA 4F1OA 5BVNA 4QMUA 3RNYA 5FP5A 3FLWA 4AX8A 5H8EA 5LVOA 3IW4A 3DV3A 2R64A 2VUWA 3L1SA 4X2KA 5AP1A 4O0VA 3FMNA 4I5HA 3LKMA 3IO7A 4GW8A 2QVSE 2XK7A 5I4NA 3WILA 2RFDA 1E1XA 3QRIA 3V8TA 2QCSA 1T46A 1TKIA 1KE5A 3MH2A 3OWPA 2ITPA 4AN3A 4APPA 2BTSA 2XRWA 4EOSA 3OVVA 2Y6OA 3ZUVA 3Q4UA 2R3HA 2W9ZB 4BDKA 4FOCA 4J8NA 4WIHA 1WBPA 4AGUA 4I22A 4IXPA 5HORA 4BY9E 4P5ZA 4FT9A 4GJ3A 3K3JA 5DOSA 4YZBA 5EI2A 2FB8A 3QGWA 2WMAA 1ZARA 4D4YA 2C30A 4FTAA 4BI1A 2CLXA 2OKRA 4M66A 3EMGA 3QFVA 4JIKA 3DXPA 1V0PA 4G6NA 2G2FA 3IK3A 4I6HA 4L52A 3BIZA 5HNBA 5KZIA 4A9TA 4KD1A 4TYIA 2OJIA 4MXAA 4ORKA 4JBVA 4OTFA 3W18A 4UALA 5CAQA 4L46A 2QHMA 4O83A 4YLKA 1WZYA 4DEGA 2YITA 4EBVA 1ZAOA 1ZYLA 2EWAA 1KV1A 1OL1A 2R3MA 2VO6A 2X8IA 3DK7A 4EONA 5CS6A 4D1SA 4K2RA 4NT4A 4BIDA 4LOQA 1CMKE 3KMWA 2F7EE 4UXQA 2XEZA 3F7WA 3FAAA 3G5DA 2O2UA 2ONLA 3PSDA 2Z7SA 4DGNA 4C36A 3S3IA 4TWCA 4RIXA 3GCQA 3FLYA 3DCVA 3UIBA 4CMTA 3ZO3A 3E87A 4HZSA 1PMEA 4O82A 5CSXA 2PSQA 4BCHA 2Z02A 4KIKB 2BFYA 3FQEA 1XKKA 1NVQA 3FMHA 3QGYA 4U3YA 3PUPA 2IW9A 4JDIA 4MQ2A 4MQ1A 2YWVA 3VBXA 1OVEA 1XBCA 4PUZA 4WOVA 3ET7A 4OTWA 5CEQA 4BIEA 1HCKA 3L9MA 3VO3A 3Q2JA 1I09A 3BYMA 4XBUA 3CEKA 2OJ9A 2W1FA 1R78A 3ALOA 3LAUA 3OFMA 3CQEA 5AR2A 4JX7A 2PZIA 2GNLA 5IUHA 4OT6A 2JGZA 4AZWA 3I0QA 4RA4A 3Q9XA 2XNOA 3D83A 2ONLC 3HV6A 3SW7A 3QTIA 5L2QA 3E7OA 3RHXA 2PMNX 3C0GA 2HZNA 3HUBA 4OTQA 4PPAA 4CMOA 4NU1A 4FEUA 4TKSA 4IFGA 2HK5A 2WMUA 4K6ZA 5A3XA 3PPJA 3EZVA 2F4JA 5CF5A 4S33A 2A2AA 1ZY5A 4JX3A 4FKGA 4QRCA 3PJCA 3AC5A 2C6IA 4IZ5A 5C03A 4J95A 3WYXA 4B9DA 5IQHA 3O8TA 5EW9A 4D5KA 5GIOE 4O86A 2R0IA 4PQNA 2CMWA 4IE9A 1FMKA 4NJ3A 4EWQA 1OL5A 3C0HA 3PZEA 4R3RA 1CM8A 1WVWA 2CN5A 1WVYA 2IJMA 3V51A 1REJA 3U55A 5DR2A 3LCDA 3WF8A 3PPKA 3L8XA 5B7VA 4DA5A 4DH5A 3I7BA 2VTMA 3HECA 5J7HA 1YVJA 3VS1A 4F65A 2B55A 4EEVA 5I9VA 2W1HA 3U51A 3NCGA 4C37A 2F57A 5CANA 3KVXA 1U59A 3QTRA 4ID7A 3ZU7A 2GNIA 1SVEA 1H1RA 1STCE 4WUAA 2XKFA 5C26A 4Z9LA 4O96A 4DT9A 4NFMA 3EFJA 1K2PA 1YI4A 5LMKC 4QMOA 5D7AA 3VBYA 4Z16A 1ZMUA 3D5XA 3F61A 4ZSGA 3PZHA 2CKQA 2JFMA 4AOJA 3EQRA 3EN6A 3ENHA 2GDOA 4XG6A 2B1PA 2QKWB 3NNUA 2QQ7A 3SX9A 2VTHA 3A62A 4ANNA 2I40A 4LUEA 4CCBA 2ERKA 2UVYA 3MN3A 5L8JA 2CNUA 4V0GA 3ULZA 4NIFA 3OUKA 5HO8A 3QU0A 2UZNA 4LV8A 5E91A 1Y91A 5CF4A 3VJNA 3TKHA 1YDSE 5IH5A 5CT0A 3U4WA 5M08A 3DJ6A 3A8XA 1PYEA 5HO6A 2JIVA 4FE2A 2JITA 4MF1A 1YWVA 3EIDA 5CAVA 2ZV9A 5FEQA 4FG7A 1JKSA 2YCQA 4NW6A 4EUUA 4TW9A 4Y83A 4RWIA 5CTPA 3HDNA 2X8DA 4Y95A 3DZQA 2WTDA 5CSWA 3QRTA 3ZO1A 2Z7RA 3EQCA 3V5QA 4GL9A 3AMBA 2X1NA 3IGOA 2PVMA 3CP9A 1BL7A 3HDMA 4CFMA 2GFCA 3FI3A 3VBVA 3B8QA 2R5TA 5J87A 1Y57A 2QO7A 5KMIA 4BKZA 2V22A 1YHWA 3D2IA 3JS2A 3PXZA 4ZTRA 4D5HA 5LVNA 4MXYA 2RSVA 3KMMA 4QQCA 4XG8A 2OXYA 3R8LA 3R22A 3PIZA 4O81A 4ZTMA 4TWNA 3BV3A 5IQEA 4GIHA 5HIBA 5EI8A 5HVJA 3DFCB 2C69A 2XM8A 2FA2A 4PL5A 4DGOA 2XNMA 2YACA 3FQHA 5A6OA 4M7IA 3HAVA 3G6HA 5EH0A 4J52A 3QXOA 3CJGA 2H34A 4AWIA 2Z7QA 4JLCA 4BFMA 3LVPA 2ZYBA 4LMNA 3VUTA 2XJ1A 3KC3A 4HCUA 4CFNA 3VS5A 2DQ7X 4IM3A 4AW0A 4F08A 1J7LA 3NYXA 4F9BA 4DBXA 4UWYA 4OT5A 3JY9A 4OTRA 3DLZA 2WOTA 3QRUA 1P5EA 3UP2A 3ZS5A 4UX9A 4EKKA 1OI9A 2YIWA 2C1AA 3D14A 4XRJA 4MXOA 4WNKA 3PWYA 5CY3A 4F9CA 3PXRA 1V0BA 1SNUA 2QONA 2X4FA 4JJRA 4QP3A 3VHKA 3CTHA 3BKBA 4GG7A 4XS2A 3ANRA 5CXHA 4D2VA 3HGKA 3PA4A 4FNWA 3UYTA 5EQYA 2W1GA 3LFCA 2B7AA 3A4OX 4O0UA 3AD6A 2C3JA 4UN0C 2WMVA 4IVDA 3BQRA 5J9ZA 4XUFA 4CVAA 4IQ6A 3COIA 4L3JA 3COKA 4CT2A 5H3QA 4QQJA 3S0OA 2XBJA 5D12A 4BBFA 3A7IA 4IB1A 3HA6A 5DT0A 5LVLA 3SC1A 5E8UA 4DGMA 4EWHA 3N4UA 4GKHA 4EH7A 2WQOA 4RQVA 1VYWA 5DMZA 3MPAA 4P7EA 4LUDA 1SVHA 3RNIA 4OTHA 4C38A 4BIBA 4CZUA 2UVXA 5HVKA 3FDNA 3QYZA 5IQDA 5GIPE 3F6XA 5CNNA 3FWQA 5IH6A 1YOLA 1RW8A 2JBOA 3D7ZA 3DBCA 1ZZ2A 3D15A 2B9IA 4U8ZA 3DDPA 2I0VA 4ZMFA 2J51A 4I6FA 5HBJA 4XV1A 2BRMA 4XEYA 4YZDA 3FLNC 3ORIA 1ZLTA 1ZMVA 4X7QA 5AR5A 5KO1A 2QC6A 2ZVAA 5AR7A 5L2IA 3DKFA 2AUHA 3FMKA 3UZRA 3BYSA 4BDDA 3BLHA 4GT4A 2VWVA 4NKAA 4FTIA 4W8DA 3QKLA 5CX9A 4ANQA 3OY1A 4ANSA 2OLCA 3V5LA 2VRXA 3OT8A 4BBEA 4TNDA 5AP2A 4M8TA 5LOHA 3FKLA 1OGUA 1YXSA 3E62A 3QQJA 3T9TA 4CFFA 3TXOA 4JQEA 5FP6A 5EK7A 3ZLYA 4E4NA 5L2WA 4FVPA 3D5UA 3UZPA 3MA6A 4I23A 3V5TA 3EYGA 5B2MA 3MESA 2FH9A 3PSBA 3II5A 4RX8A 4FKIA 4ZTQA 5L4QA 3WI6A 3V6SA 3BQCA 2OJGA 1W7HA 3LHJA 4WNOA 5AIKA 2WHBA 3NAYA 1A06A 3OOMA 4IDTA 3Q2MA 4B6LA 2J0LA 2PUIA 5KMKA 3M11A 4U7ZA 2Y4PA 3HP2A 5AX3A 4YHTA 3VRZA 2QG7A 4QYYA 4UZHA 4YJNA 3V5PA 4S2ZA 5JZJA 4D2PA 3BLRA 5AJQA 1M2RA 4L44A 5DN3A 5EDQA 3R63A 1YDTE 2FSLX 3VUGA 3KMUA 2C3LA 1PRYA 4A07A 3HMPA 4ALWA 2ITQA 3COHA 3KGAA 4E5BA 4X3FA 3RPRA 4YTFA 2O5KA 4C3FA 3NNWA 3E8CA 3EFWA 4XLVA 1SNXA 1QPJA 2CN8A 5AUVA 1JLUE 3F7ZA 3OCSA 3CLYA 4XG4A 3V6RA 4KUJA 4XV3A 4EOQA 4A9UA 1G8AA 3SRVB 5FTGA 3VWAA 4RBLA 4NKSA 5ICPA 3FV8A 4R5SA 1W98A 3U9NA 4D2SA 4TT7A 2BFXA 3C50A 4AE9A 3F5GA 4RFYA 4IZ7A 3C9WA 3KRXA 4ASEA 3E3PA 2ITOA 3B8RA 4FVQA 2P2IA 4A9SA 5A46A 4NSTA 5C8NA 3QQUA 4EZ7A 5L3AA 3LXKA 4B0GA 2Z2WA 5ETFA 4TWOA 4X3FC 2RL5A 4GYIA 2JBPA 3M42A 4WSYA 2HXLA 4H1MA 3ZH8A 3ZSGA 2X6DA 3TI1A 1YKRA 3IS5A 2IZSA 2PMIA 3Q5ZA 4X0MA 5J95A 4CG9A 5FTOA 4C2VA 3PJ8A 3TZ8A 4OAUC 3QX4A 2BROA 1R0EA 4PP9A 3TDWA 3FJQE 3L8SA 2YAAA 4XG2A 2PYWA 2J90A 3TZMA 3VS7A 3WZJA 4L45A 3E3BX 4FKJA 2JKQA 4FTJA 5HU3A 5BVFA 4JAJA 4EK6A 5M4IA 3G6GA 3R02A 4PTGA 4OTDA 5HOAA 2SRCA 5FEEA 3BGPA 3NUSA 5IPJA 4FZFB 4IHPA 3O8UA 4E4XA 3FI2A 1UNGA 4Q9SA 3LFQA 2CPKE 5A4LA 5I0BA 2QI8A 2ITYA 3KRLA 4F6SA 4O27B 3VUIA 3VC4A 4IW0A 2CKOA 3CD3A 5IU2A 2ZV7A 4RLKA 2UW4A 4GYGA 4WBBB 3NW5A 4FT3A 3ZXZA 2XK6A 4RT7A 4YBKA 3EN7A 3UIUA 4AZVA 3QQKA 2WKMA 3T8OA 4GG5A 1WBOA 3DFAA 3JR1A 1H07A 4IACA 4W9XA 1YOMA 3F5PA 3PVWA 4FT0A 4LL5A 4BWKA 1TQIA 2CGUA 3C0IA 4RGJA 1LR4A 3UPZA 4DAWA 5JFVA 4X2FA 2XP2A 3ZCLA 2BDWA 2CCIA 2PVYA 3LCTA 2VGOA 2XNGA 3DLSA 4GT5A 1F0QA 3PRFA 4FV9A 3Q9YA 4LGHA 4CV9A 5A14A 3R73A 2PL0A 3FZTA 4R3PA 3NAXA 4PMPA 3EKNA 4XMOA 3SDJA 3FXXA 3VBWA 4LV5A 5D41A 4IH8A 4KNBA
chains in the Genus database with same CATH superfamily
1WBVA 1WFCA 4N57A 2J4ZA 5CF6A 3WARA 4TXCA 2F7ZE 5CU3A 2O63A 4EH8A 2BZJA 1CKPA 3KXGA 5CALA 3LM5A 4MK0A 4I41A 5DT4A 1P14A 4EH4A 4FGRA 4RVKA 4CTBA 3PY3A 2A0CX 2X6EA 5TOZA 3ZDIA 2ITXA 1GIHA 2YERA 4W4WA 5HGIA 3OCGA 1R3CA 2OH4A 5C01A 4ACCA 4LDTA 1PJKA 3R71A 4P4CA 3HKOA 3D94A 3QWJA 3Q9WA 3UJGA 3WIKA 2QURA 3HMIA 4NW5A 4K18A 2XH5A 3F2AA 4NZWB 3UQGA 3L8VA 2ETKA 4I20A 5KCVA 1GZ8A 3FSKA 4LI5A 4C4FA 3F5XA 4QMWA 3NZ0A 2GPHA 4N0SA 3H10A 3DXNA 4D55A 4R7IA 4EC9A 3CKXA 3EQFA 4MKCA 1ZZLA 3R1NA 4FKLA 4IAFA 4O6LA 4ANMA 5L6OA 4PMTA 1CKJA 4AXFA 5LQFA 5A54A 5AV0A 1Y6AA 4Z7HA 5LXMA 2WZJA 2V0DA 4JVGA 4LMUA 1TVOA 3LLTA 3GU4A 4FTRA 3BX5A 4FIHA 3UOKA 3ITZA 2OJJA 5M53A 3E8EA 3WZDA 3C51A 5F1ZA 4UMQA 5L2SA 2BR1A 3W10A 4AT3A 2XKEA 2R3KA 1PMNA 2FO0A 2X0GA 4W4XA 2V62A 4AU8A 2ITZA 3D0EA 3WF6A 4CZTA 4IX4A 3OXZA 2JC6A 3P4KA 4PPCA 3OROA 2PZRA 2IZUA 3CQUA 3PJ1A 4R5YA 3GCSA 2X9FA 5E1EA 3UMXA 5LWMA 4Q2AA 3U6JA 3NSZA 4ZTLA 1WBTA 3JPVA 3TUCA 4DLIA 2F9GA 4KBAA 1OPLA 3GOKA 3VW8A 1DAYA 2QO9A 4H05A 4TZRA 3OBGA 3C13A 3AC8A 2AEGA 2OXDA 4FEVA 4DF3A 4CZYB 5FM2A 3EQBA 4YO4A 2QU6A 2VTLA 3R04A 2KULA 3MH0A 3HP5A 3MY1A 3GC8A 4YJPA 4I24A 4MCVA 2IWIA 3SXRA 4KKEA 3FPMA 3VBQA 3HMOA 3ELJA 3PFYA 4C3RA 1MRYA 3G0EA 4USDA 3WOWA 2E2BA 5HG9A 5LWNA 4XOYA 5D1JA 5JN2A 4F6UA 4GKIA 4JAIA 3OG7A 4EHZA 3FXWA 3A2CA 4NM3A 3UC4A 3NVKI 4AXCA 2UZDA 5AP3A 2B53A 3ZC6A 4NJDA 4O38A 5HE3A 3KEXA 4RC3A 4Z7GA 1L8TA 3BL7A 4FZ6A 2GMXA 3W0OA 4U6RA 4G16A 3V01A 4F7SA 3WE8A 4QMYA 4M12A 1U5RA 3V5WA 2WOUA 2VO7A 2ITNA 3DOGA 3SG9A 2HZIA 4O91A 1H25A 4IZAA 4BDHA 2HCKA 1XWSA 3CC6A 4CNHA 4KS7A 2W1EA 5EFQA 2UW3A 5M4CA 4QDEA 2HY0A 4MBJA 4JIAA 4OUCA 4ZY5A 3I81A 3MSSA 2HW6A 3TJDA 1H1SA 3QUPA 5KKRC 1IAHA 3DY7A 4FSMA 2PU8A 3RBWA 1UWJA 1TQMA 5HO7A 4C34A 4I6BA 3BBWA 2ZB1A 3TCPA 2GNGA 3W0QA 3QA8A 2WIPA 3OW4A 4FNYA 4JL9A 2HZ0A 1P4FA 4K1BA 2GSFA 2X7OA 5GJGA 4F99A 2J2IB 3P86A 4RRVA 5CZIA 1DI9A 2VWXA 3R00A 4JDJA 2I6LA 2R3PA 2C3IB 4FZAB 3U4UA 4PL3A 2J5FA 5ETIA 3QD4A 1FPUA 3LFBA 1H28A 4XP2A 2IO6A 3VS2A 4W9WA 4PRJA 3E8NA 3TV4A 3LXPA 2VU3A 1P4OA 2VX1A 4A9YA 3R0TA 4C4HA 4FKRA 2VX3A 3NCZA 3PXQA 5LVMA 3K2LA 5EYDA 2EVAA 3ZLSA 3CGOA 3G33A 4C59A 5KUPA 1OBDA 4S34A 4BF2A 4FKUA 2WMXA 4DFZE 4JT3A 4RC2A 2XA4A 1G3NA 4EH9A 3BELA 2XARA 3ATTA 4O22A 3RCJA 4ZP5A 4ZLZA 5J1WA 4F7JA 5AAFA 4BICA 1QL6A 1FGKA 3LFFA 4NTTA 4EK5A 1ND4A 3MFTA 4D0WA 1YXVA 3JVSA 4JBPA 4RWLA 2UZBA 3HV3A 4TYHB 2W1ZA 3ACJA 1UWHA 4UB7A 4YZ9A 4PDSA 5BVOA 1BMKA 2IVTA 3BCEA 3AKKA 3F9NA 4BCPA 1IA8A 1Q8TA 1R39A 4PPBA 5F20A 4BZOA 3PP1A 1ZXEA 3SOCA 5HZNA 5TR6A 5AR8A 2W0JA 1GJOA 4MXXA 1NW1A 1DAWA 1VZOA 5DRBA 2VTAA 2WMBA 3LJ1A 4FTQA 5DLSA 4E93A 4DT8A 1OPJA 4JI9A 2VWUA 2OO8X 1H8FA 3DQWA 2ZJWA 3DAKA 4NH1A 5AV4A 3VS6A 5IA3A 1M7QA 5HX8A 3LFAA 3QXPA 2XUUA 5GNKA 3UO6A 3ZM4A 5M09A 1YI3A 2JDOA 4FSYA 5EYCA 3P5JC 2REIA 5FD2A 5G1XA 3TV6A 3I1AA 5IH4A 2XANA 3U54A 3MB7A 3P78A 3ROYA 5CT7A 5DEYA 4G34A 3CSVA 5L6PA 2CLQA 1UNLA 2UV2A 3MI9A 4R77A 3EN4A 3PVBA 3DKOA 2R2PA 4FTKA 4ZEGA 3AT4A 3FL5A 3TNWA 1M17A 4IAYA 3KREA 4G3EA 4P2KA 5K5XA 5IQBA 4TYEA 3ZRMA 4GK4A 3RAKA 3D7TA 4FOBA 3O71A 3P23A 2IPXA 4DFLA 5H8GA 4AZFA 2FGIA 4GS6A 4XV2A 1R0PA 3BLQA 2YLEA 4BDBA 2WIHA 5LMBA 2I1MA 5E8SA 1A48A 2WQEA 3H0YA 5DIAA 5IUGA 2W9FB 3W2PA 3P0MA 3LFEA 4OLIA 4WG5A 2NPQA 3CD8A 5HHWA 5CWZA 4BWPA 3EN5A 2I0YA 3I5ZA 3LQ8A 3AOXA 5CENA 2WAJA 3RK9A 3TNPC 3OCBA 5H2UA 2YIQA 3QHRA 1IAJA 1B38A 2OK1A 3R01A 4BKYA 4RMZA 5J5SA 2YN8A 4QD6A 3O50A 2BAJA 3F69A 2VTOA 2R3QA 3VBTA 2JAVA 3QUEA 1M14A 5HBHA 5AEPA 3AMAA 2WEIA 5HLWA 3QKMA 4OBQA 5IA4A 1IASA 3REPA 2YEXA 4EHVA 2VWYA 4FVRA 3V3VA 5AP0A 3P7AA 2C0IA 3S4QA 4X3FB 3LCKA 5ANGA 3UQCA 4FG8A 4ZIMA 1FVVA 2JFLA 4QP6A 3T3UA 1FGIA 4NUSA 4K0YA 4BCGA 3KIOC 2VWZA 3RGFA 4FYOA 1FVTA 1MQ4A 1YHVA 1OKYA 4KRDA 2C6EA 4O4DA 2ZOQA 3G9LX 2PHKA 5AP5A 3RMFA 4GSBA 4C4JA 2W99B 3ZDUA 5BYLA 3P7BA 4AW1A 3MIYA 2P2HA 3KVWA 4MYGA 3FMEA 2X39A 2RGPA 3DNEA 5IUIA 2XVDA 1Q61A 2ITVA 2YDKA 4ACGA 2XF0A 4MD7E 4ZSJA 1OMWA 4QTEA 2C6MA 3NEWA 4KBCA 2YM5A 4BC6A 2G15A 4BCNA 4YUQA 5LCJA 1UA2A 2YFXA 2GU8A 2XJ0A 4M67A 4AT5A 5E8VA 3ZFYA 1Q8ZA 4IAZA 5FXQA 1BL6A 4D1ZA 5ANJA 3ZRLA 5JGDA 4BDAA 3MW1A 5IQIA 2HOGA 5FQDC 1K3AA 5JQ8A 3KXHA 5IEXA 3GFWA 5AWMA 4CGAA 2QOIA 3KRRA 3PG1A 3DAEA 2BRBA 3KL8A 4F9YA 4X2NA 4WRSA 2QOKA 5HKMA 4ANOA 3GP0A 2BVAA 2ITWA 5LMKA 4V05A 5F94A 3K54A 3ZBXA 3UPXA 5EQPA 1QPEA 3FMMA 2BUJA 3I0OA 1IEPA 4DBNA 1NA7A 3K5VA 2QOQA 3QTXA 4A4LA 2UZVA 5IMEA 2G1TA 5JKGA 1W2DA 5EOBA 3L9NA 5I5ZA 5B0XA 1REKA 3BYVA 2PULA 4Q5EA 3NYVA 5TT7A 3EQGA 1YI6A 4H39A 3P1AA 4J98A 4E5AX 2UW7A 3SXSA 4L3PA 5EG3A 2W05A 4RIYB 3RALA 3R7YA 2PWLA 3OT3A 3O51A 3VF9A 4LOPA 2FSMX 2PZPA 4XX9A 1JSTA 3HUCA 4MNEB 4RJ3A 3Q53A 3ZC5A 2W96B 3E63A 1JKKA 2YDJA 3R30A 2XNEA 4RX5A 3FEGA 2KTYA 4UXLA 5I9ZA 4FKQA 1H26A 5C8KA 2OF2A 4YLLA 3BHTA 4FV2A 4BVUA 4JMQA 2EB2A 4DHFA 2FVDA 5IA1A 1PXOA 1W0XC 3NLBA 2DYLA 3H4JA 3KULA 5C8MA 3ZONA 4Y46A 5C4LA 2VTIA 5ETAA 4N6YA 2XYUA 3QCSA 2VZ6A 3FZPA 4OTPA 3EN9A 3TKUA 3WE4A 4DG0E 3AC4A 2HWPA 5BX0A 4D2TA 3MY5A 5FUTA 3ORXA 2GNHA 3HMNA 4YR8A 4JOAA 5KMJA 1NY3A 4JRVA 2CKEA 2OF4A 4BDFA 4CRLA 2J9MA 4QNYA 3ZUUA 2Y8OA 2GQSA 4IBMA 4C8BA 5JT2A 1X8BA 3FYKX 5KZ0A 4YPSA 4FV1A 3ZFMA 5E8YA 4DEIA 1PXMA 4D28A 4RZWA 1G8JA 5GJFA 2HAKA 4YTIA 5B2LA 4IADA 3FKOA 1QPCA 2IZRA 3G15A 4YGAA 4F7NA 3LOKA 5HD4A 4EH3A 5E92A 3W8LA 4LM5A 2IZTA 2WEVA 4KAOA 3UO4A 3K3IA 1URWA 2ZV2A 4BCOA 5FDPA 1YXXA 3DXQA 4XLIA 2ZDTA 4GIIA 5GJDA 3HYHA 4GK2A 5EHOA 4ASXA 2H9VA 3BU3A 4PDYA 3FPQA 2IEWA 4M3QA 5A4QA 4G2FA 4FTLA 3CPCA 1H08A 5E8WA 5M56A 2B0QA 4C61A 3NNXA 4BJJB 4V01A 4DFNA 3R7UA 3IKAA 4C02A 2VX0A 2Y0AA 2DWBA 2C5VA 5AAEA 2RFSA 3EQIA 4PP7A 1DM2A 1H0WA 4EOIA 3DK3A 4FUYA 4YJOA 5EM7A 5HIDA 4CFUA 5CXZA 3QLFA 4YURA 5AA8A 4ASDA 5HTBA 2R4BA 3FUPA 3KF4A 4FV5A 3ZEPA 5BYZA 2WQMA 5HBEA 4FL3A 2JDTA 2GTNA 5BNJA 3BGQA 1VR2A 4C4EA 4OAVB 3VQUA 5EHLA 3OF0A 4I5MA 4JRNA 3ZZEA 2CGWA 2BAQA 4FTTA 1FOTA 3BPRA 3C5UA 4O0TA 3QD0A 2XKCA 4I94A 2Z60A 5EHYA 3TIZA 3ORMA 4EZ3A 1LPUA 1JVPP 1CSNA 5I3OA 3SV0A 1LP4A 4ZZOA 3C5IA 3OEZA 2ZM3A 3IDPA 3POZA 5JRQA 5AV1A 3HL7A 1GZNA 3WF5A 4E73A 4BRXA 3HRFA 4BDJA 4GU9A 4CYIA 3HAMA 4QQTA 3SOAA 3FI8A 4TYHA 1Z9XA 2C5YA 1JNKA 2OZAB 3GCPA 3SKCA 1UU7A 4L00A 3Q9ZA 3ZFXA 4BBMA 4ASZA 2XM9A 1GZOA 3D4QA 3QRKA 5ANEA 5FBOA 3IPHA 4E3CA 3BL9A 1OBGA 5E9EA 3ZTXA 4YNOA 4EOJA 4L6QA 2VN9A 3PTGA 4RPVA 5BVWA 1FMOE 4H3PA 4XG3A 4YPDA 4RFZA 5BVEA 5CSPA 2RFEA 2XK3A 4QMNA 3R6XA 4CV8A 4MWIA 3WIGA 5LVPA 3HV4A 5K0KA 4GMYA 3GCVA 5BUIA 1KE7A 5KKRB 2WTKB 2Q83A 3MH3A 4U45A 4FEXA 4O7TA 5M57A 5ANDA 4I5PA 3G2FA 5HCXA 4QT1A 3RPOA 1PF8A 2YM8A 4AE6A 2GNJA 3KCFA 3S00A 3ODZX 1ZMWA 1LUFA 3T9IA 2EUFB 3WF9A 4BKJA 3MV5A 3EQPA 4BGQA 4ZSLA 3ZYAA 4IX6A 3O8PA 5DRDA 4EC8A 2HYYA 3F66A 4G3FA 2J7TA 3AMYA 5IEVA 4DINA 4M0YA 3EWHA 5CEKA 1W8CA 3NUYA 2CNVA 1OUKA 2JAMA 4GT3A 4BYIA 4U44A 4BTFA 4EH6A 1H1QA 5FEDA 4QP4A 4DH8A 1SMHA 5ETCA 4EOMA 2W1DA 4FICA 4LGDA 1XH5A 3N9XA 3QBNA 1RE8A 1ST0A 2O64A 3EZRA 3QQGA 4E6AA 3F3VA 3QD2B 1ZWSA 3UQFA 3MPTA 2A4LA 1WVXA 3PY1A 4J8MA 4U5JA 5FLFA 4FEWA 1Y8GA 5M55A 1XJDA 3OWJA 3R7EA 1GAGA 3KB7A 4IB0A 4FIGA 2PVFA 3KY2A 4O6EA 3U8WA 3UODA 5HQ0A 4WD5A 4ZTSA 4A7CA 4CXAA 2GQRA 2V7AA 2VO0A 3OOGA 1WBWA 2X8EA 4B8MA 4NM7A 5AV2A 5JSMA 3JUHA 3ZO2A 4F9AA 3HEGA 2BPMA 2F7XE 3MDYA 4ZSEA 2C6OA 4KINA 2QO2A 2C5XA 5TKDA 3GC0A 3TN8A 3KA0A 4HGLA 3UOLA 5AV3A 3PPZA 5JQ5A 1E1VA 3LMIA 3MYGA 4KWPA 4PNKA 4KIQA 3RZFA 3A7JA 3RINA 4AGWA 3CCNA 4EH5A 4Y8DA 4PTCA 3KFAA 2IF8A 2F49A 4BGHA 4FG9A 4FIIA 2C0OA 4FBXA 2OFVA 3A4PA 5CAUA 3RKBA 2B54A 2OIQA 3BEAA 3MB6A 1PXIA 1Q3DA 5L8KA 1ZYJA 3EKKA 3NUXA 4IX5A 2X2LA 5CF8A 4UZDA 4XG9A 2QG5A 2O0UA 4U9AA 2PVNA 4DG2E 4R8QA 3QCQA 4O1PA 3CBLA 3UOJA 5DE2A 4R1VA 5AP4A 3UDZA 4QPSA 4GJ2A 2EXMA 2Y6MA 1UV5A 4G1WA 1GOLA 2JKKA 5A4TA 4L7SA 4YJTA 4Y5HA 4M69A 3SQQA 3V5JA 1IG1A 1XBBA 3OXIA 1BYGA 3PJ3A 2GNFA 4G9CA 4ERKA 3C4FA 2UZWE 2C68A 4D9UA 4FTUA 4P90A 3MA3A 4DEEA 1Q41A 4RSSA 1EH4A 2UW6A 4ZLYA 4HOKA 5LCKA 2BHHA 5IA2A 4JQ8A 5KBRA 3IW6A 3LQ3A 2W1IA 1S9IA 2WMSA 4HYUA 2YIYA 2J5EA 5J9LA 1TQPA 3MJ1A 5IQGA 1HOWA 3TKIA 2R3RA 4HZRA 3IG7A 4RWKA 4C62A 2E9VA 2QNJA 3IGGA 3QCYA 5CVGA 5JEBA 3UG2A 2BCJA 3AQVA 3Q04A 1G5SA 5IG1A 4BTKA 1RQQA 3DA6A 5IF1A 4G3DA 2VD5A 3P9JA 4RIYA 5IQCA 3OD6X 1Q99A 2E9PA 2FSTX 5HTCA 3D7TB 4I92A 2BIKB 2QLQA 3ORNA 4MNEA 3KRWA 3FMDA 4F1TA 2PK9A 1BX6A 4F1MA 3BEGA 3HLLA 2VNWA 4O0XA 2R0UA 3QYWA 4ITHA 5I9YA 4NFNA 3NPCA 2YA9A 3ACKA 3I6UA 3QTZA 4QTDA 3D2KA 4WNPA 2OBJA 1YXUA 4UYAA 3KXMA 3S1HA 3Q4CA 4O7VA 3DTCA 1S9JA 1Q4LA 2C1BA 3QKKA 4R1YA 4AGDA 3QTSA 5D9HA 3DKCA 4YZMA 3P08A 4Z55A 3D5VA 3NYOA 4DFUA 4JG8A 5AUWA 2EU9A 4GFGA 3O7LB 2QOOA 3PJ2A 3KXXA 4JG6A 4BYJA 3GUBA 1O9UA 3FHIA 2V5QA 4TYJA 3ENMA 5DPVA 2XMYA 5CSVA 4C2WA 4YMJA 2PVHA 1AQ1A 3QF9A 3BWFA 3W0PA 2HW7A 2WU7A 3FZOA 3E8DA 3C4CA 3ODYX 4QPAA 3CIKA 4GVJA 4QYGA 4M13A 1Q24A 3VS0A 2OICA 3AGMA 5JK3A 4CRSA 2ZM1A 3AGLA 4XJ0A 3ZOSA 3R83A 4YSJA 3W32A 3MTFA 2FUMA 4FIFA 5JFXA 3R1YA 5DG5A 4CCUA 5L2TA 3QTUA 3WZEA 3W16A 4FMQA 4QMXA 2G2HA 2P3GX 4I6QA 4RX9A 2BRGA 1O6LA 1JBPE 3QD3A 4WUNA 2R7IA 3Q96A 1PKDA 1PXLA 4FSZA 5CEPA 1APME 2QU5A 4M15A 2WD1A 4WO5A 2PZ5A 2ERZE 3IW5A 1FQ1B 2VWIA 3NIEA 4E4MA 2VV9A 2YZAA 3TUDA 4BJJA 3AD5A 4QMLA 4E6QA 3C4EA 4H3QA 4DC2A 1BI7A 5ANKA 2BZHB 4HCTA 5IA5A 4FA2A 4RJ4A 4AW2A 3TZ7A 4F9WA 5HG8A 4ZSAA 4BGGA 2GS2A 3SVVA 5DT3A 2C6KA 4E6CA 3U6HA 5AR3A 4ZJVA 4HGSA 4I1ZA 3NW7A 5EKNA 2PVRA 4Q9ZA 1ZOEA 4U42A 5DHJA 4AN2A 4FK3A 3R7IA 4YU2A 2ZMCA 5A9UA 4CTCA 2UZTA 3HX4A 4BTJA 4R7HA 4IC7A 3KRJA 3VUKA 3WZKA 3DK6A 2YCRA 1UKHA 4JBOA 3ZXTA 4OBPA 1JOWB 2FYSA 2BILB 4MVFA 5EW8A 3UVRA 3DAJA 3W0MA 3QL8A 4IMYA 4O7NA 5FBNC 2B9JA 1B39A 4RC4A 1YRPA 3FL4A 2WTJA 2P33A 2GHGA 4MXZA 1UU3A 3R7OA 3ZSIA 2GFSA 4KABA 1Q8YA 3ZEWA 1KSWA 5J8IA 2ACXA 3N4VA 1J91A 3L8PA 4B7TA 2OZAA 4O0RA 4QMMA 2IVSA 2OI4X 4G5PA 4M14A 4HPUE 4IWQA 4AFEA 5J7BA 4DFYA 5AMNA 3E88A 4HVDA 4ZS4A 3H9FA 5CEMA 1QCFA 3F3WA 3VRYA 5HNIX 4F63A 1ERKA 1XR1A 4XHKB 3QA0A 3UO5A 5FM3A 5K0XA 1BI8A 2YAKA 2W06A 3DBEA 3QQLA 4G6LA 4JR3A 5DR6A 3DKGA 2O3PA 3SLSA 4FGBA 4QMPA 4RIOA 2HIWA 3GFEA 1IR3A 4PMSA 5KHWA 3KULB 1F3MC 1NVRA 2WTCA 3EHAA 4AN9A 3AT2A 4EK3A 4Q5HA 2X2MA 4LFIA 5A6NA 1DI8A 5HCYA 3E64A 5HG7A 3BV2A 2PE1A 4O4BB 3GBZA 4BR3A 3AKLA 3I4BA 4RFMA 4O2ZA 2IG7A 4O7YA 3SG8A 4G3CA 1VYZA 4J97A 5CASA 5HCZA 3UDBA 4O7LA 4YC3A 1Y6BA 3I7CA 4FSUA 2NRYA 4QP8A 5TF9A 3Q6UA 3LFDA 4LGGA 1UVRA 3CJFA 2B52A 4QTBA 3Q60A 4R6VA 2PE2A 3RTPA 3TTIA 4KKGA 5DYJA 3FLZA 4FL2A 3PVUA 3KK8A 1KE6A 2W4JA 4UBAA 3PP0A 2PMLX 2I7QA 4NM0A 4S32A 2A27A 3BU6A 3C4ZA 1PXPA 1UU9A 1WAKA 2WMWA 4AA0A 3N4TA 3IW7A 5CLPA 1YHSA 2LGCA 2WTKC 4DEDA 5H9BA 4YTHA 3BWJA 3OWKA 4EHEA 1XQZA 4I4FA 5HE2A 3RVGA 3LPBA 4UWBA 3PUFC 3ALNA 4YO6A 4FV7A 5EM6A 4CFVA 2C6DA 4DHIB 3OC1A 3C7QA 3S95A 1WMKA 4ZAUA 2XAOA 2QR8A 2W4KA 4A9RA 4RZVA 2XZSA 1XH4A 1SZMA 3NUUA 4FTNA 3HZTA 4BCMA 1G8SA 5IEYA 3MFUA 3LCSA 5E4HA 4DN5A 4MUQA 3SW4A 3COMA 4FKWA 4RIWB 5AUUA 5CU2A 3G9NA 4G6OA 5FG8A 3MFSA 4LL0A 4U3ZA 4KSPA 1JKLA 2UZEA 2OW3A 4Y72A 2BHEA 4D0XA 3A7HA 3PE2A 3CQWA 4S30A 3BZ3A 4FTOA 3AXWA 2EB3A 4E8AA 4IWDA 3NFGB 4J53A 5AFVA 4CMUA 3GOPA 3WF7A 4Y73A 5GZ9A 3R9OA 5K9IA 5AADA 4YHJA 3NUAA 4IAAA 3LZBA 1H1WA 3MVLA 3EYHA 4YJVA 2XYNA 3BHHA 4K8AA 1W84A 3TJCA 3R2YA 2RIOA 4C4IA 2OXXA 4OTGA 3OXTA 4U97A 3R9HA 3WZUA 2OG8A 2JDRA 5HLPA 5F9EA 4RG0A 4BZDA 4DLJA 1WBNA 3ANQA 3DT1A 1RDQE 4C7TA 4YTCA 2PPQA 3TM0A 4X2JA 4B99A 4E5WA 3HMMA 3Q4TA 4AZEA 4TY1A 4QMVA 5AUXA 2QOHA 5CI7A 4TWPA 4DITA 3MS9A 3W2OA 2HZ4A 3V04A 2EXCX 1KV2A 3LCOA 2CNQA 2JKOA 4WG4A 4F7LA 4APCA 3TYKA 2NP8A 5TE0A 3TMOA 4I0SA 4I3ZA 3BU5A 1ST4A 2XIKA 4ZK5A 4EYJA 2BKKA 3TWJA 3GC7A 4O4FA 1ZOGA 2JIUA 4O1OA 3LXNA 4GK3A 3F88A 2IN6A 2LAVA 3MPMA 3KF7A 4BB4A 3A8WA 3R2BA 2GCDA 5CYIA 5DGZA 1KOAA 3EFLA 1LEZA 2UUEA 3Q52A 4CQEA 4ZY4A 4QTCA 3LFNA 5CQUA 3UBDA 5CVHA 5FWKK 4W8EA 2AC5A 3R7GA 2XNPA 3HA8A 3RHKA 4DH7A 3CGFA 4DH3A 4E20A 4IVCA 2W7XA 2BAKA 4O0WA 5CU6A 1UU8A 3IW8A 1XHAA 4N70A 4DEBA 4MHAA 1PMUA 3MWUA 4H36A 4YJQA 3UNJA 4IVBA 3F2RA 5I9UA 3TZ9A 4FR4A 4ALUA 5BVDA 2J50A 5JH6A 3E93A 3IOPA 3QHWA 4JXFA 1JWHA 3PE1A 5EW3A 2V55A 3NIZA 4AZTA 3GC9A 5BQ0A 5IZFA 4ACHA 2VWBA 4IAIA 4LRJA 4EJNA 4CKJA 4GVAA 4KA3A 1T45A 2A98A 2BKZA 2WQNA 3PFQA 4G3GA 2E9OA 4L68A 2WNTA 3U9CA 1JPAA 2Q0NA 4CD0A 4CQGA 5HE0A 3OW3A 2PUPA 3PA3A 3EB0A 4B8LA 3RAHA 1KOBA 2YISA 4HPTE 2RG6A 4PWNA 2BIYA 3PXYA 1AGWA 4QP7A 4F0FA 4FJVA 2XNBA 2JDSA 3AC2A 3UIXA 4BWXA 4EBWA 4A06A 4EK8A 3NUPA 3AC1A 2XK9A 5HLNA 1PHKA 4HW7A 5JFSA 2O8YA 5GZ8A 1MRVA 3IOKA 2XIYA 4BDGA 1JSUA 4HVSA 3KN6A 5JRSA 4BDEA 3OUNB 3RAWA 1PXKA 2GHLA 2EXEA 3FYJX 3E7VA 3FXZA 3JXWA 3NWWA 3F3TA 4UY9A 4Y5QA 4H1JA 2QOLA 4E26A 4AS0A 1W2CA 5M07A 5BPYA 1OPKA 4ITIA 3OHTA 2C0TA 2DS1A 4FK6A 4J1RA 4K77A 2WTVA 4MWHA 4GCJA 4WHZA 2E9NA 2XK4A 3GU6A 3RK5A 1GIJA 2HENA 4UV0A 4ENXA 5ACKA 3P5KA 1NVSA 2UW0A 4AP7A 4MNFA 4FV6A 4D2RA 3BYUA 3LFSA 3NDMA 1OZ1A 1OGYA 1ZYSA 3HV5A 1PMVA 3FKNA 3MFRA 3FY0A 4YP8A 3ZHPC 4BTMA 2CKPA 2R3LA 3R8UA 1JQHA 1OL2A 4KIOA 4WRGA 3CY2A 4S31A 4N6ZA 2XK8A 4HYSA 3W0SA 4HNIA 4M69B 5JZNA 4EQUA 4YC8A 4MAOA 3RWQA 3A60A 1YWRA 3KXZA 4A4XA 3VUDA 5BUEA 3B2WA 4KSQA 1OKVA 3W2QA 3UMWA 2VTPA 3PXKA 5L8LA 5FGKA 4ZMEA 3R1QA 4I4EA 4EJ7A 2OZOA 2WU6A 3E5AA 4G17A 3K5UA 4FZDB 4C57A 1J7UA 2CGXA 3OP5A 4XRLA 4PY1A 3LLAA 5M4UA 3DDQA 2BALA 2WPAA 4EYMA 2PTKA 4IB5A 4BL1A 5J9YA 1H00A 4JR7A 2R3IA 2GS6A 2BDJA 3JYAA 1OL7A 4JBQA 4ZJIA 5C27A 5ACBC 2HXQA 4LG4A 3CXWA 3FI4A 4UYNA 4D1XA 3RCDA 4BCJA 3S2PA 4UEUA 4BN1A 4DGLC 4II5A 3CR0A 2YM6A 1OL6A 3TDVA 3UVQA 4F09A 2RKUA 3PLSA 2JDVA 3GT8A 2WQBA 4RX7A 3BHUA 4F0IA 3BLAA 3LIJA 4FUXA 2QOCA 3TV7A 2YWPA 3ZM9A 1DS5A 4DG3E 4OGRA 5M06A 4L9IA 3SGCA 1E9HA 4W4VA 5KMOA 4BCIA 2Y4IC 3TNQB 2RF9A 4CT1A 1Q3WA 3CE3A 5LJJA</