2J7TA

Crystal structure of human serine threonine kinase-10 bound to su11274
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
293
structure length
285
Chain Sequence
b'HVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Activation Segment Dimerization: A Mechanism for Kinase Autophosphorylation of Non-Consensus Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2j7tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2j7tA01
4DGMA 3TWJA 3DLSA 1XBBA 2PUUA 3EKNA 4X3FB 3W2QA 3POZA 5CXZA 1PXMA 4H1JA 3VN9A 4DTBA 3TM0A 5IA3A 1JSUA 4K0YA 3A7IA 3OWJA 4AAAA 2IWIA 2R0UA 5AP4A 4RIYA 4FTUA 2VTNA 5HE0A 5DEWA 2Z7LA 5BVFA 3BYOA 3R01A 5M4IA 1Y57A 4MEDA 4C37A 5KHWA 3CTHA 4UZHA 1OKYA 4NKSA 2OLCA 3PRIA 2WZJA 2UZNA 5C8MA 2R3OA 4ITHA 4JQEA 3F5GA 3FY0A 4I24A 5I9ZA 5JGDA 4Y95A 2R64A 4G1WA 5LXMA 3RNIA 3QF9A 2XYNA 5AR3A 4CSVA 3TDWA 4N6ZA 2Z7RA 3A99A 4UEUA 2R3FA 4X2GA 5IISA 1Q61A 4O6LA 1NVSA 3G0EA 3RK9A 4RIXA 3ZO2A 4I6BA 5ANEA 3DK6A 4J95A 3VULA 4OTRA 2YZLA 2ZV8A 4YLKA 1RJBA 2BAQA 2W5HA 3PPJA 4U3ZA 5CEIA 4FTOA 4D9UA 2GS2A 3FI3A 2P33A 1OBDA 2PUPA 2WFYA 4WNMA 3D15A 5IQAA 4ACDA 3RPVA 3QRKA 4U0IA 1H25A 4A9SA 4E8AA 4FZ7A 2UUEA 3R7YA 3BHUA 5HE2A 2X7GA 4TYHB 3VBQA 3CLYA 3TDVA 3H9RA 2XKFA 5JKGA 5L3AA 3UYSA 2C0TA 1Y6AA 3BLRA 3OT8A 1UNLA 3ZLWA 1H24A 4YO6A 4FTTA 4EOMA 2PZPA 4O2PA 4OT5A 4IBMA 4PV0A 5ANGA 1OB3A 5HCXA 2GS7A 4FVRA 4YLJA 4CZTA 1K3AA 4JAIA 5LMKC 3S00A 3V6RA 4K33A 3LQ8A 4FODA 2WOTA 3HLLA 3MTFA 3SG9A 3B8RA 3ORMA 4FSYA 4I22A 1YWVA 4R6VA 5CI7A 4ZZNA 4DEAA 3EYGA 3SG8A 3QLFA 5AA8A 2RSVA 5DNRA 4WBBB 4UXLA 3Q6UA 3ZFXA 2WEVA 4M13A 1E1XA 3AD4A 3ATTA 3MH2A 4O21A 4U7ZA 2XJ0A 4O81A 2VGPA 3GU4A 4AN2A 5EQPA 3OEFX 4K18A 2PMIA 5DE2A 3LCTA 3NAYA 4D1XA 4UV0A 4FVQA 1W98A 3CPBA 4C33A 1SVGA 1X8BA 4FZ6A 4DAWA 4ZS0A 5A4EA 4UN0C 3LE6A 3KVWA 5AUYA 1PHKA 4JBOA 3HX4A 3MA6A 5LVMA 5J1WA 5B2MA 2CN5A 3FKOA 3DPKA 5KZIA 4EWHA 5HQ0A 4LGHA 3KULB 5DT3A 3EFWA 5E7RA 1U5RA 4YPSA 4GFGA 2GSFA 3PZHA 5ANJA 1KOAA 3BGPA 2OK1A 1W84A 4HCTA 2X4ZA 4PNIA 5BYYA 4NL0A 4DG3E 4FV2A 2ZV9A 3O17A 2HY81 3R22A 2QLUA 4MAOA 2PK9A 5H2UA 3NEWA 2OZAA 5KNJA 5M4UA 5HBEA 4AGCA 3EB0A 3OMVA 2ZMCA 4FK6A 3VJNA 4MNEB 2HZ4A 4GH2A 1L8TA 2EVAA 5E8UA 4G34A 4YZNA 2WMSA 2FB8A 2W1FA 2WIPA 3NWWA 2O64A 2XMYA 4UMUA 2J5EA 4BIEA 2UZDA 3DB6A 3PWDA 4R3CA 3R9NA 5ACKA 4DFNA 4AFJA 2C5VA 4X0MA 1MUOA 4AXAA 4XG9A 3RAIA 1FVRA 4X6RA 3PE1A 4M15A 4BDGA 3RWPA 5IA2A 3SW7A 3CP9A 4OT6A 4BC6A 3H0ZA 4GT3A 3NDMA 3NUNA 3EN7A 3QUPA 1PMNA 3TXOA 1R3CA 3RI1A 1QPDA 4E26A 2BDWA 3OF0A 2YIRA 1QPCA 3WARA 1SNXA 2BPMA 4H3QA 3V6SA 1J91A 2KTYA 2ZDUA 4BDCA 3G5DA 4D55A 2VRXA 2JEDA 2VWZA 2ETMA 4HGTA 3SHEA 5M06A 5ITAA 4EBWA 5M09A 1FGIA 3DKOA 1PYEA 3ZRMA 1VJYA 4QMYA 1GNGA 3R7IA 3NYXA 5D7VA 3SOCA 4BDEA 4FV1A 5M53A 3A8XA 3N51A 4UY9A 1LEWA 2JITA 1PMVA 3KK8A 3NVKI 1ZYJA 2X0GA 4CYIA 2ZM1A 3WBLA 3DK7A 1F5QA 3E63A 4QYEA 4RIYB 4MXZA 4CFVA 1VZOA 4ZMEA 3OXIA 4Z55A 2SRCA 2A1AB 2UW8A 4EK6A 4OAUC 3FLYA 2R3IA 5D7AA 4ANMA 4QD6A 4WKQA 4AQCA 4LGDA 3Q5ZA 4YSMA 5CLPA 1BL7A 3Q2MA 1FVVA 2JC6A 4QTEA 1H4LA 4BY9E 4LL5A 2VN9A 3IK3A 2JDSA 3NUYA 5HO8A 4L00A 4N6YA 2ACXA 2G1TA 3FQHA 2QHMA 3ZRLA 4O0YA 4QMNA 3EQRA 4FTNA 3Q53A 4FSUA 1APME 1ZLTA 4NW6A 4U43A 2PMLX 4RIXB 2JFMA 1BUHA 1WBNA 5M55A 2Y6OA 3O0GA 3QU0A 3QD2B 1FVTA 2ERKA 3NYOA 2GHMA 5DLSA 4CQGA 4P7EA 5AAFA 4C3RA 5J87A 3WZUA 4BCOA 3G9LX 4LMUA 1BL6A 3EIDA 3O7LB 3QX2A 2QOIA 3FKNA 4IM2A 2Y7JA 3MB7A 4JG7A 3RNYA 3HMOA 1JOWB 4NCTC 4YTIA 2R7IA 3OWLA 3O7LD 3SD0A 1YRPA 4IFCA 4IJPA 3QTSA 2OF4A 4FKTA 5M4FA 4EHZA 2BDFA 3AC8A 3IGOA 4OGRA 3R0TA 3MBLA 3UJGA 1ZMUA 4O7NA 4F7SA 2I0HA 3P7CA 4GL9A 4TNDA 3VS2A 3LM5A 5FLFA 4D4RA 3KXNA 3UG2A 5F94A 2XK3A 2R3GA 4X7QA 4RJ7A 5AR2A 3D5WA 4F7LA 2G9XA 3D2IA 3QQKA 4EEVA 4USEA 2WTKB 5E8ZA 4ZIMA 3L8PA 5AUWA 4LUEA 4JBQA 4LL0A 3WIKA 4A9RA 5CANA 1CKJA 3HRFA 3RKBA 3LPBA 3UYTA 5CI6A 5AR5A 4RSSA 3UOJA 2VNWA 2HOGA 5BUEA 3GQIA 4YJRA 5AP7A 4FTCA 5FBNC 4KKHA 4MWIA 4GUEA 3OT3A 3E7OA 5BYLA 2X7OA 4ZEGA 2Q0BA 5A4LA 1VYWA 2G2HA 4HGLA 4D4SA 4AW5A 3KQ7A 4EH5A 1G3NA 2YAAA 3HDNA 4TWNA 4YC3A 3C4FA 2JAVA 4G3GA 5IQBA 5HG8A 4OTQA 3LFEA 3W10A 2YFXA 4CEGA 5J9LA 4I0SA 4A4OA 5EQYA 3TJDA 4U81A 5FTOA 3EJ1A 2YCQA 4RVTA 3WOWA 3P86A 3EN4A 1XR1A 4FV8A 4NM3A 4JDJA 2VUWA 5J7HA 2XZSA 2VWUA 3HECA 5AUUA 3MIAA 2UW7A 3TIYA 4GVJA 4FE2A 2C5YA 2Z7SA 4DFLA 1LR4A 2IW6A 2JKOA 4EH2A 4L7FA 5HTBA 3KMUA 4I5HA 3ANRA 5J7BA 5M44A 2B0QA 2PU8A 4O7VA 4JOAA 5I0BA 4XG2A 3RBWA 3QXOA 4ORKA 4FGRA 4CZUA 4QP1A 2BHHA 1J1CA 2OZAB 4Y8DA 4MQ2A 4YTHA 3UNKA 3TI1A 3OY3A 3QBNA 4G2FA 5IUIA 1OIYA 2R4BA 4MD9E 2CKEA 3DKCA 3LJ2A 1KWPA 3IECA 4FTKA 5JFXA 1PRYA 4QMPA 4O86A 3UO4A 4APPA 3QCQA 2QI8A 4JDHA 5HX6A 3DBQA 1Q8YA 3FSFA 3W1FA 1I09A 3I79A 3RHKA 3WE8A 3JYAA 1UU8A 4V04A 2BKKA 4BDFA 4LMNA 1Q97A 2E9VA 4M69A 4EUUA 4UB7A 3GENA 4FTJA 3TNHA 3Q2JA 4JS8A 5JGAA 1ZWSA 5EW8A 3S0OA 2YAKA 3DJ7A 2UW0A 3JY9A 5I3RA 2ZOQA 1QMZA 3E8NA 2W4JA 3KU2A 4KSPA 4YBKA 4IB3A 4E7WA 3KRWA 4FKVA 3OS3A 4Z16A 4RA4A 4D4YA 2HXLA 4GJ2A 5CY3A 5E8XA 4TTHB 3LCDA 4OBQA 4XG8A 4E6CA 3S3IA 3EL7A 4RVMA 2BALA 4Y5QA 4CV8A 4Z7HA 1IA8A 4PWNA 2X7FA 3DJ6A 4DLJA 3Q96A 2CKPA 2IJMA 3EZVA 1F0QA 4ALWA 2G2IA 2XM8A 1H1WA 4L46A 2WMWA 2YWPA 5M56A 3GQLA 4PPAA 4S2ZA 2BZJA 5HHWA 4ANLA 1Y8GA 1YI4A 3QRUA 5L8JA 4DEHA 2ZM3A 2VWXA 3OTUA 3JR1A 1H00A 3FUPA 4Y83A 4E5AX 4GMYA 4P5ZA 1B38A 2WTDA 3ZH8A 5CZIA 3LXNA 5HGIA 1L3RE 4WNOA 3D0EA 4EOOA 2NP8A 2OJJA 3TZ7A 3G6HA 3DAEA 1GZNA 5AP1A 3RCDA 2VX0A 5CAUA 5L8KA 3FI8A 5DR2A 3LKMA 4JG6A 4JG8A 1SVEA 4F0FA 1H26A 1YXSA 4EOPA 1CKIA 4ASXA 1ZMWA 2I0VA 4RZWA 2X39A 3NAXA 1YXVA 2BFYA 3QRIA 3C5UA 4YP8A 3HKOA 2RG5A 3LCKA 3POOA 3HRBA 4O2ZA 2XYUA 3ZUTA 3IOPA 2QOCA 2BDJA 4GW8A 4RA5A 5CSHA 1KSWA 4ZOGA 3TKHA 3BBTB 3F3ZA 1YDSE 4E5BA 4DTKA 3UC3A 3RJCA 4BN1A 2IZRA 4ASZA 2BROA 5D9HA 2IZTA 3AMAA 3W2OA 3MVHA 4HCUA 4U97A 4ZSLA 5HNIX 5IQIA 5A6OA 3PA4A 5E8WA 2XB7A 4IZAA 4GU6A 4JDIA 2WIHA 1K9AA 3FXZA 3IW4A 4NKAA 4B8LA 1W8CA 3QKMA 3HMIA 3FAAA 2G2FA 4CMUA 2ZM4A 3KF7A 5LVLA 3VBYA 1ZYSA 3KMWA 2PVRA 2XRUA 2WD1A 1PKGA 4IZ7A 3GT8A 4L52A 4BBMA 4FT3A 4FSZA 3SXSA 4CCBA 3GC9A 5HTIA 2EXCX 5BUJA 5FDPA 4AA5A 3MW1A 5EK7A 1CTPE 3Q3BA 5T68A 5GHVA 4FL1A 4I23A 2VTRA 2C6EA 4PP7A 5C4LA 3KN6A 4IAIA 4FNXA 1URWA 3CXWA 3F5PA 4TRLA 4W4YA 3TNPC 4NJDA 3CJGA 3BU3A 4GK4A 2VO6A 5TR6A 4BYJA 2IG7A 3P0MA 3ZBFA 2BUJA 2X2LA 4EKLA 4ZTSA 3SQQA 2B53A 4S31A 3MV5A 3MN3A 2PZ5A 2WKMA 3ORKA 3O2MA 1DI9A 2B9JA 3PPKA 4EH6A 3SOAA 1UU3A 4WUAA 3MVJA 2UZTA 5CNOA 4DEDA 3BRBA 5I9WA 4MXOA 4RT7A 3BZ3A 4AOTA 4CFMA 4E4LA 5AADA 1H08A 2GNIA 4O7SA 2W1IA 1P5EA 5FWKK 3VBXA 3KA0A 3OROA 3EN6A 4O38A 4RVLA 1Q62A 1RDQE 4CRSA 2WTCA 1U59A 3HNGA 4FV5A 2IVUA 4XV1A 1U46A 3HA8A 5C9CA 3MB6A 3L9LA 1KE6A 1PXLA 4G3EA 4BCGA 3UDBA 4FKOA 4L68A 2QCSA 4CZYB 3HP5A 2WQNA 2QC6A 4BWPA 4I5CA 5CSXA 3EFJA 3NUPA 4FKSA 3ULIA 4FEVA 4FEXA 1YDRE 5EG3A 4O0XA 2GFSA 2XJ1A 5FP5A 5H8BA 2WOUA 2YIQA 4RLKA 3JS2A 3AGLA 4OTGA 2O65A 2W05A 3R9RA 4XCUA 1FMOE 4DFBA 1O6YA 3KY2A 4EH4A 3CGFA 5IH5A 3VC4A 3LQ3A 5LVOA 4M69B 3ZOSA 4BCNA 3F82A 3L9MA 5LQFA 2EXMA 3LXLA 4FTRA 3R7OA 1J1BA 3TT0A 2PMNX 3ZU7A 5CEOA 1GIJA 1GAGA 4AOIA 3NW6A 3P08A 3OY1A 5IQFA 4LYNA 4S33A 3ODZX 4Q5EA 4GCJA 4FIFA 3ZTXA 3NUAA 2CGXA 4ANQA 2IN6A 2JBOA 2VWIA 5FDXA 5IQCA 3MVMA 2PVMA 4ITIA 4BDHA 1Q8WA 4O0VA 5ETAA 4ZSAA 4IIRA 1BKXA 4GV1A 4HZRA 4IANA 3Q32A 4ZJJA 2XNMA 1CKPA 2Y4IB 2H8HA 3QC4A 3UP7A 3EZRA 4ZTHA 5AP6A 1UNGA 3L1SA 5B2KA 1J7IA 3JY0A 2RFDA 4C4IA 3FMKA 2OO8X 2XKCA 4PX6A 1P2AA 4F1TA 3UVRA 2FSMX 5L6WL 1T45A 2ITWA 4JBVA 4EYMA 3F61A 5AUTA 3BQRA 5D41A 3E8DA 5DRBA 3L8SA 4O6EA 3LLTA 4GYGA 4QQCA 3U87A 3FXWA 3OUNB 5M4CA 1ZYDA 1R0PA 2ITTA 4W9XA 4F1MA 1XH6A 4KIPA 4NUSA 3QZIA 4L67A 4BI1A 3RINA 4BI2A 2QNJA 1CM8A 4CTBA 3CY3A 4G6NA 1IAHA 1WMKA 1QPEA 4YJUA 3UOLA 3W55A 3DBCA 4FKLA 5KMKA 4NM7A 4GFMA 2UV2A 4WG3A 3ZYAA 1FPUA 3R21A 1WBOA 3ZO1A 2FSOX 2OIDA 3O71A 3U4UA 3ET7A 2WU7A 4LGGA 1J7UA 2W1HA 3A7FA 3D9VA 4PMSA 1Q5KA 3FV8A 2I6LA 4X3JA 4X6QC 4D2VA 3DZQA 4APCA 3W2RA 4C0TA 2HZIA 5EW3A 4IDTA 2BR1A 5J5TA 4E4MA 2W1CA 3KGAA 2A19B 2GHGA 2OKRA 4ID7A 3R7EA 4EKKA 2E9OA 3G51A 3SKCA 1GY3A 4IZ5A 3CKXA 3ORPA 3PVGA 2UZEA 3DK3A 5CAQA 1Z5MA 2X6EA 3Q4UA 4MYGA 3IKAA 5A54A 3OFMA 5A6NA 2GTMA 4JDKA 4E93A 3COMA 5KUPA 3PP0A 3UIXA 4KIQA 5LMKA 3A61A 4FGBA 5M08A 3R2BA 4ACHA 4AU8A 1PW2A 2J9MA 3GFEA 4IB5A 4ASEA 4BRXA 3PVBA 3R02A 3UZTA 3ELJA 2W99B 2YLFA 3BV3A 4XOZA 5AAEA 4QP9A 4AT3A 4GUBA 5B0XA 3I6UA 1JKSA 1PF8A 3K5UA 1OPJA 3R71A 5CX9A 3R8UA 4DEEA 5GJFA 2JKQA 3P79A 3PUPA 2BRBA 3NUXA 5CT7A 4CFXA 4YMJA 2R3PA 4G31A 2GFCA 2J5FA 2BZKB 4NH1A 3HAMA 2C6IA 4FT0A 4QPMA 4QMSA 5EOLA 5JK3A 3H0YA 5IDPA 2G01A 2IZSA 4UX9A 2I0EA 3JXWA 3PY0A 4FYOA 4ANSA 2J4ZA 4DITA 2FVDA 1W0XC 4YJTA 4ZK5A 3VW8A 3MTLA 3BYMA 1H27A 2BZHB 3KN5A 3QTUA 5L8LA 3SAYA 3PYYA 5CWZA 4XRLA 3C4WA 3NUSA 4BB4A 3COKA 4CGAA 3A4PA 3BYSA 4IX5A 3VW6A 3NX8A 5M57A 1QL6A 4HOKA 2X8IA 2EWAA 2PVJA 4DGOA 3DOGA 3PLAE 3K5VA 3V8WA 2XS0A 1PYXA 3HV5A 4BTJA 1WBWA 3T3VA 2BKZA 4G6LA 3I7BA 5DHJA 3ZXTA 5HVKA 3FZPA 4WBOA 1GZOA 5I9UA 4G5PA 2NNWB 5GJGA 1JSVA 4MWHA 4CXAA 2PVLA 4DH5A 4TL0A 4DBNA 3HDMA 3OHTA 3BU5A 3RK5A 3PG3A 4CFWA 5HNBA 1WVXA 2HIWA 2WXVA 4GRBA 5D11A 3TKIA 4FSQA 1NVQA 1OIQA 4I5MA 3WZDA 4YURA 4U44A 3AC4A 3DQWA 1KV2A 2VTAA 4ZTMA 2WMXA 4CYJA 3LVPA 4LM5A 5TKDA 3C0IA 4DE4A 2F2CB 2W1GA 3C4XA 2R3NA 4OW8A 5EYDA 4ALVA 2QG7A 4L9IA 4EC8A 2WB8A 4HGEA 5AV1A 3RVGA 3U54A 3OC1A 5AP2A 3VS5A 5L6OA 1FBNA 5KX8A 3AC1A 2WTIA 3KL8A 4W8DA 5AEPA 5CASA 4XUFA 5AUXA 5K4JA 5GIPE 3I0OA 3VO3A 2C6OA 4GG5A 3D14A 4HVIA 1ZZ2A 3ORLA 2QHNA 3OXTA 4EZ7A 3Q9ZA 4OBOA 4RX5A 2PPQA 1IASA 3ZMMA 3PLSA 3ZSHA 4RX8A 2Y8OA 4OTHA 2CN8A 3AXWA 2Z2WA 3VF9A 4BTMA 2C6KA 3QTWA 4QNAA 4CFUA 4XOYA 4FA2A 3R28A 4D58A 3OW4A 4BWXA 3MPAA 1GZKA 4IAKA 5KMIA 3ZDUA 4KRDA 4AGUA 5KCVA 3R8LA 4A9YA 3SGCA 2VZ6A 4QPAA 3DY7A 3HUCA 3R1SA 4JVGA 4RVKA 3PXRA 2X81A 1ZY4A 2XBAA 2RKUA 5DR9A 4BCIA 2W4OA 4D1ZA 3UZRA 2UVYA 5A4CA 5HOAA 2F49A 2J50A 5CF8A 3G9NA 3RAKA 1VR2A 1GJOA 4R3PA 2DS1A 5FP6A 2VO7A 3NSZA 2EXEA 3RK7A 3VS4A 1OGUA 1XWSA 3GOPA 5IEXA 2NO3A 1OITA 4V01A 4EOLA 4B99A 4RFMA 5C8NA 2OJFE 4DCAA 3WF8A 3MY0A 3QALE 2Z8CA 2PHKA 2XK7A 4NCTA 1OZ1A 5DH3A 1R39A 3IOKA 4AGWA 4AN9A 3WE4A 5DRDA 2XK8A 4Q9SA 4EQCA 3KMMA 3EQIA 4AW2A 3PWYA 4F6UA 4XYFA 5DMZA 3W32A 5EI2A 3ETAA 3R83A 1XH9A 4FEQA 3EHAA 3ZHPC 4DFYA 5EQEA 4ONAA 4BHNA 3FMJA 4G9RA 4J71A 4ZY4A 3R8VA 1MP8A 1Q3WA 2BRNA 4C4GA 3UO5A 5HORA 3GOKA 4KAOA 2PULA 2C68A 5G6VA 1XQZA 2GMXA 5C27A 5L2SA 4PDPA 4I0RA 3QRJA 2BVAA 3P7BA 2ITOA 2XK4A 2O63A 3U6IA 4OTPA 4I6FA 2QKRA 3A7JA 4Y46A 5GNKA 2QURA 5EHYA 3NNUA 1QCFA 2NPQA 2XNOA 4QP3A 4W4XA 3QYWA 4IAZA 1CDKA 4UMRA 1ERKA 4IQ6A 2OFUA 5HLNA 2BAKA 5A3XA 3E93A 4BKZA 2NRYA 2YABA 3TL8A 4F6WA 3LXKA 1Q8ZA 4IAYA 3D94A 4IB0A 4JNWA 4DF3A 3R9HA 4JBPA 5JFSA 1XH8A 2AC5A 1XKKA 3M2WA 3BU6A 5D12A 2A4LA 4V05A 4K11A 1Q41A 3QTXA 4MF0A 3L9PA 4MK0A 3W8QA 3BEAA 4L3PA 4UYNA 3Q52A 1MRYA 3KRLA 4O0SA 3R7UA 5DN3A 4FV6A 4RX9A 5IDNA 1JWHA 2DUVA 1H1SA 4HJOA 2HY0A 4J8NA 4YNOA 3ZBXA 4F99A 4D2PA 4FTAA 5BVKA 4BDBA 2FH9A 3P4KA 1U5QA 2GNFA 4FV3A 3G15A 4FTLA 3BCEA 3QZHA 2HAKA 3AT3A 3I5NA 4YZCA 3HUBA 4Y85A 5EOBA 4D0WA 2C0IA 3UNJA 4CG8A 5CSWA 2QOKA 2UZOA 3F6XA 3BYVA 3R7GA 1O6LA 3UO6A 3F2AA 4HYUA 5FXSA 3OCGA 1JKLA 3G33A 4FSNA 4GK3A 3KREA 4L45A 5EM7A 3TNWA 3G2FA 4ZXTA 2CCIA 4EL9A 4QMWA 3BGZA 1B39A 2CPKE 3DDQA 3WF5A 3HYHA 5KMJA 4GJ3A 2YIYA 5DGZA 4KINA 2R5TA 3AT2A 4RQKA 3DCVA 3S95A 1ATPE 3QCSA 1OKVA 1H1QA 4WUNA 5JN2A 3F88A 3CSVA 3JVSA 4C59A 3ZXZA 4FT9A 3CIKA 4FV7A 4G3FA 5ANDA 5EH0A 5TOZA 2JD5A 4F64A 1WBTA 3C13A 4HVSA 4NW5A 4BR3A 4O0UA 3IW6A 3PXFA 2BMCA 2HXQA 3PA5A 5HO6A 2IW8A 5HD4A 1OL1A 4C2WA 1E9HA 2ITVA 3R04A 4IE9A 5IA5A 4XMOA 5J95A 3IDPA 1JSTA 3MY1A 4F6SA 3BHHA 4M97A 3O8UA 1LP4A 2CGUA 2R3HA 3M11A 3QTRA 4XHKB 2PVFA 2QR7A 5AUZA 3MYGA 4N57A 2VTOA 5C8KA 2C3KA 2WMBA 4PTEA 4O27B 4YR8A 1W82A 3CE3A 1H1PA 5IA1A 3C5IA 2F2UA 3BHTA 3CS9A 1O9UA 3KK9A 3RAHA 4F9CA 2WMRA 3HGKA 2WNTA 3PJ1A 3RWQA 2YJRA 3FZOA 3IQ7A 4JQ7A 4Y73A 4HVDA 5GINE 5BYZA 2CGWA 4BCJA 4C7TA 2IVTA 3NS9A 4IAAA 3DTCA 1ZOHA 4JX3A 1M17A 4IVCA 4U79A 4XBUA 1PJKA 5HEZA 3ZZWA 5HNGA 5HO7A 4CQEA 2X1NA 2HELA 1IG1A 2VO0A 5JRSA 3TKUA 3NLBA 1JVPP 4GK2A 4U40A 5H9BA 2XP2A 4FV4A 4E6QA 2ZMDA 4FIHA 4IADA 3Q4TA 3QFVA 1XBAA 2H6DA 2UZUE 3DLZA 4L7SA 4S34A 4EOKA 4JR3A 2GQRA 5T6KA 4ANNA 4J8MA 2XM9A 4EORA 1KE9A 1NW1A 3FSKA 3UODA 3R7VA 4NFMA 5TO8A 3OG7A 4GVAA 2VD5A 4AUAA 4BTKA 3F2RA 4FSTA 3EQPA 5C03A 4OUCA 4ZSJA 4DG2E 4ANBA 3WZJA 4CFNA 4P4CA 3K54A 2DWBA 3REPA 1A9UA 1MRVA 5GZ9A 2OJGA 5HG5A 4DGGA 5CVFA 3GP0A 4QYFA 3OW3A 4A9TA 4YUQA 4G9CA 4MXXA 4XV3A 4B7TA 3DXPA 5CS6A 5CZHA 4FEWA 3NYNA 3Q5IA 4F4PA 2RL5A 4NFNA 3NPCA 2FA2A 3QWKA 4O91A 3PZEA 3V8TA 3QCXA 4FV9A 4IJ9A 1NA7A 3D5UA 4P90A 3C9WA 4BIDA 2B7AA 4NSTA 3MIYA 3Q9XA 4W8EA 3F9NA 2Y6MA 4YJSA 3FLZA 1BYGA 4JXFA 5FRIA 3SX9A 1XBCA 3BQCA 4IB1A 2YWVA 1YKRA 3QQJA 4LV5A 5CYIA 1Z57A 2QODA 3ZONA 5BVEA 4BCKA 4H58A 3K3IA 5F1ZA 5CF5A 4U3YA 3B8QA 5T3QA 4CT1A 2YA9A 4LFIA 2VTQA 3I6WA 4C35A 4CNHA 3HMNA 4LQMA 4F9YA 4IM3A 5J8IA 3VS0A 2O8YA 4WSQA 2CGVA 2QU5A 5CF6A 4FNYA 4F63A 4FKGA 4OBPA 3K3JA 5I9VA 4IWQA 3B2TA 2WAJA 3C50A 3GU5A 3H10A 2PYWA 2ITZA 1ZZLA 2XNNA 1T46A 4ERKA 4IM0A 4XJ0A 3C4ZA 4HW7A 3TV6A 4IW0A 5K5XA 1HCLA 4RC2A 4ZLYA 2YIXA 4R1VA 4KIKA 4L3LA 1YW2A 2UW5A 4KA3A 4H05A 2NRUA 2JFLA 1PXPA 2O0UA 3SXRA 5FBOA 3BHYA 5CEMA 3WYXA 2XKEA 3DNDA 4BGHA 3GC0A 3MA3A 5E1EA 3ID6C 4IHPA 2W5BA 2Z7QA 4FMQA 4CTCA 2REIA 3EN5A 5HZNA 3CEKA 3U9NA 4EJNA 4BKJA 3FYJX 3D7ZA 3MPMA 2UW4A 3EKKA 4ENXA 1JKTA 5EHLA 5I4NA 3TNIA 5DG5A 3A7HA 3MDYA 4GKHA 5BVDA 3LW0A 4ZTNA 3MESA 3GCSA 4M7IA 3WF9A 3MGYA 4JQ8A 5E91A 2BIKB 5BMSA 3OWPA 4RJ8A 4PY1A 5ACBC 3PXQA 2YJSA 2E9UA 4H1MA 3ORNA 3KB7A 2OU7A 4QMUA 4EZ3A 5AAGA 2C5XA 3QZGA 2YEXA 3R1QA 4EC9A 4J52A 1OUKA 2VNYA 1P4FA 3AGMA 4WG4A 3ULZA 3UQFA 3O23A 4O84A 2HWPA 3NGAA 3JUHA 3ZS5A 3BLHA 2PMOX 4D2TA 3RAWA 2R9SA 2VV9A 1IR3A 5K0XA 4GKIA 3AC5A 1W83A 1GOLA 3NZ0A 1U4DA 5DR6A 5DT4A 1OVEA 3QQLA 5EW9A 3EQGA 2W1DA 4EQUA 4EQMA 2C69A 2XKDA 3ERKA 4I0TA 3SV0A 3ZLYA 4IC7A 4DH8A 3ATSA 5DVRA 4AWIA 2C47A 4U42A 2GHLA 4XLVA 4YPDA 4BF2A 4BHZA 3FKLA 3PIXA 3VNTA 4IAFA 3PG1A 2XF0A 3PY3A 4FKPA 4DTAA 4AACA 3OD6X 5LWMA 4BDIA 2BILB 3P5KA 4PTGA 4MKCA 5I3OA 3R1NA 4TYJA 3L8XA 1TVOA 5HIEA 2JKMA 5EI6A 4DT9A 3R30A 3IS5A 3ZEPA 3BE2A 4FK3A 4QTAA 4WA9A 4AF3A 2CKQA 4J98A 4YO4A 2X6DA 3VRZA 5HTCA 4AZFA 4CV9A 2O2UA 3M42A 3E87A 3UP2A 5JFVA 4MTAA 3ZRKA 2VTPA 1BI7A 3CD3A 4R1YA 4WT6A 4ZY6A 3QGYA 3MH0A 3T3UA 2FGIA 3QA0A 4FTMA 5HICA 3UBDA 4D0XA 2C1AA 3Q04A 4IH8A 4M0YA 5F9EA 4CVAA 5FM2A 4QNYA 5HD7A 3FMDA 4C4JA 3DBDA 2B55A 4FSRA 1JQHA 2YHVA 3NR9A 4IVAA 4KRCA 4U80A 3ZFYA 4BBEA 5AV4A 3R8PA 2Z02A 2XCKA 3MWUA 5B2LA 3VHKA 2J6MA 1DAYA 3ZUVA 2AUHA 3DAKA 2UZWE 2YCFA 4C8BA 1Y8YA 4J7BA 3TZ9A 3CD8A 3FMLA 4UALA 5DOSA 3UPXA 2C3LA 4UMPA 4RIWA 4AX8A 5HLWA 4I94A 3E3PA 3BI6A 2C6MA 3EWHA 1OM1A 3PY1A 4HYHA 4E1ZA 4I1ZA 3I1AA 5KKRC 5CVHA 3BYUA 3DFCB 4E5WA 4F70A 5CEKA 4MH7A 1G5SA 5J1VA 3AG9A 2I7QA 4XG4A 3VUTA 2XJ2A 3QLGA 4PDSA 4O7RA 3FWQA 2C3JA 4HGSA 3FC1X 4C2VA 2W96B 4FX3A 3SLSA 1REKA 3Q60A 4K8AA 4TWPA 2P55A 4FIEA 4B8MA 4EZ5A 1YOLA 4ENYA 4IVBA 5FM3A 3WILA 3EFKA 2ONLA 3VUGA 3TZ8A 2VTJA 4JT3A 2H96A 2WPAA 3H9FA 3LHJA 1PY5A 4RRVA 4EH9A 4F9AA 4AT5A 2Q0NA 4E20A 4KKEA 4KIKB 3G6GA 4DN5A 4ZZOA 4BDDA 2VWYA 4K1BA 2GNGA 3HZTA 3QC9A 5E1SA 3DAJA 3UVPA 3P78A 4YJPA 3TUDA 3HL7A 4O0RA 3OUKA 4YGAA 1EH4A 4QP7A 5FXQA 1OKZA 3RZFA 2GU8A 3AC2A 4KB8A 3GU7A 4DH1A 5L4QA 3V3VA 4DFZE 3KCFA 4RIOA 3G90X 5DEYA 3R8ZA 4EONA 4ZLOA 4XG7A 4AW0A 3L9NA 2XRWA 3MFUA 5KBRA 4F08A 2HCKA 2JIVA 3PXYA 3FZ1A 4DINA 4BDKA 2VO3A 5BNJA 5BUIA 4OR5A 4ZTQA 4FIGA 3VVHA 5AP0A 5DA3A 5K9IA 3DXNA 4YJNA 3W2SA 1PXJA 4F09A 3FL4A 3FZSA 3IDBA 3QTQA 4KWPA 4MD8E 1YI6A 4TWCA 4H3PA 4DHFA 4EHVA 2VWWA 3VUMA 3SVVA 3LJ1A 2JGZA 5EM5A 3DKFA 3RPYA 1SMHA 1Q8TA 1Q99A 3UMWA 2WO6A 1S9JA 2UVXA 4MXCA 4M3QA 5HKMA 2P4IA 4O0TA 3WIGA 3NVMB 3VS6A 5E4HA 3MFTA 4FTQA 4ZTLA 5CT0A 4RBLA 4C34A 2GDOA 4J97A 4K6ZA 4AG8A 5CF4A 1OL5A 2ETKA 3JVRA 3L8VA 3OVVA 4O1OA 3F3VA 1JNKA 4RLLA 5EDRA 4BWKA 2EU9A 3D7TA 1FINA 3C4CA 4IC8A 4CD0A 1TQMA 4HCVA 4J99A 4EJ7A 2WQOA 5JZJA 3ODYX 5CALA 5IEVA 5JSMA 1WBVA 3F2NA 3DFAA 3IW5A 4KS7A 4YNEA 5E8TA 3WF7A 2VX3A 3IW8A 4YJVA 3DU8A 4MXAA 3I60A 5AV0A 3RZBA 3CGOA 5CU3A 4O7YA 2BRHA 4RJ3A 4DH7A 4CKRA 3LZBA 2B9HA 3GCUA 3VF8A 4DG0E 4RC4A 2F4JA 4PMPA 2JBPA 3TV4A 4ZJVA 3ZLSA 4TZRA 2W1EA 4C4HA 1ZAOA 2OH0E 2VTTA 4IZYA 3UOHA 3DXQA 1UWJA 1MQ4A 4D5KA 2GTNA 3VAPA 4CFFA 3QX4A 2I1MA 4FR4A 3RPRA 5CAPA 3II5A 3LFBA 5IMXA 4D5HA 4PDYA 5CU0A 3PSDA 4HVHA 4RWKA 4Z9LA 4ZMFA 5C4KA 3D5XA 2YM6A 3ZCLA 2XIXA 3LAUA 3I5ZA 1H8FA 4I92A 4FKRA 3F5XA 1YHWA 4OAVB 2FYSA 3BEGA 4W4VA 3JPVA 2WQEA 3D5VA 1YXUA 4QPSA 4HVGA 5IUHA 4MXYA 4K77A 4MCVA 2CHLA 1DS5A 3CCNA 4R5SA 1O6KA 4JIAA 4N70A 4FYNA 4A4LA 4ARKA 5EM8A 3QCYA 2PTKA 5AMNA 5E8VA 4NYEA 2QOOA 4BZNA 2LAVA 1BMKA 3ROCA 3KRRA 4ASDA 2VTIA 5HBJA 3S1HA 2W7XA 3LFNA 2W17A 3PVWA 5EYKA 3AD6A 2YDKA 5ANIA 1LEZA 1YI3A 5CNNA 5CVGA 3SC1A 5FEEA 4DEIA 3KRJA 4GIIA 3MH1A 4RIWB 4EOIA 5CEPA 3LM0A 3LMIA 2BTSA 3VS1A 4CG9A 3QQUA 3KXHA 2VX1A 2F7ZE 4ZP5A 4R7BA 1CMKE 1U54A 3E3BX 4N4SA 4QYYA 5FTQA 4CRLA 4GU9A 3QL8A 3BLQA 4LOQA 2GS6A 4NT4A 2HZNA 4RFYA 1MQBA 3FLWA 5BQ0A 3QUEA 1F3MC 5FUTA 4YZ9A 4KUJA 2ZB1A 1FGKA 2ZVAA 3VWAA 3UC4A 3PJ2A 5CEQA 4LOPA 2X9EA 3QTZA 2J51A 4U9AA 4R77A 3PSBA 2FO0A 3VQHA 3FLSA 2UW6A 2H9VA 2XK6A 5LCKA 3UTOA 4AA0A 4ZY5A 2GPHA 4FOCA 4YJOA 3UQGA 2KULA 5AIKA 5I9XA 2PE0A 2OJ9A 5C1QB 2ERZE 1YWRA 4O1PA 2XNPA 2W0JA 4YLLA 4AP7A 3KXMA 4KSQA 4AT4A 4BCHA 1ZMVA 4UWCA 4RJ4A 3LOKA 4FT7A 4XV9A 4YC8A 4I93A 3A2CA 1WFCA 5KZ0A 1FOTA 3OCSA 4I3ZA 2XIKA 4FTIA 3QQGA 4FOBA 4MF1A 3ORXA 4IWOA 4QMVA 4X3FC 5IQEA 5EKNA 3CJFA 4HPUE 4YZMA 4AZSA 4BIBA 2V55A 4QMZA 4FIJA 4XRJA 2BHEA 4M0ZA 3BWFA 3TG1A 4NM5A 5ANKA 4Q9ZA 3LFQA 1PXKA 3O51A 3BBWA 3U51A 3FPMA 3R9OA 4NTTA 3UIBA 3U4WA 4LOOA 2OXYA 1UV5A 3LFSA 1UVRA 4MHAA 2BTRA 2PL0A 3ALOA 4HPTE 3EYHA 4E73A 3FJQE 3NMUF 2X2MA 1G8AA 4BL1A 1TKIA 3O8PA 4M66A 2Y0AA 2C6LA 4BKYA 5KHXA 3GU8A 3GC8A 4AN3A 3TN8A 5AM7A 2VWVA 4X21A 1YQJA 1YOMA 4UBAA 4YHFA 4BDAA 5D1JA 3E5AA 2P2HA 2YM3A 4PL4A 4ZAUA 1AQ1A 3RCJA 1V0OA 3UQCA 2O5KA 2B52A 3ZC5A 4PMTA 4ZSEA 1H1RA 5BPYA 1Z9XA 4JJRA 3SDJA 3UOKA 4NM0A 2CNVA 4LV8A 4LUDA 3SW4A 2QO9A 3F7ZA 4KBAA 2V7OA 4XG6A 5AX9A 3MPTA 3BWJA 1M7QA 3D7TB 3ITZA 1PXIA 3OEZA 2UZVA 3PSCA 3E62A 5F95A 5ANOA 2WMAA 4NEUA 5E8SA 4C36A 5C26A 4XG3A 1A48A 4F1OA 3PPZA 1OI9A 4L42A 2ZJWA 5GIOE 1KE7A 4QMTA 2UVZA 3O96A 4QP2A 4Y5HA 3D83A 3FC2A 4L44A 4DBXA 3DNEA 2UW3A 2XVDA 2XBJA 3KF4A 2XNEA 1PMEA 4FUXA 4EOSA 4FG7A 2ITNA 5DT0A 2GNLA 5FEDA 5KMLA 4B9DA 4BCMA 1NT2A 3I81A 3F3TA 3G0FA 4QQTA 1OPKA 3DTWA 4WRGA 3IG7A 2Y9QA 2JLDA 2XNBA 2ZYBA 3LMGA 3GBZA 3VJOA 3S4QA 4CKIA 4F65A 4WRSA 2QR8A 5A4QA 4Q5HA 1KUTA 3RALA 2C3IB 2IZUA 2PVKA 2PVHA 3PRFA 4F7NA 5DWRA 4ANOA 4FL2A 2R3RA 4PRJA 3KFAA 4B0GA 5EYCA 4MBIA 4EH3A 1PXOA 4F7JA 4RPVA 3EQBA 5I5ZA 1GIIA 1ZOEA 2ITYA 4CT2A 5CSVA 3P1AA 2JDOA 3T9IA 2ZV7A 4GS6A 3NW5A 4WNPA 3CQUA 2WQBA 2V0DA 4YC6A 4AW1A 3RM6A 5HI2A 3T8OA 3V04A 3IONA 5E9EA 4JR7A 3ZM9A 2BCJA 2UZLA 3O50A 3TUCA 2ITPA 3FPQA 3V5WA 3ROYA 3HRCA 3QQHA 5LVPA 3FHIA 1H0VA 2OH4A 3NUUA 4DGLC 5B7VA 4OTWA 4WIHA 3QGWA 1BLXA 4YU2A 5L6PA 2QD9A 3R1YA 1Q3DA 3UZPA 4CMOA 5K0KA 1KOBA 2YIWA 4PMMA 4AA4A 5A14A 4ACGA 3FEGA 3EQDA 4I4FA 3OZ6A 4MQ1A 2E2BA 5KMMA 5AIRA 2F57A 1H0WA 1U54B 4RJ6A 5DIAA 4MD7E 4WHZA 3ZSIA 3AMBA 3UVQA 5ICPA 4JI9A 4PP9A 2AYPA 3A60A 3OTVA 5EDQA 5AV2A 3VS3A 2YACA 4NK9A 2CDZA 2JIUA 4A4XA 3TEIA 4AOJA 3QRTA 4PTCA 2XEYA 1FQ1B 4O82A 3EQCA 5JH6A 4O83A 3GEQA 4L01A 3RM7A 4II5A 2V62A 2GNHA 2XA4A 5HIBA 4EHEA 5JQ8A 2ITXA 3D4QA 5CXHA 2C5OA 3ZC6A 3NNVA 3NCZA 4LG4A 4GIHA 1HCKA 5EHOA 3DV3A 2PVNA 5FEQA 3FBVA 4GYIA 2YCRA 3V5JA 4QYHA 4G6OA 3VS7A 4TKSA 5GZ8A 4BGGA 3QHRA 1OL2A 1JAMA 4D4VA 4IACA 3T9TA 3EN9A 1OPLA 4FSMA 1UNHA 2CSNA 3GGFA 2J0LA 2QOLA 2X9FA 3C1XA 4IVDA 4J1RA 4JX7A 4E4NA 5GJDA 2JDVA 3W33A 4O0WA 5JRQA 5IA4A 4YZBA 2XUUA 3ENMA 1WBSA 4AFEA 3B2WA 4R3RA 3HA6A 3LMHA 3R73A 3LQ5A 3VRYA 2RFNA 4UWBA 5H8EA 4I41A 4YTFA 1LPUA 2H34A 1A06A 2G15A 2QOBA 4H3BA 4FT5A 4FV0A 4KBCA 2PVYA 3NYVA 4GT4A 2R3LA 3MFRA 3OCBA 3ZSGA 4DEBA 5BVNA 4I21A 3CBLA 4ACMA 3CY2A 3LFCA 3HV4A 3P7AA 3O8TA 2PE1A 2A27A 2E9PA 2YDJA 4BGQA 4ACCA 1HOWA 4BI0A 5HU9A 2QKWB 4I5PA 4ZJIA 4P5QA 3KCKA 1MRUA 2BZIB 3ZUUA 5F4NA 4AS0A 1XH4A 3LCSA 4L53A 3TNQB 5AV3A 3UG1A 3FDNA 5C01A 3TTIA 1WAKA 3QXPA 4BDJA 3GUBA 3OOMA 3PXKA 5JQ5A 4IX4A 5FD2A 2XK9A 3ORTA 2VU3A 4FSWA 2C30A 4IWPA 1XO2B 1P14A 5AP5A 4TXCA 3A8WA 3N4VA 4FNZA 4LRMA 2UW9A 4ITJA 1CSNA 2WHBA 2IVVA 1KE5A 1G8SA 1H28A 3N4UA 2ZDTA 2XIYA 4O7LA 4IMYA 3KEXA 3R9DA 4I4EA 1SM2A 3M1SA 3COHA 4JRNA 3ACKA 4JIKA 4WD5A 5AM6A 3TZMA 3V8SA 5ETIA 4FVPA 5EKOA 4WO5A 2LGCA 2JDTA 3FE3A 3QQFA 3FMHA 3H30A 4FL3A 2PUIA 3UIUA 5IH6A 3FHRA 1JKKA 1GIHA 4XX9A 2CMWA 2WTKC 2OJIA 2W9ZB 3FQEA 3UIMA 5TE0A 1WVYA 2WMTA 3BIZA 4IFGA 3GVUA 3U55A 1TQPA 3CR0A 4USDA 5CAVA 2W9FB 3LFFA 3UE4A 4OTDA 4EOJA 3IDCA 4C58A 4M8TA 1Q4LA 2B4SB 2RG6A 5KBQA 4YSJA 4WOVA 4C61A 4JL9A 3WF6A 3ZO4A 2J0KA 3V5QA 2VTMA 5IMEA 1M2RA 1VYZA 4QTBA 2VTHA 3A7GA 3GU6A 4HYIA 3IPHA 1AGWA 5CU2A 2QG5A 4HYSA 4X2KA 3ANQA 2HENA 3BPRA 4A07A 3NNXA 3W18A 4O96A 1Q8UA 2BIYA 3NNWA 4O22A 5AP3A 1YWNA 5AA9A 1E1VA 3F5UA 4ZLZA 4RJ5A 4C4EA 1UWHA 4PQNA 3MFSA 1ZY5A 2HW7A 2ETRA 4QMLA 4O7TA 2YLEA 5LARA 3D2KA 4D2RA 4EBVA 4PPCA 3N4TA 3PJ8A 4L6QA 1PKDA 2X8EA 3CQEA 4JAJA 5EI8A 4BICA 4R8QA 4QQ5A 3ZLXA 1OBGA 2OW3A 4UXQA 2OXDA 4RC3A 2B54A 3QD3A 4QMMA 3DDPA 1DAWA 3VBVA 4C3PA 3HEGA 3Q9YA 4KABA 2B9IA 5LCJA 4TW9A 4ALUA 2OXXA 5JT2A 2W4KA 3QD0A 2EUFB 2OIQA 3V5TA 3EQFA 5FQDC 4CKJA 4RGJA 4NIFA 3COIA 3UPZA 2R2PA 5TT7A 3ZZEA 2CLQA 3EQHA 3ORZA 3LCOA 4E3CA 3W16A 3DBFA 1XH5A 5DPVA 5G1XA 3FLNC 3C7QA 4CLIA 4Z7GA 4XP2A 4F0IA 4YJQA 5HBHA 4XV2A 4IDVA 2VWBA 5HG9A 1M14A 4HZSA 1R1WA 1J3HA 1XHAA 3F3UA 4NJ3A 3U8WA 4EK4A 3PXZA 1REJA 2GNJA 5A4TA 4EHGA 4UWYA 3HV3A 3QHWA 4OLIA 2A0CX 3AT4A 4MNFA 5HIDA 1R0EA 3KXXA 4H39A 3OOGA 4KD1A 4XH6A 3LJ0A 3CC6A 1IA9A 4FUYA 4MX9A 1RE8A 1KE8A 1DI8A 4YHJA 3R63A 5J9ZA 4AZVA 1K2PA 5IKWA 3PFQA 3EOCA 1WZYA 3E88A 3P9JA 4A9UA 2WGJA 3MJ1A 5HU3A 2CJMA 4TYGA 3I4BA 3AMYA 3QUDA 3TIZA 4FG8A 2QOFA 3EL8A 3FMEA 1YDTE 2VGOA 2WU6A 2FSLX 3V5LA 2I0YA 3ZEWA 2R3QA 2F7EE 3FZTA 3DGKA 4DC2A 2XIZA 4MVFA 2XEZA 4EWQA 3GB2A 5M07A 4TYEA 1OL6A 5FXRA 3VIDA 1ND4A 4XP3A 2ITUA 2OF2A 2YERA 5IUGA 3W8LA 4EOQA 3VUDA 5LOHA 3PJCA 3BELA 4ZZMA 4DLIA 5K4IA 4USFA 3GCPA 1YOJA 1WCCA 1OIUA 2ITQA 3EH9A 3I0QA 2W5AA 4A7CA 2YDIA 2V22A 1V0BA 2A2AA 4R5YA 4JLCA 5E8YA 2YM4A 2OICA 2ZAZA 4XNEA 1NXKA 4IEBA 5H3QA 2I40A 1FMKA 4FKWA 2OI4X 2QOHA 2PUNA 3GCQA 3VBTA 4L3JA 3FZRA 5AR4A 4F9BA 4J53A 3LFAA 2CLXA 4BZDA 5BX0A 2F9GA 5DBXA 4UMTA 3UGCA 4DFUA 4PNKA 2W06A 3OP5A 2C6TA 2HZ0A 4FC0A 4MBLA 1J7LA 4GSBA 4W4WA 3LFDA 1R78A 4V0GA 3RTPA 4QTCA 3H3CA 2FSTX 5M51A 2UZBA 5AX3A 3MH3A 4YZDA 2R3MA 4UZDA 4IX6A 5IQDA 3F3WA 1SNUA 2F7XE 3VUHA 5J5SA 4O7ZA 3QZFA 2QO7A 1BX6A 3SXFA 1AD5A 2RFEA 3HAVA 4R7IA 1IAJA 4Z3VA 5AR7A 3V51A 4TYIA 3MI9A 3ZDIA 2QO2A 2O3PA 3MSSA 2YM5A 5IG1A 3TACA 3QWJA 2WMVA 2J0IA 1GZ8A 5FTGA 2BAJA 5JEBA 3E64A 4RX7A 3NIZA 3RPOA 2P3GX 4BVUA 4M14A 4QMQA 3C0GA 4TPTA 2VTSA 3FI4A 3BV2A 5LVNA 2PZIA 3DA6A 3KXZA 3R2YA 3RMFA 3KXGA 4R78A 5AUVA 3C4EA 3IO7A 4FZAB 4LRKA 2YN8A 1Q24A 3SRVA 4BYIA 2V7AA 4ZSGA 2DYLA 4D9TA 3EMGA 5AWMA 4EYJA 5CAOA 3RPSA 4B4LA 2BRGA 2R0IA 3GC7A 3C51A 4FF8A 4NWMA 2QU6A 4FZDB 3FXXA 3VUKA 5ETFA 2BRMA 2EB2A 3VUIA 4FKQA 3LLAA 3PA3A 3AOXA 4AE9A 4QOXA 4G16A 1UKHA 2JKKA 2PWLA 4TT7A 1ZOGA 2ZV2A 3TJCA 3E8EA 4BTFA 4FBXA 4EI4A 1YXTA 5LWNA 4LRJA 3QA8A 1ZARA 3WYYA 2DQ7X 3HMPA 3I7CA 3FMMA 5CU4A 1BI8A 4OTIA 3UNZA 4G3DA 2W1ZA 3MVLA 3TV7A 4D1SA 2PY3A 3C0HA 2IO6A 5A46A 4O7WA 4N0SA 5K3YA 4IX3A 4H36A 2QLQA 2PZYA 3MY5A 3LXPA 4LI5A 4E6DA 3PVUA 3KVXA 4F0GA 4E4XA 1IRKA 1PXNA 2QQ7A 4GG7A 3AD5A 3VHEA 4ERWA 3U6HA 4K9YA 4NIFB 4B6LA 3BGQA 5K5NA 3ORIA 5KKRB 1IEPA 1RW8A 2XH5A 3FLQA 3PJ3A 4C62A 5L2QA 1OIRA 4FNWA 3U9CA 3WI6A 5JZNA 2J0MB 2OZOA 4EUTA 2GCDA 3PP1A 1LUFA 3ALNA 1W7HA 4I20A 4M12A 4RFZA 3BHVA 5HVJA 1Y91A 5AJQA 2C4GA 5E92A 1URCA 3WZEA 2R3JA 5HX8A 3E7VA 1STCE 2OSCA 5KMOA 3IGGA 2C6DA 1UKIA 3ACJA 4TY1A 3PIZA 4RQVA 4BZOA 2WEIA 5JMSA 4XP0A 4QTDA 4F9WA 5LMBA 2VAGA 4GT5A 4IWDA 4CLJA 3GCVA 1H01A 2CCHA 5H8GA 3FMNA 3H9OA 3IW7A 4M84A 5CU6A 4TNBA 2PSQA 3GNIB 1WVWA 4QP4A 1YHVA 4X2FA 4ZTRA 4QT1A 1H07A 4C38A 2Y4IC 5BMMA 5AFVA 4C57A 4S30A 3RHXA 1WBPA 3CTJA 4QQJA 2CKOA 4X3FA 2GQSA 4L8MA 4PF4A 4PUZA 2VTLA 5LMAA 4AGDA 4UYAA 1OL7A 4W9WA 4QMOA 4RG0A 5L2WA 3A62A 1YVJA 1ZXEA 5HESA 4EK8A 5LJJA 2BFXA 2Q83A 4X2JA 4G5JA 5HE3A 3DT1A 2J90A 3OXZA 3HV6A 3HMMA 3E92A 1PMUA 2ZB0A 2XCHA 5D10A 4MBJA 3VBWA 3ZM4A 2ESMA 3QKKA 4G3CA 4YHTA 5IQGA 5CQUA 3U6JA 4ZS4A 2WTJA 1B6CB 4YTCA 5JFWA 4DA5A 3Q4ZA 3NRMA 3R00A 4DH3A 3AQVA 4M67A 5KO1A 4J96A 4AZEA 3PIYA 5J79A 3FQSA 4R7HA 3H4JA 5HG7A 1Y6BA 1JPAA 2WQMA 2QONA 4FKJA 5CQWA 5HE1A 3V01A 1TQIA 4EK3A 3TUBA 3TTJA 1OMWA 2YM8A 5IA0A 4XBRA 3SA0A 3OWKA 5IEYA 3A4OX 4BCQA 1SYKA 2PZRA 3CPCA 2HWOA 2IW9A 4I6HA 3DQXA 3CQWA 3DJ5A 3HV7A 3W2CA 2OWBA 4HNIA 2HK5A 2C5NA 5I9YA 3QKLA 4CCUA 4KBKA 4QYGA 4DEGA 3MJ2A 3PDTA 4I6QA 4XLIA 1UU7A 5J9YA 4V0GB 4M68A 4TWOA 2AC3A 3RGFA 3FY2A 1OUYA 2YISA 4QP6A 3RP9A 4U45A 4P2KA 4DT8A 4KS8A 1OECA 3QAME 4A06A 2J2IB 2YM7A 4NZWB 5DI1A 5TF9A 4K2RA 3EFLA 2B1PA 4TYHA 5IF1A 5A9UA 4RWIA 5DFPA 3R8MA 2OG8A 4FICA 2HYYA 4FZFB 4DCEA 4BFMA 3OBGA 4WNKA 3DBEA 4WG5A 5IH4A 1M52A 3GXLA 1V0PA 4D2WA 5L2IA 5IQHA 4FI1A 5FG8A 4E6AA 1SZMA 2FUMA 3P23A 3F7WA 4KIOA 4WSYA 4PL3A 5BVWA 4D2SA 1M2PA 5CTPA 4G17A 5AR8A 4RZVA 4BCFA 3UMXA 3Q4CA 5EFQA 4U8ZA 4JRVA 3GFWA 3GI3A 4U41A 2JDRA 2Z60A 3OBJA 2J0JA 4QMXA 2X2KA 3F66A 5ETCA 4BCPA 3SRVB 4BBFA 5HLPA 2OBJA 4NTSA 4AE6A 3NIEA 4EH7A 2C0OA 2WELA 4FEUA 4RMZA 4EK5A 3AC3A 3S2PA 3V5PA 4AZWA 3BKBA 1QPJA 5GZAA 1JBPE 2EB3A 3KKVA 5E90A 5L2TA 2E9NA 3PE2A 2IVSA 3OCTA 2IPXA 5F20A 4PL5A 1ZYCA 2J7TA 1SVHA 5IU2A 2QOQA 3VQUA 5KE0A 4L43A 2RFSA 2GQGA 1P4OA 4FIIA 1I44A 4QRCA 3MS9A 2YCSA 1M7NA 2RIOA 3KULA 3W2PA 1XH7A 5HCYA 2RF9A 3DZOA 1KV1A 1YHSA 3NCGA 5EYMA 4XS2A 2ONLC 2CNUA 2OFVA 3BE9A 3Q9WA 4KKGA 3FL5A 1M2QA 3Q6WA 4IXPA 4HNFA 1DM2A 4CMTA 2RGPA 2YITA 4PPBA 2XNGA 4RWJA 4DYMA 1S9IA 1UU9A 2WTWA 3LIJA 3QD4A 2R7BA 1NY3A 5KMNA 3KRXA 3CTQA 3PTGA 2JIIA 2OIBA 3E8CA 4D28A 1XJDA 3DB8A 3ENHA 1YXXA 1RQQA 1V1KA 4KNBA 5CENA 5DYJA 2XIRA 3DKGA 2QVSE 4MNEA 2V5QA 5BVOA 4XEYA 4QO9A 4FKIA 5HVYA 3TCPA 2WTVA 3F69A 2WMUA 3FI2A 4QP8A 3K2LA 2CNQA 2YZAA 3ZO3A 4GEOA 5EM6A 3HP2A 4C4FA 3THBA 2JAMA 4YBJA 5IZFA 5JGBA 4S32A 2P2IA 3R6XA 4C3FA 2R3KA 2WMQA 4RWLA 3ZFMA 4C02A 4X2NA 1NVRA 2Y4PA 4DGNA 2OGVA 3DS6A 5EDPA 3NW7A 2C1BA 1UA2A 1VEBA 4Q2AA 3WZKA 2P0CA 4U6RA 4UMQA 5FGKA 4FG9A 2PE2A 1ZRZA 3KC3A 4DFXE 1JLUE 3QYZA 4EH8A 4AZTA 4Y72A 4FKUA 3QTIA 5IPJA 5CSPA 2B9FA 4NU1A 4U5JA 5HCZA 4OTFA 3BX5A 1ZYLA 2X4FA 4GFOA 3N9XA 2X8DA 2HW6A 3CKWA 3FYKX 4TN6A 1OKWA 4PDOA 3HVCA
chains in the Genus database with same CATH superfamily
4DGMA 3TWJA 3DLSA 1XBBA 2PUUA 3EKNA 4X3FB 4DHZA 3W2QA 3POZA 5CXZA 1PXMA 4H1JA 3VN9A 4DTBA 3TM0A 5IA3A 1JSUA 4K0YA 3A7IA 3OWJA 4AAAA 2IWIA 2R0UA 5AP4A 4RIYA 4FTUA 2VTNA 5HE0A 5DEWA 2Z7LA 5BVFA 3BYOA 3R01A 5M4IA 1Y57A 4MEDA 4C37A 5KHWA 3CTHA 4UZHA 1OKYA 4NKSA 2OLCA 3PRIA 2WZJA 2UZNA 5C8MA 4BJJA 2R3OA 4ITHA 4JQEA 3F5GA 3FY0A 4I24A 5I9ZA 5JGDA 2XALA 4Y95A 2R64A 4G1WA 5LXMA 3RNIA 3QF9A 2XYNA 5AR3A 4CSVA 3TDWA 4N6ZA 2Z7RA 3A99A 4UEUA 2R3FA 4X2GA 5IISA 1Q61A 4O6LA 1NVSA 3G0EA 3RK9A 4RIXA 3ZO2A 4I6BA 5ANEA 3DK6A 4J95A 3VULA 4OTRA 2YZLA 2ZV8A 4YLKA 1RJBA 2BAQA 2W5HA 3PPJA 4U3ZA 5CEIA 4FTOA 3W0SA 4D9UA 2GS2A 3FI3A 2P33A 1OBDA 2PUPA 2WFYA 4WNMA 3D15A 5IQAA 4ACDA 3RPVA 3QRKA 4U0IA 1H25A 4A9SA 4E8AA 4FZ7A 2UUEA 3R7YA 3BHUA 5HE2A 2X7GA 4TYHB 3VBQA 3CLYA 3TDVA 3H9RA 2XKFA 5JKGA 5L3AA 3UYSA 2C0TA 1Y6AA 3BLRA 3OT8A 1UNLA 3ZLWA 1H24A 3AKJA 4YO6A 4FTTA 4EOMA 2PZPA 4O2PA 4OT5A 4IBMA 4PV0A 5ANGA 1OB3A 5HCXA 2GS7A 4FVRA 4YLJA 4CZTA 1K3AA 4JAIA 5LMKC 3S00A 3V6RA 4K33A 3LQ8A 4FODA 2WOTA 3HLLA 3MTFA 3SG9A 3B8RA 3ORMA 4FSYA 4I22A 1YWVA 4R6VA 5CI7A 4ZZNA 4DEAA 3EYGA 3SG8A 3QLFA 5AA8A 2RSVA 5DNRA 4WBBB 4UXLA 3Q6UA 3ZFXA 2WEVA 4M13A 1E1XA 3AD4A 3ATTA 3MH2A 4O21A 4U7ZA 2XJ0A 2XARA 4O81A 2VGPA 3GU4A 4AN2A 5EQPA 3OEFX 4K18A 2PMIA 5DE2A 3LCTA 3NAYA 4D1XA 4UV0A 4FVQA 1W98A 3CPBA 4C33A 1SVGA 1X8BA 4FZ6A 4DAWA 4ZS0A 5A4EA 4AXDA 4UN0C 3LE6A 3KVWA 5AUYA 1PHKA 4JBOA 3HX4A 3MA6A 5LVMA 5J1WA 5B2MA 2CN5A 3FKOA 3DPKA 5KZIA 4EWHA 4BJJB 5HQ0A 4LGHA 3KULB 5DT3A 3EFWA 5E7RA 1U5RA 4YPSA 4GFGA 2GSFA 3PZHA 5ANJA 1KOAA 3BGPA 2OK1A 1W84A 4HCTA 2X4ZA 4PNIA 5BYYA 4NL0A 4DG3E 4FV2A 2ZV9A 3O17A 2HY81 3R22A 2QLUA 4MAOA 2PK9A 5H2UA 3NEWA 2OZAA 5KNJA 5M4UA 5HBEA 4AGCA 3EB0A 3OMVA 2ZMCA 4FK6A 3VJNA 4MNEB 2HZ4A 4GH2A 1L8TA 2EVAA 5E8UA 4G34A 4YZNA 2WMSA 2FB8A 2W1FA 2WIPA 3NWWA 2O64A 2XMYA 4UMUA 2J5EA 4BIEA 2UZDA 3DB6A 3PWDA 4R3CA 3R9NA 5ACKA 4DFNA 4AFJA 2C5VA 4X0MA 1MUOA 4AXAA 4XG9A 3RAIA 1FVRA 4X6RA 3PE1A 4M15A 4BDGA 3RWPA 5IA2A 3SW7A 3CP9A 4OT6A 4BC6A 3H0ZA 4GT3A 3NDMA 3NUNA 3EN7A 3QUPA 1PMNA 3TXOA 1R3CA 3RI1A 1QPDA 4E26A 2BDWA 3OF0A 2YIRA 1QPCA 3WARA 1SNXA 2BPMA 4H3QA 3V6SA 1J91A 2KTYA 2ZDUA 4BDCA 3G5DA 4D55A 2VRXA 2JEDA 2VWZA 2ETMA 4HGTA 3SHEA 5M06A 5ITAA 4EBWA 5M09A 1FGIA 3DKOA 1PYEA 4O4BB 1VJYA 4QMYA 1GNGA 3ZRMA 3R7IA 3NYXA 5D7VA 4QDEA 3SOCA 4BDEA 4FV1A 5M53A 3A8XA 3N51A 4UY9A 1LEWA 2JITA 1PMVA 3KK8A 3W0RA 3NVKI 1ZYJA 2X0GA 4CYIA 2ZM1A 3WBLA 3DK7A 1F5QA 3E63A 4QYEA 4RIYB 4MXZA 4CFVA 1VZOA 4ZMEA 3OXIA 4Z55A 2SRCA 2A1AB 2UW8A 4EK6A 4OAUC 3FLYA 2R3IA 5D7AA 4ANMA 4QD6A 4WKQA 4AQCA 4LGDA 3Q5ZA 4YSMA 5CLPA 1BL7A 3Q2MA 1FVVA 2JC6A 4QTEA 1H4LA 4BY9E 4LL5A 2VN9A 3IK3A 2JDSA 3NUYA 5HO8A 4L00A 4N6YA 2ACXA 2G1TA 3FQHA 2QHMA 3ZRLA 4O0YA 4QMNA 3EQRA 4FTNA 3Q53A 4FSUA 1APME 1ZLTA 4NW6A 4U43A 2PMLX 4RIXB 2JFMA 1BUHA 1WBNA 4O4EA 2Y6OA 3O0GA 3QU0A 5M55A 3QD2B 1FVTA 2ERKA 3NYOA 2GHMA 5DLSA 4CQGA 4P7EA 5AAFA 4C3RA 5J87A 3WZUA 4BCOA 3G9LX 4LMUA 1BL6A 3EIDA 3O7LB 3QX2A 2QOIA 3FKNA 4IM2A 2Y7JA 3MB7A 4JG7A 3RNYA 3HMOA 1JOWB 4NCTC 4YTIA 4I6LA 2R7IA 3OWLA 3O7LD 3SD0A 1YRPA 4IFCA 4IJPA 3QTSA 2OF4A 4FKTA 5M4FA 4EHZA 2BDFA 3AC8A 3IGOA 4OGRA 3R0TA 3MBLA 3UJGA 1ZMUA 4O7NA 4F7SA 2I0HA 3P7CA 4GL9A 4TNDA 3VS2A 3LM5A 5FLFA 4D4RA 4LDTA 3KXNA 3UG2A 5F94A 2XK3A 2R3GA 4X7QA 4RJ7A 5AR2A 3D5WA 4F7LA 2G9XA 3D2IA 3QQKA 4EEVA 4USEA 3UDSA 2WTKB 5E8ZA 4ZIMA 3L8PA 5AUWA 4LUEA 4JBQA 4LL0A 3WIKA 4A9RA 5CANA 1CKJA 3HRFA 3RKBA 3LPBA 3UYTA 5CI6A 3PFYA 5AR5A 4RSSA 3UOJA 2VNWA 2HOGA 5BUEA 3GQIA 4YJRA 5AP7A 4FTCA 5FBNC 4KKHA 4MWIA 4GUEA 3OT3A 3E7OA 5BYLA 2X7OA 4ZEGA 2Q0BA 5A4LA 1VYWA 2G2HA 4HGLA 4D4SA 4AW5A 3KQ7A 4EH5A 1G3NA 2YAAA 3HDNA 4TWNA 4YC3A 3C4FA 2JAVA 4G3GA 5IQBA 5HG8A 4OTQA 3LFEA 3W10A 2YFXA 4CEGA 5J9LA 4I0SA 4A4OA 5EQYA 3TJDA 4U81A 5FTOA 3EJ1A 2YCQA 4RVTA 3WOWA 3P86A 3EN4A 1XR1A 4FV8A 4NM3A 4JDJA 2VUWA 5J7HA 2XZSA 2VWUA 3HECA 5AUUA 3MIAA 2UW7A 3TIYA 4GVJA 4FE2A 2C5YA 2Z7SA 4DFLA 1LR4A 2IW6A 2JKOA 4EH2A 4L7FA 5HTBA 3KMUA 4I5HA 3ANRA 5J7BA 5M44A 2B0QA 2PU8A 4O7VA 4JOAA 5I0BA 4XG2A 3RBWA 3QXOA 4ORKA 4FGRA 4CZUA 4QP1A 2BHHA 1J1CA 2OZAB 4Y8DA 4MQ2A 4YTHA 3UNKA 3TI1A 3OY3A 3QBNA 4G2FA 5IUIA 1OIYA 2R4BA 4MD9E 2CKEA 3DKCA 3LJ2A 1KWPA 3IECA 4FTKA 5JFXA 1PRYA 4QMPA 4O86A 3UO4A 4APPA 3QCQA 2QI8A 4JDHA 5HX6A 3DBQA 1Q8YA 3FSFA 3W1FA 1I09A 3I79A 3RHKA 3WE8A 3JYAA 1UU8A 4V04A 2BKKA 4BDFA 4LMNA 1Q97A 2E9VA 4M69A 4EUUA 3ML1A 4UB7A 3GENA 4FTJA 3TNHA 3Q2JA 4JS8A 5JGAA 1ZWSA 5EW8A 3S0OA 2YAKA 3DJ7A 2UW0A 3JY9A 3W0PA 5I3RA 2ZOQA 1QMZA 3E8NA 2W4JA 3KU2A 4KSPA 4YBKA 4IB3A 4E7WA 3KRWA 4FKVA 3OS3A 4Z16A 4RA4A 4D4YA 2HXLA 4GJ2A 5CY3A 5E8XA 4TTHB 3LCDA 4OBQA 4XG8A 4E6CA 3S3IA 3EL7A 4RVMA 2BALA 4Y5QA 4CV8A 4Z7HA 1IA8A 4PWNA 2X7FA 3DJ6A 4DLJA 3Q96A 2CKPA 2IJMA 3EZVA 1F0QA 4ALWA 2G2IA 2XM8A 1H1WA 4L46A 2WMWA 2YWPA 5M56A 3GQLA 4PPAA 4S2ZA 2BZJA 4QDVA 5HHWA 4ANLA 1Y8GA 1YI4A 3QRUA 5L8JA 4DEHA 2ZM3A 2VWXA 3OTUA 3JR1A 1H00A 3FUPA 4Y83A 4E5AX 4GMYA 4P5ZA 1B38A 2WTDA 3ZH8A 4AQKA 5CZIA 3LXNA 5HGIA 1L3RE 4WNOA 3D0EA 4EOOA 2NP8A 2OJJA 3TZ7A 3G6HA 3DAEA 1GZNA 5AP1A 3RCDA 2VX0A 5CAUA 5L8KA 3FI8A 5DR2A 3LKMA 2A98A 4JG6A 4JG8A 1SVEA 4F0FA 1H26A 1YXSA 4EOPA 1CKIA 4ASXA 1ZMWA 2I0VA 4RZWA 2X39A 3NAXA 2X0OA 1YXVA 2BFYA 3QRIA 3C5UA 4YP8A 3HKOA 2RG5A 3LCKA 3POOA 3HRBA 4O2ZA 2XYUA 3ZUTA 3IOPA 2QOCA 2BDJA 4GW8A 4RA5A 5CSHA 1KSWA 4ZOGA 3TKHA 3BBTB 3F3ZA 1YDSE 4E5BA 4DTKA 3UC3A 3RJCA 4BN1A 2IZRA 4ASZA 2BROA 5D9HA 2IZTA 3AMAA 3W2OA 3MVHA 4HCUA 4U97A 4ZSLA 5HNIX 5IQIA 5A6OA 3PA4A 5E8WA 2XB7A 4IZAA 4GU6A 4JDIA 2WIHA 1K9AA 3FXZA 3IW4A 4NKAA 4B8LA 1W8CA 3QKMA 3HMIA 3FAAA 2G2FA 4CMUA 2ZM4A 3KF7A 5LVLA 3VBYA 1ZYSA 3KMWA 3AKKA 2PVRA 2XRUA 2WD1A 1PKGA 4IZ7A 3GT8A 4L52A 4BBMA 4FT3A 4FSZA 3SXSA 4CCBA 3GC9A 5HTIA 2EXCX 5BUJA 5FDPA 4AA5A 3MW1A 5EK7A 1CTPE 3Q3BA 5T68A 5GHVA 4FL1A 4I23A 2VTRA 2C6EA 4PP7A 5C4LA 3KN6A 4IAIA 4FNXA 1URWA 3CXWA 3F5PA 4TRLA 4W4YA 3TNPC 4NJDA 3CJGA 3BU3A 4GK4A 2VO6A 5TR6A 4BYJA 2IG7A 3P0MA 3ZBFA 2IF8A 2BUJA 2X2LA 4EKLA 4ZTSA 3SQQA 2B53A 4S31A 3MV5A 3MN3A 2PZ5A 2WKMA 3ORKA 3O2MA 1DI9A 2B9JA 3PPKA 4EH6A 3SOAA 1UU3A 4WUAA 3MVJA 2UZTA 5CNOA 4DEDA 3BRBA 5I9WA 4MXOA 4RT7A 3BZ3A 4AOTA 4CFMA 4E4LA 5AADA 1H08A 2GNIA 4O7SA 2W1IA 1P5EA 5FWKK 3VBXA 3KA0A 3OROA 3EN6A 4O38A 4RVLA 1Q62A 1RDQE 4CRSA 2WTCA 1U59A 3HNGA 4FV5A 2IVUA 4XV1A 1U46A 3HA8A 5C9CA 3MB6A 3L9LA 1KE6A 1PXLA 4G3EA 4BCGA 3UDBA 4FKOA 4L68A 2QCSA 4CZYB 3HP5A 2WQNA 2QC6A 4BWPA 4I5CA 5CSXA 3EFJA 3NUPA 4FKSA 3ULIA 4FEVA 4FEXA 1YDRE 5EG3A 4O0XA 2GFSA 2XJ1A 5FP5A 5H8BA 2WOUA 2YIQA 4RLKA 3JS2A 3AGLA 4OTGA 2O65A 2W05A 3R9RA 4XCUA 1FMOE 4DFBA 1O6YA 3KY2A 4EH4A 4MUQA 3CGFA 5IH5A 3VC4A 3LQ3A 5LVOA 4M69B 3ZOSA 4BCNA 3F82A 3L9MA 5LQFA 2EXMA 3LXLA 4FTRA 3R7OA 1J1BA 3TT0A 2PMNX 3ZU7A 5CEOA 1GIJA 1GAGA 4AOIA 3NW6A 3P08A 3OY1A 5IQFA 4LYNA 4S33A 3ODZX 4Q5EA 4GCJA 4FIFA 3ZTXA 3NUAA 2CGXA 4ANQA 2IN6A 2JBOA 2VWIA 5FDXA 5IQCA 3MVMA 2PVMA 4ITIA 4BDHA 1Q8WA 4O0VA 5ETAA 4ZSAA 4IIRA 1BKXA 4GV1A 4HZRA 4IANA 3Q32A 4ZJJA 2XNMA 1CKPA 2Y4IB 2H8HA 3QC4A 3UP7A 3EZRA 4ZTHA 5AP6A 1UNGA 3L1SA 5B2KA 1J7IA 3JY0A 2RFDA 4C4IA 3FMKA 2OO8X 2XKCA 4PX6A 1P2AA 4F1TA 3UVRA 2FSMX 5L6WL 1T45A 2ITWA 4JBVA 4EYMA 3F61A 5AUTA 3BQRA 5D41A 3E8DA 5DRBA 3L8SA 4O6EA 3LLTA 4GYGA 4QQCA 3U87A 3FXWA 3OUNB 5M4CA 1ZYDA 1R0PA 2ITTA 4W9XA 4F1MA 1XH6A 4KIPA 4NUSA 3QZIA 4L67A 4BI1A 4FJVA 3RINA 4BI2A 4O4DA 2QNJA 1CM8A 4CTBA 3CY3A 4G6NA 1IAHA 1WMKA 1QPEA 4YJUA 3UOLA 3W55A 3DBCA 4FKLA 5KMKA 4NM7A 4GFMA 2UV2A 4WG3A 3ZYAA 1FPUA 3R21A 1WBOA 3ZO1A 2FSOX 2OIDA 3O71A 3U4UA 3ET7A 2WU7A 4LGGA 1J7UA 2W1HA 3A7FA 3D9VA 4PMSA 1Q5KA 3FV8A 2I6LA 4X3JA 4X6QC 4D2VA 3DZQA 4APCA 3W2RA 1G8KA 4C0TA 2HZIA 5EW3A 4IDTA 2BR1A 5J5TA 4E4MA 2W1CA 3KGAA 2A19B 2GHGA 2OKRA 4ID7A 3R7EA 4EKKA 2E9OA 3G51A 3SKCA 1GY3A 4IZ5A 3CKXA 3ORPA 3PVGA 2UZEA 3DK3A 5CAQA 1Z5MA 2X6EA 3Q4UA 4MYGA 3IKAA 5A54A 3OFMA 5A6NA 2GTMA 4JDKA 4E93A 3COMA 5KUPA 3PP0A 1TZDA 3UIXA 4KIQA 5LMKA 3A61A 4FGBA 5M08A 3R2BA 4ACHA 4AU8A 1PW2A 2J9MA 3GFEA 4IB5A 4ASEA 4BRXA 3PVBA 3R02A 3UZTA 3ELJA 2W99B 2YLFA 3BV3A 4XOZA 5AAEA 4QP9A 4AT3A 4GUBA 5B0XA 3I6UA 1JKSA 1PF8A 3K5UA 1OPJA 3R71A 5CX9A 3R8UA 4DEEA 5GJFA 2JKQA 3P79A 3PUPA 2BRBA 3NUXA 5CT7A 4CFXA 4YMJA 2R3PA 4G31A 2GFCA 2J5FA 2BZKB 4NH1A 1VLRA 3HAMA 2C6IA 4FT0A 4QPMA 4QMSA 5EOLA 5JK3A 3H0YA 5IDPA 2G01A 2IZSA 4UX9A 2I0EA 3JXWA 3PY0A 4FYOA 4ANSA 2J4ZA 4DITA 2FVDA 1W0XC 4YJTA 4ZK5A 3VW8A 3MTLA 3BYMA 1H27A 2BZHB 3KN5A 3QTUA 5L8LA 3SAYA 3PYYA 5CWZA 4XRLA 3C4WA 3NUSA 4BB4A 3COKA 4CGAA 3A4PA 3BYSA 4IX5A 3VW6A 3NX8A 5M57A 1QL6A 4HOKA 2X8IA 2EWAA 2PVJA 4DGOA 3DOGA 3PLAE 3K5VA 3V8WA 2XS0A 1PYXA 3HV5A 4BTJA 1WBWA 3T3VA 2BKZA 4G6LA 3I7BA 5DHJA 3ZXTA 5HVKA 3FZPA 4WBOA 1GZOA 5I9UA 4G5PA 2NNWB 5GJGA 1JSVA 4MWHA 4CXAA 2PVLA 4DH5A 4TL0A 4DBNA 3HDMA 3OHTA 3BU5A 3RK5A 3PG3A 4CFWA 5HNBA 1WVXA 2HIWA 2WXVA 4GRBA 5D11A 3TKIA 4FSQA 1NVQA 1OIQA 4I5MA 3WZDA 4YURA 4U44A 1W2DA 3AC4A 3DQWA 1KV2A 2VTAA 4ZTMA 2WMXA 4CYJA 3LVPA 4LM5A 5TKDA 3C0IA 4DE4A 2F2CB 2W1GA 3C4XA 2R3NA 4OW8A 5EYDA 4ALVA 2QG7A 4L9IA 4EC8A 2WB8A 4HGEA 5AV1A 3RVGA 3U54A 3OC1A 5AP2A 3VS5A 5L6OA 1FBNA 5KX8A 3AC1A 2WTIA 3KL8A 4W8DA 5AEPA 5CASA 4XUFA 5AUXA 5K4JA 5GIPE 3I0OA 3VO3A 2C6OA 4GG5A 3D14A 4HVIA 1ZZ2A 3ORLA 2QHNA 3OXTA 4EZ7A 3Q9ZA 4OBOA 4RX5A 2PPQA 1IASA 3ZMMA 3PLSA 3ZSHA 4RX8A 2Y8OA 4OTHA 2CN8A 3AXWA 2Z2WA 3VF9A 4BTMA 2C6KA 3QTWA 4QNAA 4CFUA 4XOYA 4FA2A 1OGYA 3R28A 4D58A 3OW4A 4BWXA 3MPAA 1GZKA 4IAKA 5KMIA 3ZDUA 4KRDA 4AGUA 5KCVA 3R8LA 4A9YA 3SGCA 2VZ6A 4QPAA 3DY7A 3HUCA 3R1SA 4JVGA 4RVKA 3PXRA 2X81A 1ZY4A 2XBAA 2RKUA 5DR9A 4BCIA 2W4OA 4D1ZA 3UZRA 2UVYA 5A4CA 5HOAA 4DDIA 2F49A 2J50A 5CF8A 3G9NA 3RAKA 1VR2A 1GJOA 4R3PA 2DS1A 5FP6A 2VO7A 3NSZA 2EXEA 3RK7A 3VS4A 1OGUA 1XWSA 3GOPA 5IEXA 2NO3A 1OITA 4V01A 4EOLA 4B99A 4RFMA 5C8NA 2OJFE 4DCAA 3WF8A 3MY0A 3QALE 2Z8CA 2PHKA 2XK7A 4NCTA 1OZ1A 5DH3A 1R39A 3IOKA 4AGWA 4AN9A 3WE4A 5DRDA 2XK8A 4Q9SA 4EQCA 3KMMA 3EQIA 4AW2A 3PWYA 4F6UA 4XYFA 5DMZA 3W32A 5EI2A 3ETAA 3R83A 1XH9A 4FEQA 3EHAA 3ZHPC 4DFYA 5EQEA 4ONAA 4BHNA 3FMJA 4G9RA 4J71A 4ZY4A 3R8VA 1MP8A 1Q3WA 4FRFA 2BRNA 4C4GA 3UO5A 5HORA 3GOKA 4KAOA 2PULA 2C68A 5G6VA 1XQZA 2GMXA 5C27A 5L2SA 4PDPA 4I0RA 3QRJA 2BVAA 3P7BA 2ITOA 2XK4A 2O63A 3U6IA 4OTPA 4I6FA 2QKRA 3A7JA 4Y46A 5GNKA 2QURA 5EHYA 3NNUA 1QCFA 2NPQA 2XNOA 4QP3A 4W4XA 3QYWA 4IAZA 1CDKA 4UMRA 1ERKA 4IQ6A 2OFUA 5HLNA 2BAKA 5A3XA 3E93A 4BKZA 2NRYA 2YABA 3TL8A 4F6WA 3LXKA 1Q8ZA 4IAYA 3D94A 4IB0A 4JNWA 4DF3A 3R9HA 4JBPA 5JFSA 1XH8A 2AC5A 1XKKA 3M2WA 3BU6A 5D12A 2A4LA 4V05A 4K11A 1Q41A 3QTXA 4MF0A 3L9PA 4MK0A 3W8QA 3BEAA 4L3PA 4UYNA 3Q52A 1MRYA 3KRLA 4O0SA 3R7UA 5DN3A 4FV6A 4RX9A 5IDNA 1JWHA 2DUVA 1H1SA 4HJOA 2HY0A 4J8NA 4YNOA 3ZBXA 4F99A 4D2PA 4FTAA 5BVKA 4BDBA 2FH9A 3P4KA 1U5QA 2GNFA 4FV3A 3G15A 4FTLA 3BCEA 3QZHA 2HAKA 3AT3A 3I5NA 4YZCA 3HUBA 4Y85A 5EOBA 4D0WA 2C0IA 3UNJA 4CG8A 5CSWA 2QOKA 2UZOA 3F6XA 3BYVA 3R7GA 1O6LA 3UO6A 3F2AA 4HYUA 5FXSA 3OCGA 1JKLA 3G33A 4FSNA 4GK3A 3KREA 4L45A 5EM7A 3TNWA 3G2FA 4ZXTA 2CCIA 4EL9A 4QMWA 3BGZA 1B39A 2NYAA 2CPKE 3DDQA 3WF5A 3HYHA 5KMJA 4GJ3A 2YIYA 5DGZA 4KINA 2R5TA 3AT2A 4RQKA 3DCVA 3S95A 1ATPE 3QCSA 1OKVA 1H1QA 4WUNA 5JN2A 3F88A 3CSVA 3JVSA 4C59A 3ZXZA 4FT9A 3CIKA 4FV7A 4G3FA 5ANDA 5EH0A 5TOZA 2JD5A 4F64A 1WBTA 3C13A 4HVSA 4NW5A 4BR3A 4O0UA 3IW6A 3PXFA 2BMCA 2HXQA 3PA5A 5HO6A 2IW8A 5HD4A 1OL1A 4C2WA 1E9HA 2ITVA 3R04A 4IE9A 5IA5A 4XMOA 5J95A 3IDPA 1JSTA 3MY1A 4F6SA 3BHHA 4M97A 3O8UA 1LP4A 2CGUA 2R3HA 3M11A 3QTRA 4XHKB 2PVFA 2QR7A 5AUZA 3MYGA 4N57A 2VTOA 5C8KA 2C3KA 2WMBA 4PTEA 4O27B 4YR8A 1W82A 3CE3A 1H1PA 5IA1A 3C5IA 2F2UA 3BHTA 1O9UA 3CS9A 3KK9A 3RAHA 4F9CA 2WMRA 3HGKA 2WNTA 3PJ1A 3RWQA 2YJRA 3FZOA 3IQ7A 4JQ7A 4Y73A 4HVDA 5GINE 5BYZA 2CGWA 4BCJA 4C7TA 2IVTA 3NS9A 4IAAA 3DTCA 1ZOHA 4JX3A 1M17A 4IVCA 4U79A 4XBUA 1PJKA 5HEZA 3ZZWA 5HNGA 5HO7A 4CQEA 2X1NA 2HELA 1IG1A 2VO0A 5JRSA 3TKUA 3NLBA 1JVPP 4GK2A 4U40A 5H9BA 2XP2A 4FV4A 4E6QA 2ZMDA 4FIHA 4IADA 3Q4TA 3QFVA 1XBAA 2H6DA 2UZUE 3DLZA 4L7SA 4S34A 4EOKA 4JR3A 2GQRA 5T6KA 4ANNA 4J8MA 2XM9A 4EORA 1KE9A 1NW1A 3FSKA 1XMLA 3UODA 3R7VA 4NFMA 5TO8A 3OG7A 4GVAA 2VD5A 4AXEA 4AUAA 4BTKA 3F2RA 4FSTA 3EQPA 5C03A 4OUCA 4ZSJA 4DG2E 4ANBA 3WZJA 4CFNA 4P4CA 3K54A 2DWBA 3REPA 1A9UA 1MRVA 5GZ9A 2OJGA 5HG5A 4DGGA 5CVFA 3GP0A 4QYFA 3OW3A 4A9TA 4YUQA 4G9CA 4MXXA 4XV3A 4B7TA 3DXPA 5CS6A 5CZHA 4FEWA 3NYNA 3Q5IA 4F4PA 2RL5A 4NFNA 3NPCA 2FA2A 3QWKA 4O91A 3PZEA 3V8TA 3QCXA 4FV9A 4IJ9A 1NA7A 3D5UA 4P90A 3C9WA 4BIDA 2B7AA 4NSTA 3MIYA 3Q9XA 4W8EA 3F9NA 2Y6MA 4YJSA 3FLZA 1BYGA 4JXFA 5FRIA 3SX9A 1XBCA 3BQCA 4IB1A 2YWVA 1YKRA 3QQJA 4LV5A 5CYIA 1Z57A 2QODA 3ZONA 5BVEA 4BCKA 4H58A 3K3IA 5F1ZA 5CF5A 4U3YA 3B8QA 5T3QA 4CT1A 2YA9A 4LFIA 2VTQA 3I6WA 4C35A 4CNHA 3HMNA 4LQMA 4F9YA 4IM3A 5J8IA 3VS0A 2O8YA 4WSQA 2CGVA 2QU5A 5CF6A 4FNYA 4F63A 3NFFB 4FKGA 4OBPA 3K3JA 5I9VA 4IWQA 3B2TA 2WAJA 3C50A 3GU5A 3H10A 2PYWA 2ITZA 1ZZLA 2XNNA 1T46A 4ERKA 4IM0A 4XJ0A 3C4ZA 4HW7A 2X0PA 3TV6A 4IW0A 5K5XA 1HCLA 4RC2A 4ZLYA 2YIXA 4R1VA 4QEBA 4KIKA 4L3LA 1YW2A 2UW5A 4KA3A 4H05A 2NRUA 2JFLA 1PXPA 2O0UA 3SXRA 5FBOA 3BHYA 5CEMA 3WYXA 2XKEA 3DNDA 4BGHA 3GC0A 3MA3A 5E1EA 3ID6C 4IHPA 2W5BA 2Z7QA 4FMQA 4CTCA 2REIA 3EN5A 5HZNA 3CEKA 3U9NA 4EJNA 4BKJA 3FYJX 3D7ZA 3MPMA 2UW4A 3EKKA 4ENXA 1JKTA 5EHLA 5I4NA 3TNIA 5DG5A 3A7HA 3MDYA 4GKHA 5BVDA 3LW0A 4ZTNA 3MESA 3GCSA 4M7IA 3WF9A 3MGYA 4JQ8A 5E91A 2BIKB 5BMSA 3OWPA 4RJ8A 4PY1A 5ACBC 3PXQA 2YJSA 2E9UA 4H1MA 3ORNA 3KB7A 2OU7A 4QMUA 4EZ3A 5AAGA 2C5XA 3QZGA 2YEXA 3R1QA 4EC9A 4J52A 1OUKA 2VNYA 1P4FA 3AGMA 4WG4A 3ULZA 3UQFA 3O23A 4O84A 2HWPA 3NGAA 3JUHA 3ZS5A 3BLHA 2PMOX 4D2TA 3RAWA 2R9SA 2VV9A 1IR3A 5K0XA 4GKIA 3AC5A 1W83A 1GOLA 3NZ0A 1U4DA 5DR6