2J7TA

Crystal structure of human serine threonine kinase-10 bound to su11274
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
293
structure length
285
Chain Sequence
HVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Activation Segment Dimerization: A Mechanism for Kinase Autophosphorylation of Non-Consensus Sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 285
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2j7tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2j7tA01
2OBJA 2PUNA 4IVAA 4P7EA 4FNXA 1QPJA 3U51A 3DKGA 4CQEA 5DPVA 3EQHA 4I6BA 4W4VA 2VZ6A 4ZAUA 3KXGA 3H0YA 1SVHA 1CKIA 3LFEA 2R3FA 3QHRA 2W4JA 3QQUA 4M0YA 4NWMA 4APPA 4GIIA 3ZBFA 4MH7A 4BWKA 2Z2WA 3DFCB 2F2CB 3RPRA 4RWLA 5AA9A 3COMA 3AT2A 3HUCA 3L8XA 3OMVA 3GEQA 4QYHA 5HG9A 3BGZA 2C6OA 4IVBA 3TTJA 1ZYCA 4LV8A 4DEIA 4QMLA 5H9BA 3DB6A 2CCHA 1E1VA 2GSFA 4GW8A 2C1BA 3EKNA 3EQFA 3QD3A 4EJNA 3P4KA 2HENA 3F5XA 3COIA 3FI3A 5FGKA 1YWNA 2YDJA 2OGVA 5BUEA 3ZO2A 4JBVA 3OTVA 3DTCA 3ZC5A 4RJ3A 4W4YA 5I9UA 1H0VA 4RX7A 4DEAA 5A54A 3EHAA 4DTBA 5L8LA 4J95A 3NUXA 4RBLA 1Q41A 2OKRA 3BYOA 4NEUA 4AF3A 2XIYA 5KX8A 3FUPA 2OI4X 3VS7A 5FRIA 4G31A 4MK0A 3DTWA 3KC3A 3NIEA 2HZ0A 2IO6A 3I5NA 3RTPA 4K6ZA 1H00A 2JITA 4PDPA 3CBLA 4KA3A 2BPMA 4OLIA 3PIZA 5IKWA 3A7HA 5I9VA 4ZY5A 3K2LA 2QG5A 2PVRA 4X2KA 3HNGA 3MH3A 3OBJA 2XYNA 2ETRA 2UZLA 4L8MA 4UEUA 2WMWA 3RHKA 4WNMA 2DWBA 1RJBA 5D10A 2JKQA 3PPZA 4XLIA 1FOTA 2WELA 4O7SA 4F08A 4K1BA 4PPBA 4QRCA 3GBZA 1QPDA 2CLXA 2XF0A 1UA2A 3EL8A 3NZ0A 5DIAA 3CS9A 3PLAE 4EZ3A 3GP0A 4HVGA 5ACBC 3DKOA 2HCKA 3PVBA 2GTNA 4FK3A 4RIXA 5BVKA 1KE5A 4CFNA 4F0GA 5M09A 2W4KA 3KA0A 4G2FA 4CLJA 3VS4A 3FQSA 3RAWA 5BYYA 5JMSA 5B0XA 3ZBXA 2HXLA 3OXTA 3G5DA 4GS6A 4D1ZA 2ZJWA 3E3PA 3G2FA 1GZ8A 3FY2A 4JBOA 3QQKA 4XRJA 5CQUA 4JXFA 4CG9A 3Q53A 5TR6A 3U6JA 2G9XA 3RWQA 4NW6A 5HKMA 2R5TA 3WF5A 3UO4A 2XS0A 5AR8A 1H1RA 1MP8A 3MDYA 2F7EE 1Q8YA 4R77A 3OCSA 4ACMA 4V0GA 3GCQA 4FSNA 3O50A 4Y46A 2HYYA 1H28A 1XR1A 3QCXA 3OFMA 2REIA 4MXZA 4IM2A 3S2PA 3B2WA 4A9SA 4V01A 5IF1A 1FPUA 2ITWA 2BKZA 1TQMA 4NCTC 5HO8A 4X3FC 2R3GA 4RIYA 1Z5MA 5CI6A 4DEDA 1T45A 2G01A 4EK5A 2XEZA 5AV2A 4PPCA 4S2ZA 4JVGA 1XBCA 3C0GA 4ZEGA 1Q5KA 4DFXE 3NNUA 5J79A 1RQQA 4KIOA 4S30A 4IX4A 4YZMA 3UODA 4R7IA 4QOXA 2J5FA 3DOGA 1P5EA 3BQCA 3I60A 4XJ0A 2UW5A 4L3PA 4I23A 4JT3A 3JXWA 1W82A 1ZMVA 3LQ5A 3UBDA 3QQFA 4DH7A 5LVMA 2HY81 3C5UA 3HRFA 4D9UA 2XNBA 4I5CA 3Q4ZA 4ITHA 2C5NA 2XKDA 2BALA 4YC6A 4FTCA 3BZ3A 3LMIA 4LRKA 4L42A 3JR1A 4YURA 4ACDA 4BR3A 3NEWA 2PZPA 1K9AA 4CYIA 4FK6A 2GNIA 3FMKA 5BVWA 4FEWA 2X8DA 3E5AA 3NAXA 4FTMA 3KMWA 2QOFA 4X2GA 3MESA 3UO6A 1CKPA 2ZB1A 3DCVA 3O8PA 3FQEA 2PUUA 2EU9A 3DBDA 5KBRA 4HGTA 2C6TA 1ZOHA 4W8DA 3R71A 4YNEA 5HD4A 4YZBA 2YCRA 3PYYA 4NYEA 1JAMA 3KEXA 3LFDA 3C0HA 3ENHA 3RALA 2H9VA 3KK9A 4UWCA 2G2FA 4FZAB 1DAYA 4CD0A 4BCNA 4FIHA 4HYUA 5I9WA 5EM7A 2BTRA 3UNZA 2YM4A 3LCTA 3QTIA 3BPRA 2C6LA 2VGOA 4U5JA 3TKHA 5AV3A 4EOIA 2F7ZE 2W5BA 4IFGA 5A9UA 1W7HA 3MSSA 1NVRA 1UWHA 3CGOA 4JR7A 4NTSA 5DNRA 4QQJA 2R3MA 4C4GA 4DG2E 3GU5A 4WSQA 4DGMA 2V7AA 4E3CA 3VBQA 4BI0A 2PVLA 3HV6A 2WEIA 3ZLWA 3VS3A 4EZ5A 5DA3A 4TKSA 3BLQA 3DJ5A 4XG7A 2ZOQA 4IDVA 4C34A 4EQUA 4XP0A 1XH8A 3EWHA 3VS0A 3PE1A 3AMYA 2HAKA 4UN0C 2RFDA 4YC8A 4ZTLA 4DT9A 3RHXA 2ZVAA 2RG6A 4QMOA 4GUBA 3TCPA 2YZAA 4ZY6A 1R78A 1VZOA 2IVTA 2PE1A 3PJ2A 4G9CA 4PPAA 2ZV7A 4X7QA 5HTBA 2YA9A 5KKRB 3BWJA 4O86A 3VJNA 4FV9A 5EW8A 3FY0A 4CMUA 4MTAA 2H34A 3QXOA 4PV0A 4ANQA 4EONA 3QTSA 1PHKA 5I9ZA 3UJGA 3B2TA 4LYNA 4UZDA 2VTNA 1UKIA 4J97A 1H07A 3AD4A 5FD2A 1YDSE 5HTCA 3LCOA 3G33A 5ANGA 2X81A 1M14A 5IEVA 4HCUA 1YOLA 2R3PA 4FL1A 4YJPA 3ITZA 4P90A 5AR2A 3OP5A 2VTOA 5FDPA 3VC4A 3W8QA 4IANA 4GJ2A 4BDCA 3LXPA 3K54A 3RZBA 2G2HA 3E92A 3P79A 4DT8A 2ERKA 3A61A 1YW2A 3ZTXA 3S95A 4TNDA 2C3JA 2PY3A 3BYUA 3ORNA 2C68A 3R6XA 4FKOA 4HYIA 4YJNA 4C35A 2X4FA 4F6WA 3GQLA 3WARA 4A07A 4O0XA 2W5HA 4YC3A 3MIYA 1AGWA 5AR4A 1WBNA 3IW7A 3UIUA 3VBVA 2BUJA 1Y57A 2PU8A 4XOZA 4H39A 3OUKA 2JIUA 3FXZA 4MNEA 2AUHA 1KSWA 4JX7A 1DI8A 2HW7A 4I20A 1Y6BA 2XH5A 3UOKA 3EKKA 3I0QA 3T3UA 5CALA 5L2SA 4HVDA 3S1HA 2BROA 4FT0A 2BKKA 4O7TA 2NP8A 1URCA 5AV4A 3IDBA 5CT7A 4F65A 3QZHA 3PUPA 2ETMA 3NS9A 5CU4A 3PZEA 4LUDA 2JDRA 3KGAA 3ATSA 2Z7RA 2B55A 3VW8A 3QCYA 5L4QA 4S33A 5M4UA 4TRLA 1PYEA 4ID7A 3OY3A 4ZSAA 3OHTA 5A4TA 4UB7A 2XJ0A 4R3CA 2XK6A 2OLCA 1I44A 4JBPA 4BDJA 3FPMA 3MTFA 4LM5A 4EHGA 3RGFA 3E7OA 3FLZA 4RZVA 5CQWA 5IQGA 3KCKA 3R9NA 1OMWA 4BTFA 2VWUA 3GC8A 3CIKA 3QX4A 5KHXA 3OXZA 4O7NA 3E7VA 4FT3A 5TE0A 3R8MA 2XB7A 4TN6A 4BCFA 5JQ5A 2G2IA 1UKHA 3UE4A 5DBXA 4RJ7A 3FWQA 4A9RA 2OIDA 1OIQA 2YZLA 4N6YA 2CPKE 4BI1A 1BMKA 3LKMA 4C58A 2GPHA 1XH7A 1Y8YA 2YAAA 2C3KA 3Q6UA 3KU2A 4DG3E 3NUSA 2RKUA 5HORA 4U3YA 2LGCA 4S32A 4FEXA 4F09A 2RL5A 2HY0A 2FSMX 3VUMA 2ACXA 3T9IA 4R7HA 4O38A 4ZSGA 4QPMA 2WKMA 3DDQA 3K5VA 4IE9A 3FQHA 3VO3A 3II5A 2W1DA 4JDKA 2F49A 4AWIA 4UMUA 4E20A 4FKQA 4IB1A 5DOSA 3SXFA 4BCGA 3VJOA 2W7XA 4GK2A 2C0OA 2C6KA 3F3TA 4GG7A 3ZSGA 5I4NA 3OBGA 3QTUA 2R3QA 4QT1A 5FTQA 4M68A 4FUXA 4AA5A 4CT1A 4XG8A 4AN9A 3HA8A 4G1WA 3IOPA 1O6LA 1Y8GA 2NRYA 4YLKA 4RJ8A 4IX6A 4QPSA 4AOJA 1REJA 1VJYA 2VWYA 1J7UA 2R3KA 2PMIA 5JGBA 1H1SA 4C3RA 3K3JA 1V0OA 3HVCA 2J0IA 3FKOA 3O71A 4LQMA 3R21A 3E8NA 3NW7A 3F88A 4OAUC 5KKRC 1TQIA 4I6QA 5BX0A 1ZRZA 4ITIA 3IPHA 3MN3A 5E8UA 3IQ7A 2BILB 2Q0BA 4APCA 3I5ZA 5J5SA 3FJQE 3C1XA 2BFYA 2P2IA 4I0SA 3H9FA 3UMWA 3N4UA 3FC2A 3R9OA 3EN5A 4EH6A 4HYSA 4ZOGA 1PW2A 3EQCA 3DB8A 3QRTA 4DBNA 3KMUA 1K2PA 3I79A 4L45A 4V05A 2I0HA 5DN3A 3GU8A 2RF9A 3Q9WA 1J1BA 4IQ6A 5L2QA 2X8IA 4XG4A 3QU0A 3EYHA 3LIJA 5CU2A 5E8VA 3SRVA 5I3RA 5IPJA 2GQGA 3D15A 4KKHA 4Q5HA 1ZMUA 4U45A 3FZ1A 4FYOA 4O7ZA 4AG8A 2OJGA 5AUVA 2ZDUA 2CJMA 2UW9A 4HYHA 5F20A 3R2BA 4FSZA 4GH2A 4Y95A 2YEXA 1U46A 4FTLA 4Q9ZA 3ODYX 4QMNA 2E9UA 3FE3A 3HL7A 2X7FA 3A62A 4EC9A 4F7NA 4E4XA 2XNMA 4WUNA 1Q3DA 3BHYA 4D2TA 4UV0A 2BMCA 3OUNB 4MWIA 5L3AA 4FVPA 2IW9A 3NRMA 4BTMA 5M55A 2P0CA 3NCZA 3BV3A 4AP7A 5CT0A 3MPMA 3QZGA 4D4YA 5K5XA 4E93A 4EOQA 4RMZA 5CSVA 5HX6A 2J90A 4M67A 3MJ2A 5LJJA 3HMPA 4FKPA 4DEHA 3Q9YA 4FTQA 4FNWA 3ZLSA 4AW5A 4MQ2A 4O6EA 4JRVA 4BCKA 2Y9QA 4D4RA 4MX9A 3OW3A 5DH3A 5F4NA 5GZAA 5AX3A 2IZTA 3BCEA 3O8UA 3EMGA 4E4MA 4IAAA 2F2UA 3R7GA 1YVJA 2WMBA 5BNJA 4F6UA 3A4PA 2OW3A 4W8EA 3U6HA 2OZOA 2J7TA 2V55A 2C3IB 4ZMEA 2FA2A 2EB2A 1ZOGA 2QU6A 3LFBA 2IPXA 3GU4A 5CASA 2I1MA 3FLWA 5BMSA 4EOLA 2PYWA 3FMNA 2C3LA 5HTIA 2O8YA 4RWJA 3H9RA 3PSDA 1QPEA 5DWRA 3D9VA 3HYHA 1W83A 1PXJA 4FZDB 4NIFB 5JSMA 3TZ7A 3E8CA 3PVWA 4B9DA 2W1GA 2VAGA 4FE2A 3NYVA 4FKGA 2YLEA 5J9YA 3HAMA 2BIYA 3R28A 1GZKA 2ITOA 2VN9A 4U41A 2HWPA 3GCSA 1P4OA 2IZRA 3R8UA 5HQ0A 4PY1A 2CN8A 4NT4A 4QMYA 5CAUA 2VTPA 3VBTA 2W5AA 4QMTA 3HRCA 5CU6A 4C57A 5HESA 4FGBA 1QL6A 5D11A 4M12A 4UWYA 5CXHA 2IVUA 3HEGA 5KZ0A 3PJ1A 3GQIA 4NM7A 4JG7A 3FAAA 4D2WA 5IMEA 3QRIA 2OH0E 4GEOA 4C7TA 2J51A 3PTGA 3FI8A 3CD3A 5HGIA 4O27B 4ZTHA 1WAKA 2EUFB 2SRCA 2VTTA 3FZRA 4ZMFA 2H6DA 2QOBA 1J3HA 2IVVA 3RP9A 5HLPA 5KNJA 2C1AA 1M7QA 4F9WA 5H8BA 4FEUA 2OWBA 3MBLA 4NK9A 3MI9A 2AC3A 5CAQA 5A4LA 3ZYAA 3ROYA 4KSPA 4D4SA 3R1QA 4BKZA 3FZOA 3W1FA 2PZRA 3ALOA 3LW0A 3UGCA 1KWPA 2PVFA 4FTUA 3RKBA 3TACA 4F63A 4QMQA 2YWPA 3IG7A 2R3HA 4EJ7A 4B6LA 1NW1A 4M7IA 5BVDA 5L6PA 3BYSA 4MF1A 4AACA 4WG3A 1GJOA 5DI1A 5AAGA 2JFLA 4YZCA 2YJRA 4M69B 3VRZA 4QTEA 2CMWA 3PPJA 2R7IA 4K8AA 5IH5A 2JEDA 3D83A 3MA6A 2BCJA 1ZOEA 4FKLA 3ZDUA 4IAZA 1URWA 2A27A 3CKXA 3I6UA 2WGJA 3M11A 5IQBA 3PRIA 4GCJA 3HMNA 4B8MA 4DCEA 3LJ1A 3TZMA 4RC4A 2VO3A 2VV9A 1PXOA 3CKWA 1JNKA 1CM8A 4FTIA 4RX8A 5LCKA 4AGCA 5IA0A 2WMSA 3OF0A 3QLFA 3HV3A 5M56A 1YXUA 3W2QA 2CLQA 2X39A 4IEBA 4ZLOA 1LEWA 4KRDA 4DGGA 2GHLA 4BCPA 5HZNA 1F5QA 3CCNA 3QLGA 3R8PA 2VWZA 3QC9A 2BAJA 4P5ZA 5J95A 4DEGA 3GOKA 2ZMCA 2RFEA 4PMSA 4RT7A 4TNBA 4D4VA 4AW0A 5AUTA 1VR2A 3D5WA 4U79A 4BCOA 1IA9A 3KK8A 4LMNA 4PTEA 4RPVA 2YIRA 4XG2A 4P5QA 3GU7A 5HNGA 4E6CA 3GOPA 4UMPA 2UZUE 1MUOA 2G15A 4UZHA 4EK8A 5ETAA 1YI3A 3EFKA 5HVJA 3NUUA 4O2PA 3ZLYA 2QQ7A 4EQMA 2QOQA 4O21A 4K18A 4IDTA 1PXLA 4FL2A 4BF2A 4BIDA 3QYZA 4FR4A 2O65A 2O3PA 4IADA 4F1TA 3KB7A 2HZNA 2O0UA 3R7OA 4BL1A 4QMXA 3ZFMA 4AFEA 1OKYA 3QTWA 1JLUE 4RIWA 3FDNA 4YJVA 5GNKA 5FBOA 4RG0A 2KULA 5DMZA 4IFCA 3NGAA 4ASZA 3W2SA 3U8WA 2O5KA 2PVKA 4YZNA 3WF7A 4BBFA 4EBWA 4YTCA 1Q62A 4I5PA 3TUDA 1HCKA 3U6IA 2PUIA 2J0JA 4DFBA 4BBEA 5BYLA 4CNHA 3SW7A 3HLLA 4FV8A 2XKFA 2R3JA 5AUZA 3C0IA 4XV3A 3DS6A 5A4CA 4GT5A 4DA5A 2V22A 2I0YA 2GS2A 2QURA 3VBXA 3R7EA 1OGUA 4F6SA 3KN5A 4X2NA 3NW6A 3IS5A 1NVQA 3TZ8A 4AZSA 1PF8A 3V5PA 2GU8A 1MQ4A 4X6RA 3RJCA 3D14A 4EYJA 2BHHA 3TWJA 2XM9A 1CMKE 4GSBA 3NAYA 4LMUA 5K9IA 3NUPA 3IW5A 2WTWA 1OB3A 3JYAA 2WIPA 4JNWA 4RGJA 3R9HA 5AMNA 3UO5A 4FKIA 4QD6A 5CXZA 2ZM3A 3CR0A 5HE0A 5TOZA 4FKVA 4D2PA 3UVRA 3SKCA 4CVAA 5HVKA 2BHEA 4BYJA 5J9LA 2UW0A 4ENXA 4FF8A 3VS1A 3SVVA 2WTJA 4BCIA 2YWVA 4J52A 2ZYBA 4X3FB 5EQEA 4II5A 3CXWA 3EZVA 2Z7LA 3G0EA 2XMYA 3JUHA 5HIBA 4L44A 3P23A 3OS3A 3AQVA 3DT1A 4PDYA 3H30A 4AFJA 5D41A 2RIOA 2XK7A 3AC4A 5IUGA 2XA4A 3MGYA 2VNWA 4YJOA 5J1VA 3TM0A 2CKOA 1O9UA 3ZEWA 1PKDA 2A0CX 3FMMA 3RPYA 3WBLA 3T3VA 4C38A 4IJ9A 4CGAA 5M08A 4IWOA 3FXWA 2WXVA 3I1AA 3S3IA 3QBNA 4EK4A 2OXYA 4ACCA 2IW6A 3POOA 5KCVA 2B53A 1Z9XA 3RAHA 2HK5A 1BI7A 4J96A 1A06A 2EB3A 3FYKX 3FLNC 4O0TA 5EQYA 3WI6A 4DITA 4HCVA 5IZFA 1Q8TA 3GT8A 2QOCA 2UZEA 4CV9A 4F9YA 3AMBA 3OCBA 3F3VA 2O2UA 3FLSA 1J1CA 4AGWA 3DU8A 2OFVA 3PXFA 3K5UA 4YBJA 5D1JA 2OICA 3MIAA 3DLZA 1WBWA 2W99B 4GL9A 4IB0A 3RAIA 4BI2A 4N70A 4DG0E 3CTHA 3SXRA 3D94A 3QA0A 4C59A 4JAJA 2I40A 5AX9A 4GUEA 1J7LA 1H01A 4IZYA 2W1EA 2OO8X 4O82A 3D5VA 3TTIA 2CGUA 4OUCA 2X7OA 3FBVA 5J1WA 3E88A 3DBCA 3DK7A 3AMAA 1OITA 2EXCX 4TZRA 5D7AA 1Z57A 3OWKA 4BB4A 4KNBA 1V0BA 2WO6A 2UUEA 4RVKA 4DN5A 5M06A 3QKLA 3TUBA 3EFLA 4QYGA 3VW6A 5JZJA 5DR6A 5CEIA 3UOLA 1NY3A 3IONA 2HELA 4NFNA 1V0PA 2E9NA 3PJCA 4RRVA 3RINA 3HMIA 2Y4IC 2R2PA 1A9UA 1YWVA 4CRSA 4C36A 5FTOA 3TIZA 4BGQA 4EEVA 5JK3A 5C27A 2ITVA 5LMKA 4N57A 3MVLA 2EXMA 2VUWA 3D7TB 4PQNA 2GNHA 4CTCA 2PL0A 1P14A 2PMNX 3MVMA 4KB8A 4OBPA 4KKGA 5EW3A 1U54B 2OXXA 2RFNA 4GIHA 5EFQA 4YTIA 4DTAA 2CGVA 4GMYA 3TKUA 3TZ9A 5KZIA 2XVDA 4FI1A 4YZDA 4KKEA 1KE8A 5C9CA 3Q4TA 2B9IA 3V5QA 4FG9A 3AXWA 4ZS0A 2CN5A 4IM3A 4RX9A 4DGLC 5ANJA 4TXCA 1B39A 3R04A 2R3RA 1Q61A 4I94A 2C0IA 5CAVA 5HCYA 5M44A 3TT0A 3R02A 4KS8A 4DYMA 5CX9A 2Y6MA 3QUDA 4PL5A 5EKOA 2VTHA 4LV5A 4N4SA 2XNOA 5EKNA 3NCGA 4EH5A 5LOHA 4U8ZA 3FHIA 5E8SA 3QCSA 3VUIA 5CAOA 3VBWA 3LFNA 3C7QA 3PY1A 4AQCA 3ANQA 5AJQA 5GZ9A 5FXRA 3TXOA 5F1ZA 4IW0A 1U59A 4G34A 2WPAA 2FSLX 4B0GA 4U80A 5HE1A 3BU5A 3KULA 3PJ3A 4FIJA 4WOVA 3HA6A 3EN7A 4E8AA 2B0QA 4MQ1A 3BGQA 3TEIA 1JVPP 3ATTA 3E63A 3C13A 2FO0A 2X4ZA 3FI4A 4E4LA 5BUJA 1YXVA 1IRKA 3GUBA 4FNZA 5KMNA 4G3CA 4WG4A 3REPA 4BIBA 4MD8E 2QLUA 2Z7QA 3FPQA 4GU6A 4BHNA 4DE4A 3ZZEA 1H8FA 3B8QA 3QZIA 3ODZX 4IVCA 5IDPA 4BY9E 4KIKA 1H1WA 1U4DA 1WBOA 1Q8UA 5M07A 1OL6A 4NUSA 2W1FA 2WTVA 3POZA 4A9UA 4QTAA 4AA0A 2NO3A 5LXMA 2ITUA 3QA8A 5DVRA 4WO5A 3F2NA 4BCJA 4ZZMA 4MXYA 1UNLA 4YMJA 3RPOA 3CEKA 3TI1A 5HLWA 3R2YA 4FZFB 4FKWA 2QO2A 3TJDA 4DFNA 4A9YA 1FGKA 4C62A 4E7WA 4O84A 3AC3A 3LLTA 4KUJA 2HZIA 5A14A 2DQ7X 4P4CA 4JG6A 4QP2A 4Q2AA 5HHWA 3LCDA 4ZIMA 4BDEA 4C4EA 5HBJA 1F3MC 2JGZA 4DH5A 3EQGA 4EWQA 3LQ8A 4LUEA 4RSSA 4QP3A 5EOLA 5HVYA 4JS8A 4AUAA 5LMAA 5EI8A 3OC1A 2JFMA 1JSTA 4ASDA 2YM3A 2WZJA 5FBNC 4WIHA 3M2WA 2NNWB 3SX9A 4PNKA 5C26A 5J5TA 4PL4A 4FSWA 2ITXA 4ZP5A 5ETCA 4DLJA 3ERKA 5TO8A 2I6LA 2X2MA 3GCUA 1OIUA 4FYNA 2VWWA 2X6DA 4QYEA 4FIGA 4WHZA 3RK5A 4EHVA 4ENYA 3NVKI 5FM3A 5IUHA 1AD5A 4H3PA 2YAKA 3MFTA 1YDTE 4YJQA 2J2IB 3COKA 2OK1A 4M97A 3ZUVA 2NRUA 4J99A 4IAFA 2XYUA 4MF0A 4UMTA 2OJIA 3LMGA 1ZAOA 4PL3A 3AT3A 3OD6X 3LAUA 1YI6A 3MW1A 4LGDA 1FMKA 2R4BA 2VO7A 3RK9A 1ZYJA 4YTHA 4LL5A 5E8XA 3MTLA 3V5JA 3NYXA 5IA4A 1YI4A 4FOCA 3KF7A 4L52A 3GENA 5CF6A 1GIJA 2V5QA 4I1ZA 2CGWA 3ORIA 4OTQA 2B1PA 2YIWA 1GZNA 5KMIA 2QC6A 2WFYA 5CWZA 3IW8A 3U54A 3THBA 3TV4A 3NIZA 2ZDTA 4Y83A 2Q0NA 3BHTA 1UNHA 2JC6A 2OH4A 3BHHA 3CPCA 2JIVA 2WU6A 3MB7A 4L7FA 3PDTA 4AZEA 1Q3WA 3BHUA 1UU8A 3TDVA 4DFUA 4FTTA 1R0PA 3PY0A 5ICPA 2FYSA 3QQGA 4B8LA 4BN1A 5AUYA 5E8YA 1IAHA 2CKPA 2W4OA 3WIGA 3PXQA 2UZNA 3LXNA 3H4JA 4I22A 2OZAB 4YHTA 3UIMA 3Q4CA 3AT4A 3U4UA 2XUUA 3UQCA 4FT9A 4TT7A 1OI9A 2W05A 2X2LA 3EH9A 3UQFA 4WT6A 3FLYA 3JPVA 1MRYA 3U9CA 2PTKA 3WZDA 3MWUA 1ND4A 4QTDA 4I21A 3IOKA 2X7GA 2KTYA 2JDOA 2Z7SA 3FXXA 5EDPA 4HJOA 4FUYA 4UBAA 2UZDA 4O0UA 2FB8A 4TYEA 2BZIB 2B9JA 2C4GA 5FQDC 5IEXA 4I6HA 4OTWA 5KBQA 4USFA 4O7VA 2OJJA 2OU7A 3EJ1A 5ANIA 5AP4A 2FH9A 4Z9LA 1OPLA 4DGNA 1G5SA 5I0BA 4FSYA 2A1AB 1CTPE 3UOJA 3QGWA 1SYKA 4QMWA 3VS2A 1KE9A 4TW9A 5GIPE 3A7JA 3LCKA 2XNEA 2QO7A 5CU0A 4KABA 3O7LB 3L9NA 2W0JA 4U0IA 3KXZA 5IQFA 1XKKA 3QTQA 4AZTA 4W9WA 1FBNA 1G8SA 3EQDA 4V04A 4HGSA 3NUYA 2WOTA 4BFMA 4FV5A 5KUPA 5ITAA 5H3QA 4YPSA 4R7BA 3LFQA 4R8QA 2UW8A 1W8CA 3R8LA 4CRLA 3DQWA 3V3VA 5LCJA 5HO7A 4C3FA 4M8TA 1JBPE 1YXTA 4GT4A 4CSVA 3HKOA 3MH0A 5LVLA 3LXLA 5EYCA 3CTQA 3V8SA 3KQ7A 4FX3A 2P4IA 4IH8A 2BAQA 3D4QA 3ZDIA 3ORTA 5JRSA 3G0FA 5HNBA 2IVSA 2P33A 5DEWA 5LMBA 3DNDA 2XBJA 1R1WA 4IB3A 4FEQA 5DT3A 3DNEA 4OW8A 4O96A 1XBAA 3NYNA 3ORPA 4O7LA 3D0EA 5DE2A 2ZM1A 3V5TA 5IA3A 2JAMA 4H3BA 4EC8A 2C6DA 4EOSA 2J50A 2BTSA 3LFSA 2XJ2A 4FKUA 3DBQA 1FVVA 1XQZA 3NNWA 4NCTA 4R5SA 1OZ1A 3MH1A 4O0RA 5EDRA 1M2RA 5IA5A 2R3IA 3ZC6A 4JDIA 1OKZA 2PHKA 3ANRA 4QO9A 4ZTMA 3Q9XA 5CSXA 4O6LA 4C4JA 2IJMA 4RQKA 1XHAA 4FTOA 5CU3A 5AEPA 4IXPA 4EUUA 2WOUA 3OY1A 1PXIA 1UWJA 1ZXEA 1GY3A 3GCPA 5LARA 4HPUE 4ANOA 4YLJA 3FZSA 2B4SB 4XHKB 4M0ZA 4YO6A 2VTJA 4NFMA 1APME 3PVUA 2QOOA 3P0MA 3SXSA 5CLPA 5EHOA 2WNTA 2XK8A 3OWJA 4WRGA 4H1JA 4AE9A 3A2CA 3Q9ZA 3SA0A 2QG7A 4L68A 2JDSA 3DAJA 3WE8A 3ENMA 2C6EA 4DFLA 2P2HA 2WQEA 2R0IA 4JBQA 3SG8A 4FIEA 3FSFA 2QD9A 3E87A 4KWPA 4YJSA 1GIHA 1PXNA 3L8SA 3P08A 1WFCA 5AP0A 3H10A 2ZAZA 1Q8ZA 4I5HA 3G15A 3ZXZA 1KE6A 1W84A 3P78A 3W2CA 3HRBA 2WHBA 3ZXTA 4W9XA 4XV1A 4IZ7A 4F7JA 4IVDA 4J8MA 1YQJA 4Z3VA 4DH1A 1LPUA 4U9AA 4W4XA 3SOAA 4BWPA 4JG8A 3SW4A 5BUIA 3D2KA 2DS1A 4NZWB 4IC7A 5B7VA 2R3OA 5G1XA 3EZRA 4G6OA 5LVNA 2UW4A 3BEGA 5HG8A 2PUPA 3CQWA 5LVOA 3FL5A 3KRJA 3PG3A 4LOPA 5FG8A 5ANOA 4OAVB 3UYTA 2WMXA 4GK3A 5HICA 5TT7A 5ETIA 5CZIA 3R7UA 2JBOA 4RFZA 2XEYA 5J8IA 5CEOA 4JIKA 4CEGA 2X6EA 2JKOA 4E5BA 2ESMA 5IU2A 5AA8A 3WF9A 3FMJA 3MFRA 4XS2A 2GNLA 4CLIA 1J91A 4R6VA 3DQXA 3H3CA 4B7TA 2YCQA 2WMRA 3QL8A 2JKKA 4E6DA 4ERKA 1B38A 3CC6A 3MS9A 4ZLYA 2YCFA 2C5YA 3IDPA 3TNHA 4F0IA 4RIXB 1OM1A 1KUTA 1YDRE 2RSVA 2X8EA 3G9NA 4NW5A 5K5NA 1JOWB 3R1NA 3QTZA 4QQ5A 4GKIA 3VN9A 2WQBA 3HGKA 3L9MA 5EM5A 3NUAA 5FUTA 5IQAA 3KY2A 1F0QA 3W33A 2V7OA 3OWPA 3L9LA 1U54A 2R7BA 4RLKA 4O81A 2UVYA 2FSTX 4EZ7A 3ORXA 3GC9A 4TTHB 1O6YA 2OSCA 3CJGA 2XNNA 3HV5A 3CQUA 3KRLA 1XH6A 4CFVA 2UZTA 5HNIX 1J7IA 4FGRA 4AT4A 4ZTSA 3A8XA 3WIKA 3UPZA 4F9BA 3DY7A 1PXMA 3JY9A 4YUQA 2JAVA 3UC3A 2C47A 5GHVA 4D2RA 4C4FA 1U5QA 2UW3A 4BHZA 4J71A 2Z60A 4V0GB 4A9TA 1QCFA 3EQBA 4QTCA 3C51A 3VWAA 2P3GX 3MY1A 3DAEA 4G3DA 4OTGA 3CQEA 5HG5A 3BYMA 3EFWA 4G5JA 3MFUA 4G5PA 4O1OA 3MYGA 2OJFE 4OR5A 4YLLA 3TNPC 3ZUUA 2WU7A 1JKSA 2ETKA 4IB5A 4EHEA 2O64A 5HIDA 4EORA 3LCSA 2QR8A 2BRGA 5H2UA 4ANNA 3F2RA 5AAEA 3PSCA 3NX8A 2BRMA 3N4VA 4AA4A 3LXKA 3QGYA 4JQ7A 3ELJA 3QCQA 3R9RA 5L8JA 5IQCA 4OTPA 4U44A 4WUAA 5G6VA 5KE0A 4IIRA 4IWDA 4JOAA 3S4QA 3P9JA 4LGHA 3CY2A 5T3QA 1JKTA 2R9SA 4FVRA 4YR8A 4TYHB 3AG9A 3VRYA 5CF8A 3F82A 4KIQA 4U7ZA 3FC1X 1OL1A 1XBBA 4UXLA 3ZFXA 3QWKA 4FV2A 5E8ZA 5EOBA 3C4XA 4L7SA 4Z55A 3UVQA 2PSQA 3D7ZA 5CEPA 3W32A 2ZB0A 5D9HA 5J7HA 4L67A 1WVXA 2Z02A 5L8KA 2GNJA 4H3QA 1OPKA 1XO2B 3ZM4A 4BCQA 4CV8A 4MXAA 4EL9A 1IEPA 4PTGA 3QWJA 3RAKA 5JKGA 2VWIA 5E1EA 3VBYA 4FL3A 4ASXA 4YSJA 4OTDA 2E9VA 4BCMA 1WVWA 3TIYA 5DG5A 5C1QB 4TPTA 3R7IA 4UY9A 1RE8A 1JKKA 2DYLA 1NT2A 2PMLX 4RX5A 5GIOE 4GVAA 3TKIA 2GDOA 4WD5A 4QYYA 2JDVA 3ZMMA 1WZYA 3UYSA 2UVXA 2XBAA 2QNJA 4YP8A 4XG3A 3ZCLA 3R63A 3EIDA 4XV2A 3M42A 4EYMA 4BZOA 2YCSA 1GNGA 4G6NA 3BX5A 3KVWA 1SVEA 1OBGA 3ZRMA 1UV5A 4X21A 4FG8A 5BVEA 4QP6A 4WBOA 3G51A 2QR7A 2XZSA 3C50A 1QPCA 5IMXA 4JI9A 5J7BA 4FT7A 3TV6A 4MEDA 3ORZA 4KBKA 5CSWA 2XNPA 4PNIA 5CYIA 4AT5A 4YGAA 3UNJA 3DLSA 3V04A 2G1TA 3Q96A 4ZTQA 3GFWA 1OPJA 4R1VA 4Y5HA 2QODA 3U9NA 1OKWA 4GKHA 4GYIA 3PY3A 3MB6A 1XJDA 2ONLA 2IZUA 2Z8CA 4C8BA 3BE2A 3HDMA 4KIPA 5AIKA 3U4WA 1WBTA 4I6FA 1R0EA 3V5WA 2RFSA 4A4OA 3RM7A 1R39A 3FMHA 3A8WA 3OXIA 4NSTA 4G6LA 3PXKA 4IAIA 2VWVA 2Y4IB 4MBJA 4YSMA 2YERA 3RPVA 4DH8A 4EWHA 3LM5A 2RG5A 2AYPA 4HGLA 1CDKA 1ZZLA 5CY3A 4H05A 4FOBA 5AP3A 4FBXA 3QYWA 3ZEPA 2VTLA 1ZY5A 3HAVA 4RWKA 3VAPA 4E5AX 4AXAA 4TY1A 3R8VA 5CZHA 1Q97A 1XH5A 2W9ZB 1P2AA 2BZJA 4MAOA 4MHAA 4AOTA 4F70A 4DCAA 4TYIA 4ZSLA 3DAKA 4F1MA 4ZTNA 3ZO3A 3DXPA 3WZEA 4B99A 3BWFA 2ZMDA 3R1YA 4CKRA 4C33A 1FQ1B 1PXKA 3GC7A 4K77A 4R3RA 4I4EA 1SM2A 3FV8A 4O7YA 4YPDA 3RK7A 4DTKA 4M13A 5AR5A 1UVRA 3SD0A 4XBUA 4EK6A 3QHWA 4ZS4A 4D1XA 4TWNA 1PY5A 2WTDA 3F5UA 3KXMA 4MCVA 5H8EA 4EH7A 3KXNA 2XCKA 2CKEA 5L6WL 3R73A 4OGRA 4MNEB 2ITPA 4KRCA 4X2FA 3KRRA 4HNFA 4X6QC 4Y5QA 3RI1A 1L3RE 4PDOA 2JBPA 4OTHA 4YJTA 1IA8A 3P1AA 4I93A 2XKEA 2QU5A 5C4KA 4FTKA 3V6RA 1LEZA 3PFQA 3LFAA 3LVPA 3EN4A 2CGXA 5AV1A 3K3IA 3WZJA 5HU3A 2BRHA 3R9DA 4PUZA 4R3PA 5CF4A 1REKA 3PSBA 4LI5A 4FV0A 4CFUA 4MD9E 2PWLA 4YO4A 3LJ0A 5I9XA 2F7XE 2HXQA 3RVGA 3AC5A 4O7RA 4Q9SA 3AOXA 4OTIA 3R8ZA 2CHLA 4YHFA 2Y7JA 3PWDA 5CI7A 5AUWA 1OECA 1DI9A 1W98A 1ATPE 4YZ9A 1KV1A 4AGUA 1GAGA 4AU8A 3LJ2A 3MFSA 4NJDA 3FMEA 2J9MA 1LUFA 4H36A 3OEFX 4EOPA 4M15A 3DKFA 2BZKB 3HV4A 4ZZOA 3SOCA 3LMHA 4IM0A 2GCDA 4R5YA 5JFWA 2QOHA 5AM7A 4BIEA 4AS0A 2XIRA 4BGGA 3GCVA 4YBKA 1U5RA 4KSQA 2VTIA 2XNGA 5CSHA 4AN2A 3BEAA 5EM8A 5KO1A 5M4CA 1TVOA 3HV7A 4FV1A 5B2MA 3IK3A 1ZMWA 4M84A 4C2WA 3UZPA 4HZSA 1B6CB 3PIXA 1IAJA 4IHPA 1WBSA 2VU3A 3HDNA 1JPAA 2JLDA 4FSUA 5ACKA 2A4LA 1X8BA 3FI2A 3V5LA 3UZRA 5KMKA 5EH0A 3O23A 5C01A 3D5XA 3DXQA 3MA3A 1OL2A 3OEZA 4RVTA 5AUXA 3VS6A 4JAIA 4E1ZA 4EKKA 5JEBA 4EOMA 3QTRA 3UP7A 3DFAA 2R3NA 1UU9A 4TWCA 4L01A 2OXDA 2GHGA 1AQ1A 3LOKA 3CLYA 1T46A 2XRUA 4FG7A 4TYGA 5DHJA 4DFYA 4S34A 3VULA 4Z7GA 3Q60A 4QNYA 3MJ1A 3QRUA 5C8NA 4UX9A 3R7VA 2YM6A 2WTKB 3TNIA 1M7NA 4L6QA 5IA1A 4ZLZA 3PE2A 4MXXA 4UYAA 3NSZA 4J53A 4I3ZA 3V01A 4FKJA 3V8WA 5JH6A 4HPTE 5AADA 2J4ZA 5JZNA 2PK9A 3LFFA 4M66A 4QP7A 3QQJA 4QNAA 2PVNA 4D1SA 3BRBA 2QOIA 3PLSA 3MV5A 2CCIA 3H0ZA 4NJ3A 3SDJA 5AP5A 3UDBA 3OCTA 2J0MB 3HP2A 1PMVA 3ZFYA 3ULIA 4ANMA 3JY0A 3OTUA 5LWNA 3RZFA 5EM6A 3KRWA 2WAJA 4J98A 3OOGA 2JIIA 3DBFA 3O8TA 1Q4LA 2A2AA 2B9FA 3VF8A 2HIWA 2YIYA 3F66A 3O7LD 3LPBA 4I0TA 4PDSA 4MNFA 5IQHA 3I7BA 4ALUA 4AZWA 3TUCA 3PXRA 3KL8A 5C8MA 4JDJA 4NL0A 1JWHA 1ZYLA 3SRVB 2PVHA 2PZ5A 4X0MA 1KOBA 5HBHA 4A06A 5CANA 4USDA 1H1QA 3N51A 2C5VA 3V8TA 4PX6A 4C4HA 3FMDA 4HVHA 1UU3A 4CKJA 4JLCA 3DPKA 4O7WA 3PIYA 4IMYA 2GMXA 1BL7A 3AGMA 3F2AA 4RQVA 3UVPA 4WBBB 3Q5ZA 4CYJA 4XBRA 4F0FA 3P7CA 3RMFA 3T8OA 3G9LX 4MXOA 2GNFA 4GU9A 4LOQA 3TJCA 4AW1A 5L6OA 4WKQA 3I4BA 4FVQA 2PE0A 4ANSA 4TL0A 3DXNA 4I41A 3DKCA 5FDXA 4C37A 4ONAA 1ZWSA 3QKKA 3PA3A 5AP6A 4FZ7A 1M2QA 4UYNA 4X2JA 2QLQA 5HU9A 2I7QA 1FMOE 4F9AA 2HOGA 4LG4A 4K9YA 1OUYA 2VRXA 3DK3A 2C30A 1UNGA 2GS7A 1BKXA 3OG7A 2ITQA 4LL0A 3SAYA 4BDFA 3DBEA 5DRDA 4ZSEA 3WZKA 5K3YA 3PXZA 4K0YA 2OF2A 4MYGA 1ZY4A 4BKJA 4U42A 5T68A 2VTQA 3VUGA 2C5XA 3FL4A 4XG6A 5E8TA 5FLFA 4QMVA 3FKNA 2VX3A 4NM0A 4XH6A 3IDCA 5HG7A 3W2OA 4C4IA 4M3QA 2QHMA 3OT3A 4CCUA 3AC2A 4EBVA 3AC1A 4EUTA 5EYKA 3EN9A 3QTXA 4FA2A 5M57A 3CY3A 4QMZA 4ANBA 3NPCA 3KRXA 3AGLA 2F4JA 3CE3A 2ITTA 3TN8A 5HIEA 4C61A 5DFPA 2WQMA 2VGPA 3KMMA 3MY0A 3D2IA 4YNOA 1BL6A 4RJ4A 4FSMA 4CMOA 4DHFA 5GZ8A 4BTJA 3TV7A 2Y8OA 3VVHA 2I0VA 2EVAA 1PMEA 3RM6A 5GINE 3FLQA 1IG1A 3O2MA 1Q24A 3QQHA 4AW2A 4AX8A 3BELA 4Y73A 4QP9A 2J0KA 3E62A 3KVXA 2CNVA 1YXSA 4DEEA 1Y91A 3DJ7A 3F5PA 4C02A 5DRBA 2UZWE 5EW9A 3ZSIA 4HOKA 1WVYA 3OOMA 5JFVA 3WILA 2BRBA 3FSKA 1VYZA 3CD8A 3C9WA 1GZOA 4NIFA 4TWPA 4U6RA 5HOAA 4BDKA 5F9EA 4O0SA 4G3EA 1Q99A 4ARKA 2GFSA 4ITJA 3S0OA 2BZHB 3PA5A 2X1NA 4CT2A 4L9IA 4FC0A 5IG1A 1XWSA 4XMOA 4GFMA 1LP4A 2BAKA 3F61A 3O0GA 3RCJA 2XK3A 3W18A 3WZUA 1QMZA 4A7CA 3T9TA 4CZTA 4HVSA 1M2PA 1DAWA 4L3JA 4M14A 3VQHA 4TYHA 2BDFA 3HZTA 3QD0A 4XOYA 3UMXA 3V6SA 4HGEA 4EOOA 1SZMA 3GC0A 3BV2A 4WNKA 3OWLA 4KBAA 1V1KA 2VTSA 4MXCA 4KS7A 5HE3A 4Y72A 4DAWA 2UVZA 1HOWA 2WTKC 1R3CA 3MPAA 1KOAA 4FMQA 2C69A 4HZRA 4BYIA 5IH6A 4E26A 2UZOA 2YLFA 4HCTA 3V51A 4ACHA 2VNYA 3IECA 3BKBA 2OIBA 2VX0A 4H1MA 5CNNA 5E8WA 3SHEA 4BDAA 4CZYB 3IGGA 2GFCA 1FVRA 3AD5A 4NTTA 4O0VA 4YJRA 4BDGA 2WMAA 4FTRA 3GB2A 5K0KA 3DJ6A 3QAME 4G9RA 4IAKA 4E6QA 3QD2B 4HNIA 3EB0A 3H9OA 1OL7A 3OT8A 1PKGA 2VWBA 2WD1A 2WIHA 3BLRA 5DT4A 4GFGA 5HD7A 2RGPA 4ZY4A 5KHWA 1DM2A 4ALVA 4UXQA 2QHNA 1GIIA 2PZYA 4XG9A 4Y8DA 3UTOA 3VNTA 4ANLA 4C3PA 4CFWA 2BVAA 3BE9A 3ID6C 1TQPA 3QQLA 3ORMA 4M69A 2UZBA 4N0SA 2F57A 4JDHA 4AZVA 3EFJA 1PXPA 3Q2MA 4USEA 4FTAA 2GNGA 5AR3A 5GJFA 4AZFA 2QO9A 2FSOX 3QXPA 4LGGA 3WF8A 3ACKA 3MVJA 4ZJJA 4BVUA 4EH8A 2YM8A 4O0WA 4YHJA 5JT2A 4UMQA 1WCCA 3HP5A 4LFIA 4MVFA 4QP4A 4QQCA 5I9YA 4FV4A 5HE2A 3GVUA 4AAAA 2JKMA 3GI3A 4EH3A 3A99A 5HBEA 4CQGA 2CDZA 2ZM4A 3BBWA 4QPAA 3ZUTA 4CFMA 2WTCA 3CPBA 4IZAA 4JR3A 4ZTRA 4F7SA 4ZZNA 3QX2A 4RIWB 5F94A 4BBMA 1SNUA 3KCFA 1H4LA 3TNQB 3IW6A 4IZ5A 2Y6OA 3QRJA 2OF4A 3WYXA 1H08A 4X3JA 4AE6A 5M4IA 4UMRA 2W96B 4RFMA 4ZSJA 2PVJA 1K3AA 3ZRLA 2CNUA 3ZLXA 2YISA 3NDMA 1JKLA 4QMMA 5BVNA 2GS6A 3OROA 1TKIA 3CGFA 4Y85A 4ALWA 4RC3A 2JD5A 2UV2A 3E64A 3R01A 4FTNA 3E3BX 2OFUA 3P7BA 1S9IA 4FT5A 5FXSA 5AAFA 5BPYA 4PRJA 2J5EA 2PPQA 3QRKA 3QUEA 3PVGA 5E7RA 4BWXA 4EK3A 3HMOA 4R1YA 5ANEA 4MBIA 3LQ3A 5CS6A 3NVMB 2CSNA 5A46A 5FWKK 4YU2A 5E90A 3ZO1A 2VWXA 4F9CA 2HW6A 4GG5A 2WB8A 5BQ0A 5JGDA 4NU1A 3EQRA 1WMKA 5F95A 5HLNA 2GQSA 3FMLA 2FGIA 3UNKA 1P4FA 4G3FA 5IQIA 2QCSA 2PVYA 5FEDA 5GJDA 3RPSA 3PWYA 4U97A 2DUVA 1ZYDA 2A19B 2P55A 5ETFA 3C4ZA 4FSTA 2HWOA 2QONA 3ZZWA 3BU6A 4CG8A 5JQ8A 4K11A 4O1PA 2PMOX 2YIXA 4XP3A 2YJSA 2YABA 3ROCA 4CXAA 2C6MA 3A7IA 4S31A 3A60A 5CTPA 1XH4A 2X9FA 3F69A 2PULA 4XRLA 4PMMA 1YXXA 5FEEA 2WMQA 3F6XA 3BYVA 3SGCA 5E9EA 3EL7A 4IX3A 2C6IA 4FV3A 2X9EA 3UC4A 4LRJA 3EQPA 2IZSA 2ITZA 1G3NA 3R7YA 2YACA 5IA2A 3QC4A 3ZRKA 2EWAA 3A7GA 4X3FA 3ZOSA 3KF4A 3C4EA 5CENA 3TG1A 1CSNA 3SLSA 3CSVA 4JQ8A 4RVMA 1EH4A 3SV0A 1ZARA 2VTRA 2XP2A 4E5WA 2WEVA 2XK9A 3W16A 3W2PA 2HZ4A 4K33A 3GXLA 2O63A 3O96A 4QTBA 5JFSA 2Q83A 4U40A 5KMJA 4OBOA 1H24A 5CEKA 4ZJIA 2X0GA 2YIQA 3F3WA 1XH9A 3RNYA 4AT3A 4HVIA 5AM6A 5T6KA 4ORKA 2PZIA 1FVTA 3PZHA 2V0DA 2C5OA 3F7ZA 3Q5IA 4ASEA 2CKQA 2BRNA 2QKWB 5CVHA 3CP9A 1BUHA 2VO6A 2WMUA 3BIZA 1I09A 4PP9A 4I5MA 4DLIA 2YHVA 4LRMA 4O0YA 5E1SA 3KFAA 5FP5A 3WOWA 5M51A 1H26A 3E93A 5JFXA 4Q5EA 4EH9A 3DGKA 4OT5A 5JGAA 4AN3A 5LVPA 4XYFA 4XX9A 5DT0A 2XK4A 2ITNA 2XIZA 2YFXA 3BHVA 3W8LA 4XLVA 3NR9A 4NM3A 4MKCA 4A4LA 3VUTA 3DK6A 4F7LA 4EOJA 3VF9A 2J0LA 1PYXA 4DBXA 3MY5A 4CKIA 3UP2A 3ZS5A 4BCHA 1PMNA 2ONLC 5FTGA 3F3ZA 5M53A 5CAPA 2YDKA 3PJ8A 3EN6A 3VHEA 3ZHPC 3I7CA 5AWMA 1PJKA 3ZO4A 1IR3A 2NPQA 5J87A 2GQRA 4RJ5A 5EG3A 5D12A 3OCGA 2UW7A 2XIKA 3TDWA 5IQEA 4FKRA 4BC6A 3KXXA 4OBQA 4CZUA 1YOJA 4BZNA 3U87A 4KBCA 5FM2A 3PRFA 3UPXA 4C2VA 4H58A 4I24A 4D2VA 3OW4A 5EI2A 4NH1A 3QKMA 1JQHA 2FUMA 2IN6A 3TNWA 3B8RA 3ZU7A 2WQNA 2BIKB 2E2BA 5IUIA 3PA4A 5D7VA 3IKAA 4NKSA 5EYDA 4FZ6A 3ETAA 3LZBA 4KAOA 4NM5A 2VO0A 3HECA 3QZFA 1UU7A 4MBLA 3L9PA 5EK7A 4XUFA 5AR7A 5LQFA 2XCHA 3VUKA 3M1SA 4F1OA 3UZTA 3D7TA 3P5KA 4EH2A 5M4FA 3S00A 5CF5A 3R0TA 2IG7A 2GTMA 4J7BA 3GFEA 2XJ1A 5J9ZA 4L43A 3C4WA 2H96A 5TF9A 3BU3A 4JL9A 4WA9A 5EHLA 2VX1A 4D9TA 5DR2A 3UOHA 2J6MA 4Z7HA 4EI4A 1YRPA 3WF6A 4FEVA 3C5IA 1VEBA 1M52A 3A7FA 3QD4A 3VIDA 1SVGA 3KULB 3KKVA 3BQRA 4O22A 5C03A 4BICA 4F99A 1STCE 3PP1A 4JJRA 4DF3A 3PPKA 4PMTA 3P86A 5FEQA 4ZXTA 4YTFA 2V62A 3HMMA 5K4IA 3DA6A 3ZM9A 5A6NA 2R64A 5AIRA 3FZTA 2W06A 3UG1A 4PMPA 2QOKA 3NUNA 4RIYB 3ULZA 4IWPA 4D5HA 4IC8A 1ZYSA 3MVHA 3NWWA 4RLLA 2PVMA 5AP1A 4QP8A 4QQTA 1YWRA 3KREA 4DGOA 2AC5A 2WMVA 4RJ6A 1OL5A 4IWQA 1OVEA 5FP6A 4ZK5A 4KIKB 5IH4A 5JRQA 3F3UA 3KXHA 5CEQA 3RBWA 5A3XA 4F64A 4D0WA 2YN8A 5BVOA 2W1IA 4RA4A 3DZOA 3EQIA 5IISA 5L2IA 4FSRA 2I0EA 3L1SA 3JVSA 1A48A 3QF9A 4RZWA 2YITA 3ORKA 3U55A 4GV1A 4RC2A 1RDQE 2QVSE 3MPTA 3NNXA 3EOCA 4GK4A 5KMMA 3I81A 3G6GA 5BMMA 3Q04A 4C0TA 4PWNA 4D28A 4EOKA 3FEGA 4CMTA 3Q2JA 3Q52A 4PTCA 5HO6A 4I0RA 4XV9A 3Q4UA 4D2SA 5I5ZA 4QMUA 5DGZA 4BRXA 5HCXA 4F4PA 3TL8A 4BTKA 4TYJA 3Q32A 3UIXA 4FICA 1YHVA 1E1XA 2QI8A 4XNEA 3WE4A 4RVLA 3ET7A 4L00A 2W1CA 3O51A 5LWMA 1H27A 1OUKA 2ZV2A 4EHZA 2ZV8A 3I6WA 3LFCA 3F5GA 4J8NA 2ZV9A 4AOIA 4G16A 4UALA 1ZLTA 4WNOA 3VUHA 2BDWA 3FZPA 2WTIA 5EDQA 2F9GA 2CNQA 5C4LA 4BDHA 3ZH8A 4GRBA 4CTBA 4PF4A 3COHA 2XIXA 3ALNA 4XP2A 4BDIA 5EHYA 3RNIA 4K2RA 2W9FB 4O2ZA 2R0UA 4JIAA 5EYMA 5IDNA 4FKSA 2BR1A 1H0WA 3G90X 2W1ZA 4DINA 1BX6A 2IW8A 4OT6A 5B2LA 4L46A 3F9NA 2XRWA 3VHKA 3BI6A 3SQQA 1OIRA 3PP0A 4FV7A 4Z16A 3F7WA 3DDPA 4GVJA 2Y0AA 2FVDA 4RA5A 1IASA 2WQOA 1KE7A 5LMKC 4FIFA 4DC2A 3NYOA 5TKDA 1YHWA 4OTFA 3L8PA 3R1SA 3AD6A 1FGIA 4IACA 1JSVA 3FYJX 5GJGA 3RCDA 4A4XA 4E4NA 3QALE 3LE6A 2EXEA 5A4QA 4GJ3A 1G8AA 4WG5A 1DS5A 3OVVA 3E8EA 3EYGA 4IX5A 4U43A 1OKVA 4QYFA 1H25A 3C4FA 3WYYA 3BGPA 4FV6A 2W17A 3Q6WA 4J1RA 3VS5A 1CKJA 4FTJA 4KD1A 4BDDA 4D0XA 2XM8A 1NVSA 5E91A 4IAYA 1S9JA 3W55A 1VYWA 4ACGA 2PE2A 3NMUF 3MH2A 5CSPA 3PXYA 3C4CA 4YJUA 1SNXA 3BLHA 4IBMA 2WMTA 4I4FA 4I92A 5DYJA 1JSUA 1RW8A 2OIQA 4MD7E 4TWOA 1OBDA 3JS2A 4GFOA 5A6OA 3L8VA 2IWIA 4GYGA 3RWPA 3A4OX 3SC1A 4UWBA 2W1HA 3ACJA 1E9HA 5E92A 4ERWA 2BFXA 3BBTB 3R30A 4PP7A 3IW4A 4B4LA 2OZAA 2B52A 2VTMA 2UW6A 4IJPA 1HCLA 5H8GA 3LM0A 3VQUA 1ZZ2A 4JX3A 3UIBA 3VUDA 3CTJA 2QOLA 2YM7A 3N9XA 5AP7A 3IO7A 3UG2A 5KMOA 4AGDA 4BGHA 3W10A 4KINA 5AP2A 5A4EA 2E9PA 3NNVA 2OG8A 1Q8WA 1BLXA 4QMPA 2ERZE 4RWIA 3W2RA 1MRUA 1Y6AA 2YDIA 2LAVA 4RIOA 1L8TA 3N4TA 4CFFA 5AFVA 5DLSA 4DFZE 1BYGA 2B7AA 3DZQA 2GHMA 4DEBA 1PMUA 3R83A 4MWHA 1YKRA 3E8DA 1MQBA 1YHSA 3OZ6A 3SG9A 4GT3A 5BVFA 5L2WA 3KN6A 4XEYA 2X2KA 3GU6A 3I0OA 3P7AA 3NW5A 5CNOA 3FKLA 1NA7A 4BKYA 3D5UA 1W0XC 1KV2A 1GOLA 4FSQA 3QUPA 4G17A 1M17A 4D55A 5IEYA 5FXQA 2JDTA 4N6ZA 4RFYA 2C0TA 2YM5A 4LOOA 4O83A 4OTRA 3HUBA 4NKAA 3LHJA 3HX4A 5B2KA 4WRSA 5CEMA 3LLAA 3FHRA 5ANDA 4FKTA 4WNPA 4D5KA 1WBPA 4FODA 4G3GA 3GGFA 1NXKA 4W4WA 3AC8A 1O6KA 2ITYA 1OIYA 3JVRA 4L53A 3R22A 5HI2A 3PG1A 2XKCA 5E4HA 4JQEA 4QMSA 3QFVA 1PRYA 2QKRA 4CCBA 5HEZA 5EI6A 4R78A 2B9HA 4EH4A 2BDJA 1BI8A 4E73A 1MRVA 2VTAA 4JRNA 5ANKA 1SMHA 3ZSHA 4D58A 3ORLA 5DR9A 4U3ZA 4L3LA 5AUUA 5HX8A 4FIIA 4WSYA 4O91A 5L2TA 1FINA 3GNIB 4DH3A 5K0XA 4EKLA 2R3LA 5BYZA 1YOMA 2UZVA 3R00A 2Y4PA 3NLBA 3CJFA 4U81A 3ZONA 5JN2A 5HCZA 5DEYA 2VD5A 4HW7A 3G6HA 3Q3BA 1H1PA 4FNYA 4P2KA 2H8HA 3UQGA 1WBVA 4XCUA 2B54A 5KMLA 2E9OA 4BZDA 4EQCA 1LR4A 5CVGA 5K4JA 3IGOA 5C8KA 4E6AA 3O17A 4QP1A 5CVFA 5AV0A 5I3OA 4BDBA 5IQDA 1ERKA 4CFXA 4ZJVA 2OJ9A 5EQPA 3DV3A
chains in the Genus database with same CATH superfamily
2OBJA 2PUNA 4IVAA 4P7EA 4FNXA 1QPJA 3U51A 3DKGA 4CQEA 5DPVA 3EQHA 4I6BA 4W4VA 2VZ6A 4ZAUA 3KXGA 3H0YA 1SVHA 1CKIA 3LFEA 2R3FA 3QHRA 2W4JA 3QQUA 4M0YA 4NWMA 4APPA 4GIIA 3ZBFA 4MH7A 4BWKA 2Z2WA 3DFCB 2F2CB 3RPRA 4RWLA 5AA9A 3COMA 3AT2A 3HUCA 3L8XA 3OMVA 3GEQA 4QYHA 5HG9A 3BGZA 2C6OA 4IVBA 3TTJA 1ZYCA 4LV8A 4DEIA 4QMLA 5H9BA 3DB6A 2CCHA 1E1VA 2GSFA 4GW8A 2C1BA 3EKNA 3EQFA 3QD3A 4EJNA 3P4KA 2HENA 3F5XA 3COIA 3FI3A 5FGKA 1YWNA 2YDJA 2OGVA 5BUEA 3ZO2A 4JBVA 3OTVA 3DTCA 3ZC5A 4O4CA 4RJ3A 4W4YA 5I9UA 1H0VA 4RX7A 4DEAA 5A54A 3EHAA 4DTBA 5L8LA 4J95A 3NUXA 4RBLA 1Q41A 2OKRA 3BYOA 4NEUA 4AF3A 2XIYA 5KX8A 3FUPA 2OI4X 3VS7A 5FRIA 4G31A 4MK0A 3DTWA 3KC3A 3NIEA 2HZ0A 2IO6A 3I5NA 3RTPA 4K6ZA 1H00A 2JITA 4PDPA 3PUFC 3CBLA 4KA3A 2BPMA 4OLIA 3PIZA 5IKWA 3A7HA 5I9VA 4ZY5A 3K2LA 2QG5A 2PVRA 4X2KA 3HNGA 3MH3A 3OBJA 2XYNA 2ETRA 2UZLA 4L8MA 4UEUA 2WMWA 3RHKA 4WNMA 2DWBA 1RJBA 5D10A 2JKQA 3PPZA 4XLIA 1FOTA 2WELA 4O7SA 4F08A 4K1BA 4PPBA 4QRCA 3GBZA 3O5AA 1QPDA 2CLXA 2XF0A 1UA2A 3EL8A 3NZ0A 5DIAA 3CS9A 3PLAE 4EZ3A 3GP0A 4HVGA 5ACBC 3DKOA 2HCKA 3PVBA 2GTNA 4FK3A 4RIXA 5BVKA 1KE5A 4CFNA 4F0GA 5M09A 2W4KA 3KA0A 4G2FA 4CLJA 3VS4A 3FQSA 3RAWA 5BYYA 5JMSA 5B0XA 3ZBXA 2HXLA 3OXTA 3G5DA 4GS6A 4D1ZA 2ZJWA 3E3PA 3G2FA 4DHJA 1GZ8A 3FY2A 4JBOA 3QQKA 4XRJA 5CQUA 4JXFA 4CG9A 3Q53A 5TR6A 3U6JA 2G9XA 3RWQA 4NW6A 5HKMA 2R5TA 3WF5A 3UO4A 2XS0A 5AR8A 1H1RA 1MP8A 3MDYA 2F7EE 1Q8YA 4R77A 3OCSA 4ACMA 4V0GA 3GCQA 4FSNA 3O50A 4Y46A 2HYYA 1H28A 1XR1A 3QCXA 3OFMA 2REIA 4MXZA 4IM2A 3S2PA 3B2WA 4A9SA 4V01A 5IF1A 1FPUA 2ITWA 2BKZA 1TQMA 4NCTC 5HO8A 4X3FC 2R3GA 4RIYA 1Z5MA 5CI6A 4DEDA 1T45A 2G01A 4EK5A 2XEZA 5AV2A 4PPCA 4S2ZA 4JVGA 1XBCA 3C0GA 4ZEGA 1Q5KA 4DFXE 3NNUA 5J79A 1RQQA 4KIOA 4S30A 4IX4A 4YZMA 3UODA 4R7IA 4QOXA 2J5FA 3DOGA 1P5EA 3BQCA 3I60A 4XJ0A 2UW5A 4L3PA 4I23A 4JT3A 3JXWA 1W82A 1ZMVA 3LQ5A 3UBDA 3QQFA 4DH7A 5LVMA 2HY81 3C5UA 3HRFA 4D9UA 2XNBA 4I5CA 3Q4ZA 4ITHA 2C5NA 2XKDA 2BALA 4YC6A 4FTCA 3BZ3A 3LMIA 4LRKA 4L42A 3JR1A 4YURA 4ACDA 4BR3A 3NEWA 2PZPA 1K9AA 4CYIA 4FK6A 2GNIA 3FMKA 5BVWA 4FEWA 2X8DA 3E5AA 3NAXA 4FTMA 3KMWA 3W0PA 2QOFA 4X2GA 3MESA 3UO6A 1CKPA 2ZB1A 3DCVA 3O8PA 3FQEA 2PUUA 2EU9A 3DBDA 5KBRA 4HGTA 2C6TA 1ZOHA 4W8DA 3R71A 4YNEA 5HD4A 4YZBA 2YCRA 3PYYA 4NYEA 1JAMA 3KEXA 3LFDA 3C0HA 3ENHA 3RALA 2H9VA 3KK9A 4UWCA 2G2FA 4FZAB 1DAYA 4CD0A 4BCNA 4FIHA 4HYUA 5I9WA 5EM7A 2BTRA 3UNZA 2YM4A 3LCTA 3QTIA 3BPRA 2C6LA 2VGOA 4U5JA 3TKHA 5AV3A 4EOIA 2F7ZE 2W5BA 4IFGA 5A9UA 1W7HA 3MSSA 1NVRA 1UWHA 3CGOA 4JR7A 4NTSA 5DNRA 4QQJA 2R3MA 4C4GA 4DG2E 3GU5A 4WSQA 4DGMA 2V7AA 4E3CA 3VBQA 4BI0A 2PVLA 3HV6A 2WEIA 3ZLWA 3VS3A 4EZ5A 5DA3A 4TKSA 3BLQA 3DJ5A 4XG7A 2ZOQA 4IDVA 4C34A 4EQUA 4XP0A 1XH8A 3EWHA 3VS0A 3PE1A 3TMOA 3AMYA 2HAKA 4UN0C 2RFDA 4YC8A 4ZTLA 4DT9A 3RHXA 2ZVAA 2RG6A 4QMOA 4GUBA 3TCPA 2YZAA 4ZY6A 1R78A 1VZOA 2IVTA 2PE1A 3PJ2A 4G9CA 4PPAA 2ZV7A 4X7QA 5HTBA 2YA9A 5KKRB 3BWJA 4O86A 3VJNA 4FV9A 5EW8A 3FY0A 4CMUA 4MTAA 2H34A 3QXOA 4PV0A 4ANQA 4EONA 3QTSA 1PHKA 5I9ZA 3UJGA 3B2TA 4LYNA 4UZDA 2VTNA 1UKIA 4J97A 1H07A 3AD4A 5FD2A 1YDSE 5HTCA 3LCOA 3G33A 5ANGA 2X81A 1M14A 5IEVA 4HCUA 1YOLA 2R3PA 4FL1A 4YJPA 3ITZA 4P90A 5AR2A 3OP5A 2VTOA 5FDPA 3VC4A 3W8QA 4IANA 4GJ2A 4BDCA 3LXPA 3K54A 3RZBA 1OGYA 2G2HA 3E92A 1VLRA 3P79A 4DT8A 2ERKA 3A61A 1YW2A 3ZTXA 3S95A 4TNDA 2C3JA 2PY3A 3BYUA 3ORNA 2C68A 3R6XA 4FKOA 4HYIA 4YJNA 4C35A 2X4FA 4F6WA 3GQLA 3WARA 4A07A 4O0XA 2W5HA 4YC3A 3MIYA 1AGWA 5AR4A 1WBNA 3IW7A 3UIUA 3VBVA 2BUJA 1Y57A 2PU8A 4XOZA 4H39A 4AXDA 3OUKA 2JIUA 3FXZA 4MNEA 2AUHA 1KSWA 4JX7A 1DI8A 2HW7A 4I20A 1Y6BA 2XH5A 3UOKA 3EKKA 3I0QA 3T3UA 5CALA 5L2SA 4HVDA 3S1HA 2BROA 4FT0A 2BKKA 2XAOA 4O7TA 2NP8A 1URCA 5AV4A 3W0MA 3IDBA 5CT7A 4F65A 3QZHA 3PUPA 2ETMA 3NS9A 5CU4A 3PZEA 4LUDA 2JDRA 3KGAA 3ATSA 2Z7RA 2B55A 3VW8A 3QCYA 5L4QA 4S33A 5M4UA 4TRLA 1PYEA 4ID7A 3OY3A 4ZSAA 3OHTA 5A4TA 4UB7A 2XJ0A 4R3CA 2XK6A 2OLCA 1I44A 4JBPA 4AXCA 4BDJA 3FPMA 3MTFA 4LM5A 4EHGA 3RGFA 3E7OA 3FLZA 4RZVA 5CQWA 5IQGA 3KCKA 3R9NA 1OMWA 4BTFA 2VWUA 3GC8A 3CIKA 3QX4A 5KHXA 3OXZA 4O7NA 3E7VA 4FT3A 5TE0A 3R8MA 5BV3A 2XB7A 4TN6A 4BCFA 5JQ5A 2G2IA 1UKHA 3UE4A 5DBXA 4RJ7A 3FWQA 4A9RA 2OIDA 1OIQA 1XMMA 2YZLA 4N6YA 2CPKE 4BI1A 1BMKA 3LKMA 4C58A 2GPHA 1XH7A 1Y8YA 2YAAA 2C3KA 3Q6UA 3KU2A 4DG3E 3NUSA 2RKUA 5HORA 4U3YA 2LGCA 4S32A 4FEXA 4F09A 2RL5A 2HY0A 2FSMX 3VUMA 2ACXA 3T9IA 4R7HA 4O38A 4ZSGA 4QPMA 2WKMA 3DDQA 3K5VA 4IE9A 3FQHA 3VO3A 3II5A 2W1DA 4JDKA 2F49A 4AWIA 4UMUA 4E20A 4FKQA 4IB1A 5DOSA 3SXFA 4BCGA 3VJOA 2W7XA 4GK2A 2C0OA 2NYAA 2C6KA 4BJJB 3F3TA 4GG7A 3ZSGA 5I4NA 4QEBA 3OBGA 3QTUA 2R3QA 4QT1A 5FTQA 4M68A 4FUXA 4AA5A 4CT1A 4XG8A 4AN9A 3HA8A 4G1WA 3IOPA 1O6LA 1Y8GA 2NRYA 4YLKA 2XARA 4RJ8A 4IX6A 4QPSA 4AOJA 1REJA 1VJYA 2VWYA 1J7UA 2R3KA 2PMIA 5JGBA 1H1SA 4C3RA 3K3JA 1V0OA 3HVCA 2J0IA 3FKOA 3O71A 4LQMA 3R21A 3E8NA 3NW7A 3F88A 4OAUC 5KKRC 1TQIA 4I6QA 5BX0A 1ZRZA 4ITIA 3IPHA 3MN3A 5E8UA 3IQ7A 2BILB 2Q0BA 4APCA 3I5ZA 5J5SA 3FJQE 3C1XA 2BFYA 2P2IA 4I0SA 3H9FA 3UMWA 3N4UA 3FC2A 3R9OA 3EN5A 4EH6A 4HYSA 4ZOGA 1PW2A 3EQCA 3DB8A 3QRTA 4DBNA 3KMUA 1K2PA 3I79A 4L45A 4V05A 2I0HA 5DN3A 3GU8A 2RF9A 3Q9WA 1J1BA 4IQ6A 5L2QA 2X8IA 4XG4A 3QU0A 3EYHA 3LIJA 5CU2A 5E8VA 3SRVA 5I3RA 5IPJA 2GQGA 3D15A 4KKHA 4Q5HA 1ZMUA 4U45A 3FZ1A 4FYOA 4O7ZA 4AG8A 2OJGA 5AUVA 2ZDUA 2CJMA 2UW9A 4HYHA 5F20A 3R2BA 4FSZA 4GH2A 4Y95A 2YEXA 1U46A 4FTLA 4Q9ZA 3ODYX 4QMNA 2E9UA 3FE3A 3HL7A 2X7FA 3A62A 4EC9A 4F7NA 4E4XA 2XNMA 4WUNA 1Q3DA 3BHYA 4D2TA 4UV0A 2BMCA 3OUNB 4MWIA 5L3AA 4FVPA 2IW9A 3NRMA 4BTMA 5M55A 2P0CA 3NCZA 3BV3A 4AP7A 5CT0A 3MPMA 3QZGA 4D4YA 5K5XA 4E93A 4EOQA 4RMZA 5CSVA 5HX6A 2J90A 4M67A 3MJ2A 5LJJA 3HMPA 4FKPA 4DEHA 3Q9YA 4FTQA 4FNWA 3ZLSA 4AW5A 4MQ2A 4O6EA 4JRVA 4BCKA 2Y9QA 4D4RA 4MX9A 3OW3A 5DH3A 5F4NA 5GZAA 5AX3A 2IZTA 3BCEA 3O8UA 3EMGA 4E4MA 4IAAA 2F2UA 3R7GA 1YVJA 2WMBA 5BNJA 4F6UA 3A4PA 2OW3A 4W8EA 3U6HA 2OZOA 2J7TA 2V55A 2C3IB 4ZMEA 2FA2A 2EB2A 1ZOGA 2QU6A 3LFBA 2IPXA 3GU4A 5CASA 2I1MA 3FLWA 5BMSA 4EOLA 2PYWA 3FMNA 2C3LA 5HTIA 2O8YA 4RWJA 3H9RA 3PSDA 1QPEA 5DWRA 3D9VA 3HYHA 1W83A 1PXJA 4FZDB 4NIFB 1TFFA 5JSMA 3TZ7A 3E8CA 3PVWA 4B9DA 2W1GA 2VAGA 4FE2A 3NYVA 4FKGA 2YLEA 5J9YA 3HAMA 2BIYA 3R28A 1GZKA 2ITOA 2VN9A 4U41A 2HWPA 3GCSA 1P4OA 2IZRA 3R8UA 5HQ0A 4PY1A 2CN8A 4NT4A 4AQKA 4QMYA 5CAUA 2VTPA 3VBTA 2W5AA 4QMTA 3HRCA 5CU6A 4C57A 5HESA 4FGBA 1QL6A 5D11A 4M12A 4UWYA 5CXHA 2IVUA 3HEGA 5KZ0A 3PJ1A 3GQIA 4NM7A 4JG7A 3FAAA 4D2WA 5IMEA 3QRIA 2OH0E 4GEOA 4C7TA 2J51A 3PTGA 3FI8A 3CD3A 5HGIA 4O27B 4ZTHA 1WAKA 2EUFB 2SRCA 2VTTA 3FZRA 4ZMFA 2H6DA 2QOBA 1J3HA 2IVVA 3RP9A 5HLPA 5KNJA 2C1AA 1M7QA 4F9WA 5H8BA 4FEUA 2OWBA 3MBLA 4NK9A 3MI9A 2AC3A 5CAQA 5A4LA 3ZYAA 3ROYA 4KSPA 4D4SA 3R1QA 4BKZA 3FZOA 3W1FA 2PZRA 3ALOA 3LW0A 3UGCA 1KWPA 2PVFA 4FTUA 3RKBA 3TACA 4F63A 4QMQA 2YWPA 3IG7A 2R3HA 4EJ7A 4B6LA 1NW1A 4M7IA 3W0QA 4O4BB 5BVDA 5L6PA 4MUQA 3BYSA 4MF1A 4AACA 4WG3A 1GJOA 5DI1A 5AAGA 2JFLA 4YZCA 2YJRA 4M69B 3VRZA 4QTEA 2CMWA 3PPJA 2R7IA 4K8AA 5IH5A 3PFYA 2JEDA 3D83A 3MA6A 2BCJA 1ZOEA 4FKLA 3ZDUA 4IAZA 1URWA 2A27A 3CKXA 3I6UA 2WGJA 3M11A 5IQBA 3PRIA 4GCJA 3HMNA 4B8MA 4DCEA 3LJ1A 3TZMA 4RC4A 2VO3A 2VV9A 1PXOA 3CKWA 1JNKA 1CM8A 4FTIA 4RX8A 5LCKA 4AGCA 5IA0A 2WMSA 3OF0A 3QLFA 3HV3A 5M56A 1YXUA 3W2QA 2CLQA 2X39A 4IEBA 4ZLOA 1LEWA 4KRDA 4DGGA 2GHLA 4BCPA 5HZNA 1F5QA 3CCNA 3QLGA 3R8PA 2VWZA 3QC9A 2BAJA 4P5ZA 5J95A 4DEGA 3GOKA 2ZMCA 2RFEA 4PMSA 4RT7A 4TNBA 4D4VA 4AW0A 3NFGB 5AUTA 1VR2A 3D5WA 4U79A 4BCOA 1IA9A 3KK8A 4LMNA 4PTEA 4RPVA 2YIRA 4XG2A 4P5QA 3GU7A 5HNGA 4E6CA 3GOPA 4UMPA 2UZUE 1MUOA 2G15A 4UZHA 4EK8A 5ETAA 1YI3A 3EFKA 5HVJA 3NUUA 4O2PA 3ZLYA 2QQ7A 4EQMA 2QOQA 4O21A 4K18A 4IDTA 1PXLA 4FL2A 4BF2A 4BIDA 3QYZA 4FR4A 2O65A 2O3PA 4IADA 4F1TA 3KB7A 2HZNA 2O0UA 3R7OA 4BL1A 4QMXA 3ZFMA 4AFEA 1OKYA 3QTWA 1JLUE 4RIWA 3FDNA 4YJVA 5GNKA 5FBOA 4RG0A 2KULA 5DMZA 4IFCA 3NGAA 4ASZA 3W2SA 3U8WA 2O5KA 2PVKA 4YZNA 3WF7A 4BBFA 4EBWA 4YTCA 1Q62A 4I5PA 3TUDA 1HCKA 3U6IA 2PUIA 2J0JA 4DFBA 4BBEA 5BYLA 4CNHA 3SW7A 3HLLA 4FV8A 2XKFA 2R3JA 5AUZA 3C0IA 4XV3A 3DS6A 5A4CA 4GT5A 4DA5A 2V22A 2I0YA 2GS2A 2QURA 3VBXA 3R7EA 1OGUA 4F6SA 3KN5A 4X2NA 3NW6A 3IS5A 1NVQA 3TZ8A 4AZSA 1PF8A 3V5PA 2GU8A 1MQ4A 4X6RA 3RJCA 3D14A 4EYJA 2BHHA 3TWJA 2XM9A 1CMKE 4GSBA 3NAYA 4LMUA 5K9IA 3NUPA 3IW5A 2WTWA 1OB3A 3JYAA 2WIPA 4JNWA 4RGJA 3R9HA 5AMNA 3UO5A 4FKIA 4QD6A 5CXZA 2ZM3A 3CR0A 5HE0A 5TOZA 4FKVA 4D2PA 3UVRA 3SKCA 4CVAA 5HVKA 2BHEA 4BYJA 5J9LA 2UW0A 4ENXA 4FF8A 3VS1A 3SVVA 2WTJA 4BCIA 2YWVA 4J52A 2ZYBA 4X3FB 5EQEA 4II5A 3CXWA 3EZVA 2Z7LA 3G0EA 2XMYA 3JUHA 5HIBA 4L44A 3P23A 3OS3A 3AQVA 3DT1A 4PDYA 4F78A 3H30A 4AFJA 5D41A 2RIOA 2XK7A 4O4EA 3AC4A 5IUGA 2XA4A 3MGYA 2VNWA 4YJOA 5J1VA 3TM0A 2CKOA 1O9UA 3ZEWA 1PKDA 2A0CX 3FMMA 3RPYA 3WBLA 3T3VA 4C38A 4IJ9A 4CGAA 5M08A 4IWOA 3FXWA 2WXVA 3I1AA 3S3IA 3QBNA 4EK4A 2OXYA 4ACCA 2IW6A 3POOA 5KCVA 2B53A 1Z9XA 3RAHA 2HK5A 1BI7A 4J96A 1A06A 2EB3A 3FYKX 3FLNC 4O0TA 5EQYA 3WI6A 4DITA 4HCVA 5IZFA 1Q8TA 3GT8A 2QOCA 2UZEA 4CV9A 4F9YA 3AMBA 3OCBA 3F3VA 2O2UA 3FLSA 1J1CA 4AGWA 3DU8A 2OFVA 3PXFA 3K5UA 4YBJA 5D1JA 2OICA 3MIAA 3DLZA 1WBWA 2W99B 4GL9A 4IB0A 3RAIA 4BI2A 4N70A 4DG0E 4DDIA 3CTHA 3SXRA 3D94A 3QA0A 4C59A 4JAJA 2I40A 5AX9A 4GUEA 1J7LA 1H01A 4IZYA 2W1EA 2OO8X 4O82A 3D5VA 3TTIA 2CGUA 4OUCA 2X7OA 3FBVA 5J1WA 3E88A 3DBCA 3DK7A 3AMAA 1OITA 2EXCX 4TZRA 5D7AA 1Z57A 3OWKA 4BB4A 4KNBA 1V0BA 2WO6A 2UUEA 4RVKA 4DN5A 5M06A 3QKLA 3TUBA 3EFLA 4QYGA 3VW6A 5JZJA 5DR6A 5CEIA 3UOLA 1NY3A 3IONA 2HELA 4NFNA 1V0PA 2E9NA 3PJCA 4RRVA 3RINA 3HMIA 2Y4IC 2R2PA 1A9UA 1YWVA 4CRSA 4C36A 5FTOA 3TIZA 4BGQA 4EEVA 5JK3A 3AKKA 5C27A 2ITVA 5LMKA 4N57A 3MVLA 2EXMA 2VUWA 3D7TB 4PQNA 2GNHA 4CTCA 2PL0A 1P14A 2PMNX 3MVMA 4KB8A 4OBPA 4KKGA 5EW3A 1U54B 2OXXA 2RFNA 4GIHA 5EFQA 4YTIA 4DTAA 2CGVA 4GMYA 3TKUA 3TZ9A 5KZIA 2XVDA 4FI1A 4YZDA 4KKEA 1KE8A 5C9CA 3Q4TA 2B9IA 3V5QA 4FG9A 3AXWA 4ZS0A 2CN5A 4IM3A 4RX9A 4DGLC 5ANJA 4TXCA 1B39A 3R04A 2R3RA 1Q61A 4I94A 2C0IA 5CAVA 5HCYA 5M44A 3TT0A 3R02A 4KS8A 4DYMA 5CX9A 2Y6MA 3QUDA 4PL5A 5EKOA 2VTHA 4LV5A 4N4SA 2XNOA 5EKNA 3NCGA 4EH5A 5LOHA 4U8ZA 3FHIA 5E8SA 3QCSA 3VUIA 2ZFYA 5CAOA 3VBWA 3LFNA 3C7QA 3PY1A 4AQCA 3ANQA 5AJQA 5GZ9A 5FXRA 4LDTA 3TXOA 5F1ZA 4IW0A 1U59A 4G34A 2WPAA 2FSLX 4B0GA 4U80A 5HE1A 3BU5A 3KULA 3PJ3A 4FIJA 4WOVA 3HA6A 3EN7A 4E8AA 2B0QA 4MQ1A 3BGQA 3TEIA 1JVPP 3ATTA 3E63A 3C13A 2FO0A 2X4ZA 3FI4A 4E4LA 5BUJA 1YXVA 1IRKA 3GUBA 4FNZA 5KMNA 4G3CA 4WG4A 3REPA 4BIBA 4MD8E 2QLUA 2Z7QA 3FPQA 3W0NA 4GU6A 4BHNA 4DE4A 3ZZEA 1H8FA 3B8QA 3QZIA 3ODZX 4IVCA 5IDPA 4BY9E 4KIKA 1H1WA 1U4DA 1WBOA 1Q8UA 5M07A 1OL6A 4NUSA 4JMQA 2W1FA 2WTVA 3POZA 4A9UA 4QTAA 4AA0A 2NO3A 5LXMA 2ITUA 3QA8A 5DVRA 4WO5A 3F2NA 4BCJA 4ZZMA 4MXYA 1UNLA 4YMJA 3RPOA 3CEKA 3TI1A 5HLWA 3R2YA 4FZFB 4FKWA 2QO2A 3TJDA 4DFNA 4A9YA 1FGKA 4C62A 4E7WA 4O84A 3AC3A 3LLTA 4KUJA 2HZIA 5A14A 2DQ7X 4P4CA 4JG6A 4QP2A 4Q2AA 5HHWA 3LCDA 4ZIMA 4BDEA 4C4EA 5HBJA 1F3MC 2JGZA 4DH5A 3EQGA 4EWQA 3LQ8A 4LUEA 4RSSA 4QP3A 5EOLA 5HVYA 4JS8A 4AUAA 5LMAA 5EI8A 3OC1A 2JFMA 1JSTA 4ASDA 2YM3A 2WZJA 5FBNC 4WIHA 3M2WA 2NNWB 3SX9A 4PNKA 5C26A 5J5TA 4PL4A 4FSWA 2ITXA 4ZP5A 5ETCA 4DLJA 3ERKA 5TO8A 2I6LA 2X2MA 3GCUA 1OIUA 4FYNA 2VWWA 2X6DA 4QYEA 4FIGA 4WHZA 3RK5A 4EHVA 4ENYA 3NVKI 5FM3A 5IUHA 1AD5A 4H3PA 2YAKA 3MFTA 1YDTE 4YJQA 3UDTA 2J2IB 3COKA 2OK1A 4M97A 3ZUVA 2NRUA 4J99A 4IAFA 2XYUA 4MF0A 4UMTA 2OJIA 3LMGA 1ZAOA 4PL3A 3AT3A 3OD6X 3LAUA 1YI6A 3MW1A 4LGDA 1FMKA 2R4BA 2VO7A 3RK9A 1ZYJA 4YTHA 4LL5A 5E8XA 3MTLA 3V5JA 3NYXA 5IA4A 1YI4A 4FOCA 3KF7A 4L52A 3GENA 5CF6A 1GIJA 2V5QA 4I1ZA 2CGWA 3ORIA 4OTQA 2B1PA 2YIWA 1GZNA 5KMIA 2QC6A 2WFYA 5CWZA 3IW8A 3U54A 3THBA 3TV4A 3NIZA 2ZDTA 4Y83A 2Q0NA 3BHTA 1UNHA 2JC6A 2OH4A 3BHHA 3CPCA 2JIVA 2WU6A 3MB7A 4L7FA 3PDTA 4AZEA 1Q3WA 3BHUA 1UU8A 3TDVA 4DFUA 4FTTA 1R0PA 4AAYA 3PY0A 5ICPA 2FYSA 3QQGA 4B8LA 4BN1A 5AUYA 5E8YA 1IAHA 2CKPA 2W4OA 3WIGA 3PXQA 2UZNA 3LXNA 3H4JA 4I22A 2OZAB 4YHTA 3UIMA 3Q4CA 3AT4A 3W0OA 3U4UA 2XUUA 3UQCA 4FT9A 4TT7A 1OI9A 2W05A 2X2LA 3EH9A 3UQFA 4WT6A 3FLYA 3JPVA 1MRYA 3U9CA 2PTKA 3WZDA 3MWUA 1ND4A 4DHIB 4QTDA 4I21A 3IOKA 2X7GA 2KTYA 2JDOA 2Z7SA 3FXXA 5EDPA 4HJOA 4FUYA 4UBAA 2UZDA 4O0UA 2FB8A 4TYEA 2BZIB 2B9JA 2C4GA 5FQDC 5IEXA 4I6HA 4OTWA 5KBQA 4USFA 4O7VA 2OJJA 2OU7A 3EJ1A 5ANIA 5AP4A 2FH9A 4Z9LA 1OPLA 4DGNA 1G5SA 5I0BA 4FSYA 2A1AB 1CTPE 3UOJA 1TZDA 3QGWA 1SYKA 4QMWA 3VS2A 1KE9A 4TW9A 5GIPE 3A7JA 3LCKA 2XNEA 2QO7A 5CU0A 4KABA 3O7LB 3L9NA 2W0JA 4U0IA 3KXZA 2X0OA 5IQFA 1XKKA 3QTQA 4AZTA 4W9WA 1FBNA 1G8SA 3EQDA 4V04A 4HGSA 3NUYA 2WOTA 4BFMA 4FV5A 5KUPA 5ITAA 5H3QA 4YPSA 4R7BA 3LFQA 4R8QA 2UW8A 1W8CA 3R8LA 4CRLA 3DQWA 3V3VA 5LCJA 5HO7A 4C3FA 4M8TA 1JBPE 1YXTA 4GT4A 4CSVA 3HKOA 3MH0A 5LVLA 3LXLA 5EYCA 3CTQA 3V8SA 3W0SA 3KQ7A 4FX3A 2P4IA 4IH8A 2BAQA 3D4QA 3ZDIA 3ORTA 5JRSA 3G0FA 5HNBA 2IVSA 2P33A 5DEWA 5LMBA 3DNDA 2XBJA 1R1WA 4IB3A 4FEQA 5DT3A 3DNEA 4OW8A 4O96A 1XBAA 3NYNA 3ORPA 4O7LA 3D0EA 5DE2A 2ZM1A 3V5TA 5IA3A 2JAMA 4H3BA 4EC8A 2C6DA 4EOSA 2J50A 2BTSA 3LFSA 2XJ2A 4FKUA 3DBQA 1FVVA 1XQZA 3NNWA 4NCTA 4R5SA 1OZ1A 3MH1A 4O0RA 5EDRA 1M2RA 5IA5A 2R3IA 3ZC6A 4JDIA 1OKZA 2PHKA 3ANRA 4QO9A 4ZTMA 3Q9XA 5CSXA 4O6LA 4C4JA 2IJMA 4RQKA 1XHAA 4FTOA 5CU3A 5AEPA 4IXPA 4EUUA 2WOUA 3OY1A 1PXIA 1UWJA 1ZXEA 1ST0A 1GY3A 3GCPA 5LARA 4HPUE 4ANOA 4YLJA 3FZSA 2B4SB 4O4FA 4M0ZA 4XHKB 4YO6A 2VTJA 4NFMA 1APME 3PVUA 2QOOA 3P0MA 3SXSA 5CLPA 5EHOA 2WNTA 2XK8A 3OWJA 4WRGA 4H1JA 4AE9A 3A2CA 3Q9ZA 3SA0A 2QG7A 4L68A 2JDSA 3DAJA 3WE8A 3ENMA 2C6EA 4QDVA 4DFLA 2P2HA 2WQEA 2R0IA 4JBQA 3SG8A 4FIEA 3FSFA 2QD9A 3E87A 4KWPA 4YJSA 1GIHA 1PXNA 3L8SA 3P08A 1WFCA 5AP0A 3H10A 2ZAZA 1Q8ZA 4I5HA 3G15A 3ZXZA 1KE6A 1W84A 3P78A 3W2CA 3HRBA 2WHBA 3ZXT