2XKDA

Structure of nek2 bound to aminopyrazine compound 12
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
251
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDLKPANVFLDGKQNVKLGDFTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Aminopyrazine Inhibitors Binding to an Unusual Inactive Conformation of the Mitotic Kinase Nek2: Sar and Structural Characterization.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 251
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xkdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xkdA01
3BPRA 3HV4A 3OEZA 4MXXA 3S3IA 3IW7A 5GIPE 2P33A 3V5LA 3R02A 4G6NA 2F2CB 5H8EA 3JVSA 1J7UA 5HLNA 3FHIA 3OW3A 1V0OA 4GV1A 4ZSLA 1Q99A 5K5NA 2ZV8A 2JKMA 3QZHA 1OB3A 3KK9A 4W4VA 5GJFA 3R8PA 4M8TA 3ZO4A 4BB4A 3VW6A 4LL0A 4XG4A 4FUXA 5D1JA 5GZAA 1KE8A 4I6BA 4DFUA 4BCKA 3TUDA 5L2WA 3TUCA 2QOBA 3FMDA 5E8WA 4JJRA 5GHVA 4DAWA 4RGJA 4MTAA 3QUDA 4YJQA 3Q9WA 4PTEA 2BKKA 4X3JA 4FIIA 1URCA 2HZIA 4TWPA 5ANGA 5JFSA 2Y9QA 2X7OA 4GKHA 5HLWA 4IEBA 4FKRA 3P7BA 4FX3A 4R6VA 3RTPA 5A4CA 4FTIA 4OW8A 1FBNA 4U5JA 3OOMA 4MXZA 1SZMA 4RX5A 1FMKA 3FC2A 3UOJA 2ITQA 4MNEA 3ZRMA 5EHYA 4FTRA 5HO7A 3Q4TA 3QGWA 4FTNA 2BCJA 5JFXA 2WKMA 3VBVA 2X8IA 3RK5A 3ZDUA 1ATPE 5FWKK 4LL5A 1F3MC 3O8TA 3VUTA 3PY0A 3QYWA 3NUNA 2YZLA 5I9ZA 3QTWA 2BRBA 2R7IA 4WO5A 3ZLSA 5CI6A 1BKXA 4IWQA 2VTPA 4PPCA 2BKZA 2X0GA 3I60A 3ORXA 5F20A 4XV9A 2JGZA 4HYSA 1WBPA 3OT3A 4AGDA 4ZSGA 4RJ5A 4WOVA 4PNIA 3PPJA 4IX4A 3F88A 3OTUA 3FY0A 3OUNB 4KINA 4LFIA 1RQQA 5HG8A 4BDHA 5F4NA 3BELA 3IK3A 2W1FA 1RW8A 4FA2A 4FGBA 2VWWA 4LQMA 4GK2A 5I9XA 4BL1A 3DKOA 5CI7A 2VWXA 1PJKA 3QD2B 3LJ0A 5FEEA 1OIQA 3DBDA 4O96A 3OXZA 3UIBA 3HV7A 1FGIA 5DNRA 3AC3A 3FMKA 2OXDA 3SQQA 3PXQA 4O7WA 4ZZOA 4EBWA 3E88A 4KS8A 4O1PA 3QCXA 3BV3A 1J91A 4A9TA 4Z7HA 4R7BA 5L2QA 3SOAA 5J7BA 4O7NA 4C59A 5BUJA 2YDIA 5HD4A 3QFVA 3VQUA 3SG8A 4KBKA 3R01A 4GT4A 4GG7A 4OUCA 5BVDA 2F7ZE 2H8HA 3UG2A 4ACMA 2R3JA 3EZVA 5EI2A 5CASA 4MWHA 4C37A 3DV3A 5JH6A 3BI6A 3U4WA 5DA3A 5AR3A 3BYSA 3OW4A 1R0PA 3KXNA 4BKJA 5J79A 3SVVA 2VTLA 3COIA 2DYLA 3BLQA 4RZWA 4JR7A 1JKKA 3GXLA 4L67A 3N4VA 4Q9ZA 2XK4A 5AEPA 4LOQA 4D4YA 4U9AA 4J52A 4WNMA 2RKUA 4N6YA 4M13A 3OCSA 2R3IA 4RBLA 1NY3A 4BCOA 4QMTA 4D5HA 3A7HA 4CKRA 5LVNA 4ZMFA 4FV1A 2W4OA 4BCQA 2UZVA 3OT8A 3QZFA 3E8EA 4XG8A 1XJDA 4AT3A 4FZDB 4AQCA 5HIEA 3TKHA 1FVTA 2AC5A 3IDPA 4J71A 3R8LA 4FTMA 3TTIA 3UYTA 2C68A 4BF2A 2BDWA 3NYXA 4QPAA 3ET7A 2C6EA 2EVAA 3C0GA 2BUJA 4ONAA 4S30A 2UVZA 5IUIA 3R28A 3G6GA 4NK9A 4OAUC 5CS6A 4EK5A 3VUMA 4F7LA 3O7LD 5FXSA 4G3GA 1XR1A 3EFLA 4G3FA 4MBIA 4WKQA 4TWNA 3OFMA 3KRWA 4V0GA 4D4SA 3ZC6A 1PYEA 2V5QA 1VJYA 4O6EA 2X4FA 4OBOA 3V01A 2OJFE 5IQGA 1YDRE 4DCAA 5FTGA 3DGKA 3SGCA 4O6LA 4XLIA 2V7OA 2OIBA 3GQLA 3C0IA 4O7YA 4BDGA 5IH5A 5M56A 4MQ2A 3REPA 2PU8A 5DEYA 3OCGA 3C4ZA 1Y8YA 4BR3A 3BX5A 1ZY5A 2YAKA 2UW4A 3EFWA 3Q96A 3R1YA 3FI8A 3UC4A 2OG8A 4F65A 3CD3A 1ZY4A 2X8EA 3RAKA 3HDMA 2P4IA 5C1QB 3EWHA 4FVPA 4XBRA 4GSBA 3OCBA 4JDHA 5HVYA 3HUBA 5JGBA 2W4KA 5EI8A 2WU6A 4XG2A 3RNYA 4AG8A 3QTZA 2PZRA 2PMOX 4BICA 3NYOA 5CF8A 4IFCA 4E4LA 3A61A 2ZVAA 3L9MA 3UVRA 4IE9A 3TNPC 3P9JA 4K6ZA 4LRJA 4FV0A 4IX5A 4WNKA 3FXZA 3W18A 3TKUA 1H28A 3AQVA 5IU2A 5AP1A 3ULZA 3ZZEA 2FA2A 3OP5A 4TY1A 2WU7A 3C5UA 1P14A 1GIJA 2DUVA 4OAVB 1UWHA 2PULA 3OCTA 1H1RA 4EH3A 4I93A 2VN9A 4YLJA 3R21A 4EK8A 5KBRA 2IJMA 3LFBA 1H27A 1K9AA 5BMMA 3ZBXA 4B0GA 5HZNA 4I3ZA 3ETAA 4KABA 4AA0A 2Z02A 2RFSA 3VULA 4TW9A 5FBOA 3M2WA 2BAKA 3OTVA 3QTQA 2XRUA 2JD5A 3CKXA 1DS5A 3PJ1A 3VRYA 2F7XE 4FI1A 3VWAA 4AP7A 4J95A 4HCTA 3FI2A 1OKWA 4AW5A 5CU4A 3OWLA 4B8MA 4E4NA 3FI3A 4ITIA 4R5YA 4XRLA 4XCUA 2VRXA 5D12A 4TPTA 5FRIA 2UV2A 4ZOGA 2GHMA 3VS4A 4C8BA 3R8UA 4ANQA 3RWPA 4D2WA 3UP2A 2WMQA 3OY1A 2Y6MA 3G90X 5IA1A 3TIYA 4L44A 2CGVA 3HV6A 4Y8DA 2FVDA 5AP5A 5E8SA 3CTHA 4G1WA 1Q97A 4JI9A 4BYJA 4BIEA 2CKOA 2BALA 4EYMA 3NVMB 2BMCA 1WBVA 3ZSHA 1W83A 4YJUA 4F6WA 5ITAA 2BAJA 2BIYA 4O0VA 2WD1A 3ALNA 4ZTLA 1YW2A 2WIPA 1NVQA 3G33A 3LFCA 3WZKA 3NYNA 3LCOA 4RFMA 4KBCA 4ZY6A 4EH2A 4FL2A 5FP6A 4F0GA 2CNUA 2XNBA 2YCSA 3DBCA 4QTCA 1Q8WA 5HO8A 2Z7RA 4FG7A 4GJ3A 4DBXA 5HHWA 4EKKA 1H1QA 3JS2A 3NNUA 4ACCA 2Z60A 2JDTA 3D5WA 3AD5A 5F94A 5AAFA 4R78A 1G3NA 3E87A 3RMFA 4I4FA 2Y6OA 4MHAA 3U8WA 2NPQA 3V5PA 5FD2A 3RINA 3DBEA 3HA8A 4JG8A 5IA5A 4CGAA 3G6HA 3FLQA 4JG7A 3LW0A 2W06A 2XS0A 3NZ0A 5DT0A 4EH7A 3LJ1A 4H39A 1DAYA 4QMZA 3R22A 4G9CA 5FTQA 4F1TA 5BVOA 2BDFA 3UO5A 3ANQA 1WZYA 4A06A 2PY3A 5AX3A 3ZM9A 1Q8TA 3SRVB 3BU3A 3Q4UA 1QPEA 2KTYA 3WIKA 4TRLA 4RWIA 3TKIA 4RMZA 2XNEA 3ZZWA 3K3IA 1ZZ2A 5DRBA 2JIVA 3UP7A 4U7ZA 2WELA 3PJ3A 1Z9XA 4JAJA 3ZHPC 5HG9A 4QMLA 3LMGA 4M14A 3AD6A 4MBLA 2VTHA 2RFEA 5FP5A 4DTAA 3EKNA 4QYFA 3PJCA 4RC4A 3Q6WA 1PXMA 3F66A 2J4ZA 5GIOE 1YI4A 2R3PA 3JYAA 4O0UA 3W2PA 4UYAA 4IVAA 5L3AA 4YJPA 4UMUA 1YDTE 1PHKA 3FWQA 1L3RE 1ZLTA 4EC9A 3FC1X 2Q0BA 3MTLA 1YDSE 3NUUA 2W0JA 4D2VA 2WMSA 4QMQA 3CCNA 4AWIA 3QL8A 4AFEA 1EH4A 5GJGA 2VTJA 1H24A 2CCIA 4RQVA 2J0IA 2CSNA 3OOGA 1GAGA 5FM2A 3MY1A 1YKRA 3K5UA 4BYIA 2NP8A 4ZSJA 4KRDA 4MD8E 5H9BA 3KEXA 4NJDA 4XRJA 4WRGA 4TYIA 3SD0A 5GZ8A 5M4FA 2P2HA 5AIRA 4HYUA 4IAIA 5I3RA 2HZ0A 2OK1A 5AP3A 5IEXA 1PMVA 2UZNA 5AP6A 5I5ZA 1IAHA 2X7GA 3GQIA 3ORIA 3RPVA 4R77A 2XVDA 4FSUA 2P55A 3LE6A 3BE2A 3I0OA 4YO4A 2AYPA 3DAKA 1J1BA 4RFYA 4BTJA 4ACHA 4U43A 4FIHA 4GH2A 3KXGA 2YDJA 3NDMA 4JBOA 2WXVA 1UU3A 4MNFA 4PP9A 1M2RA 4U81A 4E6QA 3OD6X 3F3WA 4YZ9A 2F9GA 2X9EA 3UIXA 1KV1A 3TT0A 5CSHA 4AZEA 2WGJA 3JPVA 3R7OA 1OIYA 4TWOA 2I0YA 5EW8A 1H1PA 2VTQA 4FKWA 5AUXA 2G15A 4H58A 3TZ9A 5HKMA 3Q32A 1Q61A 3VRZA 3CR0A 5AJQA 5CY3A 1CMKE 2WMVA 3PXKA 4IW0A 3V04A 5DGZA 4TXCA 2VZ6A 3MJ2A 1R3CA 4K33A 4CFFA 4LV8A 4XS2A 4HGEA 3L8XA 2YJRA 4J98A 4A4LA 2IW8A 4RWLA 4AW2A 3NCGA 2IW6A 2YJSA 3D2KA 2XJ0A 1KE7A 3DB6A 3HMNA 3SG9A 1CKPA 5H8BA 2HW6A 3BQRA 3QKKA 2XEZA 5HESA 3O17A 3RPRA 3JR1A 3TDWA 1J7IA 2W05A 3MH1A 3Q5IA 5EKOA 4D1XA 1KE9A 3U9CA 3ZUUA 1M2QA 3S1HA 2YCFA 5EDQA 2P0CA 1PMEA 2WPAA 3HRCA 4RSSA 4G5PA 4F63A 5LMKA 2VWUA 5C8NA 3HYHA 4FTKA 3FMEA 3ORLA 3DAJA 3HKOA 2F7EE 3EHAA 4F1OA 3QALE 3L9NA 3GVUA 4PTCA 3VNTA 4PDSA 2GQSA 5E91A 3U9NA 5DEWA 5FGKA 3PPZA 3OBGA 4U3ZA 3RNIA 3SW7A 4I4EA 3MWUA 2PE0A 4JDJA 4ANBA 3FI4A 5K3YA 2B7AA 3DOGA 4X2NA 4YTHA 5AFVA 3DKGA 4DEDA 4RIYB 4I0SA 3HMMA 4CTCA 3JY0A 2VTNA 2XBAA 4FOBA 3NW5A 3S0OA 3DTCA 3DZQA 1BL6A 5L4QA 4BCJA 3LFAA 3QA0A 2VTSA 3OS3A 5LVLA 1JBPE 4F0IA 4Z55A 2QG7A 3QRIA 3UOKA 3UOLA 3SOCA 5IUGA 2XYNA 4NCTC 2GNIA 4R1VA 3TXOA 3B8QA 3EQIA 2Z7QA 4P7EA 1W82A 2YM8A 4OTFA 4BKZA 4H3PA 5DR6A 3DBFA 1RDQE 4BI2A 4QMUA 2B9IA 4DYMA 3PDTA 2Y4IC 5EM8A 5EM6A 4G2FA 2J5FA 3PTGA 2QO2A 1CDKA 5J9ZA 5JRQA 4KKHA 3SRVA 4I6HA 4IX6A 2PVYA 2OF4A 2Y7JA 2PZPA 4L52A 5E90A 2XKCA 2YCQA 5AAEA 3AD4A 4FE2A 2PVRA 3FZTA 2BR1A 3Q9ZA 4JAIA 3CS9A 3MW1A 3CY3A 2XUUA 1BLXA 3HX4A 4AUAA 5FUTA 4J8NA 2PVLA 2GU8A 4C4JA 4I5HA 4EHEA 1Y6BA 2CKEA 2Q0NA 2UZWE 2YM6A 4DFYA 4H3QA 3R9HA 3PE2A 2X7FA 3DLZA 3EL8A 1H01A 4ANNA 4BCGA 2XKDA 2UZOA 4RQKA 3NGAA 4BWPA 3QF9A 2ZV7A 4S34A 4EOJA 5J7HA 2VAGA 1XWSA 4PDYA 5ANDA 4FSWA 4QP3A 5HBJA 5J5SA 1IA8A 5KBQA 2WTCA 1T45A 1YI6A 3LXPA 3F7WA 2IPXA 5G6VA 5BVEA 2JFLA 1M7QA 1P5EA 1VZOA 3CGOA 4KRCA 2PZIA 4UXQA 4ALWA 4D4VA 4R3RA 4F64A 4AW1A 2QOFA 2YACA 4FNWA 2WQBA 4ZJJA 3V5TA 2VWIA 4IAFA 2PE2A 4M66A 4O0XA 3WF5A 4MD7E 3WILA 3C4WA 4QP4A 4FT9A 4OR5A 3NRMA 2J90A 4GKIA 1WVYA 2Z8CA 1Y6AA 2QOIA 2UVYA 4MF0A 4XEYA 5E7RA 4J97A 3A7JA 4UWYA 2VTTA 3QLGA 4EK4A 3ZFMA 5FEQA 4PF4A 4QYGA 1WVXA 4YJSA 4Y73A 2ONLC 3GC8A 3HMPA 2FYSA 3NPCA 3THBA 5IMEA 1PRYA 3DDPA 3C50A 2BDJA 4H1JA 3QTXA 3CSVA 5EW9A 1OL5A 4QO9A 5CQUA 3RM6A 4D28A 4YMJA 4BWKA 3C9WA 4C2VA 4IVBA 4FICA 2HOGA 3NW7A 4FTCA 1ZOGA 3EQFA 4IANA 4EZ3A 3B8RA 3LJ2A 5AX9A 4GT3A 5F9EA 2OF2A 2XP2A 2KULA 4AW0A 4YURA 4F9BA 5DYJA 2XK7A 3Q9YA 2V0DA 1OBDA 3W8QA 4DE4A 5T6KA 3EIDA 2XYUA 3D83A 3W2RA 2CDZA 1UNGA 4DTKA 1FMOE 4RIWB 4B8LA 3QLFA 4MEDA 4XH6A 1WVWA 2YIXA 4GUBA 4YC6A 5IQDA 4A4XA 5AV0A 3TI1A 3GB2A 5IISA 4OGRA 1NVSA 3IW4A 5JQ8A 4U6RA 4X2GA 4YP8A 2IW9A 5ICPA 3PY1A 2QURA 4X3FC 1S9JA 4AXAA 3HUCA 5T68A 4DH8A 1Y8GA 5LVOA 5ANIA 4LV5A 3QQFA 4QMSA 3F69A 4WSYA 4Y72A 5EYKA 5HCXA 4RA4A 3NCZA 4P2KA 2OXYA 4CMOA 4CFNA 2WMTA 5HQ0A 3N9XA 2REIA 3DA6A 4RX8A 4XHKB 4MXOA 5DIAA 4EONA 3RWQA 4AU8A 4QTEA 3RALA 2HW7A 4I5MA 4CKIA 4E3CA 4FG9A 2J9MA 2OJ9A 1K2PA 3MFRA 2PVKA 5I3OA 4WNOA 5K0XA 3LAUA 3PJ2A 4RIYA 3MPTA 3P79A 4RVMA 4F9CA 4BVUA 2BHEA 3HP5A 4YPDA 4HPUE 3PRFA 2WTKB 4ID7A 5J1VA 2XIZA 4O83A 3UMWA 5ETIA 3JVRA 4E7WA 3BYOA 4B7TA 3SKCA 3VHKA 4BCIA 3MS9A 4C4FA 1J3HA 3UNJA 1QL6A 4ZTMA 3WIGA 5AAGA 3UOHA 2J50A 3EB0A 4I6QA 1IASA 2C5YA 2Q83A 4BZDA 2XH5A 4YUQA 3D7ZA 3R73A 2X2LA 4Z3VA 4YZCA 5CAOA 4QMMA 2ITUA 2R2PA 3AMBA 4NM0A 3LXNA 4U3YA 1O9UA 3MYGA 1SVGA 3K5VA 5J1WA 1FGKA 3RAHA 4DINA 3QZGA 3F5PA 3EYHA 4NTSA 4PL4A 4LGGA 1RE8A 4V04A 4X21A 3D5VA 3LFQA 4FZ7A 4YR8A 5AV4A 2XJ1A 1FINA 3MFUA 4NU1A 4EUTA 2QKRA 2NRUA 3KMWA 5E8YA 5DN3A 3BZ3A 2WOUA 5HVJA 3FLNC 5HTCA 3PLAE 4ANOA 1AQ1A 5HNIX 3DTWA 4TL0A 4O1OA 3AGMA 5EDPA 3TL8A 3M42A 5TOZA 4EOPA 2RIOA 4UWCA 5ANKA 2A27A 2HXQA 2OW3A 4BGHA 2SRCA 2QI8A 3BGZA 3E3BX 3NEWA 4IFGA 1DI8A 4L3JA 4PDPA 4C58A 3LM0A 4EYJA 3H30A 1PY5A 1QMZA 3TUBA 2O3PA 4Y5QA 1A9UA 4UZHA 2YDKA 2VO3A 2WEVA 4A7CA 4JBPA 5FQDC 1JKSA 2QOOA 4CFXA 2QQ7A 4UBAA 3UO4A 4UZDA 3D94A 4OT5A 5EHLA 2BVAA 3MVJA 5IMXA 2H96A 3DAEA 4C4EA 3KXZA 2UZDA 2F2UA 4F08A 4YJOA 4GU6A 1F5QA 3BYVA 2PZYA 2YIRA 4FKJA 3A60A 5KUPA 1HCLA 2IZSA 2RL5A 2R3HA 2RF9A 2XF0A 3PRIA 1V0BA 2WTVA 4C57A 2PHKA 4UMPA 1UU8A 5JMSA 1ZWSA 5J87A 3AC8A 4BY9E 4AE6A 4CMTA 2WTJA 4KUJA 4QNAA 3NWWA 4LG4A 4APCA 1M52A 2UW6A 2UW7A 4LOOA 2QG5A 2OIQA 3DK6A 3JXWA 3W2CA 2QOQA 3W33A 3UNKA 3ATSA 2OGVA 3VIDA 3HRFA 3NR9A 4ZSAA 4EWQA 3C4XA 4I23A 4ASEA 4NZWB 4MK0A 5DFPA 1YI3A 4FV8A 1E9HA 5CNOA 2EB2A 4JX7A 4U8ZA 4FV2A 2G2FA 4FV6A 5JK3A 3I0QA 2VO6A 4RIWA 4QTDA 5AA8A 5KZ0A 5KKRB 2WNTA 1H8FA 4EBVA 2VX3A 2WAJA 4PMMA 3UTOA 3QQUA 4GU9A 1R39A 4ITJA 4LRKA 5HE2A 2CJMA 4UV0A 4D0WA 3W1FA 4YHTA 4O27B 3W16A 2QD9A 4FV3A 5HTIA 1BMKA 3H0ZA 4FKGA 2R3GA 4IC7A 3FDNA 3QHWA 4IWOA 3ZH8A 3EQRA 3QU0A 4YTFA 5IQIA 1Y91A 3VBQA 3PY3A 5D11A 4Y83A 2HWOA 4YJNA 5H8GA 5DOSA 4AZVA 2YN8A 1E1VA 4KIQA 3VW8A 2I6LA 3T9TA 2ZMCA 4NKSA 3PLSA 4ZIMA 2QR7A 2R3MA 4BBFA 1ZZLA 4HZRA 4I92A 3Q53A 4KAOA 5E8TA 4D2RA 2W99B 4K1BA 4L42A 4HNIA 3QX2A 5L6OA 2CNVA 4UY9A 3MESA 3FLSA 3GU4A 3Q2MA 4CT1A 3E7VA 3NLBA 3DK3A 4QP1A 4AN3A 4YNOA 3R7UA 4RWKA 3ZDIA 5TT7A 1OIUA 1J1CA 4GIHA 4FNZA 3QWKA 4G5JA 1E1XA 4JQ8A 3GGFA 2IZRA 4M15A 3PSCA 4IAAA 4OTIA 4BDJA 2GQRA 3TEIA 3HDNA 4DGGA 3ZSIA 2C6OA 3R71A 3WE8A 4D1SA 3R1NA 3W55A 3LPBA 5M55A 3FQSA 2LAVA 3SX9A 2X2KA 4FV4A 2G01A 2O2UA 2YM7A 4XJ0A 2CNQA 4ZLOA 4O7LA 3WE4A 4RG0A 5JGAA 3EN7A 5LOHA 1VYZA 3QUEA 1Q3DA 4FSQA 2XKFA 3CLYA 4RLLA 3R9NA 3R8ZA 3SXRA 1MQ4A 1PW2A 2OFUA 4BTKA 3Q5ZA 3IOKA 3DFAA 2E9OA 4IAKA 2BIKB 2OZOA 1JSVA 2ETMA 2BTRA 2ZAZA 3LCDA 4W9XA 2X9FA 5HIDA 4I21A 4G3CA 4L7FA 3VAPA 3DB8A 3FHRA 4RC2A 3ZS5A 5CVGA 4DG3E 4OBQA 2GS7A 5CAVA 4HOKA 2R3QA 4ZZNA 2GTNA 2I7QA 3BU5A 2C6LA 3AC1A 3OF0A 4FSTA 2JC6A 2ITTA 1UWJA 2PVNA 3AC5A 3FL4A 4FVRA 4IH8A 4M0YA 4OBPA 3TJDA 3V5WA 4D9TA 5HVKA 1WBNA 3ANRA 3NIZA 3TV6A 3IONA 4ZAUA 4WHZA 3PIYA 4TTHB 3RK9A 3UQGA 4N4SA 1Q41A 1PXIA 5B7VA 2XA4A 4BI0A 2W1IA 3CGFA 5DE2A 3BHHA 3RI1A 5B2MA 3BIZA 2C6MA 3UZTA 3RZBA 2OU7A 1B38A 4BZOA 3PSBA 4OTGA 3GEQA 1XH8A 3CPBA 4NM7A 2ESMA 3WYXA 2JBPA 5CANA 3QWJA 3KMUA 2ITZA 1ZMVA 2CGXA 5AR4A 3F7ZA 4ZLZA 3FKNA 2HIWA 2VWYA 2CLXA 2C69A 4YO6A 3VVHA 4FK6A 5JFVA 2E2BA 2C5VA 4I24A 3GFWA 2VU3A 3ORPA 4DT8A 5M08A 5LCJA 1BI7A 1SNXA 4IXPA 2YERA 1OI9A 3BQCA 3E8DA 5K0KA 5KO1A 3FYJX 3KMMA 5AP0A 4FEWA 3COKA 2R3FA 4WIHA 5J95A 3E8NA 5BUIA 4IACA 5E8ZA 1U4DA 3QRKA 5IDNA 4CFWA 1R78A 1GIHA 4FEUA 4APPA 2QHMA 4LOPA 3KRLA 4RVLA 5AUTA 5M4UA 4F1MA 1JSTA 5EI6A 1CKJA 5LARA 2WMBA 3DKFA 2VGPA 3FLWA 5HEZA 4PMTA 2LGCA 4AGUA 4D55A 5I9UA 4IVDA 2J6MA 2ZM3A 3QXPA 4FMQA 5IA3A 4D4RA 2W1EA 3QQLA 4X0MA 3KRXA 3O0GA 3P0MA 2XK3A 3QXOA 4TYHA 1MRVA 1YOLA 3QQKA 2JDRA 3CTJA 4XOYA 2W9ZB 3V3VA 2R0IA 4ZXTA 4PPAA 4FIJA 1OBGA 3H10A 4DC2A 4IB0A 4QPMA 5AR2A 4FSYA 1QPDA 3RHKA 2VUWA 3UZRA 1R1WA 5C8MA 4E6AA 4I94A 4FSRA 5C01A 4Z9LA 4CG9A 4IX3A 5DG5A 3H4JA 5DBXA 2ITOA 2ITXA 4FT5A 5IKWA 5ETCA 3R7VA 2RFNA 4BBEA 3FMNA 5HCZA 2R3OA 4UMQA 5BPYA 4TN6A 1PXOA 5KHXA 3UIMA 5C26A 3WF9A 2E9UA 2UVXA 4CFMA 4Z16A 3R9RA 2Y4PA 2QONA 5GINE 4X7QA 3DQXA 2I40A 4IVCA 3V8TA 3G15A 3ZFXA 2BZJA 2WHBA 4ENYA 4NJ3A 5JZJA 4ASZA 5JEBA 2C6DA 4JBVA 3LLAA 3AT4A 4S32A 5CF6A 4C4HA 4CZTA 4P90A 2VO7A 3L8SA 5FXQA 3SW4A 2V22A 3DS6A 3V8SA 4ZLYA 4TYGA 1OVEA 3OUKA 3FZ1A 1M14A 3TNHA 3VS7A 4DEGA 4F6UA 2CN5A 2FGIA 2FSLX 3F82A 3R1QA 4KWPA 2EB3A 2VGOA 4M12A 3Q4ZA 1MRYA 2UW3A 3EFKA 3P23A 4EQUA 3CP9A 4FT0A 4DEIA 2ZB1A 3OROA 2R4BA 2XZSA 4O0YA 4W4WA 4IWDA 1ZYLA 4EORA 3EQBA 3QD0A 4HYHA 1BL7A 3V6RA 4ANSA 4L01A 5CLPA 4W4YA 4H1MA 2GCDA 4WUNA 1TQMA 4WG4A 3PVWA 5AADA 1YHVA 3PWYA 4XOZA 1ZAOA 2WIHA 2ITVA 3KY2A 3ORZA 1YWRA 2WO6A 4KSQA 1P4OA 3Q52A 3LCTA 4BDIA 2RGPA 3C0HA 4KIOA 2OICA 4CQEA 4CQGA 5EHOA 5M51A 4E8AA 4FZFB 4QP2A 2BFYA 3MH3A 4FT3A 4R3CA 1XO2B 4O7VA 1JSUA 1KOAA 4W9WA 4X6QC 4CMUA 2GHGA 5HNGA 3O71A 3LVPA 5CSXA 3OY3A 3BE9A 1LUFA 5EH0A 3D4QA 3R00A 3WBLA 1OL6A 3ZRKA 3HP2A 4USDA 3POZA 4O38A 4BHZA 1YXVA 3I4BA 3M11A 4NM5A 3GC7A 3RHXA 4WG3A 3A99A 3TDVA 5AUVA 3V6SA 1SVHA 5JFWA 4YSMA 3G9LX 5E4HA 2V7AA 2B4SB 2C6IA 4B4LA 2WEIA 3G0EA 5CZIA 4PNKA 3ZCLA 3LLTA 4Q9SA 5C4KA 3FY2A 3EL7A 3PP0A 4R7IA 3ZEPA 4GFOA 4NEUA 5JRSA 3DLSA 5L6WL 1GJOA 1SMHA 3BWFA 5LWMA 4TYJA 2J51A 4U44A 3WI6A 3HAMA 4I20A 4F0FA 3ULIA 2BILB 4L43A 2PUIA 4FV9A 3WARA 4MH7A 4AZTA 3LIJA 4ZMEA 4JDKA 4O0WA 4E4MA 3MVHA 1XHAA 3POOA 4EQMA 5DMZA 4ZP5A 4PL5A 1KUTA 2IVTA 2PE1A 3LXKA 4CT2A 4RFZA 1W8CA 4QMOA 3AT2A 5KHWA 4O82A 1CKIA 4RA5A 2JDOA 4PMSA 3KVWA 3Q6UA 4PX6A 5HOAA 1OPKA 5JZNA 4X2FA 4BDFA 1WFCA 3LCSA 2J0MB 3L9PA 4K0YA 1Q8ZA 3ZSGA 4EEVA 5EYDA 3GU7A 3TZMA 4ARKA 3D7TB 1KSWA 3HECA 5EQPA 3NAXA 4QP9A 4YZNA 2WTIA 3VUHA 2CPKE 4RJ8A 5T3QA 2PVHA 4JXFA 2BTSA 3UMXA 2C1AA 3EQHA 5HG7A 4U40A 2W5BA 4FKVA 5CTPA 3IW6A 5HLPA 3JY9A 4QMNA 2H34A 3GBZA 3KXXA 4YJVA 5DWRA 3O96A 1PF8A 4E6CA 4FNYA 2DQ7X 1Q24A 1A48A 3ZFYA 5IG1A 4CG8A 3ITZA 5CSWA 1GZOA 5AV3A 4C33A 5FXRA 3TACA 2HENA 3I5ZA 3IDBA 3MFSA 4XP3A 3RVGA 2JITA 3L1SA 3MH2A 4TZRA 3R1SA 2ITNA 2XJ2A 1O6YA 4TWCA 2W1ZA 3O7LB 3VS2A 3WZDA 3LQ5A 4BTFA 5CF4A 3QTIA 4O7SA 4RIXB 4YBKA 3MDYA 4G3EA 5B0XA 4C3RA 4CYIA 5FLFA 2FUMA 4PRJA 4A9UA 5EG3A 4CNHA 4RC3A 1W98A 3U6HA 1QPCA 1U46A 4ORKA 2ZYBA 3V51A 3KU2A 2F49A 4QYHA 3VS1A 2NO3A 3F3VA 5FEDA 5A9UA 4QPSA 3W2QA 5EQYA 3AGLA 2GHLA 4DEBA 3QUPA 2WMWA 4O0TA 3GOPA 3GC0A 3QKLA 4PQNA 4GJ2A 4HGLA 2YWVA 2QLQA 2GSFA 4GL9A 1TQPA 2WMUA 3NNVA 5CT7A 4A4OA 5BX0A 4DT9A 2GS2A 3MTFA 3W2OA 2WQEA 4PDOA 2UW5A 3FLYA 1W0XC 3BHTA 4G34A 3UVPA 2YIYA 3L9LA 5C8KA 2IZUA 3MBLA 4QTAA 1JOWB 3DT1A 4BHNA 4YJTA 3O2MA 3D9VA 2B55A 3LCKA 4BCHA 3UQFA 3SXSA 1YHSA 4XUFA 3VS5A 3ZRLA 4FZAB 1OZ1A 5LQFA 5CT0A 1PKGA 5AWMA 4YNEA 3L8PA 4EZ5A 4R3PA 4FYOA 2JAMA 4IHPA 1NT2A 3GP0A 2I0HA 3HV5A 4H3BA 1H1WA 4R7HA 3SXFA 5M06A 4FZ6A 3VUIA 3R04A 4N0SA 5I4NA 3FZOA 1G8SA 5CYIA 4CZYB 4QQCA 4FTTA 5KNJA 4NW6A 3FMHA 1OUYA 3WF6A 2E9VA 1Y57A 3R8VA 4FV7A 3VS0A 5IF1A 3H0YA 4N57A 4YC3A 3HAVA 3A7IA 5AMNA 4BDCA 4F09A 4NT4A 2WFYA 1NXKA 1ZRZA 4HYIA 2JBOA 3I6UA 5M44A 3O8UA 3I7CA 3CBLA 4UXLA 2VTAA 3IW5A 1MUOA 4L46A 4E4XA 4BDBA 4EL9A 3DXPA 2QO9A 2OZAB 4AT5A 2GDOA 3MB7A 1LPUA 1KE6A 5HBEA 2A2AA 4U0IA 3O23A 4NIFB 2WTWA 3U51A 4YZBA 3UDBA 3RKBA 5EFQA 3OXIA 4FF8A 1KE5A 2J7TA 1X8BA 2FB8A 2ERZE 3C4FA 2OH4A 3C13A 3F61A 1IR3A 4E20A 3O50A 3Q04A 3MN3A 3PA3A 2VTOA 3PP1A 2BRNA 4DH5A 2VNYA 4EOQA 1FVVA 3FSFA 3E8CA 4Q5HA 3EKKA 2BRGA 3E63A 3GU6A 1U54B 1APME 2PSQA 3KXMA 3TCPA 2UW9A 1XBBA 1WBWA 3VJOA 4RT7A 4BRXA 4DG0E 2QOKA 1H25A 2XB7A 4PMPA 2BRHA 4JT3A 4QRCA 3EN4A 4CXAA 5ACBC 4DFLA 3PE1A 3WF8A 4FTLA 4C36A 3DCVA 3UBDA 5ANEA 1W7HA 4AN2A 3W2SA 4BN1A 4D58A 3BHVA 4MCVA 5BYZA 2UZEA 4FKIA 2JDVA 4LUDA 2IVSA 5HG5A 4DLIA 4IBMA 2W17A 4MBJA 3KQ7A 4C62A 2R3LA 3VS3A 5A54A 2C1BA 1ZARA 4ZTRA 3NSZA 4BDEA 1VYWA 4FKSA 4BBMA 1FVRA 2CMWA 2PMIA 2Y8OA 4FKOA 3P7AA 5CU6A 2B9HA 3F3UA 4FG8A 4LM5A 3D7TA 4WNPA 2W9FB 4HNFA 3CJGA 3O8PA 4JQ7A 4LUEA 3TNWA 4DLJA 4N70A 4HVSA 2YITA 3B2TA 4O22A 5H2UA 5CXZA 3DU8A 2R3NA 2PVJA 3IGGA 3UODA 3BGQA 3DQWA 1Q62A 4NUSA 2CKPA 5FG8A 4ASXA 3ZLWA 1H1SA 3T3UA 2GQGA 3GCUA 2WMRA 3MA3A 2G2HA 5GZ9A 3UC3A 5AUUA 2HYYA 4M7IA 4G6LA 5D7VA 4MX9A 2FO0A 3C7QA 4QMPA 3BU6A 3FKLA 5HE0A 4F99A 3F6XA 3ODZX 4M0ZA 3HMOA 3KF4A 4QP6A 4DFZE 2HWPA 3V8WA 2QNJA 4QD6A 2VTMA 4U79A 2YLEA 1YXSA 4MXCA 4RIXA 4CKJA 3QZIA 2YZAA 4QT1A 3RJCA 4EZ7A 4L45A 3OBJA 3TZ7A 3KA0A 2QODA 4MAOA 4FIEA 5AM6A 2B9JA 3PA5A 3EZRA 2EXEA 1SM2A 4ZSEA 2QR8A 2OFVA 5AUZA 5BMSA 5EM5A 4XV1A 1YOJA 4H05A 4IB5A 4IM2A 5K5XA 1OMWA 4GVJA 5L8JA 3T8OA 4ACDA 4Y95A 1GZ8A 5D10A 3PG3A 3D15A 2QLUA 2UUEA 3E93A 4KIPA 4W4XA 4GFGA 2RG5A 2DWBA 4KKGA 4K9YA 2IVUA 3FBVA 3UE4A 4LRMA 2JIIA 1WCCA 2H9VA 3ORMA 5LVMA 4JDIA 3QTRA 5DI1A 4IM3A 4O2ZA 3VS6A 4LYNA 3NUXA 3ORNA 4U41A 4EH8A 5AP7A 1IG1A 2XIYA 3HRBA 4C3PA 4GK3A 4BCFA 2QCSA 4MWIA 1I44A 1GIIA 4UMTA 3KKVA 2O5KA 2Y4IB 3Q60A 3CPCA 4QP8A 3C1XA 4FEXA 4ANMA 3S2PA 4JS8A 3RPSA 3F2RA 4XNEA 2A4LA 3FQEA 4O91A 1ZYJA 3I6WA 3D5UA 4U97A 4XLVA 5EDRA 4S31A 4XG6A 5CEQA 5I9WA 4L3LA 5GNKA 5D9HA 1REJA 4WA9A 4XX9A 4ZZMA 4O0RA 1CSNA 4YZMA 4S33A 4DH1A 1AGWA 3NIEA 2E9PA 3HMIA 2PZ5A 4RRVA 1XH9A 4GYIA 2QC6A 4C3FA 4A9YA 3AC4A 2BHHA 4BKYA 5K9IA 2YWPA 3KGAA 4MXYA 5FDPA 1DM2A 2OZAA 2R9SA 4Q2AA 4TYEA 5AP4A 4DH7A 3LFFA 4ERKA 1OITA 5JT2A 3ENHA 4NIFA 4DFXE 3KK8A 3OG7A 4BCMA 2BZIB 1PXKA 3KULB 2A19B 5G1XA 5J8IA 4IJ9A 4QQ5A 4EOMA 1AD5A 3NW6A 1WBOA 1OGUA 4UYNA 3KCFA 5JQ5A 2PTKA 3S4QA 4UMRA 3BKBA 3QHRA 2WQNA 3QBNA 3AXWA 2OH0E 3HEGA 2FSTX 2G2IA 5IA2A 4DFBA 1MP8A 5HE3A 5DVRA 3PA4A 3GUBA 1U54A 4L9IA 3UYSA 3MSSA 4C4IA 4G3DA 5DPVA 2XK6A 5J9YA 3TG1A 4EHGA 5L6PA 2YIWA 5CEOA 1YRPA 3C4CA 1PXNA 2GS6A 2UZTA 2ACXA 1B6CB 3D0EA 1ZOEA 3LFSA 3MJ1A 3NUSA 4M67A 3QAME 4YGAA 4EOKA 4HW7A 2RFDA 3F9NA 4NTTA 3EQCA 3WF7A 3AOXA 5IA4A 3TV7A 2XNGA 3DFCB 2JKOA 2XBJA 4IQ6A 1S9IA 5E92A 2XNOA 4O86A 1HOWA 4AFJA 4RJ7A 3FMLA 3E5AA 3ZXZA 1PYXA 2OI4X 3K3JA 4BZNA 4GW8A 5D41A 3EQPA 3M1SA 5KMNA 5KCVA 2HCKA 4AACA 3SLSA 5J5TA 4AOIA 2B53A 3PWDA 4GFMA 2HZNA 3TN8A 4D2TA 3ZC5A 3FMJA 5CF5A 4DCEA 4UEUA 4QYEA 4CSVA 2QOCA 3II5A 2W5AA 4FNXA 4D9UA 4TYHB 3GI3A 4CZUA 4ZY5A 2XIXA 3A8WA 4NH1A 3DJ7A 2ZB0A 4AAAA 1XH5A 2OXXA 3EFJA 1TQIA 2OJJA 4D5KA 3G51A 2JEDA 3A4OX 1LP4A 2ETKA 5A6OA 2ZMDA 5E1SA 3MFTA 2WTDA 1OKYA 3K2LA 5AR5A 5DR9A 2VX0A 3LFDA 5DRDA 4AE9A 4M84A 5TF9A 1I09A 4X3FB 4YLKA 2C4GA 3MVMA 3QX4A 3F2AA 3OWKA 1UVRA 4YJRA 5KMKA 5IQEA 5BQ0A 3ZUVA 5M4IA 3QRJA 5IQBA 2CGUA 1JKTA 2JKQA 5HORA 2OJGA 4WG5A 2ZV2A 1F0QA 3U6IA 4II5A 4V05A 4ZJVA 3ID6C 1ERKA 4RJ3A 3N4TA 2GNGA 2ITPA 4JRNA 3R30A 4KD1A 4IZAA 1BUHA 3TZ8A 2B52A 3COHA 3Q4CA 3R7IA 4K77A 4B9DA 4EOOA 5A4EA 4EH4A 4WBOA 2PMLX 2O64A 3RCDA 3LMIA 5ACKA 3UO6A 3FLZA 3PXZA 3BHYA 4QYYA 4DH3A 2YLFA 4G31A 5B2KA 4QQJA 4IB3A 4OT6A 4YTIA 4RJ4A 3LM5A 3ZLXA 5LMKC 3R9DA 1JKLA 3B2WA 2XCKA 4KBAA 2C47A 3UIUA 3DKCA 4NM3A 4PTGA 4YC8A 5FBNC 5EYCA 2O63A 2ERKA 4KSPA 1JQHA 1HCKA 4FT7A 4YHFA 3ROYA 4ALUA 1UKIA 4F7NA 3QTUA 5JN2A 3D5XA 3F5UA 3WZJA 5CAQA 2YM5A 1LEZA 2AC3A 2W1HA 4NCTA 4AGWA 2VWZA 3ZU7A 3CKWA 5HBHA 5CAPA 2VNWA 2XNNA 2B9FA 5BNJA 5IQAA 1OPJA 2JFMA 3VO3A 3EOCA 1UNLA 2Y0AA 3QRUA 1PMUA 4FTJA 2W7XA 3GU8A 5F95A 5EKNA 5H3QA 2XIKA 2YHVA 3R0TA 4I6FA 3UJGA 3I1AA 4G9RA 5AIKA 5FDXA 3CY2A 5A6NA 1JWHA 3VUGA 2GMXA 5EQEA 3HLLA 3C5IA 2YAAA 3S95A 5IDPA 3KL8A 4E1ZA 3UPXA 4J53A 1OUKA 2C30A 3OXTA 4I0TA 1Z5MA 3P78A 4PP7A 2VD5A 3N4UA 2ZM1A 2O8YA 3PVGA 3D14A 3HZTA 4DGNA 3MY5A 1ZYSA 4IZYA 3IKAA 3ALOA 3CQWA 3E62A 4BCNA 3IDCA 2E9NA 1DI9A 2YFXA 1WBSA 4M69B 2CN8A 4FKLA 2A1AB 3GFEA 3QCQA 1OIRA 2R64A 2F4JA 4GT5A 5CX9A 4G17A 2XCHA 4J96A 4NYEA 4O21A 3N51A 3MIAA 2YM4A 2HXLA 3GU5A 1H4LA 3L8VA 3LZBA 4FKQA 5AUYA 3LXLA 2GNFA 4AGCA 3KULA 3VBXA 3BBTB 3E7OA 1PXLA 4DG2E 2HAKA 3TIZA 4ZTQA 4IJPA 1O6LA 3NNWA 3BEGA 3RGFA 4BDAA 2YABA 3FYKX 3SV0A 4BWXA 4DFNA 2PUUA 2XRWA 2OKRA 3NS9A 3O51A 4FKPA 2W1DA 3BCEA 1JNKA 1MQBA 1A06A 2ZDTA 2W1GA 4MKCA 3T9IA 3MA6A 3QCSA 4DEAA 4W8EA 2BAQA 3A7GA 5IUHA 2VWBA 5C27A 4CV9A 2XM8A 3DPKA 5I9VA 5IEVA 4Q5EA 5CALA 1DAWA 3PZHA 2C5NA 4HVDA 3AG9A 4BI1A 1U5QA 1H00A 2XIRA 1JVPP 2J0JA 4JNWA 3BWJA 2PUNA 3QRTA 1H08A 2ONLA 2XKEA 3A4PA 3CJFA 4JLCA 4NSTA 3D2IA 3BGPA 4XG3A 4I5CA 3WOWA 4C7TA 4IM0A 4AF3A 1J7LA 4JOAA 3VUKA 3DZOA 4D2PA 1OL1A 2YCRA 4JVGA 3DJ5A 4PUZA 3AMYA 2XK8A 3BLHA 4O7TA 1KV2A 2QVSE 4DGLC 4G6OA 3ZEWA 4LGHA 3ZOSA 3FEGA 5L8LA 3U6JA 3R63A 5DHJA 3ZMMA 3ATTA 3PVUA 4ENXA 4OTRA 2O0UA 4QMVA 3HGKA 3RCJA 1JPAA 4C61A 5IA0A 5A4TA 2UW0A 1UU9A 4HGTA 4YZDA 3P08A 3UVQA 1PXPA 3WZEA 1H07A 4QMXA 3I79A 1O6KA 4L8MA 4X6RA 5AV1A 3AC2A 1Q5KA 4FSMA 5BYLA 3KC3A 4FTAA 5A46A 3S00A 2GNHA 5CWZA 3DDQA 4EK3A 4F70A 3FZPA 4JQEA 3SA0A 5EK7A 2ITWA 4F9YA 4CFVA 1R0EA 5E8VA 4F6SA 4FTQA 4C0TA 4X3FA 4Y46A 5CEIA 3BYUA 1YWNA 4I0RA 4O2PA 3P5KA 4DBNA 2FSMX 3BLRA 3KFAA 4ALVA 4N6ZA 4HVIA 4I41A 3RBWA 3UPZA 2VTRA 2W96B 4JX3A 5CZHA 4ZY4A 3COMA 4LGDA 3GOKA 4NKAA 4HCUA 4OTHA 4ACGA 3PXRA 4UALA 4IADA 2R5TA 4TNBA 4FIGA 4BC6A 4CCUA 2WOTA 5CNNA 4FKUA 4JG6A 4DEHA 4JR3A 4JIKA 1M2PA 3PG1A 1T46A 1LEWA 1JLUE 3A8XA 3QA8A 4IMYA 2VTIA 5AM7A 3U4UA 3W32A 4W8DA 4O0SA 1KWPA 1OPLA 4FL3A 3VF8A 4E5AX 4JBQA 5JKGA 2ITYA 4OTPA 1H26A 2PVMA 4A9SA 4HVHA 1YXTA 2X6EA 2QHNA 4NW5A 4RZVA 4TKSA 3LQ8A 2QOLA 1BYGA 3EN6A 3VN9A 2EXMA 2C6KA 4GEOA 3R7YA 4KB8A 3W10A 4AOJA 4U45A 1FQ1B 5HTBA 1ND4A 4FR4A 4QMWA 4GK4A 3VJNA 5CEMA 4USFA 1G8AA 4V01A 4FTOA 5HX6A 3FAAA 4OTWA 3FUPA 3HA6A 5BVWA 4YHJA 1GOLA 4OTDA 4PWNA 5D7AA 3RK7A 3H3CA 3AMAA 5KE0A 5BYYA 4PV0A 5EYMA 2OWBA 4E93A 3RZFA 3FPMA 1P2AA 3LHJA 5A3XA 4AZSA 4ANLA 2QKWB 4OTQA 4R8QA 5EW3A 3ZLYA 4UX9A 1ZYCA 3PVBA 2Z7LA 3TV4A 4EC8A 4QQTA 3ACKA 2R3KA 3AT3A 5KX8A 3VHEA 1CTPE 3CTQA 2FSOX 5C03A 3RP9A 3PFQA 4FYNA 3IS5A 3PZEA 4FUYA 5E9EA 5GJDA 1PKDA 3OHTA 4K11A 2BZKB 4WRSA 3UNZA 4BFMA 4H36A 4ITHA 4FODA 3RAWA 4A07A 3ZBFA 4AT4A 5JGDA 3LMHA 4GCJA 4GG5A 4NL0A 1ZYDA 4M69A 1K3AA 1OM1A 2IVVA 4EOSA 4WBBB 3K54A 2OJIA 4QP7A 4YBJA 4HCVA 2X2MA 2Z2WA 4XP2A 5AV2A 5IQCA 4ZTHA 1STCE 4L00A 2OBJA 5AR8A 3FPQA 3I7BA 4MYGA 2CLQA 3TTJA 3MPAA 4HVGA 2UZBA 5HI2A 5F1ZA 2CCHA 3NNXA 4IC8A 3QQHA 5CSVA 5A4QA 3P7CA 3IG7A 5CVHA 3G0FA 4K2RA 3DY7A 4I1ZA 3KREA 2PYWA 2XMYA 3NVKI 3V5JA 4IAYA 3ROCA 5HU9A 4KIKB 3PPKA 4WSQA 3FKOA 3Q3BA 3VQHA 2RG6A 3HL7A 3IECA 4FEQA 5HU3A 4EK6A 2ZOQA 2NRYA 3WYYA 4E5WA 1M17A 2GNJA 3F5XA 3MB6A 3F5GA 4CEGA 5M57A 3UQCA 4B99A 2JLDA 3KN6A 2QO7A 4R5SA 4X2JA 4AX8A 5KZIA 1IA9A 4BIBA 3A2CA 3FZSA 2G1TA 2C0TA 2XM9A 2F57A 2QOHA 2R0UA 3G5DA 5CU0A 3IPHA 2X6DA 3FMMA 3NUPA 2YEXA 3C51A 3ENMA 1VR2A 2C0IA 1Q8YA 3LFEA 4G16A 4C02A 3U55A 2JIUA 4L7SA 5BVNA 2IN6A 1RJBA 3PIZA 3IO7A 3CIKA 3SDJA 1V0PA 2Z7SA 3DBQA 3R2YA 4IDTA 4YSJA 2B0QA 3ZO2A 1Z57A 3OWPA 4UN0C 5M53A 2ZM4A 3CE3A 1IEPA 1Q4LA 4C35A 4PL3A 4DA5A 3LFNA 4U80A 1LR4A 2HY0A 3A62A 4ASDA 2C5XA 3DNEA 3BV2A 2IO6A 4FTUA 5E1EA 3GC9A 4UWBA 5AP2A 2BPMA 5DH3A 4PPBA 5HD7A 2DS1A 3EN9A 4FL1A 3PIXA 3RM7A 4AN9A 1OKVA 2FH9A 3SAYA 3KXHA 5I9YA 2J2IB 2X39A 2VX1A 5C9CA 4J1RA 5K4IA 3SC1A 4XP0A 2ZJWA 4FSZA 4Y85A 2HELA 1QCFA 4MVFA 4YPSA 3TNIA 2C6TA 4BIDA 1OECA 1SNUA 2X4ZA 1YXXA 3DJ6A 2CKQA 3LKMA 4KKEA 2NNWB 4E5BA 4DN5A 3PXYA 1NA7A 3RPYA 3A7FA 2XK9A 2PL0A 4EJNA 4YU2A 3P1AA 4GUEA 4P4CA 3MY0A 2JAVA 2UZLA 1URWA 3HNGA 1GNGA 4M68A 4EH6A 5BVFA 5IQFA 5FTOA 1XBCA 2OLCA 3ZM4A 4USEA 2CHLA 5M09A 3IGOA 4RJ6A 2BRMA 5CVFA 2H6DA 4J8MA 4B6LA 1GY3A 3FQHA 4BTMA 5L2SA 3ERKA 4C34A 1UU7A 4HPTE 3BBWA 3CQEA 5TKDA 4FKTA 2EU9A 4EWHA 4O84A 4F4PA 4F9AA 2WMAA 3LQ3A 4CLIA 3OVVA 3QKMA 2XNMA 4OLIA 4QOXA 5ETFA 4TNDA 2GFCA 4CV8A 3U54A 2W5HA 3E92A 5TR6A 3U87A 3KRJA 3FXXA 4FBXA 4WD5A 4CD0A 5LMBA 2JDSA 5HO6A 4CFUA 4M97A 3RAIA 1WBTA 5CXHA 2RSVA 4FEVA 4IZ7A 1PMNA 5DT3A 4ZK5A 4DGMA 5CEKA 4Y5HA 3BHUA 5ETAA 4D1ZA 4CRLA 3PXFA 4L6QA 4AZWA 2ZV9A 4O7ZA 2J5EA 1XBAA 5EOBA 2WQOA 1OKZA 1SVEA 2WMXA 2WTKC 4QMYA 2XNPA 4ZJIA 2PUPA 3OC1A 4FSNA 4ZS4A 1YOMA 1YVJA 4KA3A 4MQ1A 5A14A 3MVLA 3ZTXA 2I0VA 3EH9A 4ZTNA 4BGQA 1H0VA 4X2KA 4CRSA 4EHVA 5A4LA 4LI5A 4FK3A 3Q2JA 4IIRA 4XG7A 4FIFA 3ZO3A 3ORTA 4LMNA 4FVQA 4EOIA 3QD3A 1UA2A 3R8MA 5EM7A 2B54A 4C38A 2WB8A 3NAYA 1IRKA 2I1MA 3ZONA 3MPMA 5IEYA 1NVRA 3TM0A 3G9NA 2BZHB 2PWLA 3ZYAA 4F7SA 3TJCA 3F3ZA 4IDVA 3IW8A 3FJQE 5KMMA 3JUHA 4EH9A 1U59A 4EQCA 3FE3A 4CVAA 3QD4A 4RPVA 2HY81 3FZRA 1U5RA 2R7BA 2XEYA 4RVKA 5TO8A 3NMUF 2EUFB 5LWNA 1BI8A 3W8LA 2CGWA 3ORKA 4RVTA 4RX9A 2W4JA 2IG7A 4O7RA 1YWVA 5J9LA 3GT8A 2C3IB 2W1CA 2YA9A 3GCVA 3R9OA 3CC6A 2PPQA 4KIKA 2JKKA 5AA9A 1B39A 2IWIA 2C5OA 1TKIA 2AUHA 4XMOA 2A0CX 5LVPA 1KOBA 4LMUA 5E8XA 2YM3A 4DGOA 3EYGA 5L2TA 2X81A 3HV3A 4QTBA 1IAJA 1YXUA 3PUPA 2R3RA 5CU3A 5E8UA 4IAZA 4R1YA 3BEAA 3GCSA 1P4FA 4RWJA 4D2SA 3T3VA 5CEPA 3CEKA 2C3KA 2EXCX 3TNQB 4EOLA 4RIOA 4YLLA 5K4JA 4CCBA 5KMOA 3R7GA 2HK5A 2OO8X 5FM3A 4CYJA 5JSMA 2GTMA 4DF3A 3V5QA 1REKA 3C4EA 4A9RA 2PK9A 2YIQA 3MIYA 4RLKA 4F9WA 2C3LA 3FSKA 3R83A 1ZXEA 1GZNA 3TWJA 1W84A 3HVCA 5HICA 1L8TA 3IQ7A 5DLSA 3VBYA 3ELJA 3P4KA 4BDDA 4EHZA 4K8AA 3MI9A 3NUYA 1WMKA 1VEBA 4F7JA 3MGYA 4DTBA 3ZXTA 5LMAA 5CU2A 3QC4A 4E26A 2WZJA 5TE0A 1QPJA 3R7EA 3CXWA 5M07A 4KS7A 2C3JA 3OMVA 4MNEB 3E3PA 2VWVA 2P3GX 2QU6A 2IZTA 3EQDA 5ANJA 1XKKA 4GS6A 4HGSA 1TVOA 3I81A 4HJOA 4BGGA 3KN5A 4ZTSA 3NUAA 3QGYA 2GNLA 3F3TA 4KNBA 3EJ1A 3VBTA 1UKHA 2P2IA 3FL5A 1JAMA 2OSCA 3FV8A 5IQHA 1PXJA 5AR7A 3PJ8A 1UNHA 5I0BA 2C0OA 5BVKA 5KMJA 3GNIB 3PSDA 5KKRC 4UB7A 1BX6A 5IZFA 4XBUA 1SYKA 1CM8A 1FOTA 5EOLA 3FXWA 3KVXA 5CQWA 2UZUE 4C4GA 5HE1A 3QCYA 4K18A 5DR2A 3H9OA 5AUWA 4ERWA 2B1PA 4MD9E 2V55A 4J7BA 5LCKA 3WZUA 3DXQA 1OL7A 3QTSA 1FPUA 3EQGA 1Q8UA 4XV3A 4NFMA 5KMLA 1GZKA 4CTBA 4BDKA 4PY1A 4FC0A 3OZ6A 2GPHA 3R6XA 3QC9A 3CQUA 3KCKA 4AA4A 1ZOHA 3H9FA 3VF9A 4AS0A 4M3QA 3VC4A 4FV5A 3DNDA 3QQGA 1XH6A 3EN5A 4IWPA 4MXAA 3LOKA 3ZUTA 4FOCA 5C4LA 3KF7A 3NX8A 4O81A 3UG1A 2O65A 4P5ZA 3OEFX 2EWAA 1WAKA 4I5PA 2G9XA 4MF1A 4QNYA 2VO0A 4IZ5A 4TT7A 5DT4A 4AOTA 4S2ZA 4JIAA 5KMIA 3PYYA 1G5SA 4L53A 2OIDA 4RX7A 5B2LA 4IB1A 4NWMA 2PVFA 3NYVA 4DHFA 3H9RA 3MH0A 1V1KA 3ODYX 3CD8A 1YQJA 2PMNX 4YTCA 5LJJA 1MRUA 3F2NA 4I22A 4L68A 5HCYA 4BCPA 2UW8A 4EI4A 5HGIA 3GENA 4D0XA 4GMYA 3UZPA 1YHWA 2GFSA 5HIBA 1XQZA 1Q3WA 2BROA 2VV9A 3DXNA 2ZDUA 4CLJA 3MV5A 3R2BA 3UGCA 3VUDA 4GYGA 4ZEGA 4JRVA 2J0KA 4XG9A 3BYMA 5HNBA 3QQJA 4XV2A 4FGRA 4GRBA 1H0WA 4EH5A 4WUAA 3GCQA 5BUEA 4AA5A 4GIIA 5IH4A 3OWJA 5CENA 5L8KA 5CSPA 5L2IA 5LXMA 4EUUA 1XH4A 4U42A 3E64A 2J0LA 5IH6A 4DEEA 4C2WA 2ETRA 4WT6A 3RPOA 3ACJA 5HX8A 4NFNA 1ZMUA 5CAUA 4JL9A 4ZS0A 4AZFA 5M4CA 3KRRA 2V62A 1ZMWA 4HZSA 5ANOA 2YISA 3DK7A 4GVAA 4Z7GA 1NW1A 3KB7A 1M7NA 4J99A 3GCPA 3P86A 3QYZA 5IPJA 2QU5A 3I5NA 3ZO1A 2I0EA 2HZ4A 3VBWA 4DITA 2WQMA 1UV5A 3Q9XA 4V0GB 1XH7A 4EJ7A 2BFXA 4E6DA 3SHEA 4E73A 4L3PA 2X1NA 3EMGA 4EKLA 1OL2A 3BRBA 3G2FA 3IOPA 4XYFA 2X8DA 4P5QA
chains in the Genus database with same CATH superfamily
3BPRA 3HV4A 3OEZA 4MXXA 3S3IA 3IW7A 5GIPE 2P33A 3V5LA 3R02A 4G6NA 2F2CB 5H8EA 3JVSA 1J7UA 5HLNA 3FHIA 3OW3A 1V0OA 4GV1A 4ZSLA 1Q99A 5K5NA 2ZV8A 2JKMA 3QZHA 1OB3A 3KK9A 4W4VA 5GJFA 3R8PA 4M8TA 3ZO4A 4BB4A 3VW6A 2XANA 4LL0A 4XG4A 4FUXA 5D1JA 5GZAA 1KE8A 4I6BA 4DFUA 4BCKA 3TUDA 5L2WA 3TUCA 2QOBA 3FMDA 5E8WA 4JJRA 5GHVA 4DAWA 4RGJA 4MTAA 3QUDA 4YJQA 3Q9WA 4PTEA 2BKKA 4X3JA 4FIIA 1URCA 2HZIA 4TWPA 5ANGA 5JFSA 2Y9QA 2X7OA 4GKHA 5HLWA 4IEBA 4FKRA 3P7BA 4FX3A 4R6VA 3W0OA 3RTPA 5A4CA 4FTIA 4OW8A 1FBNA 4U5JA 3OOMA 4MXZA 1SZMA 4RX5A 1FMKA 3FC2A 3UOJA 2ITQA 4MNEA 3ZRMA 5EHYA 4FTRA 2AEGA 5HO7A 3Q4TA 3QGWA 4JMQA 4FTNA 2BCJA 5JFXA 2WKMA 3VBVA 2X8IA 3RK5A 3ZDUA 1ATPE 5FWKK 4LL5A 1F3MC 3O8TA 3VUTA 3PY0A 3QYWA 3NUNA 2YZLA 5I9ZA 3QTWA 2BRBA 2R7IA 4WO5A 3ZLSA 5CI6A 1BKXA 4IWQA 2VTPA 4PPCA 2BKZA 2X0GA 3I60A 3ORXA 5F20A 4XV9A 2JGZA 3AKKA 4HYSA 1WBPA 3OT3A 2XAOA 4AGDA 4ZSGA 4RJ5A 4WOVA 3ML1A 4PNIA 3PPJA 4IX4A 3F88A 3OTUA 3FY0A 3OUNB 4KINA 4LFIA 1RQQA 5HG8A 4BDHA 5F4NA 4MUQA 3BELA 3IK3A 2W1FA 1RW8A 4FA2A 4FGBA 2VWWA 4LQMA 4GK2A 5I9XA 4BL1A 3DKOA 5CI7A 2VWXA 1PJKA 3QD2B 3LJ0A 5FEEA 1OIQA 3DBDA 4O96A 3OXZA 3UIBA 3HV7A 1FGIA 5DNRA 3AC3A 3FMKA 2OXDA 3SQQA 3PXQA 4O7WA 4ZZOA 4EBWA 3E88A 4KS8A 4O1PA 3QCXA 3BV3A 1J91A 4A9TA 4Z7HA 4R7BA 5L2QA 3SOAA 5J7BA 4O7NA 4C59A 5BUJA 2YDIA 5HD4A 3QFVA 3VQUA 4QDEA 3SG8A 4KBKA 3R01A 4GT4A 4GG7A 4OUCA 5BVDA 2F7ZE 2H8HA 3UG2A 4ACMA 2R3JA 3EZVA 5EI2A 5CASA 4MWHA 4C37A 3DV3A 5JH6A 3BI6A 3U4WA 5DA3A 5AR3A 3BYSA 3OW4A 1R0PA 3KXNA 4BKJA 5J79A 3SVVA 2VTLA 3COIA 2DYLA 3BLQA 4RZWA 4JR7A 1JKKA 3GXLA 4L67A 3N4VA 4Q9ZA 2XK4A 5AEPA 4LOQA 4D4YA 4U9AA 4J52A 4WNMA 2RKUA 4N6YA 4M13A 3OCSA 2R3IA 4RBLA 1NY3A 4BCOA 4QMTA 4D5HA 3A7HA 4CKRA 5LVNA 4ZMFA 4FV1A 2W4OA 4BCQA 2UZVA 3OT8A 3QZFA 3E8EA 4XG8A 1XJDA 4AT3A 4FZDB 4AQCA 5HIEA 3TKHA 1FVTA 2AC5A 3IDPA 4J71A 3R8LA 4FTMA 3TTIA 3UYTA 2C68A 4BF2A 2BDWA 3NYXA 4QPAA 3ET7A 2C6EA 2EVAA 3C0GA 2BUJA 4ONAA 4S30A 2UVZA 5IUIA 3R28A 3G6GA 4NK9A 4OAUC 5CS6A 4EK5A 3VUMA 4F7LA 3O7LD 5FXSA 4G3GA 1XR1A 3EFLA 4G3FA 4MBIA 4WKQA 4QEBA 4TWNA 3OFMA 3KRWA 4V0GA 4D4SA 3ZC6A 1PYEA 2V5QA 1VJYA 4O6EA 2X4FA 4OBOA 3V01A 2OJFE 5IQGA 1YDRE 4DCAA 5FTGA 3DGKA 3SGCA 4O6LA 4XLIA 2V7OA 2OIBA 3GQLA 3C0IA 4O7YA 4BDGA 5IH5A 5M56A 4MQ2A 3REPA 2PU8A 5DEYA 3OCGA 3C4ZA 1Y8YA 4BR3A 3BX5A 1ZY5A 2YAKA 2UW4A 3EFWA 3Q96A 3R1YA 3FI8A 3UC4A 2OG8A 4F65A 3CD3A 1ZY4A 1G8KA 2X8EA 3RAKA 3HDMA 2P4IA 5C1QB 3EWHA 4FVPA 4XBRA 4GSBA 3OCBA 4JDHA 5HVYA 3HUBA 5JGBA 2W4KA 5EI8A 2WU6A 4XG2A 3RNYA 4AG8A 3QTZA 2PZRA 2PMOX 4BICA 3NYOA 5CF8A 4IFCA 4E4LA 3A61A 2ZVAA 3L9MA 3UVRA 4IE9A 3TNPC 3P9JA 4K6ZA 4LRJA 4FV0A 4IX5A 4WNKA 3FXZA 3W18A 3TKUA 1H28A 3AQVA 5IU2A 5AP1A 3ULZA 3ZZEA 2FA2A 3OP5A 4TY1A 2WU7A 3C5UA 1ST0A 1P14A 1GIJA 2DUVA 4OAVB 1UWHA 2PULA 3OCTA 1H1RA 4EH3A 4I93A 2VN9A 4YLJA 3R21A 4EK8A 5KBRA 2IJMA 3LFBA 1H27A 1K9AA 5BMMA 3ZBXA 4B0GA 5HZNA 4I3ZA 3ETAA 4KABA 4AA0A 2Z02A 2RFSA 3VULA 4TW9A 5FBOA 3M2WA 2BAKA 3OTVA 3QTQA 2XRUA 2JD5A 3CKXA 1DS5A 3PJ1A 3VRYA 2F7XE 4FI1A 3VWAA 4AP7A 4J95A 4HCTA 3FI2A 1OKWA 4AW5A 5CU4A 3OWLA 4B8MA 4E4NA 3FI3A 4ITIA 4R5YA 4XRLA 4XCUA 2VRXA 5D12A 4TPTA 5FRIA 2UV2A 4ZOGA 2GHMA 3VS4A 4C8BA 3R8UA 4ANQA 3RWPA 4D2WA 3UP2A 2WMQA 3OY1A 2Y6MA 3G90X 5IA1A 3TIYA 4L44A 2CGVA 3HV6A 4Y8DA 2FVDA 5AP5A 5E8SA 3CTHA 4G1WA 1Q97A 4JI9A 4BYJA 4BIEA 2CKOA 2BALA 4EYMA 3NVMB 2BMCA 1WBVA 3ZSHA 1W83A 4YJUA 4F6WA 5ITAA 1PRYA 2BAJA 2BIYA 4O0VA 2WD1A 3ALNA 4ZTLA 1YW2A 2WIPA 1NVQA 3G33A 3LFCA 3WZKA 3NYNA 3LCOA 4RFMA 4KBCA 4ZY6A 4EH2A 4FL2A 5FP6A 4F0GA 2CNUA 2XNBA 2YCSA 3DBCA 4QTCA 1Q8WA 5HO8A 2Z7RA 4FG7A 4GJ3A 4DBXA 5HHWA 4EKKA 3VONA 1H1QA 3JS2A 3NNUA 4ACCA 2Z60A 2JDTA 3D5WA 3AD5A 5F94A 5AAFA 4R78A 1G3NA 3E87A 3RMFA 4I4FA 2Y6OA 4MHAA 3U8WA 2NPQA 3V5PA 5FD2A 3RINA 3DBEA 3HA8A 4JG8A 5IA5A 4CGAA 3G6HA 3FLQA 4JG7A 3LW0A 2W06A 2XS0A 3NZ0A 5DT0A 4EH7A 3LJ1A 4H39A 1DAYA 4QMZA 3R22A 4G9CA 5FTQA 4F1TA 5BVOA 2BDFA 3UO5A 3ANQA 1WZYA 4A06A 2PY3A 5AX3A 3ZM9A 1Q8TA 3SRVB 3BU3A 3Q4UA 1QPEA 2KTYA 3WIKA 4TRLA 4RWIA 3TKIA 4RMZA 2XNEA 3ZZWA 3K3IA 1ZZ2A 5DRBA 2JIVA 3UP7A 3AKJA 4U7ZA 2WELA 3PJ3A 1Z9XA 4JAJA 3ZHPC 5HG9A 4QMLA 3LMGA 4M14A 3AD6A 4MBLA 2VTHA 2RFEA 5FP5A 4DTAA 3EKNA 4QYFA 3PJCA 4RC4A 3Q6WA 1PXMA 3F66A 2J4ZA 5GIOE 1YI4A 2R3PA 3JYAA 4O0UA 3W2PA 4UYAA 4IVAA 5L3AA 4YJPA 4UMUA 1YDTE 1PHKA 3FWQA 1L3RE 1ZLTA 4EC9A 3FC1X 2Q0BA 3MTLA 1YDSE 3NUUA 2W0JA 4D2VA 2WMSA 4QMQA 3CCNA 4AWIA 3QL8A 4AFEA 1EH4A 5GJGA 2VTJA 1H24A 2CCIA 4RQVA 2J0IA 2CSNA 3OOGA 1GAGA 5FM2A 3MY1A 1YKRA 3K5UA 4BYIA 2NP8A 4ZSJA 4KRDA 4MD8E 4O4DA 3KEXA 4NJDA 4XRJA 4WRGA 5H9BA 4TYIA 3SD0A 5GZ8A 5M4FA 2P2HA 5AIRA 4HYUA 4IAIA 5I3RA 2HZ0A 2OK1A 5AP3A 5IEXA 1PMVA 2UZNA 5AP6A 5I5ZA 1IAHA 2X7GA 3GQIA 3ORIA 3RPVA 4R77A 2XVDA 4FSUA 4AAYA 3BLAA 2P55A 3LE6A 3BE2A 3I0OA 4YO4A 2AYPA 3DAKA 1J1BA 4RFYA 4BTJA 4ACHA 4U43A 4FIHA 4GH2A 3KXGA 2YDJA 3NDMA 4JBOA 2WXVA 1UU3A 4MNFA 4PP9A 1M2RA 4U81A 4E6QA 3OD6X 3F3WA 4YZ9A 2F9GA 2X9EA 3UIXA 1KV1A 3TT0A 5CSHA 4AZEA 2WGJA 3JPVA 3R7OA 1OIYA 4TWOA 2I0YA 5EW8A 1H1PA 2VTQA 4FKWA 5AUXA 2G15A 4H58A 3TZ9A 5HKMA 3Q32A 1Q61A 3VRZA 3CR0A 5AJQA 5CY3A 1CMKE 2WMVA 3PXKA 4IW0A 3V04A 5DGZA 4TXCA 3W0RA 2VZ6A 3MJ2A 1R3CA 4K33A 4CFFA 4LV8A 4XS2A 4HGEA 3L8XA 2YJRA 4J98A 4A4LA 2IW8A 4RWLA 4AW2A 3NCGA 2IW6A 2YJSA 3D2KA 2XJ0A 1KE7A 3DB6A 3HMNA 3SG9A 1CKPA 5H8BA 2HW6A 3BQRA 3QKKA 2XEZA 5HESA 3O17A 3RPRA 3JR1A 3TDWA 1J7IA 2W05A 3MH1A 3Q5IA 5EKOA 4D1XA 1KE9A 3U9CA 3ZUUA 1M2QA 3S1HA 2YCFA 5EDQA 2P0CA 1PMEA 2WPAA 3HRCA 4RSSA 4G5PA 4F63A 5LMKA 2VWUA 5C8NA 3HYHA 4FTKA 3FMEA 3ORLA 3DAJA 3HKOA 2F7EE 3EHAA 4F1OA 3QALE 3L9NA 3GVUA 4PTCA 3VNTA 4PDSA 2GQSA 5E91A 3U9NA 5DEWA 5FGKA 3PPZA 3OBGA 4U3ZA 3RNIA 3SW7A 4I4EA 3MWUA 2PE0A 4JDJA 4ANBA 3FI4A 5K3YA 2B7AA 3DOGA 4X2NA 4YTHA 5AFVA 3DKGA 4DEDA 4RIYB 4I0SA 3HMMA 4CTCA 3JY0A 2VTNA 2XBAA 4FOBA 3NW5A 3S0OA 3DTCA 3DZQA 1BL6A 1G8JA 5L4QA 4BCJA 3LFAA 3QA0A 2VTSA 3OS3A 5LVLA 1JBPE 4F0IA 4Z55A 2QG7A 3QRIA 3UOKA 3UOLA 3SOCA 5IUGA 2XYNA 4NCTC 2GNIA 4R1VA 3TXOA 3B8QA 3EQIA 2Z7QA 4P7EA 1W82A 2YM8A 4OTFA 4BKZA 4H3PA 5DR6A 3DBFA 1RDQE 4BI2A 4QMUA 2B9IA 4DYMA 3PDTA 2Y4IC 5EM8A 5EM6A 4G2FA 2J5FA 3PTGA 3W0QA 2QO2A 1CDKA 5J9ZA 5JRQA 4KKHA 3SRVA 4I6HA 4IX6A 2PVYA 2OF4A 2Y7JA 2PZPA 4L52A 5E90A 4QDVA 2XKCA 2YCQA 5AAEA 3AD4A 4FE2A 2PVRA 3FZTA 2BR1A 3Q9ZA 4JAIA 3CS9A 3MW1A 3CY3A 2XUUA 1BLXA 3HX4A 4AUAA 5FUTA 4J8NA 2PVLA 2GU8A 4C4JA 4I5HA 4EHEA 1Y6BA 2CKEA 2Q0NA 2UZWE 2YM6A 4DFYA 4H3QA 3R9HA 3PE2A 2X7FA 3DLZA 3EL8A 1H01A 4ANNA 4BCGA 2XKDA 2UZOA 4RQKA 3NGAA 4BWPA 3QF9A 2ZV7A 4S34A 4EOJA 5J7HA 2VAGA 1XWSA 4PDYA 5ANDA 4FSWA 4QP3A 5HBJA 5J5SA 1IA8A 5KBQA 2WTCA 1T45A 1YI6A 3LXPA 3F7WA 2IPXA 5G6VA 5BVEA 2JFLA 1M7QA 1P5EA 1VZOA 3CGOA 4KRCA 2PZIA 4UXQA 4ALWA 4D4VA 4R3RA 4F64A 4AW1A 4BJJB 2QOFA 2YACA 4FNWA 2WQBA 4ZJJA 3V5TA 2VWIA 4IAFA 2PE2A 4M66A 4O0XA 3WF5A 4MD7E 3WILA 3C4WA 4QP4A 4FT9A 4OR5A 3NRMA 2J90A 3BL7A 4FRFA 4GKIA 1WVYA 2Z8CA 1Y6AA 2QOIA 2UVYA 4MF0A 4XEYA 5E7RA 4J97A 3A7JA 4UWYA 2VTTA 3QLGA 4EK4A 3ZFMA 5FEQA 4PF4A 4QYGA 1WVXA 4YJSA 4Y73A 2ONLC 3GC8A 3HMPA 2FYSA 2IEWA 3NPCA 3THBA 5IMEA 3DDPA 3C50A 2BDJA 4H1JA 3QTXA 3CSVA 5EW9A 1OL5A 4QO9A 5CQUA 3RM6A 4D28A 4YMJA 4BWKA 3C9WA 4C2VA 4IVBA 4FICA 2HOGA 3NW7A 4FTCA 1ZOGA 3EQFA 4IANA 4EZ3A 3B8RA 3LJ2A 5AX9A 4GT3A 5F9EA 2OF2A 2XP2A 2KULA 4AW0A 4YURA 4F9BA 5DYJA 2XK7A 3Q9YA 2V0DA 1OBDA 4LV7A 3W8QA 4DE4A 5T6KA 3EIDA 2XYUA 3D83A 3W2RA 2CDZA 1UNGA 4DTKA 1FMOE 4RIWB 4B8LA 3QLFA 4MEDA 4XH6A 1WVWA 2YIXA 4GUBA 4YC6A 5IQDA 4A4XA 5AV0A 3TI1A 3GB2A 3AKLA 5IISA 4OGRA 1NVSA 3IW4A 5JQ8A 3O5AA 4U6RA 4X2GA 4YP8A 2IW9A 5ICPA 3PY1A 2QURA 4X3FC 1S9JA 4AXAA 3HUCA 5T68A 4DH8A 1Y8GA 5LVOA 5ANIA 4LV5A 3QQFA 4QMSA 3F69A 4WSYA 4Y72A 5EYKA 5HCXA 4RA4A 3NCZA 4P2KA 2OXYA 4CMOA 4CFNA 2WMTA 5HQ0A 3N9XA 2REIA 3DA6A 4RX8A 4XHKB 4MXOA 5DIAA 4EONA 3RWQA 4AU8A 4QTEA 3RALA 2HW7A 4I5MA 4CKIA 4E3CA 4FG9A 2J9MA 2OJ9A 1K2PA 3MFRA 2PVKA 5I3OA 4WNOA 5K0XA 3LAUA 3PJ2A 4RIYA 3MPTA 3P79A 4RVMA 4F9CA 4BVUA 2BHEA 3HP5A 4YPDA 4HPUE 3PRFA 2WTKB 4ID7A 5J1VA 2XIZA 4O83A 3UMWA 5ETIA 3JVRA 4E7WA 3BYOA 4B7TA 3SKCA 3VHKA 4BCIA 3MS9A 4C4FA 1J3HA 3UNJA 1QL6A 4ZTMA 3WIGA 5AAGA 3UOHA 2J50A 3EB0A 4I6QA 1IASA 2C5YA 2Q83A 4BZDA 2XH5A 4YUQA 3D7ZA 3R73A 2X2LA 4Z3VA 4YZCA 5CAOA 4QMMA 2ITUA 2R2PA 3AMBA 4NM0A 3LXNA 4U3YA 1O9UA 3MYGA 1SVGA 3K5VA 5J1WA 1FGKA 3RAHA 4DINA 3QZGA 3F5PA 3EYHA 4NTSA 4PL4A 4LGGA 1RE8A 4V04A 4X21A 3D5VA 3LFQA 4FZ7A 4YR8A 5AV4A 2XJ1A 1FINA 3MFUA 4NU1A 4EUTA 2QKRA 2NRUA 3KMWA 5E8YA 5DN3A 3BZ3A 2WOUA 5HVJA 3FLNC 5HTCA 3PLAE 4ANOA 1AQ1A 5HNIX 3DTWA 4TL0A 4O1OA 3AGMA 5EDPA 3TL8A 3M42A 5TOZA 4EOPA 2RIOA 4UWCA 5ANKA 2A27A 2HXQA 2OW3A 4BGHA 2SRCA 2QI8A 3BGZA 3E3BX 3NEWA 4IFGA 1DI8A 4L3JA 4PDPA 4C58A 4AQKA 3LM0A 4EYJA 3H30A 1PY5A 1QMZA 3TUBA 2O3PA 4Y5QA 1A9UA 4UZHA 2YDKA 2VO3A 2WEVA 4A7CA 4JBPA 5FQDC 1JKSA 2QOOA 4BJJA 4CFXA 2QQ7A 4UBAA 3UO4A 4UZDA 3D94A 4OT5A 5EHLA 2BVAA 3MVJA 5IMXA 2H96A 3DAEA 4C4EA 3KXZA 2UZDA 2F2UA 4F08A 4YJOA 4GU6A 1F5QA 3BYVA 2PZYA 2YIRA 4FKJA 3A60A 5KUPA 1HCLA 2IZSA 2RL5A 2R3HA 2RF9A 2XF0A 2X0OA 3PRIA 1V0BA 2WTVA 4C57A 2PHKA 4UMPA 1UU8A 5JMSA 1ZWSA 5J87A 3AC8A 4BY9E 4AE6A 4CMTA 2WTJA 4KUJA 4QNAA 3NWWA 4LG4A 4APCA 1M52A 2UW6A 2UW7A 4LOOA 2QG5A 2OIQA 3DK6A 3JXWA 3W2CA 2QOQA 3W33A 3UNKA 3ATSA 2OGVA 3VIDA 3HRFA 3NR9A 4ZSAA 4EWQA 3C4XA 4I23A 4ASEA 1OGYA 4NZWB 4MK0A 5DFPA 1YI3A 4FV8A 1E9HA 5CNOA 2EB2A 4JX7A 4U8ZA 4FV2A 2G2FA 4FV6A 5JK3A 3I0QA 2VO6A 4RIWA 4QTDA 5AA8A 5KZ0A 5KKRB 2WNTA 1H8FA 4EBVA 2VX3A 2WAJA 4PMMA 3UTOA 3QQUA 4GU9A 1R39A 4ITJA 4LRKA 5HE2A 2CJMA 4UV0A 4D0WA 3W1FA 4YHTA 4O27B 3W16A 2QD9A 4FV3A 5HTIA 1BMKA 3H0ZA 4FKGA 2R3GA 4IC7A 2XAMA 3FDNA 1XMMA 3QHWA 4IWOA 3ZH8A 3EQRA 3QU0A 4YTFA 5IQIA 1Y91A 3VBQA 3PY3A 5D11A 4Y83A 2HWOA 4YJNA 5H8GA 2XARA 5DOSA 4AZVA 2YN8A 1E1VA 4KIQA 3VW8A 2I6LA 3T9TA 2ZMCA 4NKSA 3PLSA 4ZIMA 2QR7A 2R3MA 4BBFA 1ZZLA 4HZRA 4I92A 3Q53A 4KAOA 5E8TA 4D2RA 2W99B 4K1BA 4L42A 4HNIA 3QX2A 5L6OA 2CNVA 4UY9A 3MESA 3FLSA 3GU4A 3Q2MA 4CT1A 3E7VA 3NLBA 3DK3A 4QP1A 4AN3A 4YNOA 3R7UA 4RWKA 3ZDIA 5TT7A 1OIUA 1J1CA 4GIHA 4FNZA 3QWKA 4G5JA 1E1XA 4JQ8A 3GGFA 2IZRA 4M15A 3PSCA 4IAAA 4OTIA 4BDJA 2GQRA 3TEIA 3HDNA 4DGGA 3ZSIA 2C6OA 3R71A 3WE8A 4D1SA 3R1NA 3W55A 3LPBA 5M55A 3FQSA 2LAVA 3SX9A 5BV3A 2X2KA 4FV4A 2G01A 2O2UA 2YM7A 4XJ0A 2CNQA 4ZLOA 4O7LA 3WE4A 4RG0A 5JGAA 3EN7A 5LOHA 1VYZA 3QUEA 1Q3DA 4FSQA 2XKFA 3CLYA 4RLLA 3R9NA 3R8ZA 3SXRA 1MQ4A 1PW2A 2OFUA 4BTKA 3Q5ZA 3IOKA 3DFAA 3KIOC 2E9OA 4IAKA 2BIKB 2OZOA 1JSVA 2ETMA 2BTRA 2ZAZA 3LCDA 4W9XA 2X9FA 5HIDA 4I21A 4G3CA 4L7FA 3VAPA 3DB8A 3FHRA 4RC2A 3ZS5A 4AXDA 5CVGA 4DG3E 4OBQA 2GS7A 5CAVA 4HOKA 2R3QA 4ZZNA 2GTNA 2I7QA 3BU5A 3AC1A 2C6LA 3OF0A 4FSTA 2JC6A 2ITTA 1UWJA 2PVNA 3AC5A 3FL4A 4FVRA 4IH8A 4M0YA 4OBPA 3TJDA 3V5WA 4D9TA 5HVKA 1ST4A 1WBNA 3ANRA 3NIZA 3TV6A 3IONA 4ZAUA 4WHZA 3PIYA 4TTHB 3RK9A 3UQGA 4N4SA 1Q41A 1PXIA 5B7VA 2XA4A 4BI0A 2W1IA 3CGFA 5DE2A 4F78A 4FKPA 3BHHA 3RI1A 5B2MA 3BIZA 2C6MA 3UZTA 3RZBA 2OU7A 1B38A 4BZOA 3PSBA 4OTGA 3GEQA 1XH8A 3CPBA 4NM7A 2ESMA 3WYXA 2JBPA 5CANA 3QWJA 3KMUA 2ITZA 1ZMVA 2CGXA 5AR4A 3F7ZA 4ZLZA 3FKNA 2HIWA 2VWYA 2CLXA 2C69A 4YO6A 3VVHA 4FK6A 5JFVA 2E2BA 2C5VA 4I24A 3GFWA 2VU3A 3ORPA 4DT8A 5M08A 5LCJA 1BI7A 1SNXA 4IXPA 2YERA 1OI9A 3BQCA 3E8DA 5K0KA 5KO1A 3FYJX 3KMMA 5AP0A 4FEWA 3COKA 2R3FA 4WIHA 5J95A 3E8NA 5BUIA 4IACA 5E8ZA 1U4DA 3QRKA 5IDNA 4CFWA 1R78A 1GIHA 4FEUA 4APPA 2QHMA 4LOPA 3KRLA 4RVLA 4LDTA 5AUTA 5M4UA 4F1MA 1JSTA 5EI6A 1CKJA 5LARA 2WMBA 3DKFA 2VGPA 3FLWA 5HEZA 4PMTA 2LGCA 4AGUA 4D55A 5I9UA 4IVDA 2J6MA 2ZM3A 3QXPA 4FMQA 5IA3A 4D4RA 2W1EA 3QQLA 4X0MA 3KRXA 3O0GA 3P0MA 2XK3A 3QXOA 4TYHA 1MRVA 1YOLA 3QQKA 2JDRA 3CTJA 4XOYA 2W9ZB 3V3VA 2R0IA 4ZXTA 4PPAA 4FIJA 1OBGA 3H10A 4DC2A 4IB0A 4QPMA 5AR2A 4FSYA 1QPDA 3RHKA 2VUWA 3UZRA 1R1WA 5C8MA 4E6AA 4I94A 4FSRA 5C01A 4Z9LA 4CG9A 4IX3A 5DG5A 3H4JA 5DBXA 2ITOA 2ITXA 4FT5A 5IKWA 5ETCA 3R7VA 2RFNA 4BBEA 3FMNA 5HCZA 2R3OA 4UMQA 5BPYA 4TN6A 1PXOA 5KHXA 3UIMA 5C26A 3WF9A 2E9UA 2UVXA 4CFMA 4Z16A 3R9RA 2Y4PA 2QONA 5GINE 4X7QA 3DQXA 2I40A 4IVCA 3V8TA 3G15A 3ZFXA 2BZJA 2WHBA 4ENYA 4NJ3A 5JZJA 4ASZA 5JEBA 2C6DA 4JBVA 3LLAA 3AT4A 4S32A 5CF6A 4C4HA 4CZTA 4P90A 2VO7A 3L8SA 5FXQA 3SW4A 2V22A 3DS6A 3V8SA 4ZLYA 4TYGA 1OVEA 3OUKA 3FZ1A 1M14A 3TNHA 3VS7A 4DEGA 4F6UA 2CN5A 2FGIA 2FSLX 3F82A 3R1QA 4KWPA 2EB3A 2VGOA 4M12A 3Q4ZA 1MRYA 2UW3A 3EFKA 3P23A 4EQUA 3CP9A 4FT0A 4DEIA 2ZB1A 3OROA 2R4BA 2XZSA 4O0YA 4W4WA 4IWDA 1ZYLA 4EORA 3EQBA 3QD0A 4HYHA 1BL7A 3V6RA 4ANSA 4L01A 5CLPA 4W4YA 4H1MA 2GCDA 4WUNA 1TQMA 4WG4A 3PVWA 5AADA 4DHJA 1YHVA 3PWYA 4XOZA 1ZAOA 2WIHA 2ITVA 3KY2A 3ORZA 1YWRA 2WO6A 4KSQA 1P4OA 3Q52A 3LCTA 4BDIA 2RGPA 3C0HA 4KIOA 2OICA 4CQEA 4CQGA 5EHOA 5M51A 4E8AA 1VLRA 4FZFB 4QP2A 2BFYA 3MH3A 4FT3A 4DHIB 4R3CA 1XO2B 4O7VA 1JSUA 1KOAA 4W9WA 4X6QC 4CMUA 2GHGA 5HNGA 3O71A 3LVPA 3W0MA 5CSXA 3OY3A 3BE9A 1LUFA 5EH0A 3D4QA 3R00A 3WBLA 1OL6A 3ZRKA 3HP2A 4USDA 3POZA 4O38A 4BHZA 1YXVA 3I4BA 3M11A 4NM5A 3GC7A 3RHXA 4WG3A 3A99A 3TDVA 5AUVA 3V6SA 1SVHA 5JFWA 4YSMA 3G9LX 1TZDA 3UDZA 5E4HA 2V7AA 2B4SB 2C6IA 4B4LA 2WEIA 3G0EA 5CZIA 4PNKA 3ZCLA 3LLTA 4Q9SA 5C4KA 3FY2A 3EL7A 3PP0A 4R7IA 3ZEPA 4GFOA 4NEUA 5JRSA 3DLSA 5L6WL 1GJOA 1SMHA 3BWFA 5LWMA 4TYJA 2J51A 4U44A 3WI6A 3HAMA 4I20A 4F0FA 3ULIA 2BILB 4L43A 2PUIA 4FV9A 3WARA 4MH7A 4AZTA 3LIJA 4ZMEA 4JDKA 4O0WA 4E4MA 3MVHA 1XHAA 3POOA 4EQMA 5DMZA 4ZP5A 4PL5A 1KUTA 2IVTA 2PE1A 3LXKA 4CT2A 4RFZA 1W8CA 4QMOA 3AT2A 2NYAA 5KHWA 4O82A 1CKIA 4RA5A 2JDOA 4PMSA 3KVWA 3Q6UA 4PX6A 5HOAA 1OPKA 5JZNA 4X2FA 4BDFA 1WFCA 3LCSA 2J0MB 3L9PA 4K0YA 1Q8ZA 3ZSGA 4EEVA 5EYDA 3GU7A 3TZMA 4ARKA 3D7TB 1KSWA 3HECA 5EQPA 3NAXA 4QP9A 4YZNA 2WTIA 3VUHA