3KF4A

Structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
281
Chain Sequence
b'SPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl purine template.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 88
structure length 281
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kf4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kf4A01
3TN8A 2WFYA 4IAZA 2P0CA 2WMQA 1DAYA 3GOPA 3DQWA 2QO9A 3DK6A 2C6LA 3VUTA 1ZYLA 5L6WL 5KMKA 3OCBA 1M7QA 1OGUA 3QWKA 3FXZA 2C6IA 4CQEA 2YM5A 5AUYA 2OIDA 1DM2A 3AC5A 3Q04A 5J1WA 3MGYA 4FT7A 3I7CA 3RNYA 4DFBA 3EQPA 4MX9A 4V05A 3QHWA 4FKVA 1U5QA 2J2IB 3OWPA 2PPQA 4G9RA 3D5UA 3A8XA 3BQRA 3ORKA 3OUKA 4ZLOA 4O91A 2I40A 4G34A 1OVEA 4WUAA 2YA9A 5EG3A 2PTKA 4UMUA 4B8MA 1UA2A 1OM1A 2VGOA 4V04A 4YPDA 2X6EA 4C4GA 3N4TA 4YJUA 1U54B 3T9IA 4D4SA 1YI3A 3FZPA 2PZPA 2HYYA 3CLYA 3TNHA 2XNBA 1IA8A 4G1WA 4F70A 1GZ8A 4BN1A 4UMPA 3MTLA 3GP0A 4FZDB 5CAQA 4LRMA 4H05A 1NVRA 1WMKA 2X7FA 3PPKA 4M66A 5CS6A 3TACA 3U4WA 5C4LA 3GUBA 3FC2A 4V0GA 3GQLA 4R7IA 4ACCA 3GVUA 3LXNA 4NT4A 1RW8A 5IMXA 3FZOA 2IW8A 4GUBA 3IECA 3HMNA 4YU2A 3R83A 3CR0A 1PXNA 4WG5A 3W2RA 1FVTA 3OD6X 3LCTA 2VNYA 3Q5IA 4CYIA 3V5LA 1H00A 3CC6A 4CEGA 5HNBA 2Y7JA 4XP0A 5EM5A 4K0YA 1PXPA 2JBOA 2QKRA 2YIRA 4KBCA 1CSNA 3IW7A 3R00A 5B2KA 4NH1A 1ZY5A 4D2WA 2CN5A 3EN6A 5C26A 3HUBA 3UBDA 4EHGA 4KINA 2R3OA 3I60A 5IEXA 4RJ4A 5KBRA 2PVMA 2ERKA 2WOTA 3VWAA 4W4YA 3ZDIA 3Q6UA 3QUDA 4IVBA 4ASZA 1R78A 4WD5A 2QLQA 5AR5A 4U9AA 3MFUA 4MXYA 2I0VA 4NEUA 2OKRA 3TV4A 1IAHA 5J5SA 3PLAE 2VD5A 3KC3A 4HYUA 4AS0A 2XA4A 4RVLA 2BRNA 4BICA 3WZDA 1BMKA 4DE4A 1VJYA 3GXLA 1IR3A 4O81A 4EWQA 3O8PA 4BBMA 5ACKA 3QD3A 5AIRA 5AMNA 2F7ZE 3UP2A 5EDRA 4DFYA 3IDCA 4B8LA 1GAGA 2WQOA 3BV3A 4JIAA 3REPA 1WAKA 4QNYA 4FX3A 4FYNA 2H6DA 4BB4A 3O51A 4O7TA 2YZAA 5GZAA 3RHXA 5EI2A 3NUAA 4NM7A 2VGPA 3TNPC 3DY7A 4FV9A 1BL6A 5F4NA 4ZY4A 4G5PA 1FPUA 4A9YA 3BELA 4KS7A 2JDSA 2RL5A 1SVGA 2W1CA 3SKCA 4BFMA 4LGGA 4DG2E 2OH0E 2BAKA 3PYYA 3TIYA 2NRUA 2CHLA 1W83A 3Q6WA 1NVQA 4FIEA 2VX1A 4GK2A 4J8NA 4KIKA 3ZSIA 3OTUA 4L3LA 3SDJA 4MNFA 4FV1A 3QD2B 4F9AA 3RBWA 5HESA 4YUQA 4WOVA 4L6QA 4G3CA 1OPJA 3ORPA 5K4IA 3DQXA 1Q97A 4LI5A 4MBIA 2XS0A 4FTIA 3SV0A 4P90A 3GCUA 4QMWA 3D5WA 2VTQA 4MWHA 4KBAA 2CGWA 4ITIA 4C4EA 4WG3A 5AP1A 2C5OA 1ZYCA 4IAKA 1J91A 4L3JA 5M56A 1FINA 3A7FA 3FMMA 3S0OA 5CXHA 2BHEA 2W99B 3ZH8A 3OMVA 4ITJA 5BVNA 2ZOQA 4OTPA 4LGHA 1W7HA 4BYIA 4C3FA 4MWIA 3QQUA 2XNOA 4L44A 4EJNA 4UYAA 4XEYA 5HCZA 3DB6A 1OL1A 1OKZA 2B4SB 3RAKA 3LKMA 4U97A 5FP5A 5LMKC 2HY0A 4XOYA 5LJJA 1JLUE 4LUEA 3QA0A 4FTOA 3DA6A 1WBTA 2R3FA 4OTHA 2BRGA 2ZB1A 1QPJA 4FT5A 4CTCA 2EXCX 4X2NA 1KV2A 1Q62A 2QR8A 2ZV9A 4QMYA 3TNWA 3AT3A 5FG8A 5HO8A 2XM8A 5JH6A 2ITWA 3AC4A 3HDNA 4O0SA 2JKOA 4O7VA 4YGAA 3FEGA 1W98A 3NVMB 5AFVA 3D7ZA 3PJ8A 4Y73A 3D2KA 4V0GB 4TYJA 5DT0A 2VO6A 2UW8A 3BYUA 4DF3A 2ITZA 2PHKA 3DKCA 4YO6A 3AQVA 3GFWA 2R3NA 4ARKA 4M0ZA 4KB8A 2XZSA 4I0TA 4QP1A 1BI7A 5IH6A 2QKWB 4FKOA 3EFLA 3NZ0A 4L46A 3IK3A 4ZLZA 4FL3A 2QVSE 5JQ8A 4QMQA 1Y6BA 1M2RA 5AP4A 3EYHA 4IC7A 4TTHB 5K0KA 2YDIA 3H9RA 4ZK5A 4G3DA 4R1YA 2WEVA 4LOOA 2XNGA 4C4FA 2WMWA 2BZHB 2VTMA 3CGOA 3DAEA 3SG8A 5AUUA 4IFCA 5LQFA 4FOCA 3R71A 4QTEA 3COIA 2YWVA 2C5YA 2WIHA 2XJ1A 3PXQA 3PIXA 1W82A 4ZS0A 4WIHA 4FTRA 2R2PA 2YWPA 3MVHA 1WZYA 4IE9A 3PP1A 4AOTA 4D9UA 3G33A 4ERWA 4FIIA 1AQ1A 5HE2A 3UJGA 4FNYA 1UWJA 2XIRA 3DBEA 2VTSA 5AA9A 4L43A 4RWIA 1LEZA 1APME 2A1AB 3BE9A 3H9FA 4F99A 5ANJA 3VN9A 4G9CA 4PMMA 5HO7A 3MH0A 2Y4PA 3LJ2A 3O2MA 3Q4UA 3QGYA 1UVRA 2XEZA 2ZMDA 3OCSA 4Q9SA 2SRCA 3OY3A 4O22A 4F6UA 4ZMEA 2WQEA 1TQIA 1VYWA 2WGJA 3KRWA 4NCTA 1A48A 1UNLA 5A54A 5DIAA 2BKKA 2BZIB 4WBBB 3FMNA 3EH9A 5M57A 4PY1A 2UVXA 2VZ6A 1XBBA 1Y6AA 3R30A 4I21A 2HCKA 4HVDA 4YMJA 5M44A 2YABA 4ZTQA 3E5AA 4QYHA 2GU8A 2RFNA 3Q9YA 2B7AA 4L3PA 3E7OA 5HQ0A 5JGBA 2WTKB 4PPBA 3TDVA 1URCA 2VTTA 3DTWA 4BDIA 2BROA 2ITNA 3LJ1A 4PP7A 1JSUA 1OKYA 3QTSA 5CAVA 1WFCA 2VX0A 1FVRA 3F61A 4RC4A 5I9UA 4AZVA 2RG6A 2E9NA 4CMOA 3QFVA 4W9XA 4FMQA 4EHEA 4QYGA 2F4JA 1ZOGA 3I0QA 4IMYA 1VZOA 4M7IA 4DGGA 4N4SA 1ZYDA 5CEIA 3CTHA 1J7LA 2C6KA 5IMEA 3BYOA 4U79A 4OTIA 3GC9A 3C1XA 4M67A 4TWCA 2BZKB 5L2TA 3R7OA 3LQ8A 5BYLA 3PJCA 5CSXA 2VTAA 4J95A 5DEWA 4HZSA 1XJDA 3K54A 4E5BA 3LQ3A 4DINA 4A9SA 4ITHA 2JEDA 2VTJA 3D0EA 3TJCA 4UB7A 4ALUA 4J98A 4QP4A 3ID6C 4D2PA 1JVPP 5AIKA 4C36A 2PU8A 3ANRA 4FTKA 1TKIA 4I5HA 4IWQA 2R3LA 4MYGA 4QO9A 5CI6A 5AP2A 4ACGA 3IW8A 3FPQA 3OXZA 5JRQA 2LGCA 2UZEA 3CKXA 3D2IA 3E92A 3LMGA 3ROYA 3FZRA 5AV0A 1KE5A 3I6UA 1OBGA 2YCSA 5J1VA 2YIYA 4QYYA 3QCYA 2BZJA 2UZWE 2YAKA 4I20A 4F7JA 3IGGA 4MHAA 1WBWA 3OF0A 4IB3A 4K2RA 4QYEA 2XRWA 2YIQA 4EKKA 4EOQA 1UU7A 2PZYA 5FBNC 4EHZA 2J90A 3NX8A 4JAIA 4XG3A 1OI9A 1V0PA 2ETRA 3BKBA 5K3YA 3VS4A 1IA9A 4GH2A 4FSUA 3CS9A 5E91A 4OTRA 4G3EA 3U6HA 4UMRA 4GIHA 3R8MA 4EK8A 4JR7A 4AW5A 5IF1A 2W1IA 4Q2AA 2PVJA 3C0IA 3PG3A 2JKMA 4GCJA 3P23A 4O21A 5EW3A 2VTIA 4RGJA 3RTPA 4CMUA 3EQHA 3MPAA 4MNEA 4J7BA 3WZJA 1IG1A 4PRJA 4JG8A 5DT3A 5ETFA 1SZMA 3ZRLA 4FR4A 5BVWA 3TUDA 3W8LA 4KWPA 3NAXA 3ZS5A 4U81A 5F20A 2GQSA 2PUNA 5I9ZA 3GOKA 4GUEA 4NTSA 2V7AA 3KF4A 2PVHA 3W16A 3QQGA 5K5XA 4CZYB 2VNWA 3ZFXA 5AWMA 2VWYA 3RALA 3WF6A 4CKIA 1GNGA 1YHVA 1UU8A 4C57A 2GNFA 3MJ2A 5K0XA 1B39A 3S2PA 5BVEA 5I9WA 2QHNA 3KRRA 4C2VA 3KGAA 1XH9A 3H0ZA 2OXDA 2ZJWA 3FZ1A 3GC7A 3IOKA 3Q3BA 3FQEA 5EHOA 4GG7A 5F1ZA 4D28A 5IPJA 4XBUA 2CGUA 3PIZA 3D4QA 3HRBA 3OCGA 5EW8A 3WOWA 4PQNA 2F9GA 5BYZA 3PXRA 4FKTA 3ORTA 3VBXA 4E6QA 4IX4A 3MY1A 4JL9A 5ANKA 4FKQA 4GS6A 3H3CA 3MJ1A 4O0WA 3Q4ZA 3U8WA 3RWQA 3KCKA 3N51A 3WBLA 4BDBA 4IFGA 4A4XA 5LOHA 2QU6A 3Q4CA 2GQRA 2IW9A 5HX6A 4BBFA 4DG0E 2W4KA 4CRSA 5JQ5A 3BU5A 4BGGA 4EJ7A 3ZO4A 3ZHPC 4R6VA 3ZBFA 2WTKC 4DITA 2QOLA 2WO6A 3ODZX 3UP7A 4JRNA 3G6HA 2WQBA 4W8EA 4G5JA 4K9YA 5B0XA 3OROA 4O7WA 4FIJA 5B7VA 2YN8A 5A4CA 3RWPA 2PE1A 5D11A 3QZIA 1JPAA 3DZQA 2YERA 4FZFB 3MA6A 4S30A 1H8FA 5EYKA 3UOKA 5GINE 2UZBA 5L2SA 4FVQA 3NUSA 4GU9A 1PMUA 2XK7A 4RWLA 4CFNA 2F7XE 5E7RA 2JIUA 3C5IA 4HGLA 3EFWA 2YM6A 5L8JA 4EK4A 4JLCA 2XKDA 3KMMA 4PF4A 4W4WA 5D41A 5AP5A 2C6TA 2IVSA 4CV8A 4M69B 3ZLWA 3FJQE 2VTRA 4LM5A 4TWOA 4IZAA 4ASXA 4QMNA 3RPSA 3SC1A 4GK4A 2R5TA 2E2BA 2ITVA 3LOKA 4ZXTA 4I41A 3E63A 4GFMA 4FGBA 3R0TA 4UYNA 1IRKA 3MVMA 4FZ6A 5I5ZA 2XK4A 5HG7A 3C4FA 5LWMA 5J9ZA 3WI6A 4QD6A 4O7LA 2A27A 5EQEA 5HCXA 4WA9A 3KA0A 3W8QA 4BWKA 1G3NA 3Q96A 4F09A 4ZLYA 3EQGA 2G15A 1SVHA 4GMYA 3RGFA 3DLSA 4H58A 4FODA 3RK5A 4ANBA 3P1AA 3BU3A 3TZ7A 3UO4A 4E6AA 4I1ZA 3LE6A 1WBNA 2R3JA 4F6SA 3O7LD 4EYMA 3AMBA 2F2UA 3LZBA 3MY0A 3LM5A 5HG5A 5JGAA 5LMBA 5HO6A 3UQGA 2BALA 4LL5A 4QQCA 3R8PA 4EZ5A 1XKKA 2XRUA 3L8VA 5BVKA 3FLQA 4NSTA 5DWRA 4OT5A 4RQVA 4NTTA 3W55A 3R1YA 4AT3A 2JITA 3MPMA 5DA3A 3KK9A 2VWWA 4IX3A 1ZZ2A 3F7WA 2A2AA 3LFFA 1F5QA 4BYJA 5CZIA 2EVAA 3H4JA 3VF9A 3TWJA 1YWNA 1SNXA 2UW6A 4PMTA 4U3YA 5CT0A 3ZEWA 5BX0A 4F6WA 3UMXA 4PDYA 2YIWA 4DFNA 5DNRA 2B52A 5D10A 2OIBA 4GKHA 2W05A 4JDHA 2E9UA 3BGPA 3NYVA 4ACMA 2BKZA 3K5UA 3DK3A 4YZMA 5HNIX 2YCFA 2GSFA 2UZDA 5CEMA 3QALE 5CANA 4BTKA 3UVPA 5HI2A 4IVCA 4D1XA 5EKOA 5GIPE 1OIQA 2XIYA 5CU6A 5F94A 4PL5A 5FTGA 4BCMA 3TJDA 2FB8A 2J51A 4JX7A 4F7SA 4YPSA 3VS2A 5IUGA 3EOCA 1UKIA 3VUIA 3BHUA 3II5A 5CNOA 4FBXA 3CPBA 3TNQB 4A9RA 5DN3A 3BHHA 3FHRA 4NW5A 2OXYA 5FTQA 2BFXA 2WMVA 3FQSA 4EI4A 1O6KA 3CIKA 3QRJA 2XIKA 3QZFA 2X7GA 4ZJIA 5IEYA 3R7UA 2W5HA 1JOWB 3OFMA 5HX8A 3O8TA 2W06A 3PJ2A 5TO8A 3G9NA 5HNGA 4GVJA 1IEPA 4QRCA 2XNEA 1E1VA 1FBNA 5C9CA 4OAVB 4WNMA 3RPVA 4XUFA 2VWXA 3DXQA 2FH9A 3KULA 3LVPA 4MD8E 3HECA 4QYFA 4YZCA 4BF2A 1V1KA 1B38A 1U54A 4I24A 2G1TA 3L8PA 3IW5A 5BVDA 2PWLA 2O64A 4MF0A 2BDWA 3EYGA 3PWDA 3WZEA 3BYMA 4OUCA 5I9YA 3H30A 3PFQA 5EDPA 2YLEA 3KXGA 4S32A 3PG1A 5CU3A 3VVHA 4I0SA 4EH8A 2QODA 4BKZA 3DCVA 4FTMA 4RLKA 2VO3A 3V5QA 4E93A 2EXMA 1M52A 4IAIA 4QMPA 2PUPA 3ATSA 1ZYJA 4FTNA 4IX6A 3CE3A 4RA5A 2DUVA 4XBRA 5AP0A 5IA3A 2WHBA 2CGXA 2OU7A 3NSZA 4EBWA 4JDIA 2W1EA 4NJDA 4Z3VA 3EZRA 4OT6A 1KE8A 3FYJX 3UC3A 2OIQA 1H1WA 3R04A 3FQHA 1V0BA 4B9DA 4W4XA 4F9YA 3DAKA 3ATTA 3HL7A 4CYJA 2GNJA 4MXZA 3CSVA 3ACJA 5AR8A 1P2AA 3LXLA 1OL5A 4L52A 1H4LA 5DR9A 3KCFA 5IDNA 3RZBA 1CTPE 5CSVA 2VTNA 3EIDA 2YM8A 3BEAA 5E9EA 1ZYSA 3AC3A 4Y95A 4PTEA 5DR6A 2CCIA 2JAMA 4NFMA 2XNNA 3OY1A 4ANSA 2ITXA 4BZDA 3HMIA 1YQJA 3FLZA 4ACDA 5JFWA 5CF4A 3BPRA 4U7ZA 5FWKK 1YI6A 5HE0A 3L9MA 3WZKA 1V0OA 5FEQA 3UPXA 5JT2A 3CTQA 3HRCA 4G31A 3ZO3A 5EDQA 3AC8A 3FLSA 1M2PA 4ZJJA 1LPUA 4FTUA 1UV5A 2JDTA 2PSQA 4HCUA 5H9BA 3D9VA 4U44A 4AOIA 3A7JA 2X9FA 3UIMA 4BVUA 5KO1A 4TYEA 2RFEA 2ACXA 2UV2A 3VS1A 2OZAA 4PP9A 5FXSA 2W4JA 2HZIA 3F3VA 3MPTA 2XYUA 5IQCA 3FMHA 3JY9A 5GHVA 4UXLA 2NO3A 3P78A 4WBOA 4BZNA 4EL9A 3NNVA 5AX3A 1FQ1B 4CRLA 3LM0A 3DFCB 3E8EA 4JNWA 1JAMA 1SM2A 3UZRA 1XBAA 2XNMA 4ZSEA 4TW9A 4D2RA 2OG8A 3RNIA 4H1MA 4XP3A 2QOBA 1FGKA 5CT7A 2PVKA 2VRXA 2XK3A 3R22A 4I23A 4U80A 2XBJA 4YZNA 3U9CA 4FSYA 3VBWA 5AUTA 1GY3A 2R0IA 3QKKA 5HE1A 3DDQA 4BCJA 4EHVA 1NT2A 4HGTA 1H25A 2C1AA 3FYKX 3NR9A 5AR3A 4WKQA 4DGNA 3O96A 5GZ9A 2OH4A 3B8RA 3C51A 3LLAA 4O86A 4FEWA 2HWOA 2X4FA 4HW7A 2OFVA 4YZ9A 4ZSGA 2J50A 4DEAA 4ZP5A 1I44A 2VX3A 2R3MA 3DKOA 5L8LA 2F49A 4F4PA 1K2PA 1G8SA 5J7HA 3QTQA 4FK3A 3AD6A 3W2CA 2X4ZA 4R3PA 3R8UA 4EQCA 2BIYA 4XMOA 4D4YA 5JRSA 1ZLTA 3F2AA 4YLLA 3SOAA 4EK5A 1CKIA 3PY1A 1Q3WA 1TQMA 3OOGA 3QKLA 2Z7RA 2CLXA 3PSCA 1Q8WA 4EOKA 2YLFA 1Y8GA 4LFIA 5T6KA 4EK3A 3KULB 3A4OX 4FV7A 4EH9A 5IDPA 2ZV8A 2VO7A 3PDTA 4QP9A 4WT6A 4CFWA 1Q41A 3FI4A 3DXPA 4EEVA 3ETAA 3NNWA 2B55A 1PMNA 3QD4A 4X21A 2IZRA 4J52A 4J53A 4ZS4A 3QZHA 4X6QC 3QQFA 2ZM3A 5EKNA 1XWSA 3ZEPA 2UW0A 4XG7A 3F82A 5IA5A 2PZIA 3SW7A 4BDHA 4FV0A 5HTBA 4CLJA 3U4UA 1L3RE 4AZWA 2C3KA 3DTCA 3RMFA 1FMKA 3MH3A 3UG1A 5K5NA 3R9OA 3HMMA 4BRXA 2R7IA 5LVNA 4DTAA 2IZTA 4X2FA 1OIUA 3RHKA 3VC4A 4E5WA 5CEKA 5CZHA 1OL7A 2QURA 3PSBA 1YDTE 4FEUA 3QTZA 3GU7A 4L42A 4O6EA 5JSMA 4L68A 3NUPA 4IEBA 1Q3DA 3KXMA 5E8VA 4IVDA 1GZKA 3MWUA 3NRMA 5CSWA 3KFAA 3CD8A 2PVNA 2C6MA 2VTOA 2R4BA 3G51A 4YJNA 4D2SA 1YWVA 3UOJA 2ONLC 3PRFA 1A9UA 2WB8A 3C50A 4W4VA 2PVLA 1PYEA 2IZUA 2VTLA 4AX8A 5IQHA 3DKGA 2XEYA 4JG6A 4RC2A 5AEPA 3LQ5A 3TM0A 4U0IA 5KMLA 2NP8A 3ZCLA 4Y5HA 4BY9E 1YOMA 3KQ7A 5HG8A 2YEXA 3SD0A 4NW6A 4FF8A 1BYGA 4BBEA 3DB8A 1G5SA 4YO4A 1ZMVA 4QP3A 2OWBA 3V5JA 2Q83A 2J7TA 4FKRA 4NJ3A 4ENYA 4IB1A 5FP6A 4CFXA 3R2YA 4JVGA 2F57A 3R8VA 2CGVA 5DPVA 1MUOA 5M07A 4A7CA 4EOLA 3N4UA 3OWJA 3ZYAA 5KBQA 3E64A 2C0IA 3OP5A 3PVBA 1GIHA 4IZYA 4YHTA 5AM6A 2CKQA 3SRVA 5M4FA 5DFPA 3NCGA 2OZAB 3HVCA 4JI9A 2RF9A 4IACA 5FEEA 3MESA 4FVPA 1P14A 3DT1A 3H9OA 4HYHA 3I5ZA 4FI1A 4M97A 1FOTA 3BLRA 3C4WA 2UZTA 3EB0A 2CKOA 4AZEA 4LOQA 4PPCA 4O0YA 3TEIA 3MDYA 4BDEA 4NZWB 4FZ7A 2I1MA 2WMUA 4M84A 4BCKA 3LMIA 5G6VA 4YJOA 4ZAUA 4LGDA 4DH3A 3HV3A 4A4OA 4TRLA 5BMSA 3E8CA 3MB7A 2PVFA 3MI9A 1KE7A 2O65A 3HGKA 4UZDA 3EN9A 3ZXTA 4E4MA 3CXWA 3DV3A 5CENA 4QTCA 2KTYA 3BIZA 3RJCA 4GV1A 4HOKA 4OGRA 2OICA 4HGEA 4PTCA 3VUHA 3SG9A 5IQBA 1XO2B 4E7WA 4F9BA 3WE8A 2YDJA 3MB6A 2ZM4A 2V0DA 4QMTA 1XH5A 4KSQA 5CTPA 4EH6A 4Y5QA 2QONA 3IOPA 2QO7A 5DE2A 3SOCA 2UUEA 4IDTA 5ETCA 4HYIA 4JBOA 5BUEA 4CT2A 4EC9A 2P2HA 5J9YA 4YLJA 3C7QA 3CEKA 3KXNA 3M42A 1REKA 2UW3A 4IADA 3RINA 5DT4A 2W9ZB 4Z55A 1DAWA 2Y9QA 3FI2A 3GC0A 4CD0A 5T3QA 3FAAA 3R9DA 1KSWA 1OIYA 3K2LA 3VHEA 4TNDA 4BZOA 2JIVA 2REIA 2WELA 2OJFE 4C34A 4D5HA 2W9FB 5M09A 1WVWA 4K33A 3TZ9A 4O0RA 1J3HA 3S95A 4EQMA 4J1RA 3GCSA 2OXXA 2IVTA 2ZM1A 5BQ0A 1YHWA 4UZHA 2I6LA 2QG5A 3VBVA 1ZOEA 1L8TA 2BPMA 3NS9A 4DEHA 1YW2A 2YM4A 4BI1A 2PMNX 4E4XA 3BBTB 3LFSA 3D5XA 3SXRA 1YXSA 4O7SA 3TG1A 2PL0A 3RK7A 4TXCA 4DAWA 4ZSLA 5HCYA 3K3IA 5EI8A 4MXAA 4UEUA 3LCOA 4H3PA 4OLIA 3PP0A 3FMDA 4PDSA 4F64A 4ENXA 1UNHA 1SNUA 1OITA 4A4LA 3FI8A 2V7OA 2ITOA 3VULA 3DBFA 4EC8A 5EYCA 4MXCA 4BWXA 4C37A 5J5TA 3W33A 3F3TA 4R78A 2J9MA 1H27A 3ZO1A 5KE0A 2X8DA 3PTGA 4BIDA 2C69A 2HWPA 4CZTA 3UZPA 4L67A 3CD3A 2XKFA 4TN6A 3LFAA 2ITUA 4ZTRA 2WQMA 3ZZEA 4BGQA 5AP3A 4UY9A 4CCUA 3COKA 5KKRB 3VJOA 1YRPA 5TKDA 2QO2A 2W0JA 5IQGA 3FMEA 3FUPA 2BRMA 4PTGA 5EM6A 5C03A 5KMNA 4LV8A 5M4CA 4IWPA 3KVXA 3U9NA 4GT4A 3ZC5A 3L9LA 4B99A 4RX9A 5J79A 5BNJA 4O0UA 3ZRMA 4BDCA 3UO5A 3THBA 4W8DA 5CU2A 2IG7A 4MQ1A 3MYGA 3PVUA 1U59A 3GFEA 2W1ZA 3E87A 3QYWA 4P5ZA 4YC8A 3QQKA 1JBPE 3JS2A 3DZOA 4JQ7A 3V51A 4KA3A 4DBNA 4I5PA 5LVMA 3SRVB 4YTCA 2GTNA 3NAYA 3LXKA 3OWLA 3SQQA 1WCCA 4RX7A 2FSLX 2VWUA 2CKEA 4OBPA 1W84A 4ALWA 3QCXA 3UNKA 3TI1A 4YC3A 3WF8A 1GJOA 3QHRA 2WTCA 4G3FA 4IZ5A 4PL4A 4FKLA 5EM7A 2V62A 2Y6MA 4MAOA 4NK9A 4YJSA 1GZNA 4EONA 2HOGA 2IO6A 3KXXA 4MBLA 1BX6A 3FLNC 3P9JA 3F5GA 2VTHA 4O38A 3VBQA 3MBLA 2XMYA 4K11A 4U5JA 5LCKA 4FSZA 2CCHA 4BIEA 4I4FA 4EUUA 1RJBA 3I0OA 4CQGA 4PDOA 4N6YA 3N9XA 3AD5A 1R0PA 3HUCA 4GKIA 4MH7A 3F5UA 3BHVA 3I5NA 2YFXA 1H01A 3R9NA 4F7LA 1YXVA 4KNBA 3QTRA 2CPKE 3LXPA 3E7VA 3DBCA 4O2ZA 5BPYA 4XV1A 2VTPA 4RVKA 3FXWA 1YXXA 4G16A 3VUGA 5I0BA 4F0FA 2BAQA 3EFJA 4IWDA 5AV2A 3VW6A 4XRJA 5HU3A 3HZTA 1MRVA 5CVFA 4C38A 2XUUA 4EOJA 1I09A 3R21A 4I5CA 5IUHA 3RI1A 3TXOA 3OWKA 2X8EA 4FKGA 2RFDA 3DNEA 4FIGA 5HTIA 4M69A 4RWKA 2WIPA 4BDDA 5L3AA 3TUBA 5IA2A 3C0GA 5IH5A 1BL7A 2V55A 3ZM4A 3I7BA 2XCHA 4OAUC 4BDFA 4WSQA 5EYMA 2WZJA 1OPKA 1UKHA 2YM7A 5HZNA 2WOUA 4KRDA 4FIFA 2Z7QA 4RIXA 3PWYA 3R1SA 4RIWB 2P55A 5AJQA 2OFUA 4FSQA 1XH4A 2XVDA 3E8DA 4RJ3A 4C0TA 5BMMA 3POOA 3OS3A 2G2HA 3F3ZA 4EH3A 4GRBA 5ICPA 4AG8A 2VWVA 3MY5A 1X8BA 4C8BA 5D9HA 3PY0A 3UC4A 2Y8OA 4F7NA 3KRLA 2FUMA 4HCVA 3ZRKA 2YISA 4QMXA 5J95A 4APPA 4Z7HA 3S1HA 4NFNA 3I79A 4RIYA 4XNEA 4AFEA 2WXVA 1BUHA 5C27A 4QMUA 5DOSA 3EKKA 3UE4A 1F3MC 3LFQA 3VUMA 3KMWA 4YURA 2C5VA 5HEZA 3U55A 1PKGA 5HG9A 3TCPA 2GPHA 4FEXA 3VRYA 5TR6A 3FZSA 1WVXA 4ZTLA 5E1EA 2JGZA 4I6HA 4RPVA 4XV3A 3KMUA 2E9OA 2OK1A 3Q9XA 3HNGA 4O0VA 3PVGA 2GS2A 5HBEA 2ESMA 4U6RA 4QOXA 4KIOA 5I3OA 3E8NA 1H26A 3EQCA 3JUHA 1PY5A 2BFYA 2C6EA 2Z60A 3VAPA 4CMTA 3D83A 3FC1X 3HA8A 4RQKA 3BX5A 3TV6A 2G01A 2B9JA 5KKRC 4K1BA 4X0MA 3EN7A 2C0OA 5JN2A 3PZEA 4FV5A 2X2MA 4J96A 3G15A 3SXFA 3A7GA 4IZ7A 2PVYA 4H39A 3PUPA 5CVHA 1T46A 3R8LA 3RVGA 3UYSA 4IAFA 3NIZA 3UQFA 4ZEGA 5E8WA 4DH5A 3KXZA 1W8CA 4PX6A 1ZMUA 2HAKA 2HENA 5L6PA 4BDGA 4OTQA 3Q5ZA 3QUPA 4AOJA 3HX4A 2GNHA 2X7OA 3HV4A 4FL2A 4HVIA 3FPMA 3E88A 4FTCA 4CFFA 2CNUA 3FI3A 3FSKA 3MFRA 5D12A 4BCFA 3C9WA 4R3RA 5GIOE 2QLUA 4O84A 3FWQA 4L01A 4RZWA 3LCSA 5E90A 4DLIA 4PNKA 3QX4A 3O23A 3A7IA 4FV4A 3S3IA 5M08A 5HORA 4NYEA 3Q9WA 3AGMA 4JXFA 4BCQA 5TF9A 2X9EA 4QP6A 3K5VA 2QC6A 3SXSA 2QOKA 4IH8A 5AUWA 4O83A 2EB3A 4FUXA 3NNXA 4BCPA 4MK0A 4QMSA 1JQHA 5CEPA 3I81A 5KCVA 4AE9A 5EHYA 4F0GA 4D1ZA 1OPLA 4OTFA 3CY2A 4QMVA 4YBKA 2HIWA 5AV1A 2QD9A 5M4UA 3FBVA 3RM6A 4IAYA 2BCJA 2VWIA 4ONAA 3BHTA 5HOAA 1UU3A 2C47A 2ITPA 5E8XA 3F7ZA 4M14A 3EL8A 3C4XA 2G9XA 2O0UA 3NPCA 4QT1A 2OZOA 5ACBC 1P4FA 5JZNA 3CQWA 2EU9A 4FL1A 2PMLX 2FGIA 1ZRZA 3SHEA 4JG7A 4TWPA 3WZUA 5L6OA 4NM3A 2OBJA 2XK6A 4NIFA 2Z7LA 3V5PA 5K4JA 5HIEA 3UTOA 4O6LA 2J0JA 5CEQA 3M11A 1PXOA 3SW4A 2OGVA 2XM9A 3LFBA 5E8YA 3WIGA 2ONLA 4L7FA 5CI7A 3SAYA 5AADA 4QQ5A 1CDKA 1IASA 3QRKA 4RIXB 3A2CA 2YITA 4XYFA 5DYJA 4KIPA 2ETKA 3C4ZA 4II5A 2UZOA 3MV5A 3JXWA 3NW6A 5CF5A 3UNZA 5KHWA 3P7AA 4QPSA 3UPZA 3HV5A 3PY3A 5FLFA 2J4ZA 4RMZA 4Y46A 4YJRA 5LCJA 1K3AA 4PNIA 4AN2A 5M06A 4BI2A 3KRJA 3BI6A 4XV9A 4J71A 3A62A 3F3WA 3TTJA 5HD4A 4RIYB 1BKXA 5AM7A 2ZV7A 3G0FA 3VHKA 2PZRA 3G6GA 4DFLA 1NA7A 2UVYA 4P4CA 5C1QB 5FUTA 4YZDA 5L2QA 5D1JA 3PIYA 5DI1A 2JLDA 3TL8A 3GNIB 3FMLA 4ZZOA 5IKWA 4WSYA 3PE2A 4L8MA 4DG3E 3HP2A 4I93A 2JIIA 4PV0A 5E92A 4GJ3A 4AGCA 4AW1A 4CSVA 5HLWA 2AC3A 3GEQA 4FTLA 4FSTA 1NY3A 2JKKA 1YXUA 3DJ7A 4IX5A 3VS6A 4O0TA 3C5UA 4AF3A 3DFAA 4A9TA 2A4LA 4KUJA 5IQAA 3QX2A 4L53A 4BHZA 1PMEA 1KUTA 3NDMA 5G1XA 2ITYA 3BZ3A 2YZLA 2BVAA 4O7YA 4XJ0A 3NW7A 4L45A 3D15A 4AQCA 2W1FA 5E8UA 3F69A 4G6LA 4JOAA 5EOBA 3UIBA 3V3VA 1W0XC 4DCEA 3SA0A 2HZNA 3R73A 4USFA 4G2FA 4CKRA 2C3LA 4JAJA 2W17A 3VUKA 3LIJA 3PVWA 2C3JA 2W1HA 3BQCA 3DOGA 5D7AA 5ANDA 3CPCA 4O1OA 3RKBA 3W2OA 4RA4A 3UODA 3R6XA 2XK9A 2PYWA 3HV7A 4UBAA 2OLCA 2JKQA 4BI0A 1O6LA 4HZRA 3QZGA 2OO8X 1YDRE 3QUEA 5EYDA 5FQDC 3IW6A 4GW8A 4RJ5A 4HPTE 5KMJA 5DHJA 4FTAA 4MEDA 4C3PA 4RFMA 4ANLA 5E1SA 2ERZE 4TKSA 3HMOA 2NRYA 2PMOX 3AT4A 4S2ZA 3VO3A 4IM2A 1XQZA 4H1JA 5A3XA 2YIXA 2EUFB 4CV9A 5L8KA 3OEZA 3QTIA 4F1OA 3F3UA 1QPCA 1H07A 4BCGA 5A4TA 1QL6A 5FDXA 4BCNA 1MRYA 4YJVA 2XIXA 5GNKA 2XJ2A 5AR2A 2PE2A 5F9EA 2R3HA 1VYZA 2QQ7A 4EKLA 1M7NA 3ZUUA 2HW6A 3QCSA 4DT8A 1QCFA 3ORIA 1PXKA 3W10A 2ZV2A 3TZMA 2GFCA 4CGAA 2C68A 4GVAA 3F6XA 5AUXA 4JT3A 4KABA 1OIRA 2C4GA 3SVVA 4CXAA 3LCDA 4WNKA 2XF0A 4LOPA 4RJ7A 4JIKA 4EZ7A 3TKHA 4CG9A 1JKTA 4GJ2A 3MIYA 4HNFA 2QNJA 2JBPA 1Q5KA 1MQBA 2WTDA 2FSOX 2PK9A 1HCKA 2X2KA 3C4EA 3GQIA 3TIZA 3ZZWA 2GDOA 5DG5A 4OTDA 5HBHA 5C8MA 3OUNB 4J97A 4K6ZA 4E26A 4FC0A 2BR1A 3P86A 3TTIA 5IISA 3A4PA 3SGCA 4USDA 2QCSA 4MTAA 2P4IA 4NIFB 1Q8ZA 4NUSA 4R1VA 2WMSA 3DS6A 1S9JA 4QTDA 2FA2A 4HNIA 3C13A 4FICA 3BE2A 3UYTA 3ITZA 5LARA 4DC2A 4EH5A 4V01A 4G3GA 4DGOA 4XG9A 2J6MA 2J5EA 3QXOA 1SYKA 2VWBA 3QBNA 2GNLA 4NWMA 4AW2A 4ZSAA 5H8BA 3TT0A 1J1CA 4D58A 2WNTA 3L9PA 1WBPA 1CMKE 4L9IA 4D9TA 4K18A 3PJ3A 2XNPA 5FD2A 4UXQA 3BHYA 1ZMWA 4TNBA 3R7VA 4BDJA 5DR2A 3P08A 2JFMA 4YBJA 4K77A 4FTJA 1YVJA 5CALA 3EQBA 1YHSA 3FY0A 4C3RA 1JWHA 3HLLA 1CM8A 4FT0A 4ZJVA 3WIKA 5A4QA 3UMWA 4C33A 3UQCA 5HKMA 3R01A 4IW0A 3GENA 3IO7A 3EQDA 1PKDA 1VEBA 3ORXA 3OXTA 2ZVAA 4ZZMA 5LVOA 2DQ7X 4AA4A 3OCTA 3RAWA 3ZTXA 2CDZA 5KNJA 4L7SA 5C01A 4KSPA 2R3PA 2QOFA 3EWHA 4FG9A 4RJ6A 4KRCA 5HVJA 3B8QA 4AAAA 4TL0A 5J9LA 2I0HA 5T68A 4FE2A 2W1GA 3FDNA 4O0XA 4AZFA 4RZVA 2W5AA 4X3JA 5HLNA 4AT5A 2FSTX 4I94A 1YOJA 2HZ0A 4F9CA 4TWNA 1R0EA 2GHMA 3KL8A 4BCIA 4RFZA 5I4NA 4FZAB 4FVRA 2VU3A 4B6LA 4D5KA 4FGRA 5JFVA 4QTBA 2XIZA 3ULZA 3BGZA 4GSBA 3UG2A 2RG5A 2PULA 3GC8A 3CQEA 4E1ZA 4AGDA 4GT5A 5CU4A 2O3PA 2C6DA 3EQFA 3KY2A 4Y8DA 1OL2A 2QU5A 3Q4TA 3QTWA 1MRUA 3OEFX 3UZTA 5DH3A 1OKWA 3G9LX 4D4VA 2UZUE 3U6IA 1OBDA 4AU8A 1Q24A 5TT7A 4EWHA 3BV2A 4ORKA 5I9XA 3ZUVA 4C2WA 5EM8A 4F1MA 4NM5A 2WU7A 2PVRA 3P79A 4XH6A 3W2SA 5JMSA 3KB7A 4BWPA 3RPRA 5DRDA 4CVAA 3C0HA 3DAJA 4FNZA 3NWWA 1QMZA 2B9IA 2DWBA 1YKRA 4L00A 5CY3A 4ZTMA 3PA4A 4LMNA 4NM0A 5CASA 2AUHA 5EH0A 1GZOA 4Y85A 4XLIA 3DXNA 3FL5A 2Y4IB 4UWYA 1H1QA 3TKIA 3RAIA 3CY3A 3ALNA 4BC6A 1FVVA 3SX9A 4FV6A 4ZY6A 3HYHA 2EXEA 4ZTNA 3D7TB 2R64A 2W4OA 4E6CA 2V5QA 5TOZA 2RSVA 4A06A 3QLGA 4O7NA 3EN5A 3R2BA 4X2JA 3TUCA 2XYNA 3IPHA 4QP2A 5L4QA 3Q32A 4UMQA 2H9VA 4FNXA 3B2WA 1Q8UA 4AGUA 2GS7A 4FEQA 3UO6A 4FG8A 5K9IA 4R7BA 1PW2A 1QPDA 5EFQA 2HELA 3UOLA 2OJJA 3Q2JA 5AUZA 1Y91A 4XG8A 3PXFA 1QPEA 2GNGA 4BGHA 4XRLA 3VF8A 2RIOA 3PZHA 3FSFA 3LJ0A 5EQYA 3O8UA 4FKJA 4DA5A 1R3CA 1R39A 3TZ8A 1T45A 2BILB 5KMIA 2ZAZA 4RIOA 2O63A 4XHKB 1KV1A 5AAFA 3T3UA 2WKMA 3BRBA 3EZVA 3V6SA 4DT9A 3EJ1A 3CP9A 3FE3A 4DFZE 3NYXA 2GFSA 4I6QA 5IZFA 1G8AA 5LWNA 2CKPA 5AUVA 3NYOA 5A4LA 3IGOA 2QHMA 4IDVA 4JX3A 3TNIA 1B6CB 2HK5A 5ETIA 3WF9A 2ITTA 5AAEA 3VRZA 5IQIA 4J8MA 3AGLA 4O82A 2QG7A 2IN6A 5TE0A 5CU0A 4C62A 1Y57A 4Z16A 2QOHA 4QPMA 3FY2A 4M68A 3HA6A 3DNDA 3RCDA 3WILA 4FKPA 4DN5A 4JJRA 4LYNA 3EHAA 5FEDA 3A60A 3ET7A 4BHNA 5IA4A 1GIJA 2F2CB 2BRHA 4YC6A 5HIDA 5CAPA 2W7XA 4ZOGA 2EWAA 1SVEA 2DS1A 4TYHA 4BKJA 4RX8A 3WE4A 4IM0A 3D5VA 3R1NA 2KULA 3F2NA 5KHXA 2X2LA 4EOMA 4TYIA 4C59A 4RT7A 4AA5A 4TPTA 2IVUA 5BUIA 1JKKA 3Q52A 3WYYA 2Z7SA 2R3RA 2R3QA 2X1NA 4XX9A 2YJRA 3R9RA 4FG7A 5E8SA 2H96A 3U51A 2WMTA 2WU6A 3QKMA 3R1QA 5FDPA 3I1AA 2FYSA 3QRUA 5AAGA 5EW9A 4C4JA 4I92A 2W5BA 2XK8A 4WHZA 2UW4A 3WARA 2PUUA 4XS2A 4MD7E 3D14A 2V22A 4G6NA 4U40A 3V8WA 5BYYA 1PJKA 5DMZA 5AR4A 5GJDA 1REJA 3NEWA 4I3ZA 4AZSA 2GQGA 2I0YA 3MS9A 4FV3A 4JQEA 2GTMA 3R28A 3UVRA 5I9VA 3ZLXA 4QTAA 1STCE 3DJ5A 3L1SA 3LHJA 5IUIA 1OUKA 4AZTA 4E4LA 3KVWA 4DFUA 4E8AA 3JY0A 3LPBA 2BMCA 4R8QA 3VBTA 2UZLA 3Q53A 5BVFA 4S34A 1ZY4A 2ZDUA 5FM2A 3A7HA 3O17A 4EBVA 2QOQA 4TYGA 5B2MA 5HU9A 4GL9A 4RIWA 4IIRA 4USEA 2WQNA 5IU2A 3BGQA 2WTJA 2ZYBA 4Q5HA 4LQMA 3RPOA 1JKLA 4CFMA 4U8ZA 3VUDA 3I4BA 3LFNA 3AMAA 2Y4IC 3OW3A 3P7BA 3ZFYA 5CF6A 4JBPA 5GJGA 4X3FA 4NKAA 5EQPA 4BCHA 1GIIA 4GG5A 2HY81 4IQ6A 2XKEA 2X6DA 5FGKA 2Z2WA 2EB2A 1YWRA 2F7EE 3ORNA 4DH1A 2X0GA 3KK8A 1UWHA 2H8HA 3GI3A 4RRVA 3ELJA 1CKPA 5CLPA 4LMUA 4GK3A 4W9WA 3GT8A 3CCNA 3DKFA 4M3QA 2B0QA 4F9WA 2BAJA 4EOPA 3VQUA 2UW9A 3EMGA 4UMTA 5HD7A 3QTXA 3POZA 3KN6A 3E93A 4AACA 1FGIA 1WBOA 1AGWA 4FKWA 3PE1A 2J0LA 3G90X 3ORZA 3ORLA 1Q61A 4FTTA 4RFYA 5FBOA 5JFXA 5DLSA 5H8EA 3IW4A 4Q9ZA 2YCQA 5D7VA 4Z9LA 1YDSE 5JGDA 2Z02A 4RC3A 3RP9A 4ACHA 3GU4A 4DLJA 1MP8A 4O2PA 4QMZA 4YJTA 4LV5A 1YXTA 3UGCA 5HBJA 2IZSA 4IBMA 4FKSA 4ZTHA 5IA0A 4ANQA 1GOLA 3LLTA 2FSMX 3AXWA 3MW1A 3NYNA 3F88A 4QP7A 3U54A 4IHPA 3WF7A 4OBQA 5CQUA 3QGWA 2WAJA 5ANOA 3ZLSA 5EI6A 4B7TA 3CJFA 2XCKA 5LXMA 3P0MA 1YOLA 1HOWA 2XBAA 3OTVA 4N6ZA 3BYSA 4Z7GA 3A61A 4RWJA 3P4KA 2B53A 1JNKA 2RKUA 1YI4A 3BCEA 2FO0A 2YHVA 3F66A 1PXMA 3G2FA 3LFEA 3MVJA 3O7LB 3R7GA 3ERKA 3M1SA 4KKGA 1XH7A 4PUZA 2UW5A 2UVZA 3IKAA 4JDJA 4YZBA 4YHFA 3R7IA 3W2QA 4B0GA 4BIBA 3W18A 4LL0A 4TYHB 4A9UA 3BBWA 4DEEA 3QD0A 1H28A 2HXLA 3W1FA 3NUYA 3ZBXA 2AYPA 3MFTA 3NCZA 4FNWA 4D2VA 2JFLA 3QQHA 2J0IA 3BEGA 2YCRA 3CBLA 2OF2A 4S31A 1U46A 2ETMA 5DBXA 2WPAA 4H3BA 3FKLA 3R02A 3GCVA 5EOLA 1H1SA 1Z5MA 2IWIA 3QU0A 4K8AA 4IB0A 3TV7A 3PPJA 1XH6A 4FKIA 4R3CA 3GCQA 3VQHA 3JVSA 4C02A 3UIXA 1KE6A 1J1BA 4BKYA 2W1DA 2CLQA 5ANEA 3OW4A 3GU5A 3P7CA 5M4IA 4R5YA 1LEWA 2R0UA 4M15A 1U5RA 4FT3A 4TY1A 5AP6A 5M51A 4FSMA 5CYIA 2JC6A 1H24A 3VIDA 2BIKB 1LUFA 4PDPA 1VR2A 1M17A 2QI8A 4YNEA 4X7QA 2YDKA 3E3BX 2WTWA 3AOXA 4M13A 4GYIA 4MXXA 4WNPA 4R5SA 4AT4A 2B9HA 4EH7A 4KIKB 5HICA 4AN9A 1PXLA 4MVFA 4MQ2A 4QPAA 1BLXA 4EORA 3BWJA 4I0RA 5BUJA 2VAGA 3QAME 4IAAA 1P4OA 3DPKA 2PUIA 1Q8TA 1Q4LA 2HXQA 2XB7A 4YTIA 3FHIA 3T8OA 4KKEA 4ERKA 3W32A 3CGFA 3HP5A 2Q0BA 1LR4A 4FSRA 4WRSA 3M2WA 2CJMA 3QC4A 4B4LA 5KMMA 2I7QA 3R8ZA 4N0SA 4C4IA 4TT7A 4LG4A 5FXRA 1SMHA 4HGSA 2R7BA 1TQPA 4ZIMA 4FV8A 2R3GA 4P2KA 5C8NA 1A06A 1ATPE 3O50A 4C4HA 4MBJA 4JR3A 3ZXZA 5BVOA 4UWCA 3OVVA 1PYXA 2C1BA 3F9NA 2XKCA 3MSSA 4X3FB 5FM3A 1H1RA 4DEIA 3MN3A 4APCA 5C8KA 3DLZA 5CWZA 2BDJA 3NLBA 4O27B 1AD5A 4BTJA 5JKGA 3V01A 4BDKA 3C4CA 4DTBA 2A19B 2IVVA 3O71A 1LP4A 2VWZA 4AE6A 3PXYA 3JYAA 2OF4A 2R9SA 3FKNA 5A46A 5CNNA 4ZMFA 2R3IA 4YJQA 3ZONA 3PJ1A 5HE3A 3NIEA 4KAOA 4I6BA 3F5XA 4CLIA 1ZWSA 3ANQA 4E4NA 4YJPA 4FK6A 3AMYA 2C30A 3EFKA 4RSSA 3D94A 3HMPA 3HAMA 3PPZA 4J99A 1XH8A 4JBQA 5KMOA 3MFSA 2UZNA 3KN5A 4JRVA 4X6RA 5E8TA 4WRGA 2XJ0A 3O0GA 4GFGA 3H0YA 3ZFMA 1TVOA 4E3CA 4G6OA 1MQ4A 4DYMA 1JSTA 4QQTA 4CFUA 4ASEA 4O7ZA 5B2LA 3H10A 5AA8A 4GFOA 3UOHA 2BDFA 4CTBA 2YAAA 1PMVA 2YACA 4Y83A 5DGZA 5JZJA 4P5QA 2C3IB 3IDPA 2O8YA 2RFSA 4M0YA 2X81A 5KX8A 4F08A 4BR3A 1ZXEA 4IVAA 3LMHA 4FSNA 3PA3A 4EUTA 4C7TA 3RCJA 3AG9A 3ZSHA 1R1WA 1XR1A 1U4DA 4GEOA 4TZRA 3N4VA 4O7RA 1H08A 1UNGA 1BI8A 1NVSA 3JPVA 1PRYA 3OBJA 4QMMA 4AN3A 2IW6A 5ITAA 1HCLA 3U87A 1NXKA 4AP7A 4F65A 4X2GA 5EHLA 2XP2A 4Q5EA 2GMXA 4FYOA 5IH4A 4KBKA 4D0WA 3EQIA 2OI4X 3ODYX 2CN8A 1ZZLA 3GGFA 4EOSA 3RAHA 1OKVA 4X2KA 3QRTA 2WMRA 4QQJA 3QA8A 4YSMA 3FMKA 4MXOA 4E5AX 3L9NA 4KD1A 4MF1A 1Q8YA 3UDBA 1P5EA 1UU9A 3BU6A 2OJGA 4LUDA 4D2TA 4PMPA 2BTRA 2C0TA 4HPUE 4XOZA 3AC2A 3BLQA 3RPYA 3HEGA 4A07A 4XV2A 5I3RA 3BWFA 3LCKA 3Q9ZA 4FKUA 5HGIA 3QQLA 4EYJA 3ACKA 4PPAA 3ZSGA 1PXJA 1EH4A 1OMWA 3MTFA 3KXHA 4DTKA 4CKJA 2GCDA 4CFVA 3NUXA 4EH2A 1DI9A 1Z9XA 3FKOA 3PXZA 3VW8A 3CTJA 4C58A 5LVPA 5IQDA 2QOCA 3LAUA 2B9FA 2Y6OA 4OTWA 2ITQA 4ZSJA 2HZ4A 5M55A 5C4KA 4DCAA 4HJOA 3CQUA 5KZ0A 1RE8A 4OBOA 2YM3A 4RG0A 4BDAA 1RDQE 5CAUA 4U45A 4F0IA 4DH7A 4I5MA 4IM3A 2DYLA 4QMLA 5AV3A 3RM7A 4RBLA 4UN0C 4U42A 4ZY5A 4NL0A 2NNWB 3OXIA 4IB5A 4JDKA 3S4QA 4D4RA 4R7HA 3ZLYA 3MA3A 3CJGA 3V04A 4YR8A 2RGPA 2P3GX 2WTIA 3W2PA 1O6YA 3AT2A 4IJ9A 5HVYA 5HTCA 4IC8A 3HAVA 4CCBA 1WBSA 2B54A 4FEVA 3JR1A 3LFCA 4ZTSA 4U3ZA 4PWNA 3ORMA 3Q60A 5HIBA 3ZO2A 4FSWA 4FOBA 3FZTA 3CKWA 4QP8A 5CX9A 1OUYA 4P7EA 4X3FC 1ERKA 3WYXA 1WBVA 4FV2A 2ZB0A 2BUJA 5CF8A 3JVRA 4WO5A 4XLVA 2PE0A 3F2RA 5J7BA 2C5NA 1DS5A 1DI8A 4OW8A 4ANOA 4DBXA 5AP7A 4RLLA 3OZ6A 1S9IA 5L2WA 3QF9A 3WF5A 3G5DA 1NW1A 2CNVA 4KIQA 2OJIA 4ANMA 5CSPA 2BTSA 3OBGA 4I22A 4AA0A 5FXQA 5IA1A 1ZAOA 4CG8A 3DBDA 2X8IA 1ZARA 2J0MB 4F1TA 2O2UA 3IDBA 5H2UA 4ID7A 1WVYA 2VO0A 2IJMA 4RX5A 5KUPA 1KOBA 1OL6A 4KKHA 4AXAA 5IQEA 1OZ1A 3KRXA 1CKJA 3EQRA 5A14A 4OTGA 3AC1A 2J5FA 1Z57A 4AGWA 5IEVA 2Z8CA 3OHTA 4MNEB 3T9TA 4PMSA 4M12A 5EK7A 4DEDA 3OOMA 5CEOA 4BTFA 3GB2A 3VS5A 3E3PA 4NU1A 3PLSA 3DU8A 3MVLA 3R7YA 4BL1A 4HVSA 4H3QA 3KEXA 5FRIA 3DJ6A 3EN4A 5ANGA 5AX9A 4C61A 1XBCA 3COHA 3GBZA 3LW0A 4DGMA 1KWPA 3QTUA 3VS7A 3T3VA 3P5KA 4U43A 2R3KA 5DVRA 2J0KA 3V5TA 4FTQA 4AW0A 2WEIA 3HRFA 4PL3A 3BLHA 2Q0NA 4ALVA 3QXPA 2CSNA 2FVDA 3NUNA 5CQWA 2VUWA 5E8ZA 4D1SA 3I6WA 3V8TA 3V5WA 4E6DA 3DK7A 3QRIA 2JDVA 4QNAA 3FMJA 2XH5A 5IQFA 5JFSA 1PXIA 1E9HA 4Y72A 3RK9A 3VJNA 4WUNA 5DRBA 3MIAA 4E73A 4EOOA 1O9UA 3COMA 4MD9E 5H3QA 3L8SA 4GIIA 4G17A 3QQJA 3ENHA 2G2IA 2O5KA 3DGKA 3DDPA 3Q2MA 2GNIA 4DFXE 4JQ8A 5CXZA 5J87A 4ASDA 3S00A 4WG4A 2PY3A 4NCTC 1J7UA 4JBVA 3R63A 2W96B 3PA5A 4D0XA 2G2FA 2IPXA 4FT9A 5AR7A 2GHLA 4I6FA 4F63A 5LMAA 3FXXA 5IG1A 3HKOA 4MKCA 4XG2A 3A8WA 3OT8A 4AFJA 2AC5A 2E9VA 2VN9A 3D7TA 2GS6A 3ZC6A 5LMKA 3GU8A 4I4EA 5GZ8A 4XG4A 2BRBA 4IXPA 3SLSA 2JDRA 5KZIA 4DEGA 4LRJA 4EH4A 4CZUA 3QCQA 3VS3A 3OT3A 4YSJA 4CT1A 5HHWA 3K3JA 5CAOA 3AD4A 5M53A 4RVTA 4IJPA 2X39A 3MH2A 3BYVA 3ZM9A 5DEYA 1FMOE 4RJ8A 2NPQA 5H8GA 2P2IA 2UW7A 3IONA 3IS5A 1Y8YA 1M2QA 3IG7A 2H34A 4YTFA 5JEBA 2WMBA 2QOIA 3NNUA 4M8TA 5F95A 3KKVA 1KOAA 3KU2A 4AWIA 4FA2A 1H1PA 3FL4A 1IAJA 1PF8A 2YJSA 4EQUA 3VBYA 1H0WA 3VNTA 4CNHA 5HLPA 5A6NA 4HCTA 2WD1A 5CSHA 3QYZA 2CMWA 3FLWA 4XG6A 4YLKA 3QWJA 3NVKI 3KF7A 4FUYA 5CVGA 1XHAA 2P33A 3ZUTA 2QOOA 3PXKA 3UIUA 3V6RA 4C35A 3ENMA 4D55A 4IANA 4LRKA 4KS8A 2E9PA 3FV8A 3IQ7A 1PHKA 2PZ5A 4QMOA 5LVLA 2Y0AA 1E1XA 1URWA 3FLYA 5L2IA 2WTVA 1RQQA 4GU6A 5J8IA 3QLFA 1H0VA 2QR7A 4GYGA 3ZDUA 4DGLC 3DBQA 1KE9A 4UV0A 4E20A 3NGAA 4UX9A 3TDWA 4YHJA 4EZ3A 2ZDTA 4N57A 4GT3A 3GU6A 4H36A 3ZU7A 4U41A 4ZZNA 3EL7A 4FIHA 1JSVA 3LFDA 3ROCA 3MH1A 3E62A 1ZOHA 3R7EA 5E4HA 2OW3A 5ETAA 3G0EA 4IWOA 4JS8A 3V8SA 4EK6A 3F5PA 3L8XA 3UVQA 3EKNA 2C5XA 3QC9A 4DHFA 4XP2A 2I0EA 4YNOA 4NKSA 2OJ9A 1M14A 4S33A 4UWBA 1JKSA 2JDOA 3KREA 3UNJA 5ANIA 5FTOA 2OSCA 2WMXA 4UALA 2LAVA 4XCUA 3ZMMA 4ANNA 4MCVA 4O96A 4YP8A 2CNQA 3R9HA 4HVHA 3A99A 4DH8A 1F0QA 2JD5A 2C6OA 1K9AA 2ZMCA 2GHGA 3ULIA 3VS0A 3B2TA 5AV4A 3PRIA 2HW7A 3ZOSA 4BTMA 1ND4A 4R77A 2A0CX 2JAVA 3PSDA 5A9UA 3NUUA 1J7IA 2B1PA 2BHHA 3U6JA 1OECA 5A4EA 5A6OA 3ALOA 3HV6A 4O1PA 3NMUF 4HVGA 4N70A 4DEBA 3OG7A 2VV9A 2PMIA 3GCPA 2WMAA 4HYSA 3NW5A 5HVKA 5GJFA 4AUAA 4OR5A 4BCOA 2UZVA 5JK3A 3HDMA 1OB3A 4YTHA 4EOIA 4WNOA 1Q99A 3TKUA 3OC1A 3QL8A 3RZFA 4RVMA
chains in the Genus database with same CATH superfamily
3TN8A 2WFYA 4IAZA 2P0CA 2WMQA 1DAYA 3GOPA 3DQWA 2QO9A 3DK6A 2C6LA 3VUTA 1ZYLA 5L6WL 5KMKA 3OCBA 1M7QA 1OGUA 3QWKA 3FXZA 2C6IA 4CQEA 2YM5A 5AUYA 2OIDA 1DM2A 3AC5A 3Q04A 5J1WA 3MGYA 4FT7A 3I7CA 3RNYA 4DFBA 3EQPA 4MX9A 4V05A 3QHWA 4FKVA 1U5QA 2J2IB 3OWPA 2PPQA 4G9RA 4MUQA 3D5UA 3A8XA 3BQRA 3ORKA 3OUKA 4ZLOA 4O91A 2I40A 4G34A 1OVEA 4WUAA 2YA9A 5EG3A 2PTKA 4UMUA 4B8MA 1UA2A 3VONA 1OM1A 2VGOA 4V04A 4YPDA 2X6EA 4C4GA 3N4TA 4YJUA 1U54B 3T9IA 4D4SA 1YI3A 3FZPA 2PZPA 2HYYA 3CLYA 3TNHA 2XNBA 1IA8A 4G1WA 4F70A 1GZ8A 4BN1A 4UMPA 3MTLA 3GP0A 4FZDB 5CAQA 4LRMA 2ZFYA 4H05A 1NVRA 1WMKA 2X7FA 3PPKA 4M66A 5CS6A 3TACA 3U4WA 5C4LA 3GUBA 3FC2A 4V0GA 3GQLA 4R7IA 4ACCA 3GVUA 3LXNA 4LV7A 4NT4A 1RW8A 5IMXA 3FZOA 2IW8A 4GUBA 3IECA 3HMNA 4YU2A 3R83A 3CR0A 3UDZA 1PXNA 4I6LA 4WG5A 3W2RA 1FVTA 3OD6X 3LCTA 2VNYA 3Q5IA 4CYIA 3V5LA 1H00A 3CC6A 3W0OA 4CEGA 5HNBA 2Y7JA 4XP0A 5EM5A 4K0YA 1PXPA 2JBOA 2QKRA 2YIRA 4KBCA 1G8KA 1CSNA 3IW7A 3R00A 5B2KA 4NH1A 1ZY5A 4D2WA 2CN5A 3EN6A 5C26A 3HUBA 3UBDA 4EHGA 4KINA 2R3OA 3I60A 5IEXA 4RJ4A 5KBRA 2PVMA 2ERKA 2WOTA 3VWAA 4W4YA 3ZDIA 3Q6UA 3QUDA 4IVBA 4ASZA 1R78A 4WD5A 2QLQA 5AR5A 4U9AA 3MFUA 4MXYA 2I0VA 4NEUA 2OKRA 3TV4A 1IAHA 5J5SA 4AAYA 3PLAE 2VD5A 3KC3A 4HYUA 4AS0A 2XA4A 4RVLA 2BRNA 4BICA 3WZDA 1BMKA 4DE4A 1VJYA 3GXLA 1IR3A 4O81A 4EWQA 3O8PA 4BBMA 5ACKA 3QD3A 5AIRA 5AMNA 2F7ZE 3UP2A 5EDRA 4DFYA 3IDCA 4B8LA 1GAGA 2WQOA 3BV3A 4JIAA 3REPA 1WAKA 4QNYA 4FX3A 4FYNA 2H6DA 4BB4A 3O51A 4O7TA 2YZAA 5GZAA 3RHXA 5EI2A 3NUAA 4NM7A 2VGPA 3TNPC 3DY7A 4FV9A 1BL6A 5F4NA 4ZY4A 4DDGA 4G5PA 1FPUA 4A9YA 3BELA 4KS7A 2JDSA 2RL5A 1SVGA 2W1CA 3SKCA 4BFMA 4LGGA 4DG2E 2OH0E 2BAKA 3PYYA 3TIYA 2NRUA 2CHLA 1W83A 3Q6WA 1NVQA 4FIEA 2VX1A 4GK2A 4J8NA 4KIKA 3ZSIA 3OTUA 4L3LA 3SDJA 4MNFA 4FV1A 3QD2B 4F9AA 3RBWA 5HESA 4YUQA 4WOVA 4L6QA 4G3CA 1OPJA 3ORPA 5K4IA 3DQXA 1Q97A 4LI5A 4MBIA 2XS0A 4FTIA 3SV0A 4P90A 3GCUA 4QMWA 3D5WA 4FRFA 2VTQA 4MWHA 4KBAA 2CGWA 4ITIA 4C4EA 4WG3A 5AP1A 2C5OA 1ZYCA 4IAKA 1J91A 4L3JA 5M56A 1FINA 3A7FA 3FMMA 3S0OA 5CXHA 2BHEA 2W99B 3ZH8A 3OMVA 4ITJA 5BVNA 2ZOQA 4OTPA 4LGHA 1W7HA 4BYIA 4C3FA 4MWIA 3QQUA 2XNOA 4L44A 4EJNA 4UYAA 4XEYA 5HCZA 3DB6A 1OL1A 1OKZA 2B4SB 3RAKA 3LKMA 4U97A 5FP5A 5LMKC 2HY0A 4XOYA 5LJJA 1JLUE 4LUEA 3QA0A 4FTOA 3DA6A 1WBTA 2AQXA 2R3FA 4OTHA 2BRGA 2ZB1A 1QPJA 4FT5A 4CTCA 2EXCX 4X2NA 1KV2A 1Q62A 2QR8A 2ZV9A 4QMYA 3TNWA 3AT3A 5FG8A 5HO8A 2XM8A 2X0PA 5JH6A 2ITWA 3AC4A 3HDNA 4O0SA 2JKOA 4O7VA 4YGAA 3FEGA 1W98A 3NVMB 5AFVA 3D7ZA 3PJ8A 4Y73A 3D2KA 4V0GB 4TYJA 5DT0A 2VO6A 2UW8A 3BYUA 4DF3A 2ITZA 2PHKA 3DKCA 4YO6A 3AQVA 3GFWA 2R3NA 4ARKA 4M0ZA 4KB8A 2XZSA 4I0TA 4QP1A 1BI7A 5IH6A 2QKWB 4FKOA 3EFLA 3NZ0A 4L46A 3IK3A 4ZLZA 4FL3A 2QVSE 5JQ8A 4QMQA 1Y6BA 1M2RA 5AP4A 3EYHA 4IC7A 4TTHB 5K0KA 3TMOA 2YDIA 3H9RA 4O4DA 4ZK5A 4G3DA 4R1YA 2WEVA 4LOOA 2XNGA 4C4FA 2WMWA 2BZHB 2VTMA 3CGOA 3DAEA 3SG8A 5AUUA 4F78A 4IFCA 5LQFA 4FOCA 3R71A 4QTEA 3COIA 2YWVA 2C5YA 2WIHA 2XJ1A 3PXQA 3PIXA 1W82A 4ZS0A 4WIHA 4FTRA 2R2PA 2YWPA 3MVHA 1WZYA 4IE9A 3PP1A 4AOTA 4D9UA 3G33A 4ERWA 4FIIA 1AQ1A 5HE2A 3UJGA 4FNYA 1UWJA 2XIRA 3DBEA 2VTSA 5AA9A 4L43A 4RWIA 1LEZA 1APME 2A1AB 3BE9A 3H9FA 4F99A 5ANJA 3VN9A 4G9CA 4PMMA 5HO7A 3MH0A 2Y4PA 3LJ2A 3O2MA 3Q4UA 3QGYA 1UVRA 2XEZA 2ZMDA 3OCSA 4Q9SA 2SRCA 3OY3A 4O22A 4F6UA 4ZMEA 2WQEA 1TQIA 1VYWA 2WGJA 3KRWA 4NCTA 1A48A 1UNLA 5A54A 5DIAA 2BKKA 2BZIB 4WBBB 3FMNA 3EH9A 5M57A 3NFFB 4PY1A 3AKKA 2UVXA 2VZ6A 1XBBA 1Y6AA 3R30A 4I21A 2HCKA 4HVDA 4YMJA 5M44A 2YABA 4ZTQA 3E5AA 4QYHA 2GU8A 2RFNA 3Q9YA 2B7AA 4L3PA 3E7OA 5HQ0A 5JGBA 2WTKB 4PPBA 3TDVA 1URCA 2VTTA 3DTWA 4BDIA 2BROA 2ITNA 3LJ1A 4PP7A 1JSUA 1OKYA 3QTSA 5CAVA 1WFCA 2VX0A 1FVRA 3F61A 4RC4A 5I9UA 4AZVA 2RG6A 2E9NA 4CMOA 3QFVA 4W9XA 4FMQA 4EHEA 4QYGA 2F4JA 1ZOGA 3I0QA 4IMYA 1VZOA 4M7IA 4DGGA 4N4SA 1ZYDA 5CEIA 3CTHA 1J7LA 2C6KA 5IMEA 3BYOA 4U79A 4O4CA 4OTIA 3GC9A 3C1XA 4M67A 4TWCA 2BZKB 5L2TA 3R7OA 3LQ8A 5BYLA 3PJCA 5CSXA 2VTAA 4J95A 5DEWA 4HZSA 1XJDA 3K54A 4E5BA 3LQ3A 4DINA 4A9SA 4ITHA 2JEDA 2VTJA 3D0EA 3TJCA 4UB7A 4ALUA 4J98A 4QP4A 3ID6C 4D2PA 1JVPP 5AIKA 4C36A 2PU8A 3ANRA 4FTKA 1TKIA 4I5HA 4IWQA 2R3LA 4MYGA 4QO9A 5CI6A 5AP2A 4ACGA 3IW8A 3FPQA 3OXZA 5JRQA 2LGCA 2UZEA 3CKXA 3D2IA 3E92A 3LMGA 3ROYA 3FZRA 5AV0A 1KE5A 3I6UA 1OBGA 2AEGA 2YCSA 5J1VA 2YIYA 4QYYA 3QCYA 2BZJA 2UZWE 2YAKA 4I20A 4F7JA 3IGGA 4MHAA 1WBWA 3OF0A 4IB3A 4K2RA 4QYEA 2XRWA 2YIQA 4EKKA 4EOQA 1UU7A 2PZYA 5FBNC 4EHZA 2J90A 3NX8A 4JAIA 4XG3A 1OI9A 1V0PA 2ETRA 3BKBA 5K3YA 3VS4A 1IA9A 4GH2A 4FSUA 3CS9A 5E91A 4OTRA 4G3EA 3U6HA 4UMRA 4GIHA 3R8MA 4EK8A 4JR7A 4AW5A 5IF1A 2W1IA 4Q2AA 2PVJA 3C0IA 3PG3A 2JKMA 4GCJA 3P23A 4O21A 5EW3A 2VTIA 4RGJA 3RTPA 4CMUA 3EQHA 3MPAA 4MNEA 4J7BA 3WZJA 4DHJA 1IG1A 4PRJA 4JG8A 5DT3A 5ETFA 1SZMA 3ZRLA 4FR4A 5BVWA 3TUDA 3W8LA 4KWPA 3NAXA 3ZS5A 4U81A 5F20A 2GQSA 2PUNA 5I9ZA 3GOKA 4GUEA 4NTSA 5BV3A 2V7AA 3KF4A 2PVHA 3W16A 3QQGA 5K5XA 4CZYB 2VNWA 3ZFXA 5AWMA 2VWYA 3RALA 3WF6A 4CKIA 1GNGA 1YHVA 1UU8A 4C57A 2GNFA 3MJ2A 5K0XA 1B39A 3S2PA 5BVEA 5I9WA 2QHNA 3KRRA 4C2VA 3KGAA 1XH9A 3H0ZA 2OXDA 2ZJWA 3FZ1A 3GC7A 3IOKA 3Q3BA 3FQEA 5EHOA 4GG7A 5F1ZA 4D28A 5IPJA 4XBUA 2CGUA 3PIZA 3D4QA 3HRBA 3AKJA 3OCGA 5EW8A 3WOWA 4PQNA 2F9GA 5BYZA 3PXRA 4FKTA 3ORTA 3VBXA 4E6QA 4IX4A 3MY1A 4JL9A 5ANKA 4FKQA 4GS6A 3H3CA 3MJ1A 4O0WA 3Q4ZA 3U8WA 3RWQA 3KCKA 3N51A 3WBLA 4BDBA 4IFGA 4A4XA 5LOHA 2QU6A 3Q4CA 2GQRA 2IW9A 5HX6A 4BBFA 1ST0A 4DG0E 2W4KA 4CRSA 5JQ5A 3BU5A 4BGGA 4EJ7A 3ZO4A 3ZHPC 4R6VA 3ZBFA 2WTKC 4DITA 2QOLA 2WO6A 3ODZX 3UP7A 1XMMA 4JRNA 3G6HA 2WQBA 4W8EA 4G5JA 1XMLA 4K9YA 5B0XA 3OROA 4O7WA 4FIJA 5B7VA 2YN8A 5A4CA 3RWPA 2PE1A 5D11A 3QZIA 1JPAA 3DZQA 2YERA 4FZFB 3MA6A 4S30A 1H8FA 5EYKA 3UOKA 5GINE 2UZBA 5L2SA 4FVQA 3NUSA 4GU9A 1PMUA 2XK7A 4RWLA 4CFNA 2F7XE 5E7RA 2JIUA 3C5IA 4HGLA 3EFWA 2YM6A 5L8JA 3W0MA 4EK4A 4JLCA 2XKDA 3KMMA 4PF4A 4W4WA 5D41A 5AP5A 2C6TA 2IVSA 4CV8A 4M69B 3ZLWA 3FJQE 2VTRA 4LM5A 4TWOA 4IZAA 4ASXA 4QMNA 3RPSA 3SC1A 4GK4A 2R5TA 2E2BA 2ITVA 3LOKA 4ZXTA 4I41A 3E63A 4GFMA 4FGBA 3R0TA 4UYNA 1IRKA 3MVMA 4FZ6A 5I5ZA 2XK4A 5HG7A 3C4FA 5LWMA 5J9ZA 3WI6A 3W0NA 4QD6A 4O7LA 2A27A 5EQEA 5HCXA 4WA9A 3KA0A 3W8QA 4BWKA 1G3NA 3Q96A 4F09A 2X0QA 4ZLYA 4QEBA 3EQGA 2G15A 1SVHA 4GMYA 2XAOA 3RGFA 3DLSA 4H58A 4FODA 3RK5A 4ANBA 3P1AA 3BU3A 3TZ7A 3UO4A 4E6AA 4I1ZA 3LE6A 1WBNA 2R3JA 4F6SA 3O7LD 4EYMA 3AMBA 2F2UA 3LZBA 3MY0A 3LM5A 5HG5A 5JGAA 5LMBA 5HO6A 3UQGA 2BALA 4LL5A 4QQCA 3R8PA 4EZ5A 1XKKA 2XRUA 3L8VA 5BVKA 3FLQA 4NSTA 5DWRA 4OT5A 4RQVA 4NTTA 3W55A 3R1YA 4AT3A 2JITA 3MPMA 5DA3A 3KK9A 2VWWA 4IX3A 1ZZ2A 3F7WA 2A2AA 3LFFA 1F5QA 4BYJA 5CZIA 2EVAA 3H4JA 3VF9A 3TWJA 1YWNA 1SNXA 2UW6A 4PMTA 4U3YA 5CT0A 3ZEWA 5BX0A 4F6WA 3UMXA 4PDYA 2YIWA 4DFNA 5DNRA 2B52A 5D10A 2OIBA 4GKHA 2W05A 4JDHA 2E9UA 3BGPA 3NYVA 4ACMA 2BKZA 3K5UA 3DK3A 4YZMA 5HNIX 2YCFA 2GSFA 2UZDA 5CEMA 3QALE 3AKLA 5CANA 4BTKA 3UVPA 5HI2A 4IVCA 4D1XA 5EKOA 5GIPE 1OIQA 2XIYA 5CU6A 5F94A 4PL5A 5FTGA 4BCMA 4DHIB 3TJDA 3P5JC 2FB8A 2J51A 4JX7A 4F7SA 4YPSA 3VS2A 5IUGA 3EOCA 1UKIA 3VUIA 3BHUA 3II5A 5CNOA 4FBXA 3CPBA 3TNQB 4A9RA 5DN3A 3BHHA 3FHRA 4NW5A 2OXYA 5FTQA 2BFXA 2WMVA 3FQSA 4EI4A 1O6KA 3CIKA 3QRJA 2XIKA 3QZFA 2X7GA 4ZJIA 5IEYA 3R7UA 2W5HA 1JOWB 3OFMA 5HX8A 3O8TA 2W06A 3PJ2A 5TO8A 3G9NA 5HNGA 4GVJA 1IEPA 4QRCA 2XNEA 1E1VA 2XANA 1FBNA 5C9CA 4OAVB 4WNMA 3RPVA 4XUFA 2VWXA 3DXQA 2FH9A 3KULA 3LVPA 4MD8E 3HECA 4QYFA 4YZCA 4BF2A 1V1KA 1B38A 1U54A 4I24A 2G1TA 3L8PA 3IW5A 5BVDA 2PWLA 2O64A 4MF0A 2BDWA 3EYGA 3PWDA 3WZEA 3BYMA 4OUCA 5I9YA 3H30A 3PFQA 5EDPA 2YLEA 3KXGA 4S32A 3PG1A 5CU3A 3VVHA 4I0SA 4EH8A 2QODA 4BKZA 3DCVA 4FTMA 4RLKA 2VO3A 3V5QA 4E93A 2EXMA 1M52A 4IAIA 4QMPA 2PUPA 3ATSA 1ZYJA 4FTNA 4IX6A 3CE3A 4RA5A 2DUVA 4XBRA 5AP0A 5IA3A 2WHBA 2CGXA 2OU7A 3NSZA 4EBWA 4JDIA 2W1EA 4NJDA 4Z3VA 3EZRA 4OT6A 1KE8A 3FYJX 3UC3A 2OIQA 1H1WA 3R04A 3FQHA 1V0BA 4B9DA 4W4XA 4F9YA 3DAKA 3ATTA 3HL7A 4CYJA 2GNJA 4MXZA 3CSVA 3ACJA 5AR8A 1P2AA 3LXLA 1OL5A 4L52A 1H4LA 5DR9A 3KCFA 5IDNA 3RZBA 1CTPE 3BL9A 5CSVA 2VTNA 3EIDA 2YM8A 3BEAA 5E9EA 1ZYSA 3AC3A 4Y95A 4PTEA 5DR6A 2CCIA 2JAMA 4NFMA 4O4EA 2XNNA 3OY1A 4ANSA 2ITXA 4BZDA 3HMIA 1YQJA 3FLZA 4ACDA 5JFWA 5CF4A 3BPRA 4U7ZA 5FWKK 1YI6A 5HE0A 3L9MA 3WZKA 1V0OA 5FEQA 3UPXA 5JT2A 3CTQA 3HRCA 4G31A 3ZO3A 5EDQA 3AC8A 3FLSA 1M2PA 4ZJJA 1LPUA 4FTUA 1UV5A 2JDTA 2PSQA 4HCUA 5H9BA 4AXFA 3D9VA 4U44A 4AOIA 3A7JA 2X9FA 3UIMA 4BVUA 5KO1A 4TYEA 2RFEA 2ACXA 2UV2A 3VS1A 2OZAA 4PP9A 5FXSA 2W4JA 2HZIA 3F3VA 3MPTA 2XYUA 3W0RA 3FMHA 3JY9A 5IQCA 5GHVA 4UXLA 2NO3A 3P78A 4WBOA 4BZNA 4EL9A 3NNVA 5AX3A 1FQ1B 4CRLA 3LM0A 3DFCB 3E8EA 4JNWA 1JAMA 1SM2A 3UZRA 1XBAA 2XNMA 4ZSEA 4TW9A 4D2RA 2OG8A 3RNIA 4H1MA 4XP3A 2QOBA 1FGKA 5CT7A 2PVKA 2VRXA 2XK3A 3R22A 4I23A 4U80A 2XBJA 4YZNA 3U9CA 4FSYA 3VBWA 5AUTA 1GY3A 2R0IA 3QKKA 5HE1A 3DDQA 3O5AA 4BCJA 4EHVA 1NT2A 4HGTA 1H25A 2C1AA 3FYKX 3NR9A 5AR3A 4WKQA 4DGNA 3O96A 5GZ9A 2OH4A 3B8RA 3C51A 3LLAA 4O86A 4FEWA 2HWOA 2X4FA 4HW7A 2OFVA 4YZ9A 4ZSGA 2J50A 4DEAA 4ZP5A 1I44A 2VX3A 2R3MA 3DKOA 5L8LA 2F49A 4F4PA 1K2PA 1G8SA 5J7HA 3QTQA 4FK3A 3AD6A 3W2CA 2X4ZA 4R3PA 3R8UA 4EQCA 2BIYA 4XMOA 4D4YA 5JRSA 1ZLTA 3F2AA 4YLLA 3SOAA 4EK5A 1CKIA 3PY1A 1Q3WA 1TQMA 3OOGA 3QKLA 2Z7RA 2CLXA 3PSCA 1Q8WA 4EOKA 2YLFA 1Y8GA 4LFIA 5T6KA 4EK3A 3KULB 3A4OX 4FV7A 4EH9A 5IDPA 2ZV8A 2VO7A 3PDTA 4QP9A 4WT6A 4CFWA 1Q41A 3FI4A 3DXPA 4EEVA 3ETAA 3NNWA 2B55A 1PMNA 3QD4A 4X21A 2IZRA 4J52A 4J53A 4ZS4A 3QZHA 4X6QC 3QQFA 2ZM3A 5EKNA 1XWSA 3ZEPA 2UW0A 4XG7A 3F82A 5IA5A 2PZIA 3SW7A 4BDHA 4FV0A 5HTBA 4CLJA 3U4UA 1L3RE 4AZWA 2C3KA 3DTCA 3RMFA 1FMKA 3MH3A 3UG1A 5K5NA 3R9OA 3HMMA 4BRXA 2R7IA 5LVNA 4DTAA 2IZTA 4X2FA 1OIUA 3RHKA 3VC4A 4E5WA 5CEKA 5CZHA 1OL7A 2QURA 3PSBA 1YDTE 4FEUA 3QTZA 4QDVA 3GU7A 4L42A 4O6EA 5JSMA 4L68A 3NUPA 4IEBA 1Q3DA 3KXMA 5E8VA 4IVDA 1GZKA 3MWUA 3NRMA 5CSWA 3KFAA 3CD8A 2PVNA 2C6MA 2VTOA 2R4BA 3G51A 4YJNA 4D2SA 1YWVA 3UOJA 2ONLC 3PRFA 1A9UA 4DDIA 2WB8A 3C50A 4W4VA 4AQKA 2PVLA 1PYEA 2IZUA 2VTLA 4AX8A 5IQHA 3DKGA 2XEYA 4JG6A 4RC2A 5AEPA 3LQ5A 3TM0A 4U0IA 5KMLA 2NP8A 3ZCLA 4Y5HA 4BY9E 1YOMA 3KQ7A 5HG8A 2YEXA 3SD0A 4NW6A 4FF8A 1BYGA 4BBEA 3DB8A 1G5SA 4YO4A 1ZMVA 4QP3A 2OWBA 3V5JA 2Q83A 2J7TA 4FKRA 4NJ3A 4ENYA 4IB1A 5FP6A 4CFXA 3R2YA 4JVGA 2F57A 3R8VA 2CGVA 5DPVA 1MUOA 5M07A 4A7CA 4EOLA 3N4UA 3OWJA 3ZYAA 5KBQA 3E64A 2C0IA 3OP5A 3PVBA 1GIHA 4IZYA 4YHTA 5AM6A 2CKQA 3SRVA 5M4FA 5DFPA 3NCGA 2OZAB 3HVCA 4JI9A 2RF9A 4IACA 5FEEA 3MESA 4FVPA 1P14A 3DT1A 3H9OA 4HYHA 3I5ZA 4FI1A 4M97A 1FOTA 3BLRA 3C4WA 2UZTA 3EB0A 2CKOA 4AZEA 4LOQA 4PPCA 4O0YA 3TEIA 3MDYA 4BDEA 4NZWB 4FZ7A 2I1MA 2WMUA 4M84A 4BCKA 3LMIA 5G6VA 4YJOA 4ZAUA 4LGDA 4DH3A 3HV3A 4A4OA 4TRLA 5BMSA 3E8CA 3MB7A 2PVFA 3MI9A 1KE7A 2O65A 3HGKA 1W2CA 3EN9A 4UZDA 3ZXTA 4E4MA 3CXWA 3DV3A 5CENA 4QTCA 2KTYA 3BIZA 3RJCA 4GV1A 4HOKA 4OGRA 2OICA 4HGEA 4PTCA 3VUHA 3SG9A 5IQBA 1XO2B 4E7WA 4F9BA 3WE8A 2YDJA 3MB6A 2ZM4A 2V0DA 4QMTA 1XH5A 4KSQA 5CTPA 4EH6A 4Y5QA 2QONA 3IOPA 2QO7A 3PFYA 5DE2A 3SOCA 2UUEA 4IDTA 5ETCA 4HYIA 4JBOA 5BUEA 4CT2A 4EC9A 2P2HA 5J9YA 4YLJA 3C7QA 3CEKA 3KXNA 3M42A 1REKA 2UW3A 4IADA 3RINA 5DT4A 2W9ZB 4Z55A 1DAWA 2Y9QA 3FI2A 3GC0A 4CD0A 5T3QA 3FAAA 3R9DA 1KSWA 1OIYA 3K2LA 3VHEA 4TNDA 4BZOA 2JIVA 2REIA 2WELA 2OJFE 4C34A 4D5HA 2W9FB 5M09A 1WVWA 4K33A 3TZ9A 4O0RA 1J3HA 3S95A 4EQMA 4J1RA 3GCSA 2OXXA 2IVTA 2ZM1A 5BQ0A 1YHWA 4UZHA 2I6LA 2QG5A 3VBVA 4AXEA 1ZOEA 1L8TA 2BPMA 3NS9A 4DEHA 1YW2A 2YM4A 4BI1A 2PMNX 4E4XA 3BBTB 3LFSA 3D5XA 3SXRA 1YXSA 4O7SA 3TG1A 2PL0A 3RK7A 4TXCA 4DAWA 4ZSLA 5HCYA 3K3IA 5EI8A 4MXAA 4UEUA 3LCOA 4H3PA 4OLIA 3PP0A 3FMDA 4PDSA 4F64A 4ENXA 1UNHA 1SNUA 1OITA 4A4LA 3FI8A 2V7OA 2ITOA 3VULA 3DBFA 4EC8A 5EYCA 4MXCA 4BWXA 4C37A 5J5TA 3W33A 3F3TA 4R78A 2J9MA 1H27A 3ZO1A 5KE0A 2X8DA 3PTGA 4BIDA 2C69A 2HWPA 4CZTA 3UZPA 4L67A 3CD3A 2XKFA 4TN6A 3LFAA 2ITUA 4ZTRA 2WQMA 3ZZEA 4BGQA 5AP3A 4UY9A 4CCUA 3COKA 5KKRB 3VJOA 1YRPA 5TKDA 2QO2A 2W0JA 5IQGA 3FMEA 3FUPA 2BRMA 4PTGA 5EM6A 5C03A 5KMNA 4LV8A 5M4CA 4IWPA 3KVXA 3U9NA 4GT4A 3ZC5A 3L9LA 4B99A 4RX9A 5J79A 5BNJA 4O0UA 3ZRMA 4BDCA 3UO5A 3THBA 4W8DA 5CU2A 2IG7A 4MQ1A 3MYGA 3PVUA 1U59A 3GFEA 2W1ZA 3E87A 3QYWA 4P5ZA 4YC8A 3QQKA 1JBPE 3JS2A 3DZOA 4JQ7A 3V51A 4KA3A 4DBNA 4I5PA 5LVMA 3SRVB 4YTCA 2GTNA 3NAYA 3LXKA 3OWLA 3SQQA 1WCCA 4RX7A 2FSLX 2VWUA 2CKEA 4OBPA 1W84A 4ALWA 3QCXA 3UNKA 3TI1A 3W0PA 4YC3A 3WF8A 1GJOA 3QHRA 2WTCA 4G3FA 4IZ5A 4PL4A 4FKLA 5EM7A 2V62A 2Y6MA 4MAOA 4NK9A 4YJSA 1GZNA 4EONA 2HOGA 2IO6A 3KXXA 4MBLA 1BX6A 3FLNC 3P9JA 3F5GA 2VTHA 4O38A 3VBQA 3MBLA 2XMYA 4K11A 4U5JA 5LCKA 4FSZA 2CCHA 4BIEA 4I4FA 4EUUA 1RJBA 3I0OA 4CQGA 4PDOA 4N6YA 3N9XA 3AD5A 1R0PA 3HUCA 4GKIA 4MH7A 3F5UA 3BHVA 3I5NA 2YFXA 1H01A 3R9NA 4F7LA 1YXVA 4KNBA 2XALA 3QTRA 2CPKE 3LXPA 3E7VA 3DBCA 4O2ZA 5BPYA 4XV1A 2VTPA 4RVKA 3FXWA 1YXXA 4G16A 3VUGA 5I0BA 4F0FA 2BAQA 3EFJA 4IWDA 5AV2A 3VW6A 4XRJA 5HU3A 3HZTA 1MRVA 5CVFA 4C38A 2XUUA 4EOJA 1I09A 3R21A 4I5CA 5IUHA 3RI1A 3TXOA 3OWKA 2X8EA 4FKGA 2RFDA 3DNEA 4FIGA 5HTIA 4M69A 4RWKA 2WIPA 4BDDA 5L3AA 3TUBA 5IA2A 3C0GA 5IH5A 1BL7A 2V55A 3ZM4A 3I7BA 2XCHA 4OAUC 4BDFA 4WSQA 5EYMA 2WZJA 1OPKA 1UKHA 2YM7A 5HZNA 2WOUA 4KRDA 4FIFA 2Z7QA 4RIXA 3PWYA 3R1SA 4RIWB 2P55A 5AJQA 2OFUA 4FSQA 1XH4A 2XVDA 3E8DA 4RJ3A 4C0TA 5BMMA 3POOA 3OS3A 2G2HA 3F3ZA 4EH3A 4GRBA 5ICPA 4AG8A 2VWVA 3MY5A 1X8BA 4C8BA 5D9HA 3PY0A 3UC4A 2Y8OA 4F7NA 3KRLA 2FUMA 4HCVA 3ZRKA 2YISA 1W2FA 4QMXA 5J95A 4APPA 4Z7HA 3S1HA 4NFNA 3I79A 4RIYA 4XNEA 4AFEA 2WXVA 1BUHA 5C27A 4QMUA 5DOSA 3EKKA 3UE4A 1F3MC 3LFQA 3VUMA 3KMWA 4YURA 2C5VA 5HEZA 3U55A 1PKGA 5HG9A 3TCPA 2GPHA 4FEXA 2XAMA 3VRYA 5TR6A 3FZSA 1WVXA 4ZTLA 5E1EA 2JGZA 4I6HA 4RPVA 4XV3A 3KMUA 2E9OA 2OK1A 3Q9XA 3HNGA 4O0VA 3PVGA