3KF4A

Structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
281
Chain Sequence
SPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title Structural analysis of DFG-in and DFG-out dual Src-Abl inhibitors sharing a common vinyl purine template.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 88
structure length 281
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kf4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kf4A01
3D7ZA 4IX4A 4EK4A 1OITA 2Y4IB 3SKCA 3WARA 3OCGA 2A4LA 4IEBA 4ZLYA 3HLLA 2R0IA 3WF7A 4NEUA 2IJMA 3R9OA 4RJ7A 4FZ7A 4RJ4A 4TPTA 3VS6A 3LMIA 1Q8WA 4GT3A 3LXKA 2PZYA 3PG1A 4GV1A 5IQFA 1U54B 3EQRA 4LQMA 4MKCA 4QP2A 4E4XA 5F9EA 2CGWA 4N6ZA 5KO1A 4BDEA 3P08A 1PW2A 2Y9QA 4B4LA 3GCSA 4U3ZA 4DCEA 5FWKK 2XNGA 3FMNA 1BUHA 3O8UA 3T9TA 3EZVA 5FTOA 3A8XA 4XP3A 4WOVA 3LQ8A 3QCYA 2X9FA 4FNYA 5M4UA 4FTKA 1VR2A 2JEDA 4U3YA 3ZFMA 2W96B 4G9RA 1GZOA 1B39A 2Q0BA 4P4CA 3TJCA 3VS0A 2PUIA 1P2AA 4TYJA 4XG2A 5HE3A 3KRLA 2JD5A 4E1ZA 2YIRA 3G51A 4RFZA 5D10A 4ZY6A 4BTJA 3NYVA 4ASXA 4MXOA 5E1EA 5JMSA 4PPAA 4WUAA 2H96A 3VF8A 3CD8A 4ITHA 2WTWA 5GJFA 4CFMA 2B1PA 5DGZA 4DFXE 1IG1A 3MH1A 2GDOA 2VO7A 2P0CA 3DAKA 3JY9A 3ZYAA 4DEBA 4E5BA 3VULA 2X39A 4JAIA 3GENA 2BMCA 1FPUA 3LQ5A 3PE2A 2XS0A 5C9CA 5DN3A 4F0IA 3DKFA 3DXPA 4WD5A 5I9ZA 3L9PA 5AUYA 4IQ6A 1ZYLA 2XP2A 4Y85A 3NPCA 4U40A 3TN8A 3QRKA 3D5WA 3JXWA 2UZUE 1G8AA 4P5ZA 4EOQA 3D4QA 2VO0A 2HWOA 5M07A 3ZMMA 5JEBA 3LMGA 3GC0A 4WRSA 3C4XA 3RMFA 3KREA 4C4HA 2GNLA 1JKTA 3N51A 4QYYA 2JITA 4M14A 2ONLA 5GZ8A 5KE0A 1FGIA 1CM8A 4NUSA 1JVPP 4D2RA 3ZFYA 4EZ5A 3QUDA 4AN3A 4GVJA 2CNUA 5ANKA 3WF5A 3U4WA 2CDZA 1MQ4A 2QO2A 2RSVA 3NEWA 3PXFA 2Y8OA 4FI1A 4O0YA 3ZSGA 4EH9A 1M17A 3LM5A 2J5FA 3QQHA 2UZEA 1URCA 2VTPA 3COMA 5FXQA 4JR7A 2GNIA 3VVHA 1Z9XA 4YTIA 1FMOE 1M52A 3FLNC 4FSNA 3SG8A 4J8MA 1PXIA 5K9IA 4M66A 4RLLA 3W10A 3QX2A 4EHVA 1NT2A 2QLQA 2EXCX 4ZSAA 5JGBA 3ROYA 2XIRA 2RG6A 2XRUA 2QOKA 3I60A 4Y46A 5DEYA 3CJFA 3BELA 2QR7A 4EOLA 4CVAA 3O2MA 3PJ2A 3AG9A 4C4IA 5CF5A 3WOWA 5D7VA 5AR5A 2BDFA 2CGVA 1H26A 2J0IA 4USEA 4RX7A 5HHWA 5M51A 4FIGA 3BWFA 2ITZA 4A06A 1PY5A 3BE9A 2YCRA 3O7LD 3HL7A 4D4VA 1GNGA 3VC4A 3KKVA 4HYHA 3LM0A 4O21A 5DNRA 5L4QA 2F7XE 2GCDA 3FQEA 3DNEA 4XMOA 4KBAA 2ZV7A 3IOPA 1YVJA 4LRMA 3ZRKA 4O7LA 1M7QA 5C4KA 3QRTA 4DFNA 1FQ1B 4HGSA 4XOYA 3RALA 3DU8A 4FV9A 2XVDA 1H01A 4QP7A 5DFPA 1O9UA 4YJUA 3RWPA 3QTWA 3LAUA 4QP8A 4ALVA 1QL6A 3F5PA 3IGGA 2VO6A 3BLHA 3G9NA 3QXPA 4PP9A 1U5RA 3P1AA 4U97A 4DYMA 2R3QA 4N57A 2W1EA 3VBYA 4CKIA 4FE2A 1R0EA 3SAYA 3MPTA 5HQ0A 3TUBA 4BRXA 3QQJA 3QCQA 3NUSA 4DHFA 2G2FA 4ARKA 2XNNA 3QTUA 3FV8A 2PVNA 5HBHA 3W2RA 4MX9A 3NUXA 1REJA 5LJJA 1Q4LA 4G6NA 4MTAA 1ERKA 4ZAUA 3PLSA 3R1NA 5G1XA 4AA0A 2J4ZA 3KRRA 5A4TA 3I0QA 3KF7A 2UW5A 4EK5A 4O91A 1H27A 2JDOA 3D7TB 3QD3A 3VW8A 1WBVA 2I40A 3RAIA 5CAOA 3KMWA 4BGGA 1CKIA 1PXKA 3L1SA 1CDKA 4RLKA 4X7QA 3R1YA 5EDQA 5GZAA 5CEQA 3RHKA 3ZTXA 4S31A 2WMRA 3G2FA 4QD6A 2UW7A 4R1VA 4BDHA 4C59A 1OPKA 2FVDA 2WTKB 5J5SA 2P3GX 3P9JA 5ANJA 5CS6A 3W2OA 5KMKA 4FC0A 3DLZA 3T8OA 4YTHA 4YZ9A 2ZAZA 4QP9A 4IDVA 4YZNA 4NW6A 1WBTA 3VBWA 2XIZA 4P5QA 1SZMA 4IZAA 1Q8UA 5AUXA 3R7YA 3UYSA 2XK3A 4YC6A 5KKRB 5FUTA 4W8EA 3TXOA 2G1TA 4F99A 2WO6A 5DR9A 4CCUA 3U6IA 4IMYA 2CKPA 3V5TA 3EYHA 4BICA 5C4LA 2ZOQA 4B6LA 4EH6A 5EFQA 4HVIA 1B6CB 1PXNA 3UNZA 2Z8CA 3SX9A 3IDCA 2BHHA 2IW6A 5HG9A 3UOHA 4B7TA 3EFWA 4L44A 3VBTA 3GOKA 4AAAA 1WZYA 4JNWA 5CZIA 4IX3A 2E9PA 4IAFA 3PRFA 4CSVA 5EM6A 4RPVA 4AQCA 3F2RA 2ZV2A 4HGLA 5CT7A 3GFEA 3V6SA 4CG9A 1G5SA 3PJCA 1EH4A 5IA1A 4FYNA 3ZDIA 3IW7A 3DAEA 3UIUA 2YM3A 5IISA 5EQEA 3DPKA 3PVWA 2OJGA 4G5JA 3TKUA 3MFUA 4I3ZA 3ORMA 3R1SA 4BHNA 2Z7RA 1XR1A 4KS8A 1PXOA 3H9FA 4AT5A 4AW1A 2HWPA 2O8YA 4QMVA 4BCHA 4JDKA 4RWKA 2QHMA 1OIRA 4C3FA 4EH8A 1LEZA 3KN6A 1WAKA 3E8DA 3AC1A 5EM7A 4FV6A 5EI2A 4UN0C 3GU8A 4HJOA 3NW6A 4PRJA 1KSWA 3R30A 3ELJA 4U8ZA 3O8PA 1OUKA 4AWIA 2WB8A 3UZTA 1YWRA 5D41A 3WBLA 4AXAA 3FYJX 4EUTA 1ND4A 3EFJA 3F7WA 1VJYA 3ORTA 2FO0A 5DT4A 5HOAA 4CFXA 5HD4A 4FT3A 5HTCA 3FAAA 4ZSGA 3R7GA 2VX3A 3AC5A 3L9MA 4FKTA 4HYSA 3D94A 1PMNA 4M0ZA 4WBBB 3PXYA 3O23A 2ERZE 3OG7A 5AA8A 4O0UA 4DGMA 4YLLA 3SXSA 4I4EA 3WILA 4Y83A 2VRXA 3RPSA 3E3PA 4IAZA 4L3PA 2QKRA 4RZWA 4FF8A 3DK6A 3QLFA 5AR2A 1BX6A 4KIKA 4DT8A 5IA2A 5JN2A 3N4UA 2CN5A 1ATPE 3LXNA 4R5SA 4EI4A 2X81A 5CT0A 5EYDA 4FICA 2VTHA 3LLTA 4K9YA 5CI7A 4NCTC 1OI9A 2UW4A 3KA0A 4JBQA 5I9YA 3B2WA 4YO6A 4OTQA 4EZ7A 4WG3A 5AUUA 3CGOA 3BRBA 3QQKA 4W4WA 5M06A 5A3XA 5I9UA 3TZ8A 4BR3A 1J1BA 1TQIA 3UPXA 4BIDA 2JKMA 5CXZA 5AA9A 5HI2A 2QOLA 3L8VA 4YJSA 3EYGA 5EW9A 5J87A 3CS9A 3DZQA 4Z7GA 1QCFA 1KOAA 1M14A 4BCOA 4EOMA 2VWYA 4FZ6A 4XRLA 4I41A 5AX9A 5L2WA 4R7HA 1RJBA 4O82A 2BIYA 4Y8DA 1W83A 4EHZA 5ICPA 3CQUA 2A1AB 3FI3A 4W4VA 2C3JA 2WGJA 3BZ3A 2VZ6A 5M4FA 5IQIA 4ID7A 3UIXA 1ZOGA 4ZK5A 4M84A 4ZSEA 2VTSA 4KWPA 4P2KA 4F9AA 4KSQA 4BCGA 3PPZA 5IH4A 4RIYA 2BRHA 4OUCA 5BNJA 4XG9A 3FSKA 4ORKA 4O96A 1WCCA 3RKBA 3ERKA 4DEDA 3NUPA 2XNOA 2B52A 4NFMA 2QOOA 4I4FA 3QTRA 4IC7A 4XV9A 2UZNA 4HYIA 4EORA 1A9UA 3BWJA 4ZLOA 4E7WA 3DBDA 3QC4A 4JR3A 5EHOA 4LM5A 2BCJA 3MTFA 4IHPA 4MVFA 4YGAA 4HGEA 3SXRA 3HP2A 3P7CA 5LVNA 1WBPA 5EHLA 3UIBA 4RQVA 4PV0A 5FBNC 3QQFA 2YJSA 4QMQA 4J99A 4EK6A 5DLSA 3R9HA 4PQNA 4ZMEA 3BHHA 4IVDA 2W1DA 3QRJA 4QMYA 5J7BA 2XBJA 1M7NA 4HZRA 4DCAA 3G90X 3PXRA 2BFXA 3PVGA 3GU7A 4UY9A 2C5XA 3LFCA 4R3RA 3NW7A 4GJ3A 3R02A 4J53A 5EDPA 2C3LA 3K2LA 4CFNA 3ZBFA 4FTCA 3AGMA 4NKAA 2HK5A 2A27A 3C7QA 1OL7A 1NVRA 3ZRLA 5T3QA 2UZOA 4O38A 1UA2A 3GU6A 3MGYA 4LRJA 4DFBA 3EKNA 4L3LA 2WIPA 3ENMA 4PX6A 3S2PA 4JDJA 3TIYA 4CXAA 4F7NA 1MP8A 1I44A 2XEZA 4KSPA 2V7AA 4IB0A 2E2BA 5B7VA 3ZXZA 4ACMA 1BI8A 4JJRA 4GT4A 4CKJA 4FKIA 2BAJA 3EN6A 1YXTA 3K5VA 2GPHA 4V01A 1PXPA 3TKIA 3ZBXA 5A4LA 4PPBA 4QQCA 1W7HA 3TZ7A 1YWVA 3HECA 4EHEA 2YM7A 4KIQA 4OGRA 1JKLA 3IW5A 5DBXA 3HEGA 5L2SA 4BDIA 4NM5A 3FBVA 3OF0A 3COHA 5DT3A 2X8IA 2PE2A 2P4IA 2UUEA 4BYJA 4RIOA 3NIEA 2Y7JA 4EZ3A 4YTCA 5IA5A 4JQEA 5IUHA 3OROA 3QL8A 5I9WA 5E8UA 4FKOA 4KKEA 2VTNA 3MH3A 1MRVA 2C5NA 2DS1A 1QPEA 1YDSE 2PUUA 5HG8A 3D2KA 3NWWA 4PTGA 4YNOA 3F5XA 3BV3A 3HKOA 1OB3A 3PPJA 3G6HA 3Q2MA 4KRDA 4H1MA 2BZKB 3KVXA 2BRBA 3DQXA 3DJ5A 3Q9YA 3NUNA 2PTKA 2WZJA 3FMHA 4GCJA 2BKZA 2ZB1A 3MB6A 4D4YA 3A7GA 5IKWA 2B0QA 3T9IA 3UP2A 3G15A 1WVWA 4XUFA 4EH5A 3PG3A 3HRCA 3EQIA 2E9UA 3R7OA 5BYYA 5M4IA 4TL0A 4AGUA 4GUBA 4MK0A 3VBXA 4F63A 3ZFXA 3REPA 2F2CB 4IJPA 3BU3A 2ITUA 2ZYBA 4R77A 4AF3A 3E7OA 3NS9A 4FG8A 4TW9A 5JFWA 5HNIX 3PWDA 4FNZA 2VTAA 4FSTA 5IF1A 3UC3A 4D0XA 4FEWA 3LVPA 3W32A 5LXMA 5EOLA 1NVSA 2HIWA 4ZTRA 3SD0A 2IWIA 4E3CA 4G16A 3DBQA 4ENYA 4BF2A 5FRIA 4U9AA 3S1HA 3C51A 4DGNA 3U4UA 4HW7A 1IEPA 3W2PA 4ERWA 1L8TA 3BEGA 4ZZMA 1J7UA 3RCDA 5C8MA 2OZAB 4FV1A 4AN2A 3A7IA 1SNUA 4ZSJA 4IXPA 3KB7A 4O6EA 4CD0A 4CYIA 5KMNA 3QCSA 3ORPA 3Q9XA 5L6PA 4ZLZA 3RZFA 4O83A 4E6QA 3DB8A 1TQMA 4YC8A 2I0VA 5AMNA 1XO2B 2C3IB 2W4OA 4RFYA 2Y6MA 4YP8A 3E64A 3UC4A 2C0IA 3FMDA 4OTIA 2Y0AA 5CEIA 4BKYA 4ACDA 3EQPA 4FTAA 4UYNA 5CEMA 3C13A 4TNDA 2JAVA 3C4ZA 5KZ0A 4G3GA 3F3ZA 4IAYA 3AC4A 4FV7A 2XIXA 4L43A 4GL9A 4FIEA 3JUHA 3R71A 3IGOA 5HD7A 1WVYA 4AW0A 4QPAA 1GIJA 3KEXA 2ITWA 3GC8A 4JS8A 5GHVA 4PL4A 5DE2A 4KKHA 3ZO2A 4O1OA 3VBQA 2I1MA 4W9XA 3FLWA 3MESA 3F2AA 3F69A 3JY0A 4CQEA 4F0GA 5KCVA 3UQFA 5ANOA 4QP6A 4ZJIA 4CCBA 5L2TA 4YJTA 4FGBA 5LWMA 2OF4A 4NWMA 4K2RA 4FTRA 2I0EA 3ACKA 3VJOA 2WXVA 4CZTA 4D2VA 4JRNA 4II5A 4F65A 4FNWA 4ITJA 5AFVA 4JIAA 4YPDA 4PUZA 5EYMA 4FV4A 4YZMA 4AZFA 4MQ1A 4ZOGA 4FV5A 3V8TA 2PVHA 4AN9A 3ATSA 2JDVA 2E9VA 4XS2A 4BVUA 2ZM4A 1AGWA 3KXZA 3KMMA 4I21A 4AT4A 2VAGA 2A19B 2BRGA 3VUMA 3R28A 3SDJA 4UALA 4MWHA 3VBVA 3NYXA 4UMTA 4EK8A 3HV6A 4E5WA 4DC2A 3FE3A 3DNDA 4E26A 4E4LA 3LFSA 3LW0A 4GU6A 4O2ZA 3E92A 3P7AA 4KIOA 3O0GA 3NMUF 2GQSA 3PY0A 1DAYA 3MVHA 4G3DA 4J7BA 4KIKB 2V62A 3UJGA 2PMIA 4QTAA 3OWPA 4J96A 1O6LA 3C9WA 1G3NA 5HVYA 4LGHA 3IDBA 3QU0A 3TZ9A 4TTHB 4O0TA 3IO7A 4PDOA 1J91A 5C27A 1OL2A 5HO8A 4A9YA 4ONAA 2I0HA 2IVUA 1R78A 4J52A 1UV5A 4Q9ZA 4CV8A 4HNIA 4XLVA 3QA0A 1V1KA 3TTJA 2RL5A 2B4SB 5C26A 4DTAA 3QUEA 4GVAA 4O2PA 4WHZA 4I5CA 3BU6A 5IQAA 2B53A 1FINA 5D11A 4BDDA 2YCSA 3HMNA 5CVGA 2BAKA 3BGZA 4FK3A 1UU3A 3MY1A 2HYYA 3CKXA 4WKQA 1L3RE 4FL2A 4ANBA 4TYIA 2C6KA 4FTTA 2VD5A 3G5DA 5FLFA 4X3FC 4C36A 4BBEA 1QPCA 2C5VA 1FGKA 2VTMA 4RIYB 3Q3BA 3QA8A 3R2BA 2YERA 4AE6A 3KMUA 3EMGA 2J0JA 3ZRMA 3DDQA 4D1SA 4F6UA 4AOIA 3MB7A 3ZHPC 3GQIA 4AOTA 3UPZA 3HAMA 3KC3A 4QMNA 2OXYA 2I0YA 3AT4A 3P0MA 3BLQA 4F9YA 3C4FA 5E8YA 3BGQA 5E8VA 3UTOA 5HO6A 3FXZA 2H6DA 4FK6A 2ETMA 3HX4A 1RQQA 4LUDA 3VWAA 3BBTB 4JL9A 3MIYA 2PSQA 3A2CA 3DA6A 1JOWB 3PXQA 4G6LA 4TKSA 5AX3A 2RFEA 3LJ1A 2F2UA 3MVLA 4CFUA 4GKHA 1R0PA 5K4IA 1XKKA 1SMHA 2HY0A 4LI5A 3Q52A 4HCUA 3C1XA 4IM3A 3DY7A 2J5EA 4XX9A 4UMPA 4YO4A 3UO4A 2XK9A 5CSWA 3T3VA 3R9RA 2XM9A 3RPRA 4FZDB 3N4TA 2PHKA 4LGDA 3V5PA 2C6TA 2XRWA 3KXMA 2BIKB 3U51A 5IA4A 2R3NA 2C1BA 2GU8A 3M1SA 3FHIA 3AT3A 3RZBA 4OBOA 1Q8TA 3HRBA 3QGWA 1SNXA 3O8TA 4JDHA 4PDPA 4V04A 3PZEA 4GU9A 2Y4IC 3VS4A 5J5TA 2W9ZB 3OD6X 4YHFA 5AV0A 3HMMA 5I4NA 4D2TA 5LQFA 5I3OA 4DEHA 4S34A 1K3AA 2IO6A 2W7XA 2RIOA 4OAVB 3O50A 2XKFA 3AC2A 2YCQA 3UG2A 3EQFA 5M4CA 4RG0A 3IPHA 4JT3A 5E8TA 5BVFA 5DPVA 4IWPA 4TN6A 3SHEA 5L2QA 4PL3A 3R8ZA 1Q97A 2PVRA 5ETIA 2XF0A 4BKJA 2R3FA 2W1IA 3MWUA 2GNFA 4LYNA 4ZZNA 4ITIA 1KOBA 3ZO1A 3D5VA 4EH3A 1KUTA 3TWJA 4MHAA 1UKHA 4GJ2A 4G3FA 1YI6A 4NCTA 2NRUA 3ZC6A 3CTJA 5HE0A 4RJ8A 4WSQA 3FQHA 4KABA 3D5UA 3Q53A 3RTPA 4A9UA 2PZ5A 5HCZA 3SOAA 4QMXA 4R3CA 3OY3A 3TEIA 2HCKA 2WMSA 5IEVA 4C62A 2EXEA 1YOMA 2EB2A 4HYUA 5L8KA 2NNWB 2Q0NA 1TVOA 3P7BA 1GZKA 4D0WA 4NM7A 1I09A 3HMIA 3CTHA 3P23A 4CMTA 4UX9A 4DH8A 3UVQA 1OM1A 3GCQA 4C7TA 3CSVA 4N6YA 4U45A 4FUYA 4XOZA 5CZHA 3GQLA 3HVCA 3OWLA 3EQDA 4FOBA 4L01A 2XH5A 5EM8A 3WF9A 4QMLA 3NDMA 4MD7E 3QHRA 4DH5A 3FPQA 2PWLA 4KA3A 3V5LA 4E6AA 3DJ7A 2HAKA 3OHTA 3OOMA 4BKZA 4I92A 3VUTA 2X1NA 3QXOA 1YKRA 2P55A 2XZSA 4I6HA 3DBFA 3DLSA 4IJ9A 4EYMA 3D2IA 3PP0A 5TO8A 3ZLWA 1E1XA 2OK1A 4FTQA 4IE9A 4PTCA 4W8DA 3QTSA 4K18A 1O6KA 3V5QA 5IEYA 4J8NA 2R3LA 1WBWA 1UNHA 4A4OA 3TG1A 4F64A 3C0HA 3P78A 3CY3A 4BWXA 3MPMA 5A14A 3WI6A 2PMNX 4RC3A 5L6WL 1UNLA 2GFSA 4ACHA 1U46A 4CEGA 4HVHA 5GIOE 2QHNA 4LRKA 2PYWA 4RVKA 3FHRA 3LFFA 4S2ZA 3OUNB 2QQ7A 4QQ5A 5JQ8A 3LCSA 3Q9WA 4BBMA 4JQ7A 4ZJJA 4BI1A 5IU2A 4CNHA 4EL9A 4MBJA 5FDXA 3AC8A 4Q5EA 3LFAA 3GB2A 1PXMA 4QMTA 5IUIA 4FV2A 2HZIA 4FKRA 3VQUA 2CCIA 3OOGA 2BZHB 4FTUA 3MYGA 4ERKA 3VO3A 3HGKA 1ZOEA 4BCKA 2G15A 4C4FA 3OW3A 4HVDA 4IAAA 1JSTA 3TI1A 4D9TA 3PSBA 3CGFA 2CNQA 2HY81 5J1WA 4WUNA 2R0UA 4AS0A 3OBJA 4CGAA 4BDCA 3V5WA 1ZMVA 2IZUA 4UV0A 3QRIA 4BGQA 2OH4A 4K0YA 2E9NA 3DK3A 4YNEA 5AM7A 4ANOA 5DI1A 2R64A 4ZZOA 5E8WA 1Y57A 3DCVA 4DH3A 1AQ1A 2G2HA 2YIWA 2O65A 3LCTA 5IA0A 4IB5A 4RJ5A 4PMPA 4CFFA 3IW6A 4I5MA 4AE9A 2WMWA 5KNJA 1IR3A 5EW8A 3SGCA 2PZRA 3HA6A 3TNHA 5A54A 4YZBA 3GI3A 5ANDA 5CY3A 2JC6A 2X8EA 2BAQA 4KS7A 3PTGA 4O27B 3KVWA 3BU5A 4FTOA 3TM0A 1PYXA 2UW6A 2R7IA 2W1CA 1JNKA 3TV7A 4MXXA 2JLDA 4NTTA 4EYJA 1GY3A 2WMTA 4RX9A 3C4WA 4PMMA 3AOXA 2XK4A 4K6ZA 4DBNA 1PJKA 2PVYA 4DG0E 4ZTLA 4FZFB 5HNBA 3WF6A 4GYIA 3HA8A 4O6LA 5H8BA 1URWA 5A6NA 2X8DA 2Z02A 1JPAA 2JGZA 4H1JA 4QMPA 5AUZA 3UVPA 4D4RA 4QYFA 4BFMA 3GVUA 4EEVA 3TTIA 4ASEA 2UW0A 3FUPA 4FIHA 3UODA 3WZEA 2PUPA 4WRGA 4MXZA 4RA4A 3KCFA 4ASDA 5BQ0A 4M69B 5H9BA 2QC6A 4G17A 5C03A 2YAAA 4F7JA 5GJDA 1Q24A 2XMYA 4O1PA 3OFMA 4DAWA 3S95A 4C57A 5K3YA 3PY1A 5HORA 4JBVA 1IAHA 1ZYJA 3LFBA 4I24A 4QYGA 5IEXA 2HW6A 4YPSA 3U87A 1PYEA 3O7LB 4I6FA 4I0TA 3R8UA 2WTDA 4NT4A 3WE4A 3DTCA 1XH8A 4Q9SA 4M13A 5CSXA 4DGLC 2QD9A 2W5BA 1T46A 2YACA 3ZOSA 2JDRA 3QYZA 3R9NA 3DOGA 3DXNA 1Z5MA 5HKMA 5GJGA 4K77A 3VUGA 3PJ8A 2ETRA 4CLJA 5FQDC 5KKRC 4XBUA 1R1WA 4XCUA 4B99A 5LVOA 3V6RA 2VV9A 3A60A 4DGOA 3FI4A 1VYWA 2FYSA 5LCJA 4N0SA 3JYAA 1GOLA 4DTKA 3EOCA 5ETFA 2C69A 3ZXTA 3FY2A 3I6UA 3IDPA 2FSOX 3MH0A 5AR4A 4FV3A 5E8SA 3K54A 2BTSA 4KIPA 5FTGA 5C8KA 2V55A 4BCFA 3IECA 4UZDA 2B9HA 3Q96A 3UMXA 5HX8A 4H36A 2YN8A 4RC4A 3CCNA 3HV5A 2X6DA 2O2UA 2OXDA 1G8SA 2YDJA 4CRSA 1U4DA 2PVKA 2XCKA 5CF8A 1JKSA 2YIQA 3KXXA 4KBCA 5BVDA 5LMBA 2QU6A 4O84A 4ALUA 2O64A 4BTMA 2DWBA 2ITVA 4E93A 1CSNA 2QOFA 5HCXA 1VZOA 3V5JA 1XH7A 2CKEA 1YHSA 3OXZA 3H0YA 3SLSA 4X2NA 4DINA 2DYLA 2BZJA 5EH0A 3QALE 3POOA 2YIXA 4D2WA 3BHYA 3NZ0A 4GS6A 4C4EA 3RPYA 4O7ZA 4RIWA 4X3JA 5TE0A 1IASA 5AV2A 4O81A 3MTLA 4V05A 2WTVA 4C61A 3CE3A 3IW8A 3KK8A 3O51A 4EJ7A 5AP7A 5LMKC 2X4FA 5EKOA 3RK7A 2GMXA 2XIYA 4C2VA 5KHWA 2OJ9A 2J9MA 3TACA 1BKXA 3RCJA 5E8ZA 2QOHA 2IG7A 4PP7A 4PNKA 1UWHA 3EL8A 4LV8A 4ZY5A 4I93A 4NFNA 3Q32A 2WTJA 2WELA 2WOTA 4W4YA 4AU8A 3ORZA 4GW8A 3VUIA 5BX0A 3VIDA 4UMQA 3QBNA 2IN6A 4RWIA 2WMQA 4CYJA 2BKKA 3KN5A 4ZS4A 1B38A 4IIRA 3CTQA 4J1RA 4RRVA 5IQGA 2V0DA 2PL0A 1P5EA 5EOBA 4FG9A 3RPVA 4O0XA 1NVQA 1MRUA 4C33A 4PNIA 2ITTA 1ZOHA 4JG8A 4I94A 5J9LA 3CY2A 4E4MA 4FIIA 2BHEA 4QO9A 4GFOA 5KBQA 2YCFA 1JLUE 1HCKA 4YHJA 4C0TA 3RBWA 4FKSA 2YHVA 5C1QB 5CEOA 4G34A 2WMAA 3BLRA 1CKPA 5JFXA 3ZM4A 2CKQA 4B0GA 3RINA 1ZYSA 3VQHA 4MEDA 2PVJA 2Z7LA 2FA2A 3KL8A 3LCOA 4QMWA 3F5GA 4BI0A 3MW1A 3GOPA 4EOKA 4YSJA 5ANIA 4EH7A 4PDSA 2PUNA 2WAJA 4EQCA 3SVVA 4CMOA 1UU8A 2YM4A 2O5KA 4L7SA 3NGAA 1DS5A 2J7TA 3FXXA 3ORLA 4M7IA 3DFAA 4TYGA 2BDWA 4GFGA 4YBJA 1YI4A 3IKAA 3RI1A 4AX8A 3UQCA 4GIIA 2QVSE 3QTXA 4IC8A 4MXAA 5CU2A 5HZNA 3QD4A 1NXKA 2VWZA 2XYNA 4MXCA 5HVJA 2RG5A 2W1FA 1H1PA 5FXSA 1KV1A 3ZLXA 5BUEA 4L3JA 2EB3A 4S32A 4C3PA 5LVLA 1K2PA 1ZYDA 2XNPA 3BE2A 3QLGA 3W2SA 1VEBA 4DFZE 5L8LA 4O7RA 4WG4A 5IQDA 3ET7A 5AV1A 5HTBA 1XH4A 3W2CA 5L3AA 2H8HA 3QTZA 4X3FA 4FT9A 5KHXA 2WQNA 4FVQA 3FL5A 4M12A 4F1TA 3GNIB 1MRYA 2WU7A 4IANA 4BGHA 3SRVA 2PZPA 5K5NA 3EKKA 3VW6A 1E1VA 3UG1A 3A4OX 5M44A 2OIQA 2QKWB 4W4XA 3FSFA 4ZTHA 4F70A 2H9VA 4GMYA 2F49A 3GU4A 3PWYA 3FI2A 5BVNA 3I7BA 5AADA 4UYAA 5HIBA 5LVPA 3A99A 2ONLC 3W1FA 3WZUA 2GTNA 2IPXA 2P2IA 3DKCA 4WNKA 4OAUC 4N4SA 3UO5A 4KINA 3VS1A 5HIEA 5CTPA 1ZMUA 3EFLA 4Y95A 4HCTA 5J7HA 3KRJA 3TV6A 3EJ1A 3U55A 3KXNA 3QWJA 4AA5A 4O7WA 2Z7QA 4XRJA 2OXXA 4I5HA 4FEUA 4FYOA 4BCIA 3QAME 4D5KA 2Y6OA 3ATTA 4L9IA 1UWJA 4I22A 4JBOA 4BY9E 3CQEA 5E4HA 3F66A 2C6LA 2PK9A 2X7FA 4JG7A 3TCPA 5JQ5A 4UMUA 4TYHA 4D58A 1FBNA 2H34A 3KQ7A 2ITYA 3KF4A 3UIMA 1IAJA 2QI8A 3LFNA 3GGFA 5T6KA 2VTJA 4QTEA 4YMJA 3LPBA 4X6QC 4O0RA 2XIKA 3QC9A 5BVWA 3ZUVA 1OL1A 2JAMA 3F82A 2WOUA 5CU0A 3P79A 3LMHA 3DKGA 3QZHA 3OCTA 4OR5A 2BRMA 2W5HA 4TY1A 3U8WA 4U81A 3A62A 4YLKA 1H00A 3CEKA 4E4NA 2OG8A 3MFRA 5AR8A 1FVRA 2QR8A 3PSCA 4FKJA 4FMQA 4TWNA 2O0UA 3EQBA 3VN9A 3F9NA 1H0VA 3I4BA 4RT7A 4ASZA 4LUEA 1OGUA 4MNEA 4H39A 3HUCA 4I6BA 5CSVA 4IB1A 4YZCA 1BLXA 3VAPA 1YXXA 2PPQA 3OVVA 4KRCA 3UGCA 3ZZEA 4DGGA 3B8RA 5HU3A 2F7EE 3COKA 3BIZA 2FH9A 1OUYA 2RFDA 4A9RA 4FV0A 5J79A 3GCUA 3TUCA 5CSPA 2X6EA 3U54A 2XUUA 1UNGA 2W99B 5FP6A 5KBRA 3R04A 4IZ7A 5FGKA 2CMWA 5IQBA 3RAHA 3KK9A 3ORIA 3UBDA 4MQ2A 4CV9A 5FDPA 4DE4A 1OKYA 3GFWA 5DG5A 4HVSA 4K33A 3TDWA 3HDMA 3HMOA 4QTBA 3WIGA 1E9HA 4E20A 4YURA 1H24A 3WIKA 5I5ZA 4DH7A 4OTWA 2DQ7X 4HOKA 4X6RA 2VN9A 5JKGA 3EZRA 3MS9A 1BI7A 5HE1A 4RC2A 5CXHA 4AZVA 3QD0A 4UMRA 3HV3A 4ENXA 3RGFA 2QONA 2X7OA 5A4QA 5H8GA 4GK4A 1UVRA 2PMOX 3TZMA 3OC1A 2HW7A 5F4NA 4YUQA 1PF8A 2WHBA 4BDBA 2QO7A 3R00A 4DEEA 4DITA 2ACXA 3QTQA 1KE9A 4XEYA 2R3IA 1H07A 2J0LA 2YAKA 4JIKA 3QZFA 4CT1A 3HUBA 3I79A 2ZMDA 3CC6A 2W4KA 4RIXA 4BCPA 4CG8A 2Z60A 4U79A 3PDTA 5T68A 4QRCA 4A4XA 1ZARA 4RQKA 1YDRE 2QOCA 3R6XA 2ERKA 5CSHA 1JWHA 4M67A 2UZVA 3NR9A 4DFLA 3GCPA 3UNKA 4BZNA 5TOZA 3R1QA 3G9LX 3BYMA 2B54A 2EXMA 2OIBA 4YJNA 5HX6A 2JBPA 3C0GA 3IS5A 4F9CA 2C0TA 2G9XA 3BHTA 5E7RA 3FLYA 1A06A 1FOTA 1GJOA 5E90A 2VGOA 3F6XA 4LOQA 3ZZWA 3FWQA 2EU9A 3GT8A 1OIYA 4KD1A 3H3CA 2ESMA 4R78A 4D55A 4NZWB 2KTYA 4NU1A 3A7JA 3NLBA 1Z57A 4XG6A 2WMBA 4FT7A 3DV3A 4J71A 4HCVA 4OTFA 4RVMA 4BCNA 2UV2A 2CCHA 1Y6AA 2UW8A 3FLSA 4BI2A 2J6MA 5LWNA 5JRSA 2GS2A 3A61A 1XQZA 3OT3A 1ZZ2A 2YDKA 3E7VA 4FKQA 3PLAE 3R21A 3TNPC 3F3VA 1GIHA 2VO3A 2YM8A 3GC9A 5CNNA 2R5TA 5FEDA 4ZXTA 1Y6BA 4RBLA 3I1AA 5DWRA 3HYHA 4YU2A 2HZ4A 5IMEA 5FEEA 2W4JA 4BWPA 3K5UA 4CRLA 1SM2A 2A0CX 3FI8A 4DLIA 4F1MA 4I23A 1ZXEA 2W5AA 2BRNA 4FKVA 2YIYA 3FXWA 1CMKE 2RFNA 3LHJA 2UW9A 2YLFA 3RNYA 4RIWB 5F94A 3PIXA 1KE8A 3MJ2A 2V7OA 5AIKA 1WVXA 2J2IB 4PY1A 3R7EA 2BTRA 3JVSA 3CPBA 3U6JA 3EWHA 3E93A 3LCDA 2JKKA 2C0OA 4JLCA 3ALOA 4Y5QA 5AAFA 2IZRA 1P4FA 2ZV9A 4BCMA 4FTMA 1UKIA 1WBOA 1YXSA 2GFCA 4KBKA 5JZNA 1KV2A 1LEWA 2WNTA 3E5AA 3O17A 3QX4A 4L45A 3DFCB 2BDJA 5FM3A 4GRBA 5AJQA 4MD9E 2OU7A 3AD5A 3TNQB 5JRQA 5HBEA 3VUHA 4AW2A 3H9RA 4CMUA 3ZO4A 1DI8A 4BC6A 1AD5A 2W1GA 2ITQA 5AP2A 3CBLA 5TF9A 2NO3A 4FZAB 5EHYA 5HU9A 1Q8YA 4O0WA 5AP6A 4ACGA 2OJFE 3PXZA 4BBFA 3RK5A 3E8EA 4EH2A 4EBVA 4PWNA 5DRBA 5J1VA 4QQTA 2C5OA 5A4EA 1W84A 4UZHA 4TNBA 4WO5A 4EWQA 2VNYA 3KRWA 4XHKB 5JFSA 1OPLA 5AP0A 1ZLTA 3FLQA 4X0MA 4JBPA 4Q2AA 5CASA 5AUVA 4MNFA 4OT6A 4OTRA 3HNGA 2JIVA 4ALWA 5DMZA 4U6RA 2UZWE 3LXPA 3M11A 1P14A 1XBBA 5AP5A 2OICA 1YQJA 4G1WA 5JFVA 5D9HA 5HBJA 2YZAA 4A07A 3JR1A 2BVAA 3TNIA 4G6OA 1H8FA 4MCVA 4RSSA 4EQUA 5D7AA 5IDPA 5IMXA 4RX8A 2HXLA 4EKKA 1JQHA 4CQGA 3GP0A 5IH5A 3MN3A 3PA4A 2OJJA 5M56A 4PPCA 2WMUA 5E1SA 3THBA 4X3FB 4FT0A 2VTQA 4QP4A 1RE8A 4PDYA 4L67A 1YRPA 3SRVB 4WNOA 3PIZA 4XG4A 1V0OA 5AR7A 2ZVAA 1Y91A 4YLJA 1YW2A 3VRYA 4MF1A 2W1ZA 3G33A 5EG3A 4F6SA 3O96A 2B9IA 4IW0A 4PTEA 5AWMA 2UVXA 3COIA 4OTHA 4XV1A 3VF9A 2IVVA 2R3OA 3OWKA 3MV5A 4R7IA 3RVGA 3BHVA 3MFSA 4OTDA 3F3WA 5LARA 1IRKA 2WQMA 3T3UA 4TZRA 4QMOA 2E9OA 1JSUA 2BUJA 2YABA 5IPJA 2OKRA 2X2LA 4L6QA 3VNTA 2FUMA 5J9ZA 1IA9A 4AZEA 4D1XA 2QOBA 4RVLA 4RGJA 4EC8A 1RDQE 3VJNA 1SVEA 2WMVA 3G0EA 4D4SA 3ITZA 3DT1A 4FIJA 3UOLA 5BMSA 4UB7A 4D28A 3CIKA 4NM3A 5DIAA 4Z16A 4LL5A 4XYFA 5A9UA 2PY3A 3BQCA 3LFDA 5F1ZA 2VU3A 4QMZA 1OIQA 2LGCA 4OBQA 3ZCLA 4DEGA 3IG7A 5TR6A 4XV2A 4ANQA 3OEFX 1CKJA 4XG3A 2HELA 3A7HA 4XH6A 3AC3A 3F5UA 3ZM9A 3POZA 5CAPA 4KAOA 2P33A 4J98A 4ANMA 3LCKA 4UBAA 2ZM1A 4RZVA 2AC5A 5CVHA 3B8QA 3U9NA 4BTFA 1OZ1A 1PKDA 3Q4UA 4BN1A 2X9EA 3AT2A 3PVUA 3LLAA 5LMKA 3QF9A 2QURA 4RWJA 2RFSA 5EW3A 5G6VA 5BUJA 3UZRA 5AP3A 3BKBA 4MBLA 2XJ0A 3KCKA 4BIEA 2GS7A 2R3KA 2UZBA 2J51A 2GQGA 2WQBA 3BEAA 4MAOA 4XNEA 1TKIA 3DK7A 4FSZA 4P7EA 5K0XA 3LZBA 5TKDA 4DEIA 1U59A 2ZV8A 3AMYA 3A8WA 4FBXA 3KULA 2JIIA 3SG9A 3LJ2A 2IZSA 2AC3A 2VX0A 2XJ2A 4MNEB 1FVVA 4GKIA 3ZUUA 1QPDA 3F2NA 3NW5A 2I7QA 3GU5A 2ITNA 4AT3A 3K3IA 3R73A 4C8BA 4O7YA 5GNKA 3UDBA 2PMLX 2VWXA 2CN8A 4X2JA 5M55A 3L8SA 4NJ3A 4UWYA 3MY0A 4Y72A 3JVRA 4ZTNA 4DTBA 4B8LA 4IFGA 3FMEA 4O0SA 2PULA 5HLNA 2J50A 2BZIB 5A4CA 4F9WA 4FKWA 5AEPA 4XLIA 3B2TA 3MY5A 4OBPA 1SVGA 2VTRA 3UOKA 4EBWA 5GIPE 4C3RA 4XV3A 1LPUA 3MA6A 3ZSIA 3QCXA 3TV4A 3N4VA 3S4QA 3AQVA 3LOKA 1XHAA 2YJRA 4JAJA 4NM0A 2FGIA 4P90A 5AIRA 5DEWA 1KE7A 3P5KA 2WPAA 5D12A 3TT0A 5IZFA 5IG1A 1W82A 3RPOA 4E73A 4ZTSA 4EUUA 2R9SA 3NVKI 2X2KA 2R3MA 4AZWA 5I9XA 3PJ1A 4HPTE 1MUOA 3MJ1A 5DYJA 4L7FA 3TKHA 4O7NA 4PMSA 4QYEA 5HNGA 3R22A 5EI8A 2GHMA 3A7FA 3OS3A 1WBNA 3ODYX 1F5QA 3HMPA 4EWHA 4V0GA 4C35A 2YFXA 4HVGA 3L8XA 3ZC5A 3CLYA 5CANA 1PRYA 3Q2JA 4ANNA 4RIXB 4OW8A 1O6YA 1W98A 4BL1A 4BHZA 3I7CA 1JKKA 2Z7SA 5M57A 2RGPA 4R3PA 4RJ6A 3BPRA 3PUPA 3VUKA 4BDGA 4J95A 4CZYB 4G31A 2XEYA 4TYEA 1OKVA 2C5YA 4AGDA 5AAEA 5KMJA 4M68A 2YZLA 4L8MA 5HCYA 2XA4A 2HZ0A 5TT7A 1ZAOA 2X0GA 3WYXA 3FJQE 2W9FB 5AV4A 3CXWA 4K1BA 4ZJVA 4TT7A 5IQHA 4TRLA 4GK2A 4BB4A 1YHWA 4M15A 4FKGA 4DEAA 3VS3A 2BR1A 2B9JA 3OT8A 3DZOA 4NSTA 3MI9A 2R4BA 2R7BA 4YJVA 3OCSA 4ACCA 2IVTA 2QCSA 4IAIA 1YHVA 3ZLYA 4OTGA 4QQJA 2WFYA 4IH8A 3FPMA 1KE5A 4M97A 1V0PA 1VYZA 2JFMA 3I5ZA 5EM5A 5GZ9A 1H0WA 4K8AA 1ZY5A 4YHTA 4LOPA 5IDNA 4ZIMA 5JZJA 5BVOA 3V8WA 5CI6A 3M2WA 3U6HA 1IA8A 1LUFA 4UWCA 1PMVA 3FKOA 3R7UA 1M2RA 2J0MB 2REIA 3QKKA 4FKLA 4IX5A 5I3RA 5EQYA 2QG5A 1J3HA 4DFUA 5DOSA 4HNFA 2W17A 4L68A 4U0IA 5CEKA 4DF3A 1DAWA 4EJNA 4IZYA 2I6LA 3ACJA 1OPJA 2CLXA 2FSMX 3HV4A 3QTIA 3GC7A 2W0JA 4I20A 4EHGA 5IH6A 5BYLA 3BI6A 4IWQA 3ULZA 4CZUA 2OH0E 5C8NA 2BILB 3UMWA 2NP8A 4ANLA 5BPYA 4FTJA 4G2FA 2VTIA 5DT0A 3SC1A 5ACKA 3ZONA 3IW4A 4USFA 4I1ZA 4U44A 4OLIA 1Y8GA 1R3CA 1Q5KA 3W18A 3NRMA 4A4LA 3KGAA 3WYYA 3AD6A 4U43A 3S00A 5BMMA 3NNWA 3F7ZA 1ZZLA 3CPCA 4X2GA 5AR3A 3VHKA 4CT2A 4RX5A 2EUFB 2F57A 2Z2WA 4NIFA 3SV0A 3QQUA 4ZS0A 2CSNA 1KE6A 3BHUA 4NH1A 4R5YA 1Q41A 4FEXA 5CU4A 4YTFA 2AYPA 3EH9A 2QOQA 4R8QA 3BGPA 5ETAA 5FP5A 4EONA 4DFYA 3L9NA 2OF2A 1H25A 5F20A 4QMMA 5FG8A 5CAUA 4CLIA 1REKA 4BDAA 2WTIA 5CLPA 2ITOA 2C6MA 2NPQA 2PE0A 4N70A 4Z55A 5DVRA 3KFAA 2YM5A 3L9LA 4XG7A 3QQGA 3JPVA 3GCVA 3O71A 3AGLA 5CALA 2GQRA 3ANQA 2WTKC 1Y8YA 2OO8X 4LL0A 3GEQA 3QWKA 2VTOA 4FOCA 4NW5A 2JKOA 4U42A 4JXFA 3ZEWA 3H9OA 3PZHA 5BVEA 4D1ZA 5DA3A 4C34A 3OP5A 4R7BA 3TIZA 5DR6A 4C4JA 4FTIA 5E9EA 2ITPA 1WFCA 4BWKA 3NYOA 2CJMA 5HESA 3V51A 3WZDA 3ZDUA 2GHGA 3HZTA 2HXQA 3OMVA 4LMUA 4RA5A 4D2SA 3DTWA 2UZTA 4JI9A 3FZPA 1XBAA 2WD1A 4GUEA 2C6OA 3FZTA 5J95A 4O7SA 2WKMA 3D5XA 3OTUA 2LAVA 4YC3A 5GINE 2HOGA 4QT1A 4S30A 1ZRZA 2W06A 1BL7A 4FKPA 3ORKA 4JX3A 3FMKA 3MSSA 2OZAA 3MFTA 5D1JA 5ETCA 3R7IA 4F09A 5KMOA 3OUKA 3QHWA 2QG7A 4WBOA 2CPKE 3DQWA 4B9DA 4F4PA 3FZSA 4L52A 5A46A 2OBJA 5CENA 2VX1A 4DA5A 2J90A 3NCZA 4FSYA 1PXJA 1Q62A 2YISA 3W8QA 3JS2A 4FX3A 3SW7A 1OBGA 2O63A 4YJQA 5CAVA 3UZPA 4C58A 3KRXA 1ZMWA 2XB7A 3OY1A 4IWOA 5HLPA 5B2MA 5CWZA 3PFQA 3BYSA 2BPMA 2PZIA 1NY3A 2EWAA 5JT2A 2V5QA 2XKCA 4RJ3A 4XJ0A 3E87A 1W8CA 3FZ1A 4WT6A 4DN5A 3EHAA 2OFUA 3MVJA 4O0VA 4FT5A 4WA9A 5JGDA 4WG5A 4IBMA 2FSLX 4HPUE 1H4LA 3Q4CA 3WZJA 3VS2A 3SXFA 2QOIA 3DGKA 4RVTA 5AUWA 4WNPA 1HOWA 3W8LA 4BZDA 3A4PA 3FKLA 5CF6A 1Q8ZA 2F4JA 4EH4A 5EK7A 3FC1X 4JQ8A 3ZLSA 5BYZA 2CHLA 5EQPA 4AACA 1Q61A 3OW4A 3ODZX 4TWCA 3DDPA 1JAMA 3H30A 4Y73A 5J8IA 3AXWA 4J97A 4JG6A 3TDVA 1PMEA 2Q83A 3BQRA 2ZM3A 4MH7A 1M2PA 3Q6UA 3C0IA 2R2PA 1PMUA 4S33A 4U41A 2GNJA 2QU5A 4G5PA 5A6OA 5CQUA 3FEGA 3ZO3A 5I0BA 3KULB 3I6WA 3OWJA 4C4GA 3E3BX 3NUYA 3I0OA 3NNVA 4U5JA 2F9GA 2VGPA 2OIDA 4EOOA 1J7LA 3SQQA 1FVTA 2V22A 3FKNA 3OCBA 5H2UA 1LR4A 2BALA 4I0SA 5H3QA 1XWSA 4CFVA 4BCJA 3C5UA 3MH2A 5ITAA 3LE6A 4QTCA 4DT9A 4F1OA 3FMJA 3BBWA 3RP9A 3C4EA 1W0XC 3FC2A 5IQCA 4EOSA 3MA3A 2R3RA 1X8BA 1H08A 3R9DA 5HO7A 2R3HA 1FMKA 2XK7A 3R01A 4KKGA 4BYIA 5EYKA 3VRZA 3H10A 3HV7A 2GHLA 4L42A 4MYGA 2CGXA 2FSTX 4NJDA 1V0BA 3BV2A 4WIHA 3PYYA 4Z7HA 5EKNA 3LJ0A 4G3EA 5IQEA 3D9VA 4GIHA 3M42A 4R1YA 3MVMA 1ZY4A 4EOPA 2VUWA 3Q9ZA 3ZSHA 3DS6A 3PXKA 3OTVA 3HRFA 4EOIA 1YOJA 2C30A 2C47A 3LFEA 4FKUA 3MDYA 5BVKA 5AAGA 3PJ3A 1HCLA 1QPJA 5KZIA 4E5AX 1OKWA 4JDIA 2UVZA 5LMAA 4QTDA 4F6WA 1OL6A 4FNXA 2OFVA 3WF8A 3PP1A 5F95A 3EQGA 4HZSA 4IM0A 3D83A 3E8NA 4H3PA 3RM6A 2IZTA 5HVKA 4GH2A 4IDTA 4V0GB 1GIIA 2VWWA 3EB0A 4JX7A 4X2FA 3Q5ZA 3G6GA 4L53A 4C37A 3R8MA 3IOKA 5FXRA 4DG2E 3H4JA 4UEUA 4QPSA 3V3VA 1LP4A 4ZY4A 2NRYA 4YJRA 3MPAA 5AUTA 3QQLA 1SYKA 2XKEA 4AFJA 1PHKA 4XG8A 3VUDA 5CVFA 5L6OA 4M8TA 3EN4A 4H58A 5LVMA 5AM6A 3CR0A 5ANGA 3OXIA 3E62A 3PA3A 2CGUA 2YLEA 3MBLA 3NYNA 3QRUA 1YWNA 2C68A 2ZMCA 4GT5A 3QZIA 5I9VA 3U9CA 5KX8A 3EN7A 3C4CA 4IACA 4QP3A 4KB8A 3QZGA 3V01A 3ZS5A 4ANSA 5JGAA 3NNUA 2OZOA 5FEQA 5HLWA 2PU8A 2C3KA 4ZEGA 4FODA 2OSCA 3AMBA 3TL8A 3UQGA 2VWUA 3UE4A 4AGCA 1J7IA 4GEOA 2R3GA 3R63A 4LMNA 4DG3E 3I81A 5CU6A 4BDJA 3NUAA 3QKLA 2WQEA 1OECA 2VWVA 1STCE 3P4KA 4AZSA 4GFMA 4ZTMA 1OIUA 3LKMA 4FSMA 3OBGA 3GXLA 3F3UA 3KXHA 3Q4TA 3Q5IA 2UZLA 3FLZA 3OEZA 4AOJA 4IVCA 3D0EA 1TQPA 2YA9A 4A9SA 4FV8A 5B0XA 3LQ3A 4XP0A 3W33A 3ULIA 2UVYA 4FSWA 4FTNA 1H1QA 3GBZA 4YJOA 1ZWSA 5DHJA 1YXUA 3EL7A 1U54A 4IVAA 4JOAA 4RFMA 2CKOA 4YBKA 1U5QA 2C6IA 2GS6A 2PVLA 4XBRA 3KXGA 4E6DA 4F9BA 5CF4A 4RWLA 4LGGA 2JBOA 3AD4A 1SVHA 3V8SA 5EDRA 2Y4PA 3RAWA 2BFYA 3MIAA 2GNGA 3RHXA 3DBCA 4A9TA 4NKSA 2IVSA 1GZNA 4UWBA 3VS5A 3FZRA 4GYGA 1GZ8A 4K11A 5M08A 4AW5A 3PY3A 4I6QA 4IAKA 1XJDA 1BMKA 3NUUA 1OMWA 3CQWA 3EIDA 3Q04A 4U80A 5J9YA 1NW1A 1GAGA 3HDNA 2IW8A 4LG4A 5LOHA 3CP9A 2YWPA 3RWQA 4F7LA 4NIFB 3EN9A 4AA4A 4FGRA 3SA0A 2B55A 5E92A 3TJDA 3IONA 2WTCA 4CTBA 3NVMB 5HG7A 1PKGA 5AV3A 3QGYA 3S0OA 3UYTA 4IWDA 2XNMA 3W55A 4UXQA 4UXLA 3QFVA 4C2WA 1F0QA 2WIHA 1JSVA 3UO6A 1H1SA 5FM2A 4TWPA 3GUBA 5L2IA 1MQBA 2JKQA 3LXLA 2OLCA 5CAQA 4JRVA 4QYHA 3C50A 2B7AA 4F08A 1RW8A 4FG7A 1Q3WA 3LIJA 5B2LA 3WE8A 4EC9A 4Z3VA 3ID6C 4YZDA 4CTCA 3F88A 4BZOA 5K4JA 4C02A 4EK3A 2XYUA 4MF0A 5CQWA 2OW3A 3TNWA 2F7ZE 3ZUTA 1ZYCA 1H1WA 2VTTA 2VNWA 3R8LA 4KNBA 3UVRA 5BUIA 3EN5A 3H0ZA 4RMZA 2XNBA 5HICA 2JIUA 3W16A 4Y5HA 1BYGA 2PE1A 4W9WA 1S9IA 3NNXA 4DH1A 3PPKA 3NIZA 3PSDA 2R3PA 4LOOA 5EYCA 2G01A 1XH5A 4PMTA 5JK3A 4ZMFA 4WNMA 4YR8A 4CKRA 3E63A 5EI6A 5M53A 2QLUA 2PVMA 5CYIA 3KY2A 4F0FA 2CLQA 3FQSA 1CTPE 2YDIA 2ZDTA 3ORXA 5DH3A 3P86A 3RM7A 3AMAA 4DBXA 1UU9A 4GG7A 1PXLA 4FIFA 2ZB0A 3Q60A 3FY0A 4IFCA 5CU3A 4IM2A 4QPMA 5KMIA 2SRCA 3K3JA 4BDKA 4O7TA 3BYUA 4FVPA 2ETKA 4F7SA 5M09A 2WQOA 3SW4A 3NAXA 5B2KA 4AP7A 2PVFA 4KUJA 4Z9LA 4NYEA 1OVEA 2XNEA 4APCA 2ZJWA 4NL0A 3QD2B 2B9FA 4FTLA 4AFEA 4IB3A 3DAJA 4OT5A 3UP7A 2W05A 2OJIA 2XKDA 4EQMA 1BL6A 3BYOA 3CKWA 2EVAA 5DR2A 4EKLA 2P2HA 2A2AA 4M3QA 2HZNA 4ZP5A 1F3MC 2FB8A 3ENHA 4AZTA 2GSFA 2G2IA 3E88A 4G3CA 2DUVA 5FTQA 3WZKA 3ALNA 5K0KA 3ORNA 4X2KA 1R39A 2YITA 2JDSA 4O22A 4GK3A 2GTMA 3CD3A 4EOJA 5IA3A 2IW9A 5HG5A 5C01A 3BYVA 2C1AA 3DKOA 4BCQA 3R2YA 4QMUA 3VHEA 4O7VA 3BCEA 3DXQA 3S3IA 1KWPA 3KU2A 3G0FA 3I5NA 2X2MA 3RNIA 4FR4A 4OTPA 3RJCA 3UNJA 2UW3A 1YOLA 3D14A 4QNAA 2QNJA 3ETAA 3VS7A 2OI4X 4X21A 4ZTQA 1APME 1OKZA 4BTKA 4FUXA 4G9CA 2UZDA 1YDTE 3EQCA 3FL4A 4TXCA 5FBOA 2VTLA 4AG8A 5HTIA 1S9JA 3HP5A 5H8EA 5KMLA 4AUAA 5AP4A 2XJ1A 3FYKX 4B8MA 4I0RA 5AP1A 1JBPE 4Q5HA 1T45A 5K5XA 4BDFA 3R8VA 2OWBA 4R6VA 5FD2A 2KULA 3N9XA 3II5A 3R0TA 3OXTA 4FEVA 2ITXA 2QO9A 3LFQA 4JVGA 3R83A 4E8AA 3D7TA 3NSZA 2RKUA 2C6EA 3IQ7A 4GG5A 4O86A 3NX8A 5KUPA 2XK6A 2XK8A 4H3BA 5DRDA 3BX5A 4GSBA 4MXYA 5CEPA 4M69A 2JDTA 4D2PA 5HGIA 5HEZA 1XBCA 4MD8E 3PE1A 5HIDA 5IUGA 4QOXA 2WEIA 3C5IA 4I5PA 4USDA 3RK9A 3R8PA 1WBSA 4FSUA 3Q6WA 3F61A 3ZH8A 3FDNA 4QP1A 2XBAA 3CJGA 2RF9A 2ZDUA 1UU7A 5ACBC 5CNOA 3R7VA 1A48A 1DM2A 2OGVA 4AGWA 3FZOA 3QUPA 3IK3A 3OZ6A 4TWOA 2J0KA 4CFWA 3EQHA 3Q4ZA 3ZEPA 4D5HA 5JH6A 4FEQA 4ZSLA 2X4ZA 2VWIA 4FSRA 3V04A 2WEVA 3PA5A 3DB6A 2CNVA 3PVBA 5E8XA 2GNHA 3SOCA 3RAKA 3DJ6A 4C38A 2HENA 4YSMA 3HAVA 3FMMA 1YI3A 1Q3DA 4QNYA 3QKMA 5LCKA 4E6CA 2WU6A 4LFIA 2YM6A 4D9UA 1YXVA 1DI9A 2O3PA 3PIYA 4PL5A 2XM8A 4XP2A 1K9AA 2QODA 3FMLA 3DBEA 1QMZA 4M0YA 1M2QA 2VWBA 3EFKA 3QYWA 4H05A 1OL5A 4QMSA 5L8JA 3ANRA 4WSYA 3D15A 4DLJA 4LV5A 1Q99A 4IX6A 2XCHA 3PRIA 2C6DA 5E91A 5JSMA 2R3JA 4FVRA 1J1CA 4NTSA 3TUDA 3UOJA 4U7ZA 2C4GA 4PF4A 4NK9A 4FL1A 3ROCA 4IVBA 3F3TA 4FL3A 4L46A 3NAYA 4L00A 2W1HA 1WMKA 4MWIA 4APPA 2AUHA 1P4OA 5HE2A 1H28A 4A7CA 2X7GA 3ZU7A 5KMMA 2YWVA 4TYHB 1H1RA 3W2QA 3E8CA 2JFLA 4H3QA 4YJPA 1OBDA 2YEXA 5ANEA 3NCGA 4IADA 5CX9A 4IZ5A 4BIBA 1NA7A 4HGTA 2WMXA 4MBIA 4FSQA 4FA2A 2BROA 1XH6A 1XH9A 3L8PA
chains in the Genus database with same CATH superfamily
3D7ZA 4IX4A 4EK4A 1OITA 2Y4IB 3SKCA 3WARA 3OCGA 2A4LA 4IEBA 4ZLYA 3HLLA 2R0IA 3WF7A 4NEUA 2IJMA 3R9OA 4RJ7A 4FZ7A 4RJ4A 4TPTA 3VS6A 3LMIA 1Q8WA 4GT3A 3LXKA 2PZYA 3PG1A 4GV1A 2XANA 2XARA 5IQFA 1U54B 3EQRA 4LQMA 4MKCA 4QP2A 4E4XA 5F9EA 2CGWA 4N6ZA 5KO1A 4BDEA 3P08A 1PW2A 2Y9QA 4B4LA 3GCSA 4U3ZA 4DCEA 5FWKK 2XNGA 3FMNA 1BUHA 3O8UA 3T9TA 3EZVA 5FTOA 3A8XA 4XP3A 4WOVA 3LQ8A 3QCYA 2X9FA 4FNYA 5M4UA 4FTKA 1VR2A 2JEDA 4U3YA 3ZFMA 2W96B 4G9RA 1GZOA 1B39A 2Q0BA 4P4CA 3TJCA 3VS0A 2PUIA 1P2AA 4TYJA 4XG2A 5HE3A 3KRLA 2JD5A 4E1ZA 2YIRA 3G51A 4RFZA 5D10A 4ZY6A 4BTJA 3NYVA 4ASXA 4MXOA 5E1EA 5JMSA 4PPAA 4WUAA 2H96A 3VF8A 3CD8A 4ITHA 2WTWA 5GJFA 4CFMA 2B1PA 5DGZA 4DFXE 1IG1A 3MH1A 2GDOA 2VO7A 2P0CA 3DAKA 3JY9A 3ZYAA 4DEBA 1OGYA 4E5BA 3VULA 2X39A 4JAIA 3GENA 2BMCA 1FPUA 3LQ5A 3PE2A 2XS0A 5C9CA 5DN3A 4F0IA 3DKFA 3DXPA 4WD5A 5I9ZA 3L9PA 5AUYA 4IQ6A 1ZYLA 2XP2A 4Y85A 3NPCA 4U40A 3TN8A 3QRKA 3D5WA 3JXWA 2UZUE 1G8AA 4P5ZA 4EOQA 3D4QA 2VO0A 2HWOA 3PUFC 5M07A 3ZMMA 5JEBA 3LMGA 3GC0A 4WRSA 3C4XA 3RMFA 3KREA 4C4HA 2GNLA 1JKTA 3N51A 4QYYA 2JITA 4M14A 2ONLA 5GZ8A 5KE0A 1FGIA 1CM8A 4NUSA 1JVPP 4D2RA 3ZFYA 4EZ5A 3QUDA 4AN3A 4GVJA 2CNUA 5ANKA 3WF5A 3U4WA 2CDZA 1MQ4A 2QO2A 2RSVA 3NEWA 3PXFA 2Y8OA 4FI1A 4O0YA 3ZSGA 4EH9A 1M17A 3LM5A 2J5FA 3QQHA 2UZEA 1URCA 2VTPA 3COMA 5FXQA 4JR7A 2GNIA 3VVHA 1Z9XA 4YTIA 1FMOE 1M52A 3FLNC 4FSNA 3SG8A 4J8MA 1PXIA 5K9IA 4M66A 4RLLA 3W10A 3QX2A 4EHVA 1NT2A 2QLQA 2EXCX 4ZSAA 5JGBA 3ROYA 2XIRA 2RG6A 2XRUA 2QOKA 3I60A 4Y46A 5DEYA 3CJFA 3BELA 2QR7A 4EOLA 4CVAA 3O2MA 3PJ2A 3AG9A 4C4IA 5CF5A 3WOWA 5D7VA 5AR5A 2BDFA 2CGVA 1H26A 2J0IA 4USEA 4RX7A 5HHWA 5M51A 4FIGA 3BWFA 2ITZA 3W0QA 4A06A 1PY5A 3BE9A 2YCRA 3O7LD 3HL7A 4D4VA 1GNGA 3VC4A 3KKVA 4HYHA 3LM0A 4O21A 5DNRA 5L4QA 2F7XE 2GCDA 3FQEA 3DNEA 4XMOA 4KBAA 2ZV7A 3IOPA 1YVJA 4LRMA 3ZRKA 4O7LA 1M7QA 5C4KA 3QRTA 4DFNA 1FQ1B 4HGSA 4XOYA 3RALA 3DU8A 4FV9A 2XVDA 1H01A 4QP7A 5DFPA 1O9UA 4YJUA 3RWPA 3QTWA 3LAUA 4QP8A 4ALVA 1QL6A 3F5PA 3IGGA 2VO6A 3BLHA 3G9NA 3QXPA 4PP9A 1U5RA 3P1AA 4U97A 4DYMA 2R3QA 4N57A 2W1EA 3VBYA 4CKIA 4FE2A 1R0EA 3SAYA 3MPTA 1W2DA 5HQ0A 3TUBA 4BRXA 3QQJA 3QCQA 3NUSA 4DHFA 2G2FA 4ARKA 2XNNA 3QTUA 3FV8A 2PVNA 5HBHA 3W2RA 4MX9A 3NUXA 1REJA 5LJJA 1Q4LA 4G6NA 4MTAA 1ERKA 4ZAUA 3PLSA 3R1NA 5G1XA 4AA0A 2J4ZA 3KRRA 5A4TA 3I0QA 3KF7A 2UW5A 4EK5A 4O91A 1H27A 2JDOA 3D7TB 3QD3A 3VW8A 1WBVA 2I40A 3RAIA 5CAOA 3KMWA 4BGGA 2A98A 1CKIA 1PXKA 3L1SA 1CDKA 4RLKA 4X7QA 3R1YA 5EDQA 5GZAA 5CEQA 3RHKA 3ZTXA 4S31A 2WMRA 3G2FA 4QD6A 3W0SA 2UW7A 4R1VA 4BDHA 4C59A 1OPKA 2FVDA 2WTKB 5J5SA 2P3GX 3P9JA 5ANJA 5CS6A 3W2OA 5KMKA 4FC0A 3DLZA 3T8OA 4YTHA 4YZ9A 2ZAZA 4QP9A 4IDVA 4YZNA 4NW6A 1WBTA 3VBWA 2XIZA 4P5QA 1SZMA 4IZAA 1Q8UA 5AUXA 3R7YA 3UYSA 2XK3A 4YC6A 5KKRB 5FUTA 4W8EA 3TXOA 2G1TA 4F99A 2WO6A 5DR9A 4CCUA 3U6IA 4IMYA 2CKPA 3V5TA 3EYHA 4BICA 5C4LA 2ZOQA 4B6LA 4EH6A 5EFQA 4HVIA 1B6CB 1PXNA 3UNZA 2Z8CA 3SX9A 3IDCA 2BHHA 2IW6A 5HG9A 3UOHA 4B7TA 4BJJB 3EFWA 4L44A 3VBTA 3GOKA 4AAAA 1WZYA 4JNWA 5CZIA 4IX3A 2E9PA 4IAFA 3PRFA 4CSVA 5EM6A 4RPVA 4AQCA 3F2RA 2ZV2A 4HGLA 5CT7A 3GFEA 3V6SA 4CG9A 1G5SA 3PJCA 1EH4A 5IA1A 4FYNA 3ZDIA 3IW7A 3DAEA 3UIUA 2YM3A 5IISA 5EQEA 3DPKA 3PVWA 2OJGA 4G5JA 3TKUA 3MFUA 4I3ZA 3ORMA 3R1SA 4BHNA 2Z7RA 1XR1A 4KS8A 1PXOA 3H9FA 4AT5A 4AW1A 2HWPA 2O8YA 4QMVA 4BCHA 4JDKA 4RWKA 2QHMA 1OIRA 4C3FA 4EH8A 1LEZA 3KN6A 1WAKA 3E8DA 3AC1A 5EM7A 4FV6A 5EI2A 4UN0C 3GU8A 4HJOA 3NW6A 4PRJA 1KSWA 3R30A 3ELJA 4U8ZA 3O8PA 1OUKA 4AWIA 2WB8A 3UZTA 1YWRA 5D41A 3WBLA 4AXAA 3FYJX 1TZDA 4EUTA 3EFJA 1ND4A 3F7WA 1VJYA 3ORTA 2FO0A 5DT4A 5HOAA 4CFXA 5HD4A 4FT3A 5HTCA 3FAAA 4ZSGA 3R7GA 2VX3A 3AC5A 3L9MA 4FKTA 4HYSA 3D94A 1PMNA 4M0ZA 4WBBB 3PXYA 3O23A 2ERZE 3OG7A 5AA8A 4O0UA 4DGMA 4YLLA 3SXSA 4I4EA 3WILA 4Y83A 2VRXA 3RPSA 3E3PA 4IAZA 4L3PA 2QKRA 4RZWA 4FF8A 3DK6A 3QLFA 5AR2A 1BX6A 4KIKA 4DT8A 5IA2A 5JN2A 3N4UA 2CN5A 1ATPE 1W2CA 3LXNA 4R5SA 4EI4A 2X81A 5CT0A 5EYDA 4FICA 2VTHA 3LLTA 4K9YA 5CI7A 4NCTC 1OI9A 2UW4A 3KA0A 4JBQA 5I9YA 3B2WA 4YO6A 4OTQA 4EZ7A 4WG3A 5AUUA 3CGOA 3BRBA 3QQKA 4W4WA 5M06A 5A3XA 5I9UA 3TZ8A 4BR3A 1J1BA 1TQIA 3UPXA 4BIDA 2JKMA 5CXZA 5AA9A 5HI2A 2QOLA 3L8VA 4YJSA 3EYGA 5EW9A 5J87A 3CS9A 3DZQA 4Z7GA 1QCFA 1KOAA 1M14A 4BCOA 4EOMA 2VWYA 4FZ6A 4XRLA 4I41A 5AX9A 5L2WA 4R7HA 1RJBA 4O82A 2BIYA 4Y8DA 1W83A 4EHZA 5ICPA 3CQUA 2A1AB 3FI3A 4W4VA 2C3JA 2WGJA 3BZ3A 2VZ6A 5M4FA 5IQIA 4ID7A 3UIXA 1ZOGA 4ZK5A 4O4CA 4M84A 4ZSEA 2VTSA 4KWPA 4P2KA 4F9AA 4KSQA 4BCGA 3PPZA 5IH4A 4RIYA 2BRHA 4OUCA 5BNJA 4XG9A 3FSKA 4ORKA 4O96A 1WCCA 3RKBA 3ERKA 4DEDA 3NUPA 2XNOA 2B52A 4NFMA 2QOOA 4I4FA 3QTRA 4IC7A 4XV9A 2UZNA 4HYIA 4EORA 1A9UA 3BWJA 4ZLOA 4E7WA 3DBDA 3QC4A 4JR3A 5EHOA 4LM5A 2BCJA 3MTFA 4IHPA 4MVFA 4YGAA 4HGEA 3SXRA 3HP2A 3P7CA 5LVNA 1WBPA 3NFGB 5EHLA 3UIBA 4RQVA 4QDEA 4PV0A 5FBNC 3QQFA 2YJSA 4QMQA 4J99A 4EK6A 5DLSA 3R9HA 4PQNA 4ZMEA 3BHHA 4IVDA 2W1DA 3QRJA 4QMYA 5J7BA 2XBJA 1M7NA 4HZRA 4DCAA 3G90X 3PXRA 2BFXA 3PVGA 3GU7A 4UY9A 2C5XA 3LFCA 4R3RA 3NW7A 4GJ3A 3R02A 4J53A 5EDPA 2C3LA 3K2LA 4CFNA 3ZBFA 4FTCA 3AGMA 4NKAA 2HK5A 2A27A 3C7QA 1OL7A 1NVRA 3ZRLA 5T3QA 2UZOA 4O38A 1UA2A 3GU6A 3MGYA 4LRJA 4DFBA 3EKNA 4L3LA 2WIPA 3ENMA 4PX6A 3S2PA 4JDJA 3TIYA 4CXAA 4F7NA 1MP8A 1I44A 2XEZA 4KSPA 2V7AA 4IB0A 2E2BA 5B7VA 3ZXZA 4ACMA 1BI8A 4JJRA 4GT4A 4CKJA 4FKIA 2BAJA 3EN6A 1YXTA 3K5VA 2GPHA 4V01A 1PXPA 3TKIA 3ZBXA 5A4LA 4PPBA 4QQCA 1W7HA 3TZ7A 1YWVA 3HECA 4EHEA 2YM7A 4KIQA 4OGRA 1JKLA 3IW5A 5DBXA 3HEGA 5L2SA 4BDIA 4NM5A 3FBVA 3OF0A 3COHA 5DT3A 2X8IA 2PE2A 2P4IA 2UUEA 4BYJA 4RIOA 3NIEA 2Y7JA 4EZ3A 4YTCA 5IA5A 4JQEA 5IUHA 3OROA 3QL8A 5I9WA 5E8UA 4FKOA 4KKEA 2VTNA 3MH3A 1MRVA 2C5NA 2DS1A 1QPEA 1YDSE 2PUUA 5HG8A 3D2KA 3NWWA 4PTGA 4YNOA 3F5XA 3BV3A 3HKOA 1OB3A 3PPJA 3G6HA 3Q2MA 4KRDA 4H1MA 2BZKB 3W0RA 3KVXA 2BRBA 3DQXA 3DJ5A 3Q9YA 3NUNA 2PTKA 2WZJA 3FMHA 4GCJA 2BKZA 2ZB1A 3MB6A 4D4YA 3A7GA 5IKWA 2B0QA 3T9IA 3UP2A 3G15A 1WVWA 4XUFA 4EH5A 3PG3A 4DDIA 3HRCA 3EQIA 2E9UA 3R7OA 5BYYA 5M4IA 4TL0A 4AGUA 4GUBA 4MK0A 3VBXA 4F63A 3ZFXA 3REPA 2F2CB 4IJPA 3BU3A 2ITUA 2ZYBA 4R77A 4AF3A 3E7OA 3NS9A 4FG8A 4TW9A 5JFWA 5HNIX 3PWDA 4FNZA 2VTAA 4FSTA 5IF1A 3UC3A 4D0XA 4FEWA 3LVPA 3W32A 5LXMA 5EOLA 1NVSA 2HIWA 4ZTRA 3SD0A 2IWIA 4E3CA 4G16A 3DBQA 4ENYA 4BF2A 5FRIA 4U9AA 3S1HA 3C51A 4DGNA 3U4UA 4HW7A 1IEPA 3W2PA 4ERWA 1L8TA 3BEGA 4ZZMA 1J7UA 3RCDA 5C8MA 2OZAB 1XMLA 4FV1A 4AN2A 3A7IA 1SNUA 4ZSJA 4IXPA 3KB7A 4O6EA 4CD0A 4CYIA 5KMNA 3QCSA 3ORPA 3Q9XA 5L6PA 4ZLZA 3RZFA 4O83A 4E6QA 3DB8A 1TQMA 4YC8A 2I0VA 5AMNA 1XO2B 2C3IB 2W4OA 4RFYA 2Y6MA 4YP8A 3E64A 3UC4A 2C0IA 3FMDA 4OTIA 2Y0AA 5CEIA 4BKYA 4ACDA 3EQPA 4FTAA 4UYNA 5CEMA 3C13A 4TNDA 2JAVA 3C4ZA 5KZ0A 4G3GA 3F3ZA 4IAYA 3AC4A 4FV7A 2XIXA 4L43A 4GL9A 4FIEA 3JUHA 3R71A 3IGOA 5HD7A 1WVYA 4AW0A 4QPAA 1GIJA 3KEXA 2ITWA 3GC8A 4JS8A 5GHVA 4PL4A 5DE2A 4KKHA 3ZO2A 4O1OA 3VBQA 2I1MA 4W9XA 3FLWA 3MESA 3F2AA 3F69A 3JY0A 4CQEA 4F0GA 5KCVA 3UQFA 5ANOA 4QP6A 4ZJIA 4CCBA 5L2TA 4YJTA 4FGBA 5LWMA 2OF4A 4NWMA 4K2RA 4FTRA 2I0EA 3ACKA 3VJOA 2WXVA 4CZTA 4D2VA 4JRNA 4II5A 4F65A 4FNWA 4ITJA 5AFVA 4JIAA 4YPDA 4PUZA 5EYMA 4FV4A 4YZMA 4AZFA 4MQ1A 4ZOGA 4FV5A 3V8TA 2PVHA 4AN9A 3ATSA 2JDVA 2E9VA 4XS2A 4BVUA 2ZM4A 1AGWA 3KXZA 3KMMA 4I21A 4AT4A 2VAGA 2A19B 2BRGA 3VUMA 3R28A 3SDJA 4UALA 4MWHA 3VBVA 3NYXA 4UMTA 4EK8A 3HV6A 4E5WA 4DC2A 3FE3A 3DNDA 4E26A 4E4LA 3LFSA 3LW0A 4GU6A 4O2ZA 3E92A 3P7AA 4KIOA 3O0GA 3NMUF 2GQSA 3PY0A 1DAYA 3MVHA 4G3DA 4J7BA 4KIKB 2V62A 3UJGA 2PMIA 4QTAA 3OWPA 4J96A 1O6LA 3C9WA 1G3NA 5HVYA 4LGHA 3IDBA 3QU0A 3TZ9A 4TTHB 4O0TA 3IO7A 4PDOA 1J91A 5C27A 1OL2A 5HO8A 4A9YA 4ONAA 2I0HA 2IVUA 1R78A 4J52A 1UV5A 4Q9ZA 4CV8A 4HNIA 4XLVA 3QA0A 1V1KA 3TTJA 2RL5A 2B4SB 5C26A 4DTAA 3QUEA 4GVAA 4O2PA 4WHZA 4I5CA 3BU6A 5IQAA 2B53A 1FINA 5D11A 4BDDA 2YCSA 3HMNA 5CVGA 2BAKA 3BGZA 4FK3A 1UU3A 3MY1A 2HYYA 3CKXA 4WKQA 1L3RE 4FL2A 4ANBA 4TYIA 2C6KA 4FTTA 2VD5A 3G5DA 5FLFA 4X3FC 4C36A 4BBEA 1QPCA 2C5VA 1FGKA 2VTMA 4RIYB 3Q3BA 3QA8A 3R2BA 2YERA 4AE6A 3KMUA 3EMGA 2J0JA 3ZRMA 3DDQA 4D1SA 4F6UA 4AOIA 3MB7A 3ZHPC 3GQIA 4AOTA 3UPZA 3HAMA 3KC3A 4QMNA 2OXYA 2I0YA 3AT4A 3P0MA 4DHZA 3BLQA 4F9YA 3C4FA 5E8YA 3BGQA 5E8VA 3UTOA 5HO6A 3FXZA 2H6DA 4FK6A 2ETMA 3HX4A 1RQQA 4LUDA 3VWAA 3BBTB 4JL9A 3MIYA 2ZFYA 2PSQA 3A2CA 3DA6A 1JOWB 3PXQA 4G6LA 4TKSA 5AX3A 2RFEA 3LJ1A 2F2UA 3MVLA 4CFUA 4GKHA 1R0PA 5K4IA 1XKKA 1SMHA 2HY0A 4LI5A 3Q52A 4HCUA 3C1XA 4IM3A 3DY7A 2J5EA 4XX9A 4UMPA 4YO4A 3UO4A 2XK9A 5CSWA 3T3VA 3R9RA 2XM9A 3RPRA 4FZDB 3N4TA 2PHKA 4LGDA 3V5PA 2C6TA 2XRWA 3KXMA 2BIKB 3U51A 5IA4A 2R3NA 2C1BA 2GU8A 3M1SA 3FHIA 3AT3A 3RZBA 4OBOA 1Q8TA 3HRBA 3QGWA 1SNXA 3O8TA 4JDHA 4PDPA 4V04A 3PZEA 4GU9A 2Y4IC 3VS4A 5J5TA 2W9ZB 3OD6X 4YHFA 5AV0A 3HMMA 5I4NA 3BL7A 4D2TA 5LQFA 5I3OA 4DEHA 4S34A 1K3AA 2IO6A 2W7XA 2AEGA 2RIOA 4OAVB 3O50A 2XKFA 3AC2A 2YCQA 3UG2A 3EQFA 5M4CA 4RG0A 3IPHA 4JT3A 5E8TA 5BV3A 5BVFA 5DPVA 4IWPA 4TN6A 3SHEA 5L2QA 4PL3A 3R8ZA 1Q97A 2PVRA 5ETIA 2XF0A 4BKJA 2R3FA 2W1IA 3MWUA 2GNFA 4LYNA 4ZZNA 4ITIA 1KOBA 3ZO1A 3D5VA 4EH3A 1KUTA 3TWJA 4MHAA 1UKHA 4GJ2A 4G3FA 1YI6A 4NCTA 2NRUA 3ZC6A 3CTJA 5HE0A 4RJ8A 4WSQA 3FQHA 4AAYA 4KABA 3D5UA 3Q53A 3RTPA 4A9UA 3W0NA 2PZ5A 5HCZA 3SOAA 4QMXA 4R3CA 3OY3A 3TEIA 2HCKA 2WMSA 5IEVA 4C62A 2EXEA 1YOMA 2EB2A 4HYUA 5L8KA 2NNWB 2Q0NA 1TVOA 3P7BA 1GZKA 4D0WA 4NM7A 1I09A 3HMIA 3CTHA 3P23A 4CMTA 4UX9A 4DH8A 3UVQA 1OM1A 3GCQA 4C7TA 3CSVA 4N6YA 4U45A 4FUYA 4XOZA 5CZHA 3GQLA 3HVCA 3OWLA 3EQDA 4FOBA 4L01A 2XH5A 5EM8A 3WF9A 4QMLA 4FJVA 3NDMA 4MD7E 3QHRA 4DH5A 3FPQA 2PWLA 4KA3A 3V5LA 4E6AA 3DJ7A 2HAKA 3OHTA 3OOMA 4BKZA 4I92A 3VUTA 2X1NA 3QXOA 1YKRA 2P55A 2XZSA 4I6HA 3DBFA 3DLSA 4IJ9A 4EYMA 3D2IA 3PP0A 5TO8A 3ZLWA 1E1XA 2OK1A 4FTQA 4IE9A 4PTCA 4W8DA 3QTSA 4QEBA 4K18A 1O6KA 3V5QA 5IEYA 4J8NA 2R3LA 1WBWA 1UNHA 4A4OA 3TG1A 4JMQA 4F64A 3C0HA 3P78A 3CY3A 4BWXA 3MPMA 5A14A 3WI6A 2PMNX 4RC3A 5L6WL 1UNLA 2GFSA 4ACHA 1U46A 4CEGA 4HVHA 4AXFA 5GIOE 2QHNA 4LRKA 2PYWA 4RVKA 4DDGA 3FHRA 3LFFA 4S2ZA 3OUNB 2QQ7A 4QQ5A 5JQ8A 4AQKA 3LCSA 3Q9WA 4BBMA 4JQ7A 4ZJJA 4BI1A 5IU2A 4CNHA 4EL9A 4MBJA 5FDXA 3AC8A 4Q5EA 3LFAA 3GB2A 1PXMA 4QMTA 5IUIA 4FV2A 2HZIA 4FKRA 3VQUA 2CCIA 3OOGA 2BZHB 4FTUA 3MYGA 4ERKA 3VO3A 3HGKA 1ZOEA 4BCKA 2G15A 4C4FA 3OW3A 4HVDA 4IAAA 1JSTA 3TI1A 4D9TA 3PSBA 3CGFA 2CNQA 2HY81 5J1WA 4WUNA 2R0UA 4AS0A 3OBJA 4CGAA 4BDCA 3V5WA 1ZMVA 2IZUA 4UV0A 3QRIA 4BGQA 2OH4A 4K0YA 2E9NA 3DK3A 4YNEA 5AM7A 4ANOA 5DI1A 2R64A 4ZZOA 5E8WA 1Y57A 3DCVA 4DH3A 1AQ1A 2G2HA 2YIWA 2O65A 3LCTA 5IA0A 4IB5A 4RJ5A 4PMPA 4CFFA 3IW6A 4I5MA 4AE9A 2WMWA 5KNJA 1IR3A 5EW8A 3SGCA 3ML1A 2PZRA 3HA6A 3TNHA 5A54A 4YZBA 3GI3A 5ANDA 5CY3A 3O5AA 2JC6A 2X8EA 2BAQA 4KS7A 3PTGA 4O27B 3KVWA 3BU5A 4FTOA 3TM0A 1PYXA 2UW6A 2R7IA 2W1CA 1JNKA 3TV7A 4MXXA 2JLDA 4NTTA 4EYJA 1GY3A 2WMTA 4RX9A 3C4WA 4PMMA 3AOXA 2XK4A 4K6ZA 4DBNA 1PJKA 2PVYA 4DG0E 4ZTLA 4FZFB 5HNBA 3WF6A 4GYIA 3HA8A 4O6LA 5H8BA 1URWA 5A6NA 2X8DA 2Z02A 1JPAA 2JGZA 4H1JA 4QMPA 5AUZA 3UVPA 4D4RA 4QYFA 4BFMA 3GVUA 4EEVA 3TTIA 4ASEA 2UW0A 3FUPA 4FIHA 3UODA 3WZEA 2PUPA 4WRGA 4MXZA 4RA4A 3KCFA 4ASDA 5BQ0A 1TFFA 4M69B 5H9BA 2QC6A 4G17A 5C03A 2YAAA 4F7JA 5GJDA 1Q24A 2XMYA 4O1PA 3OFMA 4DAWA 3S95A 4C57A 5K3YA 3PY1A 5HORA 4JBVA 1IAHA 1ZYJA 3LFBA 4I24A 4QYGA 5IEXA 2HW6A 4YPSA 3U87A 1PYEA 3O7LB 4I6FA 4I0TA 3R8UA 2WTDA 4NT4A 3WE4A 3DTCA 1XH8A 4Q9SA 4M13A 5CSXA 4DGLC 2QD9A 2W5BA 1T46A 2YACA 3ZOSA 2JDRA 3QYZA 3R9NA 3DOGA 3DXNA 1Z5MA 5HKMA 5GJGA 4K77A 3VUGA 3PJ8A 2ETRA 4CLJA 5FQDC 5KKRC 4XBUA 1R1WA 4XCUA 4B99A 5LVOA 3V6RA 2VV9A 3A60A 4DGOA 3FI4A 1VYWA 2FYSA 5LCJA 4N0SA 3JYAA 1GOLA 4DTKA 3EOCA 5ETFA 2C69A 3ZXTA 3FY2A 3I6UA 3IDPA 2FSOX 3MH0A 5AR4A 4FV3A 5E8SA 3K54A 2BTSA 4KIPA 5FTGA 5C8KA 2V55A 4BCFA 3IECA 4UZDA 2B9HA 3Q96A 3UMXA 5HX8A 4H36A 2YN8A 4RC4A 3CCNA 3HV5A 2X6DA 2O2UA 2OXDA 1G8SA 2YDJA 4CRSA 1U4DA 2PVKA 2XCKA 5CF8A 1JKSA 2YIQA 3KXXA 4KBCA 5BVDA 5LMBA 2QU6A 4O84A 4ALUA 2O64A 4BTMA 2DWBA 2ITVA 4E93A 1CSNA 2QOFA 5HCXA 1VZOA 3V5JA 1XH7A 2CKEA 1YHSA 3OXZA 3H0YA 3SLSA 4X2NA 4DINA 2DYLA 2BZJA 5EH0A 3QALE 3POOA 2YIXA 4D2WA 3BHYA 3NZ0A 4GS6A 4C4EA 3RPYA 4O7ZA 4RIWA 4X3JA 5TE0A 1IASA 5AV2A 4O81A 3MTLA 4V05A 2WTVA 4C61A 3CE3A 3IW8A 3KK8A 3W0PA 3O51A 4EJ7A 5AP7A 5LMKC 2X4FA 5EKOA 3RK7A 2GMXA 2XIYA 4C2VA 5KHWA 2OJ9A 2J9MA 3TACA 1BKXA 3RCJA 3AKKA 4F78A 5E8ZA 2QOHA 2AQXA 2IG7A 4PP7A 4PNKA 1UWHA 3EL8A 4LV8A 4ZY5A 4I93A 4NFNA 1XMMA 3Q32A 2WTJA 2WELA 2WOTA 4W4YA 4AU8A 3ORZA 4GW8A 3VUIA 5BX0A 3VIDA 4UMQA 3QBNA 2IN6A 4RWIA 2WMQA 4CYJA 2BKKA 3KN5A 4ZS4A 1B38A 4IIRA 3CTQA 4J1RA 4RRVA 5IQGA 2V0DA 2PL0A 1P5EA 5EOBA 4FG9A 3RPVA 4O0XA 1NVQA 1MRUA 4C33A 4PNIA 2ITTA 1ZOHA 4JG8A 4I94A 5J9LA 3CY2A 4E4MA 4FIIA 2BHEA 4QO9A 4GFOA 5KBQA 2YCFA 1JLUE 1HCKA 4YHJA 4C0TA 3RBWA 4FKSA 2YHVA 3P5JC 5C1QB 5CEOA 4G34A 2WMAA 3BLRA 1CKPA 5JFXA 3ZM4A 2CKQA 4B0GA 3RINA 1ZYSA 3VQHA 4MEDA 2PVJA 2Z7LA 2FA2A 3KL8A 3LCOA 4QMWA 3F5GA 4BI0A 3MW1A 3GOPA 4EOKA 4YSJA 5ANIA 4EH7A 4PDSA 2PUNA 2WAJA 4EQCA 3SVVA 4CMOA 1UU8A 2YM4A 3UDZA 2O5KA 4L7SA 3NGAA 1DS5A 2J7TA 3FXXA 3ORLA 4M7IA 3DFAA 4TYGA 2BDWA 4GFGA 4YBJA 1YI4A 3IKAA 3RI1A 4AX8A 3UQCA 4GIIA 2QVSE 3QTXA 4IC8A 4MXAA 5CU2A 5HZNA 3QD4A 1NXKA 2VWZA 2XYNA 4MXCA 5HVJA 2RG5A 2W1FA 1H1PA 5FXSA 1KV1A 3ZLXA 5BUEA 4L3JA 2EB3A 4S32A 3NFFB 4C3PA 5LVLA 1K2PA 1ZYDA 2XNPA 3BE2A 3QLGA 3W2SA 1VEBA 4DFZE 5L8LA 4O7RA 4WG4A 5IQDA 3ET7A 5AV1A 5HTBA 1XH4A 3W2CA 5L3AA 2H8HA 3QTZA 4X3FA 4FT9A 5KHXA 2WQNA 4FVQA 3FL5A 4M12A 4F1TA 3GNIB 1MRYA 2WU7A 4IANA 4BGHA 3SRVA 2PZPA 5K5NA 3EKKA 3VW6A 1E1VA 3UG1A 3A4OX 5M44A 2OIQA 2QKWB 4W4XA 3FSFA 4ZTHA 4F70A 2H9VA 4GMYA 2F49A 3GU4A 3PWYA 3FI2A 5BVNA 3I7BA 5AADA 4UYAA 5HIBA 5LVPA 3A99A 2ONLC 3W1FA 3WZUA 2GTNA 2IPXA 2P2IA </