2ETMA

Crystal structure of focal adhesion kinase domain complexed with 7h-pyrrolo [2,3-d] pyrimidine derivative
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
272
structure length
262
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of Focal Adhesion Kinase Domain Complexed with ATP and novel 7H-Pyrrolo [2,3-d] pyrimidine scaffolds
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 262
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2etmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2etmA01
4JX3A 4EH3A 3LW0A 2ZDUA 4WG5A 3C5IA 1PKDA 4I6BA 4E5BA 4F6WA 4PP9A 3EL7A 3KK8A 4F70A 2BTRA 3P4KA 3NUPA 3RK9A 1QPEA 2XKCA 3E63A 2YDIA 4J8NA 5LWNA 5IMEA 2GQRA 2OH4A 2WQBA 4W4WA 4WBOA 4ACDA 2BZJA 1BUHA 2VX1A 5AUUA 4AACA 2X7GA 2ZOQA 1BYGA 3MFTA 3VS0A 4D4RA 5C9CA 3VN9A 4GIHA 3FC1X 3AC2A 4O1OA 4RJ6A 4OUCA 4RJ3A 4X2NA 2WMAA 3UYTA 1F0QA 3DS6A 3R8ZA 3MIAA 1ERKA 4BI2A 4ITHA 3TV7A 1OIRA 3H0ZA 5AJQA 1PXLA 3K3IA 3K5UA 2WMQA 2R3PA 4BDHA 5A46A 4L7SA 3PDTA 4O84A 3RAIA 4J8MA 3ZC5A 4J96A 3ZSGA 4D4YA 3UE4A 4WSYA 4OT5A 5EI8A 2GQGA 5AV0A 1XH6A 3QKLA 4ZXTA 2X7FA 3DA6A 4R7HA 5DMZA 3U9CA 5D7AA 1YWRA 3CEKA 1JSTA 2DQ7X 3C51A 4WBBB 2WMWA 3MGYA 4AFEA 3VQUA 3VBXA 4IB3A 4QMWA 3AMAA 3II5A 5E8WA 4IW0A 1NA7A 4MYGA 4IVDA 3MIYA 3EHAA 3IW4A 3OOMA 1NVQA 4AN3A 3GI3A 4B6LA 1YRPA 4KIQA 2OU7A 5FG8A 1M52A 5TF9A 4AOJA 3TJCA 1Q97A 4M12A 2YITA 3GVUA 2VTTA 5FXSA 1ZRZA 1ZAOA 4D58A 1ATPE 3QCXA 4M0YA 3CTHA 2PVMA 4GCJA 5D7VA 3U4UA 4GU6A 5AMNA 2W4OA 2C3JA 4PMSA 2YJSA 2BCJA 5IPJA 3LQ8A 3I7CA 2J5FA 5HICA 3O8PA 4XH6A 3DU8A 4ZZMA 5E8TA 3QCQA 3TCPA 2J50A 3GCPA 1JKKA 5H2UA 3ZLSA 4FV9A 4U3ZA 1PKGA 5C8KA 3Q2JA 5AIRA 2SRCA 4MNEB 4EC9A 5M51A 4G16A 3V5WA 3UOLA 2GTMA 3RI1A 5ETIA 5CNNA 2W1FA 3DJ6A 2QO7A 3Q96A 1YI4A 4NW5A 2X2KA 5L3AA 4F9CA 3PA5A 3UPXA 5C26A 4I94A 2QURA 4WT6A 1OBDA 3MH2A 4FSQA 3BPRA 3ZH8A 2XNEA 3GC9A 4R3CA 3ZRKA 5K5NA 4WRGA 2XH5A 2ZM4A 2YM3A 4FTNA 2I0HA 1OL7A 2HW6A 3GB2A 4MXCA 5ETCA 4WUAA 4XEYA 3S0OA 2XMYA 3BWJA 4BICA 2Y6MA 2W0JA 3ORXA 1J1CA 2VU3A 1E1XA 4ZJVA 3D7ZA 4PRJA 4U8ZA 1ZOHA 3BIZA 4UN0C 4FV3A 3M1SA 4TZRA 5EYMA 3D9VA 3ENHA 4F6SA 2W1GA 4FYOA 3FYKX 3G9NA 5HNIX 3F5PA 3QC9A 5EOBA 4ZSLA 5AAFA 3WYYA 2HZ4A 3THBA 4IWDA 2BRHA 4JI9A 4AAAA 2YHVA 3R1NA 4GL9A 5HU9A 4NWMA 3RAKA 5BX0A 4IZYA 3LLAA 2VN9A 4H58A 5EKNA 3BEGA 4BKJA 4GMYA 2PVKA 2GNIA 2VTJA 4J95A 5I9XA 3FSKA 4BDGA 2UZDA 4OTRA 4PDOA 3BLRA 3CP9A 4LRMA 4RJ7A 2Z02A 3SOCA 4YO4A 5JQ5A 1Q24A 4ZEGA 1ZARA 4MCVA 4C37A 1X8BA 3IW6A 1WBTA 4FKIA 3EN9A 5CAQA 3UBDA 4QYFA 3BLQA 5HD7A 1QMZA 3FMJA 4O7SA 4CTBA 5E4HA 4EOOA 3PJCA 3E8CA 4JLCA 2I40A 3FI8A 3LXPA 4IQ6A 4RSSA 2IG7A 5M44A 4DT8A 3CE3A 2UZUE 3AT4A 3RHKA 3FZOA 4K8AA 3POOA 4FG7A 5CLPA 3HVCA 4PY1A 5DPVA 4BFMA 2C5VA 5FD2A 3DV3A 3OBGA 1T45A 3KVWA 4L3JA 3UQFA 2WTKC 3MH1A 2P3GX 2G15A 5CI7A 3WF8A 4G5JA 4JDIA 3TG1A 3ZC6A 4J53A 3ZLWA 2ETRA 2WHBA 2PPQA 4NJ3A 5HO8A 3PXKA 4EJ7A 2EVAA 2ZB1A 4JDHA 3ZZWA 2F7XE 3GOPA 5C01A 2HZ0A 1ZXEA 5CU3A 5ETFA 3RP9A 5CF4A 5HVKA 3U6HA 2IZRA 3N9XA 4R7IA 1M2QA 3HKOA 3BELA 1K9AA 3Q53A 3VBQA 2FSOX 5IA1A 4K2RA 1ZY4A 2F49A 4YPDA 4U0IA 5M08A 4QYHA 4EWQA 3QRKA 2XKFA 4K18A 5J5TA 3R9OA 1ZOGA 2PVNA 4HYIA 1DM2A 5KBQA 5D1JA 4KNBA 5HNGA 3V04A 4MD7E 4RRVA 4XOYA 5GJGA 2J4ZA 5CAPA 3HYHA 3DJ5A 2J51A 3MW1A 4EK4A 5CY3A 2OFUA 4KINA 3QD2B 3KB7A 4I92A 4TXCA 3OOGA 5CALA 2BAJA 4P4CA 5F4NA 3R7IA 1NVSA 3E3BX 3W2CA 3FUPA 4RLKA 2YM6A 3HL7A 4IX5A 4EOLA 3W10A 4RIXA 4DITA 3ZUUA 4O0VA 2OGVA 3LFQA 4MXXA 5AA9A 4TYHA 4C3FA 3EOCA 3UO4A 1KUTA 1OIQA 1J91A 4L68A 3TNHA 3JS2A 1I44A 3RPSA 5IUGA 3DXPA 3G51A 2GDOA 4UMRA 3TNIA 4AFJA 3PY1A 5K0XA 2VO3A 3EQIA 3PVBA 5IQCA 2XF0A 3L1SA 3CD3A 3QTSA 2FGIA 4DBXA 2JAVA 3B2WA 3PZHA 4GV1A 2GNGA 4LV8A 4D5KA 2J2IB 5I9UA 2XS0A 4RWLA 2BPMA 4M68A 3IK3A 5IKWA 2JC6A 2WIHA 3ORKA 4U97A 3NS9A 4JX7A 4U40A 4XX9A 3ALNA 5BUIA 4IZAA 2RFDA 2QOFA 3LFNA 4KRCA 2W96B 2DYLA 3TV6A 3VHKA 3FBVA 4DGOA 3A2CA 5H9BA 2UUEA 3O23A 4WO5A 2X2MA 4E7WA 4X21A 5KUPA 3R71A 5CWZA 3MPMA 3ORLA 2C0OA 5C1QB 4FA2A 3IOPA 3DT1A 3PIYA 4D55A 1CKIA 3KRJA 4EHZA 2CMWA 1GJOA 4F9WA 2V22A 2VTQA 2IZUA 2W5AA 3EQHA 5FBOA 1ZYSA 2O8YA 3QXPA 2QOQA 2PYWA 3LFEA 4FR4A 4EK3A 2OO8X 5AP3A 3ZONA 3P79A 2X8IA 2WIPA 2BZHB 2V5QA 1CMKE 5H8BA 4DGLC 4TYJA 4EEVA 4QTEA 2O5KA 1YI3A 2VAGA 5K9IA 4FEXA 3BYMA 4KWPA 4FZDB 3FKLA 3LCTA 5H8GA 3NYOA 1SVEA 5J95A 4BF2A 3LE6A 2Y7JA 3MJ2A 3IDBA 2ITUA 2A0CX 4QYYA 5HE3A 1VEBA 4K6ZA 4NJDA 4R1YA 5JRQA 5FEEA 2JKMA 2OJJA 4D1SA 2RG6A 3IO7A 4TWNA 3VUGA 2Q0BA 3GQLA 4PDSA 5D9HA 4AZTA 5TR6A 1H00A 3ORNA 2WZJA 2CKEA 4QT1A 4QNAA 3UYSA 2C30A 4C59A 3PLSA 3BZ3A 3F7WA 2JIIA 4QP2A 3AQVA 3QFVA 4AQCA 2PUNA 3KMUA 5ANOA 3SLSA 4OLIA 3KXNA 3OY3A 1YXVA 3OWKA 2PZRA 3GCVA 3IW8A 3OMVA 4DG3E 4IFGA 3E5AA 3V5LA 1BX6A 5CS6A 3UVRA 3IONA 5F95A 4L42A 3OD6X 4J98A 4NUSA 3HV3A 4V05A 3OEZA 3LAUA 2E2BA 4LYNA 4O0YA 3WZJA 4OTQA 2NRYA 4X6RA 3R8LA 5BUEA 3Q9XA 4FSWA 1M17A 4IAAA 4O91A 2C6LA 5IG1A 4B8MA 4ASXA 2P0CA 2P2HA 4C35A 4IAKA 1OPLA 2BFXA 1Y6AA 4AT5A 3TNQB 3OUKA 4FL1A 1H01A 2PVHA 4IX3A 1GZ8A 4X3FA 4YMJA 4KBKA 4TYIA 1H0VA 5AP5A 3BGPA 4G3CA 4UWCA 5BVFA 3LVPA 5IUIA 3F5XA 3FMHA 4FI1A 4FNWA 2ZV7A 4XG9A 4D2PA 4XG8A 2J0JA 4NIFB 4BKZA 4C7TA 3WOWA 3C50A 3EQFA 2BR1A 2CKOA 1H07A 2FSMX 4ANMA 4BTJA 3EQGA 5DT0A 1LPUA 4G31A 4X3FC 3AC3A 4U42A 5LMBA 1W83A 3NUUA 5K3YA 5CENA 4L44A 2O0UA 4E5AX 3V8SA 4ZTLA 3E62A 2IW6A 1ZZLA 3CJGA 3DNEA 4FIGA 2XJ1A 3NGAA 4QMOA 1XHAA 3FWQA 2GNHA 2XK9A 4CRLA 5BVDA 5M57A 2XIZA 2X39A 4GFMA 4WNPA 2R3NA 3ZYAA 3RKBA 5L6WL 4DCEA 5I4NA 2VTNA 2PK9A 3QF9A 1OZ1A 2EU9A 4G6NA 5LMAA 3SA0A 2YABA 4Z55A 3G15A 2WTKB 3GC8A 3L8SA 5J7HA 2C3LA 5E8YA 4EOKA 3U6JA 4Q5HA 4K1BA 3UO6A 4AZEA 4BWKA 3BV3A 3UO5A 4JQ7A 3W8LA 4DA5A 3ZLYA 5IQFA 4JG7A 3VWAA 3KRWA 2BFYA 2BRNA 4F0FA 3OCBA 1VJYA 3HMOA 4IC7A 3IW5A 2YCSA 3NX8A 4HPTE 3BKBA 4KBCA 4G3GA 4YSMA 4E20A 5AUTA 4FEQA 3GU6A 4Q2AA 5FQDC 1UVRA 2C0TA 3FKNA 3PE2A 3QZHA 3NAYA 5E8SA 2GU8A 3ZMMA 3ZTXA 3U9NA 4A9SA 2C6OA 2UVYA 2W5BA 4AN2A 4YNEA 3O0GA 4RG0A 2CCIA 3DBQA 2R3HA 1W84A 4MF0A 2J0MB 1OKVA 3NAXA 4I24A 3HV7A 4M15A 3MVMA 3NR9A 3GUBA 3VIDA 3HMIA 1F5QA 3IPHA 2Y4IC 1PXIA 1WMKA 3NUSA 4Z3VA 2C5OA 3MH0A 4QQJA 5B2MA 1FVRA 1URWA 4EUUA 3O50A 3DKFA 3EN4A 3PVUA 3DJ7A 3H3CA 4JT3A 1P4FA 5CTPA 5IEVA 5B2KA 4PTGA 1KSWA 4AT3A 4QYEA 5HTIA 1ZYDA 5ANIA 2OXXA 2HY81 2R3IA 3C4WA 2XK7A 3FZSA 2C1AA 4I41A 4QP9A 2RFSA 1PHKA 4IM3A 4EK8A 1DAWA 5HO6A 4NT4A 4P90A 4M7IA 4ANBA 4E4XA 2W9FB 1DI9A 4OBOA 4QTDA 1P2AA 3T9IA 4Y83A 4YJRA 1AD5A 3KCFA 5E8VA 2FVDA 4ANNA 4EK6A 2G2IA 2QOLA 2I7QA 1B38A 3VJNA 5DYJA 4FKUA 4EH6A 2I6LA 3QL8A 4FV6A 5FBNC 3UMWA 3F3UA 1XH9A 2PZIA 2W1DA 3GOKA 3OHTA 4M3QA 4WNOA 4ALWA 4CZUA 4RIXB 1OUKA 3CQWA 2ACXA 4QQTA 5AP2A 3D15A 4BBFA 3RINA 2X81A 3AGMA 5DNRA 5HX6A 3QC4A 2F9GA 3OY1A 3KMMA 1YDSE 3VS6A 3MSSA 2FA2A 3FC2A 3L9NA 4ZZOA 1U5RA 4ITJA 4C58A 5HIEA 5HG9A 3PXZA 3G33A 2JDSA 3QUEA 3WZEA 3QQHA 5K0KA 3P7BA 3TWJA 5JQ8A 4A4LA 2ERKA 3DXNA 5HI2A 3V3VA 2YCQA 4P2KA 1TQPA 4FF8A 5ETAA 3EFLA 3DY7A 2W05A 2QG5A 5EKOA 2Z60A 2GNLA 5HCXA 2YM7A 4BHNA 4CCUA 4B0GA 4QTAA 3FAAA 4GJ2A 4PPAA 4LV5A 2XBJA 4ZY6A 4MHAA 4TY1A 3RCDA 5HU3A 5FDXA 5EM8A 4YJTA 4LGGA 3M42A 5AUZA 5C8MA 4F1TA 4I6FA 5JRSA 3SW4A 5DR9A 2CNUA 2RGPA 3AMYA 3O8TA 1GZKA 3LCOA 4C4EA 2ESMA 4I6HA 2YA9A 4IXPA 4EBVA 4EZ7A 2YZLA 3FMMA 5L2TA 4C4GA 4PF4A 3FY2A 4QMLA 4DH1A 4EKLA 4L45A 3KF7A 1L3RE 4S30A 1DAYA 1Y8GA 4BIEA 5TO8A 4LOPA 5HTCA 4NTSA 3K3JA 3QTIA 5AX9A 4BBEA 3SW7A 4D9TA 4YZBA 2PE1A 3L9PA 4MD8E 3RM7A 5KCVA 2ITOA 3UNJA 1R3CA 1YOMA 4RJ8A 4JBVA 4MXOA 4BHZA 1YWNA 2XM8A 5FXQA 5E8ZA 4RVKA 4BDDA 4M66A 2OXYA 5JKGA 3ZM4A 4V01A 3ORPA 3ZZEA 3VF8A 4O27B 4DINA 4PL5A 4MXZA 4BWPA 5HGIA 3GCUA 2GS7A 3R9DA 3QQUA 4FV1A 4F7JA 3U4WA 2QU5A 3F2RA 2YCFA 3MH3A 2YLFA 5BNJA 4ORKA 1FPUA 3IDPA 2C3KA 3PRFA 3ZLXA 4FX3A 4F08A 1PY5A 3CC6A 3JY9A 4YURA 3ZFYA 1Z57A 2XNPA 3HDMA 3ZCLA 3UGCA 2R3FA 4FEUA 3VAPA 3DCVA 4CLIA 3PLAE 4TNBA 4UYNA 3RTPA 3R63A 4QMMA 4H3QA 4XJ0A 4FEVA 2GSFA 1JSVA 4FT3A 4CMOA 2C5YA 3MJ1A 3FZRA 4AW1A 3NNVA 3SVVA 2Y4PA 3EN5A 3ZO3A 5B0XA 2QVSE 5EQPA 3MY0A 1CTPE 2WTIA 2RL5A 1REJA 5CXZA 4F9AA 3HP2A 1OECA 3B8RA 4NM0A 4X2GA 4BIDA 2YWVA 4NW6A 4FTJA 4QP7A 3KXXA 4M0ZA 5FEQA 1OIUA 3E87A 1UWHA 3I6UA 3MFSA 4X3FB 3BRBA 3PSBA 4E8AA 3PXFA 5A4LA 3DGKA 4JBPA 2FH9A 1RJBA 3I60A 4RIOA 3Q5ZA 4FL3A 5D10A 3RPYA 4BB4A 3NW6A 4IANA 4KSPA 4KS7A 4L3LA 3VUIA 4D4SA 4DFLA 4YU2A 4YLKA 2OLCA 1B39A 3NDMA 4OTDA 4Y72A 4O7YA 2QODA 5I3RA 4RMZA 3L8XA 5JFSA 3M11A 2JFMA 4RVLA 5LWMA 3EZRA 4CV8A 1TQIA 3AC8A 1WFCA 3S1HA 4RQKA 2X8DA 2OKRA 5E90A 3OBJA 4ANQA 2QO9A 1OGUA 3ULIA 2PULA 1UKIA 3FZPA 3H4JA 3DFAA 4O0WA 4ZJJA 2XEZA 3SQQA 4O7ZA 3LFDA 2CKQA 4HGEA 5AP1A 2J9MA 4CYIA 1OMWA 3PJ8A 3T3UA 3WARA 3G0FA 2UZOA 1OPKA 4U9AA 5HX8A 3F5GA 4LM5A 1GZNA 5I9WA 4YTIA 3LJ2A 3SAYA 3ZEPA 3LKMA 5CVGA 3A4OX 4ACGA 2XK6A 3OCTA 2R3KA 4OGRA 2HAKA 4RC2A 3D5VA 3AD6A 3ZFXA 1BMKA 4CRSA 3V51A 5A4EA 4HW7A 5B2LA 4CXAA 5EK7A 4E4MA 2QNJA 4UMPA 5E1SA 3LQ5A 3FV8A 3HECA 3QA8A 4HOKA 4M67A 5CYIA 2WU6A 5GJFA 5CEOA 3VRYA 4GW8A 2A1AB 5IEXA 1OL6A 4FV0A 4LUDA 4AP7A 5I9ZA 1PF8A 3RBWA 5CSHA 4GSBA 1AQ1A 2XIYA 3DTWA 4XG6A 3T3VA 5EI6A 2QONA 1V0OA 2HIWA 4FG9A 3K5VA 5FRIA 4NFNA 4LGDA 3KN5A 4EI4A 4KRDA 4FKWA 2XEYA 2VX3A 4IACA 1YXXA 4IX4A 2R7IA 5LCJA 2ITPA 3QWKA 2AC3A 1UKHA 2ZJWA 4IIRA 3DBCA 3KXMA 3DXQA 4EH7A 2NRUA 3EZVA 3QHRA 3CPBA 1Q8ZA 4FV5A 4UZHA 4BZNA 5IA0A 3DLSA 3WF5A 4JAJA 2VV9A 1LEWA 4HNFA 2QLQA 4C0TA 5EHLA 4EHGA 1O9UA 4QMNA 1OVEA 2JD5A 2WTJA 2W4KA 4A4OA 2VUWA 3DZQA 3LMIA 3DDPA 3H9FA 3VUKA 2CGWA 2EUFB 4CVAA 4M14A 5HE2A 3KKVA 3FZ1A 3VJOA 4S33A 1NW1A 4IM0A 3NVMB 3UP2A 3DAKA 2W99B 3U51A 4JL9A 4B4LA 1CKPA 5J7BA 2CKPA 2IVTA 3C9WA 3D2KA 4PL3A 4WD5A 5HIDA 4EKKA 3CXWA 5CX9A 4U3YA 3BHTA 3FMDA 2WMBA 3HNGA 4QP3A 5KZIA 3WZUA 4RJ5A 3VBVA 3UOJA 1U5QA 4J97A 2PVJA 3A99A 4O2ZA 5IH6A 1M14A 4RT7A 4A9UA 4II5A 4EQCA 2W1ZA 4ALUA 2WMSA 4G3EA 4OAVB 4R1VA 4CTCA 2IW8A 2F7ZE 2AUHA 3KXGA 2ONLA 3VS1A 3R7EA 4O7TA 1WBWA 3QQKA 3BBWA 5EW8A 3BHUA 5A4QA 4MK0A 4CD0A 1Y6BA 5A14A 3Q5IA 3I0QA 5DI1A 4GK2A 2OJ9A 3C13A 1RDQE 3PTGA 2QG7A 3QX2A 5CVHA 3POZA 2ONLC 2QQ7A 3R1QA 2WQOA 4XP0A 1YKRA 2R9SA 3C1XA 4ZS0A 4ZSGA 4RFZA 3NYVA 1G3NA 4R8QA 3BU6A 3CTJA 4FNYA 2ZB0A 3U87A 4Q9ZA 5FM2A 3KRXA 3R8UA 3MDYA 2VO6A 4JIAA 3RJCA 4GJ3A 4EONA 5GNKA 1R0PA 4E3CA 4YHFA 1J7UA 5EFQA 4L52A 1V0PA 1V0BA 5CZHA 3KCKA 3QLGA 2GNJA 4QMZA 2B53A 2ZM1A 3FMNA 5J79A 2BVAA 4QQ5A 3C4EA 5EDQA 3RZBA 3FQHA 2HK5A 4BWXA 1NT2A 2Y9QA 1ZOEA 3MVHA 4MVFA 4IH8A 5EW9A 4NYEA 3E92A 3RNYA 2VWXA 3TUDA 4Y5QA 3I6WA 5EQEA 2CNVA 4H1JA 4CZYB 2Z7QA 5G6VA 3CGOA 2ITQA 5A54A 4PNKA 4FKSA 4RC3A 3MVJA 5AM6A 2YWPA 4DHFA 5IA5A 3NVKI 3N51A 2AYPA 3R1SA 2BHEA 4RFYA 1IAHA 3KF4A 2BDFA 1P4OA 4NIFA 1IEPA 3OEFX 4O0XA 4MQ1A 3GC0A 3P5KA 1KV1A 1EH4A 5J9LA 5LARA 5IQEA 3KULA 3RPOA 4ZY4A 3LMHA 4IHPA 4U5JA 2PMOX 3JR1A 2OFVA 2PZPA 4ZP5A 5M4UA 1OKZA 3A8XA 4AG8A 5G1XA 1FOTA 4FIFA 2X8EA 4WUNA 3TIYA 1HCKA 2WMVA 1OKYA 4KUJA 2B9JA 1H1QA 3E8NA 2JDOA 2QCSA 4FKQA 3UJGA 1ZMUA 3SG8A 4I23A 1U54A 4AW5A 4DYMA 4NM7A 4OBQA 4BCOA 4TW9A 3Q4CA 5LMKA 1OBGA 2VTRA 3PPJA 4FKVA 3AD5A 5TE0A 2XIKA 4AGDA 4RZVA 4EK5A 1JKTA 2VX0A 1H24A 1XBCA 2W06A 3AXWA 1R0EA 3HA6A 2VGPA 3HEGA 3HGKA 4OTPA 2OJGA 4U7ZA 4BGGA 2ITTA 2XK3A 4PTCA 3SX9A 3ZEWA 4ACHA 4E6DA 5J9ZA 5EQYA 4GFOA 4GIIA 3BWFA 4XLVA 5KX8A 5LQFA 3QUDA 4GVJA 5DBXA 2X4FA 5LMKC 3N4VA 5AV1A 5C27A 2IVVA 3QTZA 4A7CA 3DPKA 4PL4A 3WZKA 3W18A 3A61A 3P7CA 5CQWA 2R0UA 2JDTA 5FLFA 5JH6A 3QD0A 2YLEA 3V8TA 1H26A 1NY3A 4R3PA 4R78A 3Q4ZA 1A06A 4RZWA 4U45A 4KKGA 2UW8A 5ANGA 1VR2A 3EL8A 3EKKA 2CGXA 4UMUA 3R9RA 4O86A 3A7JA 4FUYA 2ITXA 2ZDTA 1UU8A 3GU4A 3O71A 3HX4A 3O2MA 3VBWA 3OCGA 2IWIA 3QAME 4BCFA 4QMPA 2P2IA 4BCJA 5DN3A 2XNGA 3PXRA 2IJMA 4OTHA 2I1MA 2WPAA 3FPMA 4PTEA 4AN9A 3CQEA 3QHWA 3A7FA 4A07A 3UMXA 3O17A 3ETAA 5E8XA 4YHTA 4B9DA 5IQAA 3ATSA 2XYNA 3BX5A 3IS5A 4J71A 4ZLOA 3NMUF 1CM8A 2UZWE 2YM4A 4M13A 5H3QA 5I3OA 3TNWA 2WNTA 3LFFA 1TKIA 3CJFA 1M2RA 2W1HA 2XCHA 3MTFA 3OCSA 4HVIA 5DVRA 4EHVA 5DG5A 2UW7A 1I09A 3DAEA 3PY0A 3ZXTA 4BCKA 2XKEA 4EOQA 4W4YA 3JY0A 4TYGA 3COMA 3TT0A 3SRVB 5KHXA 4PUZA 3UIXA 3R2YA 4QMXA 3QXOA 1FVVA 4OTGA 2QO2A 4WNMA 3F66A 3WF9A 3P0MA 4GT5A 3NW7A 5CZIA 4C4FA 3PWDA 3EWHA 3R2BA 4X2FA 4H39A 3PPKA 1O6LA 4K77A 2QC6A 2DS1A 4MXAA 4QPAA 4RVMA 3VF9A 3QTWA 4E5WA 1M7NA 4L01A 2PZ5A 1MRYA 3A60A 4E4NA 4DF3A 2KULA 1S9JA 5AADA 3BGZA 1ZWSA 5J1VA 3P08A 3EQDA 3DK7A 4XV3A 4D2VA 3MWUA 5KHWA 2BDJA 5AP0A 4D0WA 5A6OA 3C7QA 4UEUA 2LAVA 2R3JA 1KE5A 3RALA 3LCSA 3TM0A 4HYUA 3F3WA 4FK3A 4I21A 5T68A 3SXFA 3KN6A 4H3BA 1JOWB 2OIBA 5ANJA 3NIEA 4XV1A 2ERZE 2QR8A 3FL5A 4I0TA 3EFJA 3I4BA 4FC0A 4TWCA 4QO9A 3U6IA 4D2RA 4I1ZA 3ZS5A 2BAKA 4CKIA 2BIYA 2P55A 3GEQA 3G9LX 3MPTA 1W7HA 1Q8TA 1QL6A 2YIYA 3JYAA 3RK5A 4CFFA 3DQWA 4KIPA 1LR4A 4BCGA 5HG7A 2XCKA 4FKLA 5IDPA 5M06A 2WMTA 1IAJA 3TTIA 5DA3A 4AE6A 4M8TA 4QQCA 3QZIA 2E9VA 2EWAA 4RA5A 4YTHA 3RVGA 1SZMA 3FLZA 4I0RA 2GS2A 2BALA 4MEDA 3A4PA 3IDCA 4WRSA 5CU4A 5AEPA 2QOKA 3ALOA 4IDVA 2EXCX 3F61A 3RWPA 5HO7A 5C4LA 4BCPA 5IA4A 3C5UA 2EB3A 5CI6A 4IBMA 4HZRA 3S4QA 5LXMA 3ACJA 1XBAA 3AD4A 2IVSA 3NNWA 4KBAA 5EG3A 4FVPA 3WILA 4DE4A 2JKQA 3DZOA 4BDIA 5KMMA 3D0EA 3ZM9A 3SC1A 3OW3A 5HESA 2IO6A 4CYJA 4C3RA 4FSUA 3R8MA 4EHEA 2EXEA 4TWOA 4L53A 4F65A 3R7GA 4R77A 4TYEA 3REPA 3EFKA 4HVDA 3GQIA 5IQDA 4HVSA 5FP5A 3F3TA 4O7VA 1ZZ2A 2G2FA 3ZO4A 4BL1A 4A4XA 5IA2A 2DWBA 2UW3A 4G5PA 4FSNA 4FIHA 3ODZX 4HCUA 5J8IA 3ZUTA 5BQ0A 5HLWA 1J7IA 4GVAA 4YLJA 3BHVA 3BQCA 5HOAA 3ZBXA 3Q6WA 3TL8A 4DBNA 2R3RA 3GCSA 2Q83A 5B7VA 4FOCA 4J52A 5K5XA 5HNBA 4QP8A 2G01A 3BI6A 4M69B 3LQ3A 3WF7A 3R0TA 2NO3A 4FTQA 2B54A 3KFAA 1WVYA 4W9XA 4EYJA 4MBIA 1XKKA 5BPYA 1GIIA 3KQ7A 4FVQA 2JLDA 5IQIA 3CCNA 3LXLA 4FSZA 4ZS4A 2GQSA 3Q3BA 5AUVA 4CQEA 4DH8A 3ORZA 5K4IA 5J1WA 4KIKA 4XG3A 4G9CA 3QTXA 4IB1A 3NUAA 1WVXA 4ACCA 3B8QA 4JBQA 4APCA 4JG8A 4NTTA 4QOXA 4IB5A 5L2WA 2YM8A 3GP0A 4AA5A 2CPKE 5J87A 3UC3A 3QD4A 2IZSA 4GYIA 1XR1A 3CY2A 5AV4A 4E6AA 1KE7A 5HG8A 2YCRA 3JUHA 3D5XA 5A4CA 2XNMA 4FK6A 3KULB 3E7OA 3MA3A 4NK9A 4XG7A 2C5NA 2W7XA 3BU5A 1ZY5A 2PHKA 3FXXA 3GC7A 4FGBA 3UIMA 4F9BA 3TEIA 4YO6A 1G5SA 2C0IA 3PJ2A 2UW5A 2WMRA 3MPAA 4C4IA 4FICA 3MFUA 1PRYA 2Z2WA 4DT9A 3SXSA 1FBNA 4K33A 2OZOA 3DKOA 4KKEA 4C33A 3L8PA 1U54B 2PMLX 1SNXA 2F2CB 2VZ6A 1JQHA 4FE2A 3FSFA 4YJQA 2HOGA 4TT7A 3VUMA 2JDVA 4YJPA 5L6PA 5DEWA 1O6YA 3MN3A 4FSYA 2BDWA 4GUBA 1HOWA 3MI9A 3QGYA 4TWPA 2WEIA 1YOLA 5FTOA 2XJ0A 3IW7A 1GNGA 4L8MA 2WTVA 5E1EA 2CJMA 5KNJA 5GIPE 2JBPA 3FKOA 2XM9A 3W32A 1Y8YA 2JKOA 4CMTA 1PXOA 3PA4A 5BYZA 1DI8A 5A9UA 5CSXA 5DEYA 2Z7RA 1B6CB 1U59A 4NCTA 1JLUE 2W17A 4C34A 1JKSA 1WCCA 1YW2A 4XS2A 5JFWA 1H1SA 1RQQA 3F9NA 3CIKA 3LJ1A 4WOVA 4BC6A 4EOSA 3IECA 2PVRA 2O3PA 4WG3A 3WBLA 1WBSA 2O2UA 2OXDA 5CEIA 1K2PA 2BAQA 3EQRA 4WSQA 4BGQA 5F1ZA 5CF8A 4NCTC 4XV9A 3KY2A 4DEGA 1YXTA 1ZLTA 2IPXA 1H27A 3QRIA 4LI5A 4YZCA 3TXOA 4PMPA 3QX4A 4CMUA 3G0EA 5CEPA 1UNLA 1UWJA 4GFGA 2QOOA 4P5QA 4XRLA 4DH7A 3UIBA 1E1VA 4YSJA 4LL5A 5TKDA 3V01A 5EW3A 4L9IA 1P5EA 2PSQA 5HKMA 3VUTA 3VS7A 4W4VA 2X2LA 2B7AA 2WKMA 3CQUA 4RJ4A 4QMSA 3ROCA 4BTKA 2HWPA 3PZEA 2R5TA 2IN6A 4PV0A 4LG4A 4RQVA 5DH3A 5F20A 3HMPA 2W9ZB 4N4SA 1XH7A 3E8EA 4FKRA 4FT7A 4FUXA 3RAHA 3VHEA 4C2WA 4EJNA 4EWHA 4ERKA 3VS2A 3DBEA 5LVLA 3DK6A 3G6GA 1MP8A 2F2UA 5EH0A 1YI6A 3QRTA 5CF5A 3E64A 2C4GA 1OL5A 1YWVA 1UU9A 1QPCA 2GCDA 3E88A 3PP1A 1CSNA 1Q8WA 4FNZA 2H34A 3NYXA 2UV2A 3ZU7A 4YR8A 3OT8A 5IU2A 5HLNA 5I0BA 4I4EA 1VYZA 3FHRA 4LRKA 4G17A 5KMOA 2WAJA 4LMUA 4BCQA 2XP2A 5A6NA 4JIKA 3HRCA 3Q9ZA 4AGUA 1Q3DA 3ZDIA 3DTCA 4F99A 5HCZA 3GFWA 2QD9A 4YZNA 4EH4A 4XBRA 3WE4A 3CSVA 2XKDA 3DAJA 4MWHA 4PMTA 5AWMA 4AW0A 4BDCA 3OXIA 3ZUVA 4JAIA 5KO1A 5L8KA 2VWYA 2IW9A 4NFMA 4NM3A 3IQ7A 3PYYA 3PXYA 4DGMA 2HZNA 5CASA 4DLJA 4F1OA 5CU0A 1PYXA 3Q9WA 4WIHA 4IB0A 2WGJA 3HV4A 3R9NA 3CKXA 3ZOSA 4AA0A 2O64A 3IOKA 3QGWA 3W2OA 4RFMA 3GGFA 4S31A 1OKWA 3O8UA 3R7UA 4CT1A 4IM2A 4QPSA 5BVOA 4LMNA 4BZOA 3FE3A 2CLQA 3H9RA 4ASZA 4FT0A 3WIKA 3HAMA 4O2PA 4HJOA 4X2KA 5FP6A 3TDWA 1W98A 2B1PA 2B9HA 2C6IA 5IISA 1PW2A 2XYUA 4YC3A 3EJ1A 3GT8A 3UVPA 2OICA 3F3VA 4G3DA 4Z9LA 2RKUA 4FKTA 4ALVA 3KXZA 4DC2A 1H0WA 3UG2A 4FTUA 4D2WA 4EH2A 4GUEA 5LVPA 2QOBA 3NUNA 3QYWA 2WQEA 5CXHA 4BCNA 5FDPA 2YJRA 4IC8A 1XBBA 3ZO1A 3EN7A 3ANRA 2C1BA 4BBMA 1GAGA 4DAWA 4IVCA 3RPVA 2BUJA 4RPVA 4U41A 4ZTRA 1PMVA 1GIHA 2JEDA 3QQLA 4V04A 3RHXA 3TJDA 4D0XA 5DWRA 2G9XA 2PE2A 5A4TA 2OSCA 4FKPA 4OW8A 1SYKA 4JQ8A 4N57A 5M4IA 4W9WA 3TUCA 4AGCA 2PTKA 4HCVA 4F7NA 4D5HA 4U80A 3MB7A 1YHVA 2I0VA 2OBJA 2GMXA 4AF3A 4XNEA 1H08A 3QRUA 2C6KA 4MNFA 5DT4A 5CT0A 4ZJIA 1Z5MA 2PVFA 4Q5EA 4QTBA 5KMKA 3UNZA 2YACA 2YDKA 3CPCA 4HGLA 4HYHA 3VW8A 3VS3A 3W2RA 3PVGA 5HEZA 5L8JA 1GOLA 4YJSA 5HG5A 4AWIA 3IKAA 4CV9A 1W0XC 4DTBA 4D28A 3ZRLA 2YIXA 3OFMA 4FTTA 2RFEA 3A7GA 4I20A 5KMJA 3U54A 5IMXA 2IZTA 3JVRA 1OIYA 4I5HA 4CFWA 2RF9A 2UZTA 4DG2E 3EIDA 3BE9A 2YZAA 1WBOA 3PPZA 4QMQA 4O6EA 4AZWA 5AP4A 4ZSJA 4U79A 3W55A 4ZLYA 2XIRA 5HZNA 4DFXE 1F3MC 3BGQA 2JIVA 3QQJA 3MESA 5BVEA 1FGIA 1OL1A 3UP7A 2R3QA 4AX8A 4BDJA 4Z16A 3BCEA 3LZBA 4WA9A 4FTKA 2CGVA 5I9YA 3PIXA 3ID6C 4KIKB 2C6TA 2LGCA 5M09A 4WNKA 4K0YA 4YUQA 4KSQA 3KRLA 2R7BA 4BCMA 2VTMA 4BTMA 2YAAA 2YERA 4C57A 1XH4A 2JBOA 2V62A 4EOIA 3GENA 5ANEA 1Q99A 1OUYA 4OT6A 5KKRC 4XLIA 4FSMA 2X6EA 2XJ2A 4LOQA 4KABA 4IAZA 2PZYA 4PNIA 3NEWA 3DBFA 4G6OA 3I0OA 2JIUA 3CKWA 4HYSA 5M07A 3HV5A 5GINE 5T6KA 4HCTA 4BDAA 5JMSA 1NXKA 1V1KA 3DLZA 2HENA 2X0GA 3RNIA 2VNYA 4ACMA 3ZDUA 4UY9A 4JJRA 3Q2MA 1NVRA 4TKSA 1KE6A 3BQRA 3CBLA 5HLPA 3LMGA 4O0UA 4PWNA 2GNFA 4EOPA 2REIA 4R5YA 4ANSA 4B99A 3S00A 4C36A 3TIZA 2WEVA 4GG7A 1FQ1B 4AZSA 3AG9A 4LOOA 2OF2A 4ZTSA 4OAUC 3HMNA 2O63A 4D1ZA 1GY3A 3SDJA 5IDNA 1FMOE 1PXKA 3VO3A 4JBOA 5HBEA 3S3IA 2VWVA 1IA8A 4EUTA 2C6EA 3QYZA 4MKCA 3R04A 3ERKA 3JXWA 1MUOA 2VO0A 4NU1A 5DGZA 5JFXA 3QTQA 5HBHA 5JGBA 2VTPA 4L3PA 3WYXA 5FWKK 4DN5A 2EXMA 3UC4A 3V8WA 3KMWA 4Y95A 4R5SA 1ZYLA 5CU2A 4FEWA 3QA0A 5DOSA 1GIJA 4CFVA 3HRFA 4KIOA 4UALA 3R7YA 3TKUA 3SRVA 1JAMA 2J6MA 3AC1A 1TQMA 3P1AA 4Y8DA 3FXZA 5AX3A 2QOHA 3OZ6A 4MTAA 2YIWA 5L2QA 5ACBC 3EB0A 3F82A 4IJ9A 1Z9XA 4DLIA 3NUXA 5GZ9A 1ZMWA 3BE2A 4OTWA 2R0IA 3FJQE 5HQ0A 5AR4A 2R4BA 2VNWA 3FPQA 3ZBFA 1JKLA 4BCIA 3DQXA 3LFSA 4F0GA 4ZLZA 2WELA 2ITZA 4FKJA 4GT4A 3PSCA 4OR5A 3RMFA 5M56A 2OH0E 4DEEA 3BLHA 1QCFA 1QPJA 5JZJA 1G8AA 4CG9A 5EHYA 1H1RA 4IWQA 1Q8YA 4FNXA 4MF1A 4MBLA 3ULZA 5AUWA 3VS4A 5CF6A 4O83A 4IWPA 2UZEA 3PG3A 1STCE 3G6HA 3DB6A 2UZBA 4GH2A 4BDFA 4GKIA 4JDKA 2WQMA 2CHLA 3NNXA 4N6ZA 4YJUA 3FMKA 4FTIA 1PXNA 2PUUA 3NRMA 3NZ0A 4U6RA 3TZ8A 2XRWA 3WZDA 3W2SA 2E9UA 3GCQA 4X7QA 4G3FA 3V6RA 4E26A 4FZ7A 3EQBA 2NP8A 3FL4A 5IF1A 1IR3A 3R9HA 3E7VA 4O0RA 3WF6A 2PVLA 2QR7A 4UMTA 1YHSA 3H30A 4JR7A 2B55A 2F7EE 2GHGA 5EI2A 3FMLA 1LP4A 5IEYA 4JG6A 1M2PA 3UDBA 4AOTA 3C0GA 3B2TA 2E9PA 2W4JA 4IJPA 4R6VA 4CKRA 3N4TA 5KMIA 4PPBA 4RX9A 5DIAA 4B7TA 3Q9YA 2ZAZA 4BR3A 3UIUA 4JS8A 4C3PA 4RIYB 1MQ4A 4M84A 4GS6A 2CDZA 3P78A 5JSMA 5AP6A 4FMQA 3D5WA 2ETMA 3FZTA 3OT3A 3R00A 4OTFA 5FM3A 3P86A 4Z7GA 3MYGA 2Z7SA 4UWYA 3NLBA 5EYCA 3FI3A 5CEKA 3KK9A 5CEMA 5CNOA 4EOMA 3FEGA 5LVOA 3EFWA 2DUVA 3PFQA 2UZVA 1A48A 2WD1A 3R73A 3KEXA 3VVHA 3D94A 4M69A 5KMNA 2CSNA 5HIBA 3V6SA 5GJDA 2J5EA 3COIA 4YJVA 3UZPA 4ANOA 1BI8A 3D5UA 5IQHA 4UYAA 4C38A 4FT5A 5E9EA 2C68A 5A3XA 5GIOE 3L9MA 5HTBA 2UW4A 5EHOA 1JWHA 4XV2A 2I0EA 4HGTA 1UA2A 5TT7A 3SXRA 3T9TA 1MRVA 4CCBA 3M2WA 4FTLA 2P4IA 4GT3A 3RK7A 2ZMCA 5GHVA 5L2IA 5I5ZA 4E93A 2FO0A 3EQPA 1U46A 2VGOA 2CN8A 2OJIA 2RSVA 3WI6A 3ZSIA 2XRUA 3VBTA 2AC5A 3HRBA 1O6KA 4QD6A 2PU8A 3TKIA 2ZMDA 4K9YA 4YZ9A 4CFUA 4ANLA 3PA3A 2Y0AA 3WE8A 2Y6OA 4C4HA 4G9RA 3BBTB 2PVYA 2VTSA 1LEZA 4PDPA 4IAYA 5CEQA 4EYMA 4RX7A 5AR5A 3ROYA 5EM7A 4M97A 4RC4A 4DFNA 4F63A 4F09A 4MX9A 3TACA 2H96A 2YAKA 3AGLA 2X9EA 4XCUA 2YM5A 3RAWA 4BCHA 4IFCA 1R39A 4DGNA 3ATTA 3R02A 4XBUA 2ZV9A 3VULA 2QHNA 4JQEA 3OUNB 1PYEA 3IGOA 2P33A 3ITZA 3SV0A 2BMCA 1XO2B 2FSLX 3R1YA 3PSDA 1KE9A 3K54A 4QP4A 3MA6A 4E4LA 2XBAA 4L7FA 5M4FA 4DEDA 2J0LA 4YZDA 5KKRB 2C5XA 3V5JA 3W2QA 4J99A 4RWJA 5LJJA 4FTAA 4DTAA 2EB2A 2FSTX 3CLYA 2CGUA 1H4LA 2YIRA 5DE2A 4IE9A 2WU7A 1FINA 2PMNX 2OG8A 5JZNA 1H25A 4XP2A 4F4PA 2UVXA 1JSUA 4A06A 1W8CA 1Q62A 5CU6A 4JNWA 3W16A 4ZTQA 3FQSA 3W33A 4JDJA 4XRJA 3Q4UA 4CFNA 3G5DA 2RIOA 3PVWA 5LVMA 2CCHA 2XNNA 4QMYA 4AW2A 3FLNC 4FV7A 5JT2A 3UZRA 2H9VA 4IADA 4EH5A 1JVPP 3KVXA 4AA4A 5LOHA 3BV2A 3OVVA 4ZTNA 4CQGA 5IH4A 3AOXA 3KRRA 5JFVA 2A4LA 3NYNA 2XA4A 3COHA 4UMQA 1CKJA 4PMMA 3ACKA 3MY5A 2CN5A 3HDNA 4O0SA 4ONAA 4DTKA 1Y91A 4LFIA 4RIWB 4YJNA 3CD8A 4F64A 5BYLA 3E8DA 3QTUA 3LM5A 5E7RA 3C4CA 2QHMA 1RW8A 3LXKA 4NH1A 2E9NA 4W8DA 4Y46A 3F3ZA 3LM0A 3JVSA 4XG2A 3KL8A 3OWPA 1ZYCA 1HCLA 3LFCA 4FIIA 3VS5A 4CNHA 4P7EA 3F88A 3TKHA 4DH5A 4XG4A 3RCJA 4FV4A 4I0SA 3QRJA 2G2HA 3QUPA 4FG8A 4FV2A 2PUIA 4XOZA 3R7VA 4BGHA 3O51A 3QU0A 4O7LA 4AXAA 4AS0A 4O81A 5AAEA 5BMMA 2GHLA 3R22A 2A2AA 4I5PA 3C0HA 1FMKA 2HWOA 3EQCA 5BVWA 4DFYA 3MBLA 4BZDA 4L6QA 1KOAA 3MB6A 5DFPA 2WTDA 4E6CA 4YTFA 3AT3A 4BN1A 4FKGA 1A9UA 3C4FA 3LXNA 1UNGA 2WTCA 4KA3A 3D7TB 4WHZA 4ZAUA 4D4VA 4ZOGA 2ITVA 3DKCA 4XHKB 4V0GB 3PXQA 1PXMA 2FB8A 3LIJA 2J0KA 4H36A 4BKYA 4CFXA 4DH3A 2BTSA 5C4KA 2XNBA 1PMUA 3PIZA 1XWSA 4MH7A 4D9UA 5GZAA 3ELJA 1KE8A 4C2VA 4ZSAA 3KGAA 3UZTA 3R21A 1WBVA 3LPBA 4IZ5A 4K11A 3LLTA 3EYHA 3PJ1A 4IAIA 4JRVA 3LCKA 5D41A 3HMMA 4QPMA 4D2TA 1KV2A 4ZIMA 2BRMA 1VZOA 4MAOA 1ZYJA 3LCDA 5JGAA 2ITYA 3QTRA 4USDA 3UPZA 2FYSA 1E9HA 2GTNA 3COKA 2BIKB 2J7TA 2YEXA 3EN6A 5JK3A 2OK1A 4O7WA 4X0MA 3EKNA 3OXTA 3PG1A 4TNDA 3QZGA 4H05A 2PE0A 4I22A 4R3RA 1BLXA 1MQBA 4NSTA 3IG7A 5ITAA 4EH8A 4EZ5A 4UB7A 1OI9A 5KBRA 2PMIA 4J1RA 2XK4A 3RGFA 3ZRMA 2GFSA 3MVLA 1BI7A 4KB8A 1W82A 2BZIB 4U44A 3MS9A 3FLQA 4LQMA 5L6OA 2OW3A 3UOHA 3BHHA 4XMOA 2V0DA 1SMHA 1UU3A 1SVGA 3Q04A 1JNKA 3NW5A 4O96A 5K4JA 3KC3A 4IMYA 3KREA 2XVDA 3PY3A 4S2ZA 3PWYA 1UV5A 5CSWA 4FIJA 1L8TA 2OJFE 3DKGA 4EORA 2JITA 2VTHA 2A27A 5DR2A 1XH5A 4LL0A 3TUBA 2J0IA 1YDRE 2XNOA 3TV4A 2XIXA 5HD4A 1APME 1OITA 1YDTE 2XUUA 3PE1A 3UG1A 3ZXZA 5CAUA 3BYSA 4NM5A 3VW6A 4RWKA 2QU6A 3FLYA 5AP7A 3G2FA 4RBLA 2O65A 4IEBA 1FVTA 3GFEA 2Z8CA 3HLLA 1Y57A 1R1WA 3F6XA 3TTJA 2HW7A 3S95A 4FZFB 4TN6A 4QMTA 3QKKA 3FHIA 2RFNA 1M7QA 4DEHA 3EYGA 4USEA 2VO7A 3A7HA 4PPCA 5IUHA 2W1IA 3NSZA 2QKRA 2YDJA 3BHYA 4O1PA 4APPA 2JAMA 3I7BA 3OROA 4HZSA 3ODYX 1H1WA 3DB8A 4YBJA 3RM6A 4JVGA 2WTWA 4NL0A 3DBDA 4IWOA 5BMSA 3L8VA 2R3MA 3OF0A 2X7OA 1U4DA 2HCKA 4HGSA 1REKA 5BVKA 4ASEA 1YXUA 2YFXA 4I3ZA 3UQCA 3CR0A 4F6UA 3R8VA 3MFRA 3BEAA 5EM5A 4FTMA 4L67A 4WKQA 4CEGA 1IRKA 2JDRA 1IA9A 2BROA 4B8LA 2H8HA 2R2PA 3QZFA 1TVOA 3C4ZA 3P23A 2R64A 3Q60A 4MXYA 2Q0NA 3T8OA 5ACKA 2B4SB 1H8FA 2VD5A 4MQ2A 3G90X 3LOKA 3R8PA 2B0QA 2H6DA 3U55A 2FUMA 4GYGA 3NCZA 5FGKA 3ZHPC 4ERWA 3AC4A 3DFCB 4YC8A 4YPSA 3F7ZA 5CSPA 5M4CA 4BY9E 4IVBA 5HVYA 3GU8A 4JR3A 4D1XA 4FBXA 4FIEA 5ANKA 4E6QA 3FQEA 3DK3A 3SHEA 4BI1A 2XK8A 1Q4LA 2W1EA 4I93A 4EC8A 3RWQA 3ORMA 2XZSA 3QCYA 4ITIA 3U8WA 3R01A 3I5NA 3TZMA 3OXZA 4DFBA 2WMUA 1J7LA 2C6MA 3JPVA 3MY1A 1PXJA 2JGZA 3KU2A 1J1BA 2BHHA 3Q32A 4C02A 2WO6A 2A19B 4XUFA 3OTUA 4YJOA 5L4QA 4EZ3A 1XJDA 3QQFA 5JEBA 2B52A 4CLJA 5M53A 4E73A 4IVAA 5HORA 3UTOA 1S9IA 2QOIA 2VWBA 3E93A 4FSTA 4N0SA 5EOLA 2W1CA 4ZMFA 2KTYA 5JN2A 2UW9A 4QNYA 5LVNA 4YTCA 3HAVA 3MTLA 4AOIA 4QP1A 3AC5A 3TN8A 4FOBA 3I79A 4E1ZA 1VYWA 5JGDA 4EH9A 4W8EA 5C8NA 3Q4TA 3D14A 4GEOA 4FYNA 1WAKA 4XYFA 4MD9E 5KMLA 4I5CA 5AFVA 3A8WA 4AUAA 4O21A 3C0IA 5LCKA 1PXPA 3Q6UA 3VUDA 4BIBA 4RLLA 4PP7A 5BYYA 2IVUA 3GXLA 3QALE 2UVZA 4QYGA 2HY0A 1JPAA 2VWIA 3O7LB 4YHJA 4X3JA 2WQNA 1WBPA 4ENXA 5FXRA 2C47A 3R83A 3FXWA 3PRIA 2OZAA 3R6XA 2C6DA 4O7NA 2V7AA 3QD3A 1MRUA 2QOCA 3QBNA 3S2PA 5CT7A 3AMBA 5HCYA 4F1MA 4GKHA 2VTLA 4HNIA 2BKZA 2J90A 4O6LA 5FTQA 2B9FA 3OC1A 4DCAA 3UQGA 5CVFA 3HUBA 4BI0A 4C4JA 4QMVA 4O7RA 5CAVA 4G1WA 4LRJA 4EBWA 1DS5A 4UWBA 3V5TA 1JBPE 2R3OA 3LFBA 5CQUA 2NNWB 4ZK5A 4FSRA 3VUHA 4AGWA 5CANA 2R3GA 4AZVA 1OPJA 4YZMA 2C3IB 4ZTMA 5AR2A 5KE0A 4R7BA 5AV2A 5FEDA 4MBJA 5AV3A 3V5PA 4I6QA 4O82A 2ITNA 2OIDA 3W2PA 2VTAA 2UZNA 3R28A 4UV0A 3D2IA 2ZV8A 4UZDA 4DG0E 3CGFA 4FZAB 3VNTA 4BDKA 4DEAA 4UX9A 4DEBA 1LUFA 4EOJA 5IZFA 3NNUA 4MWIA 4QP6A 3ORIA 3UOKA 4HVHA 5ANDA 1K3AA 2HXLA 3H9OA 4X2JA 3TI1A 3FDNA 3FLWA 5F9EA 3VBYA 5FTGA 4QMUA 4NKSA 5D11A 4CFMA 2VTIA 4TRLA 2RG5A 4L43A 5DLSA 1PMEA 3QKMA 4OTIA 3BYVA 3EH9A 4IDTA 3UVQA 3DNDA 1PJKA 4CG8A 4FVRA 1SM2A 2V7OA 4G6LA 4H1MA 5AR7A 1WVWA 4HPUE 4KD1A 5EM6A 5HHWA 3C4XA 4NZWB 2C69A 3BU3A 4FT9A 4QTCA 4RIYA 4RX8A 2JKKA 2WXVA 5CSVA 3VC4A 1YHWA 4AU8A 3UNKA 4GG5A 3FY0A 3N4UA 2WOTA 4TYHB 4JOAA 2WB8A 3GU7A 4XP3A 1BL7A 5EYKA 2JFLA 4KKHA 1UNHA 3I81A 2BRBA 3O7LD 3F5UA 3TZ9A 1R78A 3EMGA 4TTHB 3AT2A 4NKAA 3NIZA 4CGAA 3QWJA 3IGGA 5AUYA 1BL6A 2OI4X 4BYIA 3OG7A 4C61A 4EL9A 5IQBA 5DRDA 4FTCA 4Y73A 4D2SA 4C8BA 3NPCA 1UU7A 5T3QA 1IASA 5D12A 1YXSA 5J9YA 4YGAA 4ZY5A 4LGHA 4CSVA 3O96A 4Z7HA 5IA3A 3GNIB 1GZOA 1ZMVA 4PQNA 4F0IA 2HELA 3F2NA 1XQZA 1CDKA 4A9TA 3VQHA 1PMNA 5EYDA 1H28A 2GPHA 4FODA 3W1FA 5FUTA 2PY3A 3D4QA 2PL0A 5CAOA 4RGJA 3GBZA 4MNEA 2Y8OA 5HBJA 3LFAA 3GU5A 1OL2A 3PJ3A 5KZ0A 4RX5A 1Q8UA 2GFCA 3NUYA 3TDVA 4Y85A 3ZSHA 4FKOA 5HVJA 3ZFMA 4FGRA 4RWIA 5DHJA 4ASDA 2Z7LA 3H0YA 4H3PA 4OBPA 5AUXA 3FYJX 5BUJA 3PP0A 4ARKA 3K2LA 1T46A 4USFA 2VWZA 2V55A 3SKCA 4A9YA 2HYYA 4HVGA 4NEUA 2HZIA 2W5HA 2UZLA 2ZYBA 4N70A 4UXLA 5J5SA 2QI8A 4CZTA 2ZM3A 1URCA 3A62A 5E91A 3UODA 2ITWA 5DRBA 4ZMEA 4DGGA 3L9LA 4S34A 4L00A 4BRXA 4FV8A 3OP5A 1Q5KA 5GZ8A 2VTOA 1XH8A 3QLFA 4N6YA 3D83A 2G1TA 3SD0A 2WMXA 3DOGA 4O22A 3ET7A 1IG1A 2VWWA 3F2AA 2UW0A 3ENMA 4O38A 5F94A 3SOAA 3W8QA 3ORTA 4YLLA 1RE8A 3OW4A 3VRZA 4F9YA 4UBAA 3FMEA 3HUCA 1SVHA 3TZ7A 2R3LA 1Q41A 3FLSA 1YOJA 5E8UA 3NCGA 4QRCA 3A7IA 4JRNA 3DDQA 4AZFA 3OTVA 3OWLA 4EQUA 3I5ZA 2BILB 2X1NA 4J7BA 4P5ZA 1J3HA 3HA8A 4G2FA 4DEIA 2CLXA 2PWLA 4IZ7A 4FL2A 3I1AA 2WOUA 4YBKA 5AIKA 4BVUA 4BYJA 2E9OA 4CT2A 2ZVAA 3ZO2A 1KWPA 3KXHA 4I5MA 2OWBA 5L2SA 4AT4A 4GU9A 1Q3WA 4ID7A 4JXFA 1KOBA 1YVJA 3HV6A 4X6QC 3RZFA 3V5QA 1H1PA 4FTOA 4DFZE 5AA8A 4TL0A 2BRGA 4YC6A 2WFYA 5IH5A 5EDRA 2HXQA 3BYUA 3MV5A 3NWWA 4U43A 4RIWA 4YNOA 1Q61A 3ANQA 4ZZNA 4RVTA 2X4ZA 3PUPA 1OB3A 1QPDA 3H10A 5AR8A 4A9RA 2YIQA 2YN8A 1AGWA 4ZSEA 3FI4A 5TOZA 3R7OA 4AE9A 3HP5A 4G34A 3TNPC 1BKXA 1SNUA 2ZV2A 2CNQA 5BVNA 1G8SA 2F57A 4WG4A 2B9IA 2PUPA 3Q52A 4BDBA 1OM1A 3F69A 4FZ6A 4GRBA 4KAOA 2VWUA 2BZKB 4UXQA 3SGCA 3R30A 3KA0A 5DR6A 5L8LA 2OF4A 5HE0A 4O0TA 3CTQA 3RPRA 3HZTA 2F4JA 5HE1A 1ND4A 3P9JA 4IX6A 1YQJA 5AR3A 4RA4A 2QKWB 2GHMA 3BYOA 3D7TA 3FI2A 2X9FA 3SG9A 3OS3A 4LUEA 4IAFA 4V0GA 5E92A 4Q9SA 4BDEA 4S32A 4L46A 3P7AA 4DFUA 2OZAB 2QLUA 5I9VA 2BKKA 3QCSA 5AAGA 5ICPA 2XB7A 1WBNA 2X6DA 2VRXA 4GK3A 4CKJA 2ETKA 5C03A 4PDYA 3CY3A 3E3PA 3QQGA 5DT3A 5AM7A 2I0YA 4C62A 4ENYA 4GK4A 4I4FA 4FTRA 5M55A 2UW6A 3LJ0A 4TPTA 2NPQA 4YP8A 4PX6A 5H8EA 5EDPA 4EQMA 2GS6A 4F7SA 4F7LA 5IQGA 2OIQA 1FGKA 3WIGA 4BTFA 1P14A 2YISA 2Y4IB 3LHJA 3CS9A 4KS8A 4U81A 4W4XA 4Y5HA 4ZTHA 3OWJA 1WZYA
chains in the Genus database with same CATH superfamily
4JX3A 4EH3A 3LW0A 2ZDUA 4WG5A 3C5IA 1PKDA 4I6BA 4E5BA 4F6WA 4PP9A 3EL7A 3KK8A 4F70A 2BTRA 3P4KA 3NUPA 3RK9A 1QPEA 2XKCA 3E63A 2YDIA 4J8NA 5LWNA 5IMEA 2GQRA 2OH4A 2WQBA 4W4WA 4WBOA 4ACDA 2BZJA 1BUHA 2VX1A 5AUUA 4AACA 2X7GA 2ZOQA 1BYGA 3MFTA 3VS0A 4D4RA 5C9CA 3VN9A 4GIHA 3FC1X 3AC2A 4O1OA 4RJ6A 4OUCA 4RJ3A 4X2NA 2WMAA 3UYTA 1F0QA 3DS6A 3R8ZA 1TZDA 1ERKA 3MIAA 4BI2A 4ITHA 3TV7A 1OIRA 3H0ZA 5AJQA 1PXLA 3K3IA 3K5UA 2WMQA 2R3PA 4BDHA 5A46A 4L7SA 3PDTA 4O84A 3RAIA 4J8MA 3ZC5A 4J96A 3ZSGA 4D4YA 3UE4A 4WSYA 4OT5A 5EI8A 2GQGA 5AV0A 1XH6A 3QKLA 4ZXTA 2X7FA 3DA6A 4R7HA 5DMZA 3U9CA 5D7AA 1YWRA 3CEKA 1JSTA 2DQ7X 3C51A 4WBBB 2WMWA 3MGYA 4AFEA 3VQUA 3VBXA 4IB3A 4QMWA 3AMAA 3II5A 5E8WA 4IW0A 1NA7A 4MYGA 4IVDA 3MIYA 3EHAA 3IW4A 3OOMA 1NVQA 4AN3A 3GI3A 4B6LA 1XMLA 3UDZA 1YRPA 4KIQA 2OU7A 5FG8A 1M52A 5TF9A 4AOJA 3TJCA 1Q97A 4M12A 2YITA 3GVUA 2VTTA 5FXSA 4QEBA 1ZRZA 1ZAOA 4D58A 1ATPE 3QCXA 4M0YA 3CTHA 2PVMA 4GCJA 5D7VA 3U4UA 4MUQA 4GU6A 5AMNA 2W4OA 2C3JA 4PMSA 2YJSA 2BCJA 5IPJA 3LQ8A 3I7CA 2J5FA 2XAOA 5HICA 3O8PA 4XH6A 3DU8A 4ZZMA 5E8TA 3QCQA 3TCPA 2J50A 3GCPA 1JKKA 5H2UA 3ZLSA 4FV9A 4U3ZA 1PKGA 5C8KA 3BL9A 3Q2JA 5AIRA 2SRCA 4MNEB 4EC9A 5M51A 4G16A 3V5WA 3UOLA 2GTMA 3RI1A 5ETIA 5CNNA 2W1FA 3DJ6A 2QO7A 3Q96A 1YI4A 4NW5A 4FJVA 2X2KA 5L3AA 4F9CA 3PA5A 3UPXA 5C26A 4I94A 2QURA 4WT6A 1OBDA 3MH2A 4FSQA 3BPRA 3ZH8A 2XNEA 3GC9A 4R3CA 3ZRKA 5K5NA 4WRGA 2XH5A 2ZM4A 2YM3A 4FTNA 2I0HA 1OL7A 2HW6A 3GB2A 4MXCA 5ETCA 4WUAA 4XEYA 3S0OA 2XMYA 3BWJA 4BICA 2Y6MA 2W0JA 3ORXA 1J1CA 2VU3A 1E1XA 4ZJVA 3D7ZA 4PRJA 4U8ZA 3W0RA 1ZOHA 3BIZA 4UN0C 4FV3A 3M1SA 4TZRA 5EYMA 3D9VA 3ENHA 4F6SA 2W1GA 4FYOA 3FYKX 3G9NA 5HNIX 4O4DA 3F5PA 3QC9A 5EOBA 4ZSLA 5AAFA 3WYYA 2HZ4A 3THBA 4IWDA 2BRHA 4JI9A 4JMQA 4AAAA 2YHVA 3R1NA 4GL9A 5HU9A 4NWMA 3RAKA 5BX0A 4IZYA 3LLAA 2VN9A 4H58A 5EKNA 3BEGA 4BKJA 4GMYA 2PVKA 2GNIA 2VTJA 4J95A 5I9XA 3FSKA 4BDGA 2UZDA 4OTRA 4PDOA 3BLRA 3CP9A 4LRMA 4RJ7A 2Z02A 3SOCA 4YO4A 3PFYA 5JQ5A 1Q24A 4ZEGA 1ZARA 4MCVA 4C37A 1X8BA 3IW6A 1WBTA 4FKIA 3EN9A 5CAQA 3UBDA 4QYFA 3BLQA 5HD7A 1QMZA 3FMJA 4O7SA 4CTBA 5E4HA 4EOOA 3PJCA 3E8CA 4JLCA 2I40A 3FI8A 3LXPA 4IQ6A 4RSSA 2IG7A 5M44A 4DT8A 3CE3A 2UZUE 3AT4A 3RHKA 3FZOA 4K8AA 4AXEA 3POOA 4FG7A 5CLPA 3HVCA 4PY1A 5DPVA 4BFMA 2C5VA 5FD2A 3DV3A 3OBGA 1T45A 3KVWA 4L3JA 3UQFA 2WTKC 3MH1A 2P3GX 2G15A 5CI7A 3WF8A 4G5JA 4JDIA 3TG1A 3ZC6A 4J53A 3ZLWA 2ETRA 2WHBA 2PPQA 4NJ3A 5HO8A 3PXKA 3TMOA 2IEWA 4EJ7A 2EVAA 2ZB1A 4JDHA 3ZZWA 2F7XE 3GOPA 5C01A 2HZ0A 1ZXEA 5CU3A 5ETFA 3RP9A 5CF4A 5HVKA 3U6HA 2IZRA 3N9XA 4R7IA 1M2QA 3HKOA 3BELA 1K9AA 3Q53A 3VBQA 2FSOX 5IA1A 4K2RA 1ZY4A 2F49A 4YPDA 4U0IA 5M08A 4QYHA 4EWQA 3QRKA 2XKFA 4K18A 5J5TA 3R9OA 1ZOGA 2PVNA 4HYIA 1DM2A 5KBQA 5D1JA 4KNBA 5HNGA 3V04A 4MD7E 4RRVA 4XOYA 5GJGA 2J4ZA 5CAPA 3HYHA 3DJ5A 2J51A 3MW1A 4EK4A 5CY3A 2OFUA 4KINA 3QD2B 3KB7A 4I92A 4TXCA 3OOGA 5CALA 2BAJA 4P4CA 5F4NA 3R7IA 1NVSA 3E3BX 3W2CA 3FUPA 4RLKA 2YM6A 3HL7A 4IX5A 4EOLA 3W10A 4RIXA 4DITA 3ZUUA 4O0VA 2OGVA 3LFQA 4MXXA 5AA9A 4TYHA 4C3FA 3EOCA 3UO4A 1KUTA 1OIQA 1J91A 4L68A 3TNHA 3JS2A 1I44A 3RPSA 5IUGA 3DXPA 3G51A 2GDOA 4UMRA 3TNIA 1G8JA 4AFJA 3PY1A 5K0XA 2VO3A 3EQIA 3PVBA 5IQCA 2XF0A 3L1SA 3CD3A 3QTSA 2FGIA 4DBXA 2JAVA 3B2WA 3PZHA 4GV1A 2GNGA 4LV8A 4D5KA 2J2IB 5I9UA 4O4FA 2XS0A 4RWLA 2BPMA 4M68A 3IK3A 5IKWA 2JC6A 2WIHA 3ORKA 4U97A 3NS9A 4JX7A 4U40A 4XX9A 3ALNA 5BUIA 4IZAA 2RFDA 2QOFA 3LFNA 4KRCA 2W96B 2DYLA 3TV6A 3VHKA 3FBVA 4DGOA 3A2CA 5H9BA 2UUEA 3O23A 4WO5A 2X2MA 4E7WA 4X21A 5KUPA 3R71A 5CWZA 3MPMA 3ORLA 2C0OA 5C1QB 4FA2A 3IOPA 3DT1A 3PIYA 4D55A 1CKIA 3KRJA 1W2FA 2CMWA 1GJOA 4EHZA 4F9WA 2V22A 2VTQA 2IZUA 2W5AA 3EQHA 5FBOA 1ZYSA 2O8YA 3QXPA 2QOQA 2PYWA 3LFEA 4FR4A 4EK3A 2OO8X 5AP3A 3ZONA 3P79A 2X8IA 2WIPA 2BZHB 2V5QA 1CMKE 5H8BA 4DGLC 4TYJA 4EEVA 4QTEA 2O5KA 1YI3A 2VAGA 5K9IA 4FEXA 3BYMA 4KWPA 4FZDB 3FKLA 3LCTA 5H8GA 3NYOA 1SVEA 5J95A 4BF2A 3LE6A 2Y7JA 3MJ2A 3IDBA 2ITUA 2A0CX 4QYYA 5HE3A 1VEBA 4K6ZA 4NJDA 4R1YA 5JRQA 5FEEA 2JKMA 2OJJA 4D1SA 2RG6A 3IO7A 4TWNA 3VUGA 2Q0BA 3GQLA 4PDSA 5D9HA 4AZTA 5TR6A 1H00A 3ORNA 2WZJA 2CKEA 4QT1A 4QNAA 3UYSA 2C30A 4C59A 3PLSA 3BZ3A 3F7WA 2JIIA 4QP2A 3AQVA 3QFVA 4AQCA 2PUNA 3KMUA 5ANOA 3SLSA 4OLIA 3KXNA 3OY3A 1YXVA 2XAMA 3OWKA 2PZRA 3GCVA 3IW8A 3OMVA 4DG3E 4IFGA 3E5AA 3V5LA 1BX6A 5CS6A 3UVRA 3IONA 5F95A 4L42A 3OD6X 4J98A 4NUSA 3HV3A 4V05A 3OEZA 3LAUA 2E2BA 4LYNA 4O0YA 3WZJA 4OTQA 2NRYA 4X6RA 3R8LA 5BUEA 3Q9XA 4FSWA 1M17A 4IAAA 4O91A 2C6LA 5IG1A 4B8MA 4ASXA 2P0CA 2P2HA 4C35A 4IAKA 1OPLA 2BFXA 1Y6AA 4AT5A 3TNQB 3OUKA 4FL1A 1H01A 2PVHA 4IX3A 1GZ8A 4X3FA 4YMJA 4KBKA 4TYIA 1H0VA 5AP5A 3BGPA 4G3CA 4UWCA 5BVFA 3LVPA 5IUIA 3F5XA 3FMHA 4FI1A 4FNWA 2ZV7A 4XG9A 4D2PA 4XG8A 2J0JA 4NIFB 4BKZA 4C7TA 3WOWA 3C50A 3EQFA 2BR1A 2CKOA 1H07A 2FSMX 4ANMA 4BTJA 3EQGA 5DT0A 1LPUA 4G31A 4X3FC 3AC3A 4U42A 5LMBA 1W83A 3NUUA 5K3YA 5CENA 4L44A 2O0UA 4E5AX 3V8SA 4ZTLA 3E62A 2IW6A 1ZZLA 3CJGA 3DNEA 4FIGA 2XJ1A 3NGAA 4QMOA 1XHAA 3FWQA 2GNHA 2XK9A 4CRLA 5BVDA 5M57A 2XIZA 2X39A 4GFMA 4WNPA 2R3NA 3ZYAA 3RKBA 5L6WL 4DCEA 5I4NA 2VTNA 2PK9A 3QF9A 1OZ1A 2EU9A 4G6NA 5LMAA 3SA0A 2YABA 4Z55A 3G15A 2WTKB 3GC8A 3L8SA 5J7HA 2C3LA 5E8YA 4EOKA 3U6JA 4Q5HA 4K1BA 3UO6A 4AZEA 4BWKA 3BV3A 3UO5A 4JQ7A 3W8LA 4DA5A 2A98A 3ZLYA 5IQFA 4JG7A 3VWAA 3KRWA 2BFYA 2BRNA 4F0FA 3OCBA 1VJYA 3HMOA 4IC7A 3IW5A 2YCSA 3NX8A 4HPTE 3BKBA 4KBCA 4G3GA 4YSMA 4E20A 5AUTA 4FEQA 3GU6A 4Q2AA 5FQDC 1UVRA 2C0TA 3FKNA 3PE2A 3QZHA 3NAYA 5E8SA 2GU8A 3ZMMA 3ZTXA 3U9NA 4A9SA 2C6OA 2UVYA 2W5BA 4AN2A 4YNEA 3O0GA 4RG0A 2CCIA 3DBQA 2R3HA 1W84A 4MF0A 2J0MB 1OKVA 3NAXA 4I24A 3HV7A 4M15A 3MVMA 3NR9A 3GUBA 3VIDA 3HMIA 1F5QA 3IPHA 2Y4IC 1PXIA 1WMKA 3NUSA 4Z3VA 2C5OA 3MH0A 4QQJA 5B2MA 1FVRA 1URWA 4EUUA 3O50A 3DKFA 3EN4A 3PVUA 3DJ7A 3H3CA 4JT3A 1P4FA 5CTPA 5IEVA 5B2KA 4PTGA 1KSWA 4AT3A 4QYEA 5HTIA 1ZYDA 5ANIA 2OXXA 2HY81 2R3IA 3C4WA 2XK7A 3FZSA 2C1AA 4I41A 4QP9A 2RFSA 1PHKA 4IM3A 4EK8A 1DAWA 5HO6A 4NT4A 4P90A 4M7IA 4ANBA 4E4XA 2W9FB 1DI9A 4OBOA 4QTDA 1P2AA 3T9IA 4Y83A 4YJRA 1AD5A 3KCFA 5E8VA 2FVDA 4ANNA 4EK6A 2G2IA 2QOLA 2I7QA 1B38A 3VJNA 5DYJA 4FKUA 4EH6A 2I6LA 3QL8A 4FV6A 5FBNC 3UMWA 3F3UA 1XH9A 2PZIA 2W1DA 3GOKA 3OHTA 4M3QA 4WNOA 4ALWA 4CZUA 4RIXB 1OUKA 3CQWA 2ACXA 4QQTA 5AP2A 3D15A 4BBFA 3RINA 2X81A 3AGMA 5DNRA 5HX6A 3QC4A 2F9GA 3OY1A 3KMMA 1YDSE 3VS6A 3MSSA 2FA2A 3FC2A 3L9NA 4ZZOA 1U5RA 4ITJA 4C58A 5HIEA 5HG9A 3PXZA 3G33A 2JDSA 3QUEA 3WZEA 3QQHA 5K0KA 3P7BA 3TWJA 5JQ8A 4A4LA 2ERKA 3DXNA 5HI2A 3V3VA 2YCQA 4P2KA 1TQPA 4FF8A 5ETAA 3EFLA 3DY7A 2W05A 2QG5A 5EKOA 2Z60A 2GNLA 5HCXA 2YM7A 4BHNA 4CCUA 4B0GA 4QTAA 3FAAA 4GJ2A 4PPAA 4LV5A 4I6LA 2XBJA 4ZY6A 4MHAA 4TY1A 3RCDA 5HU3A 5FDXA 5EM8A 4YJTA 4LGGA 3M42A 5AUZA 5C8MA 4F1TA 4I6FA 5JRSA 3SW4A 5DR9A 2CNUA 2RGPA 3AMYA 3O8TA 1GZKA 3LCOA 4C4EA 2ESMA 4I6HA 2YA9A 4IXPA 4EBVA 4EZ7A 2YZLA 3FMMA 5L2TA 4C4GA 4PF4A 3FY2A 4QMLA 4DH1A 4EKLA 4L45A 3KF7A 1L3RE 4S30A 1DAYA 1Y8GA 4BIEA 5TO8A 4LOPA 5HTCA 4NTSA 3K3JA 3QTIA 5AX9A 4BBEA 3SW7A 4D9TA 4YZBA 2PE1A 3L9PA 4MD8E 3RM7A 5KCVA 2ITOA 3UNJA 1R3CA 1YOMA 4RJ8A 4JBVA 4MXOA 4BHZA 1YWNA 2XM8A 5FXQA 5E8ZA 4RVKA 4BDDA 4M66A 2OXYA 5JKGA 3ZM4A 4V01A 3ORPA 3ZZEA 3VF8A 4O27B 4DINA 4PL5A 4MXZA 4BWPA 5HGIA 3GCUA 2GS7A 3R9DA 3QQUA 4FV1A 4F7JA 3U4WA 2QU5A 3F2RA 2YCFA 3MH3A 2YLFA 5BNJA 4ORKA 1FPUA 3IDPA 2C3KA 3PRFA 3ZLXA 4FX3A 4F08A 1PY5A 3CC6A 3JY9A 4YURA 3ZFYA 1Z57A 2XNPA 3HDMA 3ZCLA 3UGCA 2R3FA 4FEUA 3VAPA 3DCVA 4CLIA 3PLAE 4TNBA 4UYNA 3RTPA 3R63A 4QMMA 4H3QA 4XJ0A 4FEVA 2GSFA 1JSVA 4FT3A 4CMOA 2C5YA 3MJ1A 3FZRA 4AW1A 3NNVA 3SVVA 2Y4PA 3EN5A 3ZO3A 5B0XA 2QVSE 5EQPA 3MY0A 4AXDA 1CTPE 2WTIA 2RL5A 1REJA 5CXZA 4F9AA 3HP2A 1OECA 3B8RA 4NM0A 4X2GA 4BIDA 2YWVA 4NW6A 4FTJA 4QP7A 3KXXA 4M0ZA 5FEQA 1OIUA 3E87A 1UWHA 3I6UA 3MFSA 4X3FB 3BRBA 3PSBA 4E8AA 3PXFA 5A4LA 3DGKA 4JBPA 1W2DA 2FH9A 1RJBA 3I60A 4RIOA 3Q5ZA 4FL3A 1XMMA 5D10A 3RPYA 4BB4A 3NW6A 4IANA 4KSPA 4KS7A 4L3LA 3VUIA 4D4SA 4DFLA 4YU2A 4YLKA 2OLCA 1B39A 3NDMA 4OTDA 3ML1A 4Y72A 4O7YA 2QODA 5I3RA 4RMZA 3L8XA 5JFSA 3M11A 2JFMA 4RVLA 5LWMA 3EZRA 4CV8A 1TQIA 3AC8A 1WFCA 3S1HA 4RQKA 2X8DA 2OKRA 5E90A 3OBJA 4ANQA 2QO9A 1OGUA 3ULIA 2PULA 1UKIA 3FZPA 3H4JA 3DFAA 4O0WA 4ZJJA 2XEZA 3SQQA 4O7ZA 3LFDA 2CKQA 4HGEA 5AP1A 2J9MA 4CYIA 1OMWA 3PJ8A 3T3UA 3WARA 3G0FA 2UZOA 1OPKA 4FRFA 4U9AA 5HX8A 3F5GA 4LM5A 1GZNA 5I9WA 4YTIA 3LJ2A 3SAYA 3ZEPA 3LKMA 5CVGA 3A4OX 4ACGA 2XK6A 3OCTA 2R3KA 4OGRA 2HAKA 4RC2A 3D5VA 3AD6A 3ZFXA 1BMKA 4CRSA 3V51A 5A4EA 4HW7A 5B2LA 4CXAA 5EK7A 4E4MA 2QNJA 4UMPA 5E1SA 3LQ5A 3FV8A 3HECA 3QA8A 4HOKA 4M67A 5CYIA 2WU6A 5GJFA 5CEOA 3VRYA 4GW8A 2A1AB 5IEXA 1OL6A 4FV0A 4LUDA 4AP7A 5I9ZA 1PF8A 3RBWA 5CSHA 4GSBA 1AQ1A 2XIYA 3DTWA 4XG6A 3T3VA 5EI6A 2QONA 1V0OA 2HIWA 4FG9A 3K5VA 5FRIA 4NFNA 4LGDA 3KN5A 4EI4A 4KRDA 4FKWA 2XEYA 2VX3A 4IACA 1YXXA 4IX4A 2R7IA 5LCJA 2ITPA 3QWKA 2AC3A 1UKHA 2ZJWA 4IIRA 3DBCA 1ST4A 3KXMA 3DXQA 4EH7A 2NRUA 3EZVA 3QHRA 3CPBA 1Q8ZA 4FV5A 4UZHA 4BZNA 5IA0A 3DLSA 3WF5A 4JAJA 2VV9A 1LEWA 4HNFA 2QLQA 4C0TA 5EHLA 4EHGA 1O9UA 4QMNA 1OVEA 2JD5A 2WTJA 2W4KA 4A4OA 2VUWA 3DZQA 3LMIA 3DDPA 3H9FA 3VUKA 2CGWA 2EUFB 4CVAA 4M14A 5HE2A 3KKVA 3FZ1A 3VJOA 4S33A 1NW1A 4IM0A 3NVMB 3UP2A 3DAKA 2W99B 3U51A 4JL9A 4B4LA 1CKPA 5J7BA 4AXFA 2CKPA 2IVTA 3C9WA 3D2KA 4PL3A 4WD5A 5HIDA 4EKKA 3CXWA 5CX9A 4U3YA 3BHTA 3FMDA 2WMBA 3HNGA 4QP3A 5KZIA 3WZUA 4RJ5A 3VBVA 3UOJA 1U5QA 4J97A 2PVJA 3A99A 4O2ZA 5IH6A 1M14A 4RT7A 4A9UA 4II5A 4EQCA 2W1ZA 4F78A 4ALUA 2WMSA 4G3EA 4OAVB 4R1VA 4CTCA 2IW8A 2F7ZE 2AUHA 3KXGA 2ONLA 3VS1A 3R7EA 4O7TA 1WBWA 3QQKA 3BBWA 3NFFB 5EW8A 3BHUA 5A4QA 4MK0A 4CD0A 1Y6BA 5A14A 3Q5IA 3I0QA 5DI1A 4GK2A 2OJ9A 3C13A 1RDQE 3PTGA 2QG7A 3QX2A 5CVHA 3POZA 2ONLC 2QQ7A 3R1QA 2WQOA 4XP0A 1YKRA 2R9SA 3C1XA 4ZS0A 4ZSGA 4RFZA 3NYVA 1G3NA 4R8QA 3BU6A 3CTJA 4FNYA 2ZB0A 3U87A 4Q9ZA 5FM2A 3KRXA 3R8UA 3MDYA 2VO6A 4JIAA 3RJCA 4GJ3A 4EONA 5GNKA 1R0PA 4E3CA 4YHFA 1J7UA 5EFQA 4L52A 1V0PA 1V0BA 5CZHA 3KCKA 3QLGA 2GNJA 4QMZA 2B53A 2ZM1A 3FMNA 5J79A 2BVAA 4QQ5A 3C4EA 5EDQA 3RZBA 3FQHA 2HK5A 4BWXA 1NT2A 2Y9QA 1ZOEA 3MVHA 4MVFA 4IH8A 5EW9A 4NYEA 3E92A 3RNYA 3W0PA 2VWXA 3TUDA 4Y5QA 3I6WA 5EQEA 2CNVA 4H1JA 4CZYB 2Z7QA 5G6VA 3CGOA 2ITQA 5A54A 4PNKA 4FKSA 4RC3A 3MVJA 5AM6A 2YWPA 4DHFA 5IA5A 3NVKI 3N51A 2AYPA 3R1SA 2BHEA 4RFYA 1IAHA 3KF4A 2BDFA 1P4OA 4NIFA 1IEPA 3OEFX 4O0XA 4MQ1A 3GC0A 3P5KA 1KV1A 1EH4A 5J9LA 5LARA 5IQEA 3KULA 3RPOA 4ZY4A 3LMHA 4IHPA 4U5JA 2PMOX 3JR1A 2OFVA 2PZPA 4ZP5A 5M4UA 1OKZA 3A8XA 4AG8A 5G1XA 1FOTA 4FIFA 2X8EA 4WUNA 3TIYA 1HCKA 2WMVA 1OKYA 4KUJA 2B9JA 1H1QA 3E8NA 2JDOA 2QCSA 4FKQA 3UJGA 1ZMUA 3SG8A 4I23A 1U54A 4AW5A 4DYMA 4NM7A 4OBQA 4BCOA 4TW9A 3Q4CA 5LMKA 1OBGA 2VTRA 3PPJA 4FKVA 3AD5A 5TE0A 2XIKA 4AGDA 4RZVA 4EK5A 1JKTA 2VX0A 1H24A 1XBCA 2IF8A 2W06A 3AXWA 1R0EA 3HA6A 2VGPA 3HEGA 3HGKA 4OTPA 2OJGA 4U7ZA 4BGGA 2ITTA 2XK3A 4PTCA 3SX9A 3ZEWA 4ACHA 4E6DA 5J9ZA 5EQYA 4GFOA 4GIIA 3BWFA 4XLVA 5KX8A 5LQFA 3QUDA 4GVJA 5DBXA 2X4FA 5LMKC 3N4VA 5AV1A 5C27A 2IVVA 3QTZA 4A7CA 3DPKA 4PL4A 3WZKA 3AKJA 3W18A 3A61A 3P7CA 5CQWA 2R0UA 2JDTA 5FLFA 5JH6A 3QD0A 2YLEA 3V8TA 1H26A 1NY3A 2X0OA 4R3PA 4R78A 3Q4ZA 1A06A 4RZWA 4U45A 4KKGA 2UW8A 5ANGA 1VR2A 3EL8A 3EKKA 2CGXA 4UMUA 3R9RA 4O86A 3A7JA 4FUYA 2ITXA 2ZDTA 1UU8A 3GU4A 3O71A 3HX4A 3UDSA 3O2MA 3VBWA 3OCGA 2IWIA 3QAME 4BCFA 4QMPA 2P2IA 4BCJA 5DN3A 2XNGA 3PXRA 2IJMA 4OTHA 2I1MA 2WPAA 3FPMA 4PTEA 4AN9A 3CQEA 3QHWA 3A7FA 4A07A 3UDTA 3UMXA 3O17A 3ETAA 5E8XA 4YHTA 4B9DA 5IQAA 3ATSA 2XYNA 3BX5A 3IS5A 4J71A 4ZLOA 3NMUF 1CM8A 2UZWE 2YM4A 4M13A 5H3QA 5I3OA 3TNWA 2WNTA 4DHZA 3LFFA 1TKIA 3CJFA 1M2RA 2W1HA 2XCHA 3MTFA 3OCSA 4HVIA 5DVRA 4EHVA 5DG5A 2UW7A 1I09A 3DAEA 3PY0A 3ZXTA 4BCKA 2XKEA 4EOQA 4W4YA 3JY0A 4TYGA 3COMA 3TT0A 3SRVB 5KHXA 4PUZA 3UIXA 3R2YA 4QMXA 3QXOA 1FVVA 4OTGA 2QO2A 4WNMA 3F66A 3WF9A 3P0MA 4GT5A 3NW7A 5CZIA 4C4FA 3PWDA 3EWHA 3R2BA 4X2FA 4H39A 3PPKA 1O6LA 4K77A 2QC6A 2DS1A 4MXAA 4QPAA 4RVMA 3VF9A 3QTWA 4E5WA 1M7NA 4L01A 2PZ5A 1MRYA 3A60A 4E4NA 3O5AA 2KULA 4DF3A 1S9JA 5AADA 3BGZA 1ZWSA 5J1VA 3P08A 3EQDA 3DK7A 4XV3A 4D2VA 3MWUA 5KHWA 2BDJA 5AP0A 4D0WA 5A6OA 3C7QA 4UEUA 2LAVA 2R3JA 1KE5A 3RALA 3LCSA 3TM0A 4HYUA 3F3WA 4FK3A 4I21A 5T68A 3SXFA 3KN6A 4H3BA 1JOWB 2OIBA 5ANJA 3NIEA 4XV1A 2ERZE 2QR8A 3FL5A 4I0TA 3EFJA 3I4BA 4FC0A 4TWCA 4QO9A 3U6IA 4D2RA 4I1ZA 3ZS5A 2BAKA 4CKIA 2BIYA 2P55A 3GEQA 3G9LX 3MPTA 1W7HA 1Q8TA 1QL6A 4DHIB 2YIYA 3JYAA 3RK5A 4CFFA 3DQWA 4KIPA 1LR4A 4BCGA 5HG7A 2XCKA 4FKLA 5IDPA 5M06A 2WMTA 1IAJA 3TTIA 5DA3A 4AE6A 4M8TA 4QQCA 3QZIA 2E9VA 2EWAA 4RA5A 4YTHA 3RVGA 1SZMA 3FLZA 4I0RA 2GS2A 2BALA 4MEDA 3A4PA 3IDCA 4WRSA 5CU4A 5AEPA 2QOKA 3ALOA 4IDVA 2EXCX 3F61A 3RWPA 5HO7A 5C4LA 4BCPA 5IA4A 3C5UA 2EB3A 5CI6A 4IBMA 4HZRA 3S4QA 5LXMA 3ACJA 1XBAA 3AD4A 2IVSA 3NNWA 4KBAA 5EG3A 4FVPA 3WILA 1TFFA 4DE4A 2JKQA 3DZOA 4BDIA 5KMMA 3D0EA 3ZM9A 3SC1A 3OW3A 5HESA 2IO6A 4CYJA 4C3RA 4FSUA 3R8MA 4EHEA 2EXEA 4TWOA 4L53A 4F65A 3R7GA 4R77A 4TYEA 3REPA 3EFKA 4HVDA 3GQIA 5IQDA 4HVSA 5FP5A 3F3TA 4O7VA 1ZZ2A 2G2FA 3ZO4A 4BL1A 4A4XA 5IA2A 2DWBA 2UW3A 4G5PA 4FSNA 4FIHA 3ODZX 4HCUA 5J8IA 3ZUTA 5BQ0A 5HLWA 1J7IA 4GVAA 4YLJA 2X0PA 3BHVA 3BQCA 5HOAA 3Q6WA 3TL8A 3ZBXA 2R3RA 3GCSA 4DBNA 5B7VA 4FOCA 4J52A 5K5XA 5HNBA 4QP8A 2G01A 3BI6A 4M69B 3LQ3A 3WF7A 3R0TA 2NO3A 4FTQA 2B54A 3KFAA 1WVYA 4W9XA 4EYJA 4MBIA 1XKKA 5BPYA 1GIIA 3KQ7A 4FVQA 2JLDA 5IQIA 3CCNA 3LXLA 4FSZA 4ZS4A 2GQSA 3Q3BA 5AUVA 4CQEA 4DH8A 3ORZA 5K4IA 5J1WA 4KIKA 4XG3A 4G9CA 3QTXA 4IB1A 3NUAA 1WVXA 4ACCA 3B8QA 4JBQA 4APCA 4JG8A 4NTTA 4QOXA 4IB5A 5L2WA 2YM8A 3GP0A 4AA5A 2CPKE 5J87A 3UC3A 3QD4A 2IZSA 4GYIA 1XR1A 3CY2A 5AV4A 4E6AA 1KE7A 5HG8A 2YCRA 3JUHA 4DHJA 3D5XA 5A4CA 2XNMA 4FK6A 3KULB 3E7OA 3MA3A 4NK9A 4XG7A 2C5NA 2W7XA 3BU5A 1ZY5A 2PHKA 3FXXA 3GC7A 4FGBA 3UIMA 4F9BA 3TEIA 4YO6A</