2ETMA

Crystal structure of focal adhesion kinase domain complexed with 7h-pyrrolo [2,3-d] pyrimidine derivative
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
272
structure length
262
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Crystal Structure of Focal Adhesion Kinase Domain Complexed with ATP and novel 7H-Pyrrolo [2,3-d] pyrimidine scaffolds
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 262
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2etmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2etmA01
5L2SA 3PY3A 3LFFA 2OIQA 1CSNA 3MH3A 4A9RA 4PX6A 3ATTA 3S2PA 4M13A 5JFXA 2QHMA 3CTHA 4FSZA 3RK9A 3EN5A 4F09A 2BFYA 3COKA 2J0JA 4M84A 4QQJA 4D55A 1JKSA 1R1WA 3A7IA 4H36A 3QL8A 4J98A 3R8LA 2XK7A 3PYYA 3NDMA 3UJGA 4ANQA 4P4CA 4WUNA 3NWWA 4ASXA 1SNXA 3BHTA 1XH5A 3BQRA 2B53A 1ZMWA 3HLLA 3KVWA 5CF5A 1YI3A 4BYJA 4GUBA 3L8VA 3ZO3A 3FMHA 2PZ5A 4I6HA 3NW5A 4YLLA 4CYJA 5HTBA 2O63A 4ASZA 1OITA 4C61A 5IQIA 4I24A 4MTAA 4RX7A 3TXOA 2Y4IC 2OXDA 1ZMVA 4UBAA 4YBJA 5M55A 4ZLYA 2XB7A 5DVRA 4MD9E 3RBWA 4CCUA 5M44A 3ZM9A 1WVXA 2JBPA 3TCPA 4IAIA 4TL0A 3T3UA 4O0VA 3LFCA 3UOLA 5M4IA 4O7SA 1UU8A 4QMOA 3TN8A 5I9YA 4XEYA 4FEVA 2OICA 2VNWA 5LMKC 4GUEA 2Y8OA 2HK5A 5EM8A 4XP0A 4ZSJA 1V0OA 4J71A 4UY9A 4IWDA 2VTMA 4GVJA 2EXMA 3QTUA 5HOAA 4BCNA 4QMYA 4BFMA 3DJ7A 1L8TA 3CE3A 4UB7A 4NFNA 3FLQA 4O91A 5HHWA 1UNHA 1Q3DA 4YNEA 4IH8A 5IH5A 3KMUA 4ERKA 3DJ6A 3QQFA 1GY3A 2QOHA 4A9SA 3LQ8A 1OIRA 4EOQA 4FV4A 5HICA 2ZJWA 2WMVA 1H1RA 4C4EA 2PZYA 3NIZA 5BVFA 1BYGA 1SM2A 3TUDA 2R3KA 2YCSA 5FM2A 2OZAA 3D2IA 3FL5A 1GIHA 2A2AA 2IJMA 3C1XA 2WEVA 4YJNA 4E6DA 4GU6A 4GKHA 3POZA 5IMXA 3MB7A 3R7GA 3HYHA 4TTHB 1CKJA 2UVZA 3BIZA 4LRKA 4FG9A 1Z5MA 4LQMA 4NU1A 3BWJA 4AW1A 3S1HA 4FTUA 3ZSHA 4JDJA 3UZTA 3QTZA 3QHWA 3HZTA 4JBQA 4ZTQA 4MCVA 1H0VA 3CIKA 4NUSA 3HL7A 1TQPA 3QXOA 4L9IA 3BLRA 4E6AA 5CQWA 4FSRA 3VS1A 1U54A 3O0GA 4U42A 3SRVB 4DFXE 3CQWA 4IVDA 4GFGA 3TV7A 3OY3A 2VX0A 4HNFA 3QGYA 3OROA 3QLGA 2XEYA 1JVPP 5L6OA 2VTSA 5EI8A 5IQDA 3VVHA 3QQKA 3AC2A 4CG8A 4E73A 3TZ7A 3LM0A 3KRRA 3P7BA 3PJCA 3QKKA 4LMUA 5CVHA 3EQIA 3QRTA 2JDTA 2WMBA 4U43A 2P4IA 4R3RA 4DTAA 5AAGA 4TPTA 5M4CA 3RZBA 4DG2E 5I4NA 4BKJA 2UZWE 4O0SA 3QYWA 4FL3A 3F3WA 3OT3A 3TL8A 2XNEA 4R3CA 1TQIA 4BCMA 5IEXA 4PWNA 4IJ9A 4Q5HA 1LPUA 1PF8A 2PVJA 3ZCLA 4BC6A 5IG1A 1IAJA 1JSVA 3G51A 5C03A 4MXOA 5C26A 1MUOA 4IWQA 2C6DA 3TACA 4YJQA 3HAMA 5HLWA 4DE4A 4PMPA 2PVMA 2WXVA 3MFTA 3F5UA 1H01A 4RVTA 4YC8A 3V8TA 3FMMA 1BX6A 3UO5A 3AQVA 4QYEA 4DITA 1URWA 3BE9A 3O7LB 4IB3A 3R1NA 5CALA 4FF8A 4UMQA 5L6WL 2QVSE 3HA6A 5IQFA 4ACDA 2VTNA 3QC9A 5K5XA 4R77A 2YDKA 3E8DA 4UN0C 4ZP5A 4RC3A 5TR6A 2R2PA 3G15A 1IEPA 3GB2A 3BYOA 5FBOA 3JPVA 3VBVA 2HZIA 4FVQA 3MJ1A 1XO2B 3QTXA 2NP8A 2Y6OA 2O2UA 1P14A 3C50A 5AV0A 4BRXA 3R9RA 4BHNA 4DFYA 4BCGA 1RE8A 3QKLA 4G5JA 3COIA 2XIYA 3ORKA 3UP2A 3KB7A 2XYUA 4WSYA 4IX4A 4J7BA 3LW0A 1J7UA 2X7OA 3D5WA 3BU5A 5M56A 2J0LA 4F9YA 5J7BA 1PXMA 2ZMDA 2ITQA 1Q61A 2P2HA 2FVDA 2Y4PA 2SRCA 4I5HA 5B0XA 1AGWA 2GNIA 4RJ5A 5F94A 4EI4A 4IX6A 3R00A 5LQFA 4OT6A 5K0XA 4L7FA 3L1SA 5HESA 3H0ZA 3SDJA 2YM6A 3EN4A 3PA4A 4JT3A 3FZTA 4KIKB 5IH6A 3D94A 4Z9LA 5K4IA 4IWPA 5KMLA 5L8KA 5LVOA 1XJDA 2UV2A 2W1IA 5BYLA 4GV1A 2HAKA 4QNAA 2JITA 1F3MC 4MYGA 5JT2A 3D15A 1Y8GA 3EQHA 4K9YA 1V0PA 3ZUTA 2XIRA 4BCQA 2PE2A 2WKMA 4S33A 4DN5A 4O7ZA 4O7NA 2ERKA 5L2TA 3F66A 1FVRA 3IO7A 4G3DA 3K54A 4EUTA 2EB3A 3VRZA 5EK7A 4Q9ZA 5HD4A 5C1QB 4FV2A 3ZRLA 4RRVA 5FDXA 3RPOA 5IUGA 2NRUA 1U5QA 4UMPA 4BBMA 3VHKA 2PY3A 1H4LA 2XKDA 4ZXTA 4M0YA 4IACA 4F6UA 2GNFA 4FZFB 2W99B 1WCCA 3HV3A 3FV8A 2VO7A 4XOYA 5KKRB 1NXKA 3GC0A 3TKHA 4JIKA 2BVAA 3R22A 3PZHA 4O2PA 4AZSA 1BKXA 2WFYA 5HVYA 4IB5A 4Y5HA 4DFLA 2XKFA 3R01A 4AA0A 2ITYA 5CY3A 5CZIA 5DIAA 2XKCA 4GFMA 4RX9A 5LWNA 4NEUA 2PVKA 2CSNA 3LFBA 3SQQA 2GQGA 1BLXA 2GDOA 3A7FA 4C57A 5I9VA 3W2RA 4DFUA 4F0IA 2HWPA 4KUJA 4Y95A 3OXTA 1I44A 3BYSA 3UQCA 3UYTA 3R30A 2C6IA 3M42A 3WI6A 4C58A 4EH4A 4FT9A 4NL0A 5AUVA 4TT7A 4X7QA 1E1VA 1CKIA 1YXSA 2WTKC 2UZEA 4F6WA 5CF6A 3O23A 3FBVA 4AFEA 4JQ7A 5D9HA 1MP8A 4CFMA 2VWBA 2PZPA 4FUYA 2R0IA 4MVFA 5LCKA 1T45A 3GU5A 4J8MA 4RQKA 1NT2A 2WO6A 4RSSA 2GPHA 4IE9A 2HXLA 4V05A 2CHLA 3FI8A 4OTIA 4ANMA 3UZRA 2QOBA 4NJ3A 4YC6A 1O6LA 3R0TA 2BKKA 4II5A 3D0EA 4R8QA 3AD4A 4CVAA 2IO6A 2E9OA 4FG7A 2X1NA 3Q6WA 4HCUA 2R4BA 4NIFB 4CZTA 5CAVA 3OMVA 2BIYA 2QCSA 1PXOA 2PVRA 4G5PA 2VTLA 4NM7A 1RDQE 3WF5A 5HX8A 3QTRA 4U6RA 4QYFA 2NRYA 4FV3A 3LAUA 4HJOA 1PMUA 3LIJA 4EZ7A 3UVPA 3FKOA 3FPQA 4EK5A 3FDNA 2YIQA 2UW8A 5C01A 3TNHA 4PPAA 5KMJA 2HZ4A 2W96B 2H8HA 5A4CA 2NO3A 4OT5A 2RFEA 3OWLA 3BLQA 4V01A 3KREA 2VZ6A 3VQHA 3UTOA 4BCPA 3EH9A 5LOHA 2CKOA 3RAHA 4QMNA 3KMMA 4JDIA 4MBLA 4BCFA 2X4FA 2ITUA 3GBZA 5K3YA 3HX4A 3TKIA 4EC8A 5BVOA 4JBPA 3REPA 3HP5A 2V55A 3WZKA 4KIPA 1H00A 3L8SA 4Z7GA 2JKQA 3FWQA 4E20A 3EWHA 3R7UA 4B6LA 4NSTA 4OTDA 1KSWA 3HV7A 3LMIA 2VTRA 4D2SA 3UQGA 2OGVA 2GMXA 4FKSA 3FKLA 4G17A 4KINA 3R8VA 2NPQA 2HYYA 3JR1A 3UOHA 2A1AB 2IVSA 1JQHA 3ODZX 1PXPA 2FA2A 4BDDA 4PMTA 3RK7A 2CNVA 3GGFA 3KCKA 2BRMA 3G2FA 4OTPA 5IKWA 5KBQA 2VTQA 4WOVA 3AMYA 3HMPA 5CAPA 5BVWA 4YJOA 3PPZA 5AM6A 4NKSA 3GCPA 4RZWA 4ZSAA 3ALOA 4YNOA 2YCFA 3NNVA 4HYSA 4IM3A 3AMBA 4MAOA 3OW4A 3ZTXA 4XOZA 3K3IA 4ZJJA 4JG8A 3QHRA 5KBRA 5AR2A 4ZTMA 5D7VA 4FIHA 2UW7A 4NW5A 1FQ1B 2B52A 3QQUA 3PTGA 4KIQA 4MKCA 3B2WA 4FTAA 4LRMA 2OJGA 3PSBA 4DGNA 4EYJA 2LGCA 5IQEA 4ITJA 4FTJA 5M4FA 3ET7A 4FX3A 4XG4A 4WNKA 1ZY5A 3OT8A 3QCYA 1LEZA 1XH4A 4GK4A 1FVVA 3OWKA 2H96A 4A07A 1ERKA 5J7HA 4OAUC 4GSBA 4MD7E 3HMIA 5DLSA 3WF6A 3L9MA 4CD0A 5D12A 5HORA 5H3QA 2DQ7X 3LFDA 4FIGA 4WBOA 3UODA 4EONA 2KULA 2OK1A 5BUEA 3VBYA 3NAXA 2ZYBA 5CS6A 3HV4A 3C5UA 3G90X 4RX5A 3HMOA 3FQEA 4AACA 3NYOA 3OBGA 3QWKA 2J4ZA 2ZM3A 1OB3A 1V1KA 3EZVA 3KK9A 3BGZA 3IKAA 3RPVA 3ITZA 3DNEA 3DDQA 1F0QA 1Z57A 4FKGA 1T46A 4XBUA 4FTLA 2BFXA 3ENHA 3HRBA 3IS5A 3QU0A 4PV0A 4TYGA 4ZJVA 3IPHA 4FNYA 2Y4IB 1NVQA 4FV1A 3KULB 3TNPC 1ZAOA 3WF7A 2YAKA 4GJ3A 4KABA 4TKSA 3E5AA 4KBAA 3OY1A 3B2TA 4QOXA 1KV1A 2BTRA 3NAYA 2QG7A 5TF9A 2ZAZA 2I0VA 5BVEA 2PMLX 4GJ2A 4A06A 3S4QA 3OW3A 4LV5A 4DTBA 3WZUA 5LMAA 2PVNA 4AT4A 4IC7A 2O5KA 5FTGA 4I20A 3QUEA 4TNDA 3NUXA 4ZZOA 3A7JA 5CZHA 4H39A 2ZVAA 2JKMA 4OTRA 4ZLOA 4QTBA 4WUAA 4DEGA 4USEA 1Q41A 3KRXA 4O2ZA 1H1SA 5IA4A 3ZLYA 2W5HA 1YI6A 3O96A 4QMWA 3ZOSA 4MWHA 5AV3A 4C2WA 3S0OA 1PJKA 3Q3BA 1YRPA 4W9WA 3R2BA 4GW8A 3RM7A 2PPQA 4BL1A 4GYGA 3WF9A 3II5A 3VS3A 4BCIA 3DDPA 4RLKA 2YWVA 1G3NA 2Z7QA 1CMKE 5DRBA 4ALUA 2YEXA 3UMXA 2W1HA 5ANOA 4BDEA 2QODA 2JKOA 2XNPA 5AR8A 5ETFA 3W8QA 4QQ5A 4E5AX 4HYUA 2WMUA 4ZAUA 2V62A 4IQ6A 3DLSA 3IW4A 4XLVA 2PUUA 3GU7A 3TZMA 3ELJA 5L8LA 3C7QA 3C4WA 3A60A 2GTMA 2ITTA 3FE3A 4BIDA 4FZ7A 4IM2A 1KE5A 3W33A 2ITVA 2OW3A 2G2IA 4XRLA 1U46A 1ZMUA 4F1MA 4GVAA 2P3GX 1Y6AA 5HLPA 3WIKA 5IQGA 5ANEA 3KEXA 1Q8ZA 2VO3A 3ZUUA 3OUKA 4KAOA 2VTHA 2WU7A 4FSTA 5AP5A 1CKPA 4FT5A 2QR7A 5CEKA 4GEOA 1VEBA 2C68A 1VJYA 3WZEA 1V0BA 4RC4A 1O9UA 5AP1A 3LPBA 5AV1A 4ACGA 3FXXA 1FINA 1DI8A 5TOZA 4ZTSA 4O1OA 3DOGA 4JX7A 1XR1A 3OEZA 3HRFA 4S31A 4V0GB 3H0YA 4CV9A 4A4XA 4FBXA 3QAME 4D1ZA 2ONLA 2X8DA 3OXIA 4ZIMA 4AX8A 4QMTA 3S95A 3EMGA 3RMFA 2WOUA 3E3PA 2WTVA 5D7AA 2BUJA 2Y7JA 4X2KA 3PXQA 3QZHA 3BU3A 4FTNA 5FGKA 3ZO2A 5C27A 4ID7A 1AQ1A 2PSQA 3TV6A 3DFAA 2W1GA 3BCEA 3VUTA 4EK4A 5GJDA 5CU2A 2QD9A 3MPMA 5FUTA 3I60A 3F5GA 4D9TA 4RC2A 3C9WA 3AOXA 5L3AA 2HWOA 2A4LA 4XUFA 3FZ1A 1H1WA 3QALE 4H3BA 4WIHA 3RINA 4UWCA 3VC4A 4HYIA 4X2NA 2WZJA 4APPA 4CT1A 5BVDA 4XG3A 3LMHA 3LXPA 4FT7A 3VW6A 4QMUA 4EYMA 4FEWA 3O17A 3T8OA 3I1AA 4A9YA 3C0HA 3I4BA 3PDTA 4AW2A 5HE0A 2YM7A 5JKGA 2F57A 4ZY4A 2YJSA 3KRJA 4L7SA 3Q52A 1Q3WA 4XV2A 3EB0A 5ITAA 3QZFA 3LHJA 2BTSA 4V04A 1OUYA 5EYCA 4MBJA 3H10A 2C6EA 2FSTX 4BI1A 5I9WA 3MN3A 4D4SA 1S9IA 3D14A 3W10A 3FI2A 3AGLA 3Q4UA 2XVDA 4DINA 3NEWA 3QD2B 4Y8DA 4O0RA 4ORKA 4D2VA 2HCKA 4I41A 4KRCA 2PULA 4ZTHA 3WOWA 5T6KA 1YOJA 2CCHA 1W83A 4M97A 3OCGA 4UMTA 4OBPA 2CPKE 3TJCA 2IVUA 4HW7A 4FZAB 5C8KA 2CGWA 3CXWA 5IU2A 2C6KA 2VWIA 4HCTA 5ACKA 3EQRA 5EW9A 4CQGA 2WQNA 3PIYA 4O7VA 2VTTA 2WB8A 4I5CA 3KKVA 4FKLA 1EH4A 3RJCA 4J99A 3ZSGA 3KMWA 4E4XA 1OI9A 2F9GA 5DFPA 3SKCA 5CASA 1HOWA 2UZBA 4U41A 3FMLA 3OCBA 3QUPA 5ANJA 3BYVA 3PSDA 3PY0A 3U4UA 2VNYA 3HMNA 4M8TA 3RPYA 3PJ8A 3Q60A 3UO6A 1ZOEA 4ZSEA 2WU6A 2OJFE 4FOCA 3QA8A 1Q8YA 4F65A 2Z60A 4D5KA 5BUJA 4DGLC 2XZSA 3NR9A 4N70A 2I0EA 2XRWA 4IAYA 4EORA 5F20A 3DK7A 1J91A 4ZSGA 4AOTA 5AADA 1Q8UA 3WARA 4IZ7A 4AW0A 2EU9A 1H27A 2ZDUA 4MD8E 4F08A 1GJOA 4CFVA 4BWXA 4WD5A 3UO4A 5C8NA 3DXPA 3DKGA 2IW8A 4BBFA 4HCVA 3NPCA 1W98A 3ORNA 4DCAA 3QC4A 2OBJA 5LXMA 2C3IB 2XJ2A 3PXKA 2YDJA 2OFVA 3KN5A 3P7AA 3TNWA 1QCFA 3T3VA 5EDPA 1M14A 5CU4A 4AFJA 4AF3A 2X8EA 2XIXA 4WRSA 1H24A 4MBIA 3F2AA 4A9UA 5C8MA 3ZS5A 3W32A 4L43A 4YO6A 2JAMA 4RFYA 5A14A 3SG8A 3R73A 5L8JA 3ACJA 1LP4A 2BZHB 2WHBA 3DXNA 3EFWA 4KKHA 5EOLA 4D9UA 5IMEA 3WE4A 3ZXTA 2W17A 4CFFA 3ANQA 5FEQA 2OH0E 4WNOA 1ZOGA 1QL6A 2JAVA 3DQWA 4BDGA 4FOBA 2IN6A 2J2IB 4FTCA 4GFOA 4DT8A 2J51A 4EH9A 3GP0A 3RPRA 4AE6A 4APCA 4L45A 2WTKB 4QTDA 1AD5A 3HUCA 3R1QA 3JY0A 3MV5A 4L3JA 3R7VA 5KUPA 1XH9A 2YISA 2W1CA 3LJ0A 2JD5A 3LXKA 4EQMA 4UZDA 3AC8A 3GI3A 2Y9QA 1Y91A 4IAKA 2A0CX 4ZY6A 3S3IA 1GZNA 5EM5A 4IFCA 2AYPA 4FV5A 3NCGA 4IJPA 3VS5A 3A61A 5HNBA 2GS2A 2YDIA 5FD2A 4KB8A 5IA2A 4IIRA 5EKOA 3P5KA 3R6XA 2YN8A 3PWDA 1DAYA 2VX3A 3Q9XA 1GAGA 2C6TA 3Q4CA 4JBOA 4U3ZA 4FI1A 5DBXA 2QI8A 4QTEA 3E8NA 2X8IA 1P5EA 5E90A 5FM3A 4YZBA 5KX8A 2XBJA 5EDQA 3GT8A 3BQCA 3MDYA 4QYYA 4RWIA 4YJUA 3ZZWA 5J1VA 1R78A 4AW5A 4WNPA 5IA5A 2RFNA 1Q8TA 3RWPA 3LCKA 3UOJA 2ETMA 3BHHA 3GNIB 3OWPA 4K0YA 4NIFA 4AAAA 3R1SA 4J97A 3LVPA 4CKIA 2ZV9A 4WHZA 2WPAA 3PVGA 4IVAA 4MF0A 5GZ8A 4YZMA 5AMNA 1B39A 1IR3A 4DEDA 2ZMCA 5CEOA 3ZO1A 4D4YA 5EOBA 5FBNC 1M52A 3V8WA 3MSSA 4JBVA 3RZFA 4FTOA 3ORLA 4BCOA 4PNIA 2OG8A 3IGGA 3L8PA 3LLTA 4F9CA 4FL2A 2CGUA 3PJ1A 4ZZMA 1PYEA 2BRHA 4YBKA 2A19B 4DA5A 4LI5A 4EKLA 2QKRA 2C3KA 3GU8A 4FYOA 3RP9A 4R6VA 3IDPA 2QU6A 5ETAA 3GQLA 4B99A 2XNGA 3P0MA 5HU9A 2QLQA 4C3PA 3VS4A 4FODA 4EWQA 4FV9A 3W2OA 2BAKA 4TW9A 3D7ZA 1UU3A 5DE2A 2OXYA 1SVGA 3E63A 4QP4A 1FGIA 2XK3A 3LQ3A 4XYFA 3M11A 4DH1A 2VO0A 4FK3A 4XP3A 1WBOA 2V22A 5L2QA 5LVLA 3PJ3A 3Q6UA 4J52A 4TWNA 3VS2A 3JYAA 4XG2A 4NW6A 3UC3A 1JKTA 2R3IA 4L53A 2EVAA 4BVUA 4YLKA 1GNGA 3FMDA 2X2LA 1YOMA 2B54A 4Y46A 1WVWA 5CU3A 4CYIA 4JXFA 5JGAA 5LCJA 4GMYA 5KMMA 2W1DA 5E1SA 3HP2A 4EOMA 5IEVA 3LQ5A 2X2KA 4U9AA 5L4QA 1OBDA 5A9UA 5HO6A 2HW6A 4GS6A 4QP8A 3DKOA 3CJGA 4PP7A 2XCKA 4DT9A 4KBKA 4NT4A 3DAKA 3RHKA 4JDKA 4CMUA 2P55A 3GU6A 5KHWA 4D4RA 3TDWA 3KU2A 2J5FA 3QTIA 4CZUA 3NVMB 4DH5A 4FEUA 3JXWA 4O7WA 4D4VA 4FV7A 2ZV2A 4JAIA 4PF4A 3EQFA 2R7BA 3ZFYA 4WG3A 3LXLA 3GOPA 3DB6A 4RBLA 3E62A 3TTIA 4EHVA 2PYWA 3H9OA 3FMKA 3P23A 4QMPA 4U79A 3NMUF 1OL7A 4UYAA 5EI2A 4MXYA 3GCVA 2IVTA 5CT0A 5E4HA 3P9JA 4JDHA 4P5ZA 3QZGA 4OLIA 4P2KA 3SOAA 4CQEA 3PP0A 3U87A 2WIPA 4LGDA 1LEWA 4EOSA 1NY3A 5A4QA 2YA9A 3DZQA 5E1EA 4CG9A 2YIRA 4FV0A 4MXCA 3IW5A 2VU3A 3OHTA 4XJ0A 2GS6A 1A48A 3MVMA 2E9VA 3UGCA 4RGJA 4XV1A 3R04A 4ENYA 5EYMA 5KZ0A 4LL5A 1PYXA 3CPCA 3OUNB 2YCQA 5CI6A 5A46A 3BKBA 2VTIA 5BQ0A 4ZOGA 2VTOA 4Z55A 5HVKA 5CTPA 3CY2A 1R39A 3HGKA 1YWRA 3KULA 2OU7A 2J6MA 3DBDA 5CX9A 4AWIA 3N4TA 5AR5A 2XJ0A 3SG9A 2VD5A 3F9NA 3EHAA 3MY1A 4L44A 3P4KA 3VAPA 3AC4A 4DLIA 2W4KA 3BV2A 1XHAA 4C62A 2VWVA 3OBJA 5GIOE 1P2AA 2CDZA 1IAHA 1ATPE 4EUUA 4KSPA 4DBXA 4K18A 4O0WA 5LMKA 1M17A 4IX5A 4J1RA 4E6QA 3VS7A 4MHAA 2YHVA 4HZRA 4JS8A 3I5NA 5HO8A 4F6SA 5C4LA 3CSVA 1KE9A 3QKMA 5L2WA 3FMJA 2R3NA 1SNUA 3EYGA 1MRYA 1U4DA 4OTFA 4NM3A 2PWLA 4PTEA 2OJJA 3QUDA 4GK2A 3GC9A 3UIBA 2O3PA 4DTKA 4O96A 3UZPA 5JQ8A 1NVSA 3AG9A 4XG8A 5AUXA 5IA3A 4NFMA 4ANOA 3MY5A 1J7IA 1ZOHA 2R3JA 5DN3A 2VRXA 2CNUA 2C0TA 3OOGA 2OIDA 2RG6A 5FDPA 5HCXA 4X3FC 3E64A 3ZBFA 4OAVB 3WF8A 3WZJA 3MA6A 3EQGA 2A27A 3FY0A 2CN8A 1Q5KA 3GCUA 5J87A 1IA9A 1OKWA 2WNTA 4KRDA 1PMEA 4AG8A 4ANNA 4C4IA 2RFSA 3Q4TA 4IFGA 3KC3A 4B4LA 4N0SA 4YZ9A 4FKIA 3NUYA 2QU5A 2BILB 4JG6A 4L8MA 1OKYA 4PL3A 3R8ZA 5H9BA 4ZY5A 5BPYA 3RAIA 3QX2A 2Z2WA 1YW2A 4EH8A 3FJQE 4RIYB 3SOCA 2V7AA 1UWJA 5JK3A 4YZCA 3UC4A 4BTJA 2Y0AA 3NNUA 5HE3A 1PY5A 4JQEA 3Q5IA 5JFSA 3LCDA 4F7SA 3OCSA 4IZ5A 4FSYA 3E8EA 3RNYA 5IDNA 2QNJA 2X7FA 2W4OA 3UYSA 3ORMA 3DFCB 5M06A 5IQHA 4FKOA 3PUPA 1J3HA 2BZIB 1TVOA 4KNBA 3T9IA 5CVFA 4M12A 3DGKA 4AA4A 4YPDA 3VUIA 1Y8YA 2G1TA 3D7TB 4PQNA 4X6QC 4D1SA 3HVCA 4V0GA 4BDKA 4YU2A 3LM5A 2JBOA 4U0IA 5HLNA 4O82A 4CFXA 4YLJA 4S30A 2XCHA 1ZLTA 4HZSA 5FLFA 2YITA 1F5QA 1QMZA 2RG5A 3IDBA 4JLCA 3W2SA 4AOIA 4HNIA 3TUCA 2ZDTA 3ZONA 3EN6A 3DS6A 3CQUA 3FQSA 4L68A 4C3RA 3NSZA 2WGJA 3E92A 3PZEA 2W06A 4G9CA 5CSXA 4BI0A 4QQTA 2IW9A 1URCA 4RWLA 4HVHA 1G8SA 4IANA 2X0GA 3O50A 3UNKA 4CGAA 5L6PA 4ALVA 5ETIA 2CCIA 3SXRA 4ZTNA 3EYHA 3PJ2A 4E4LA 5JSMA 4JRNA 5DWRA 4UV0A 3PLAE 3KXMA 3LJ1A 3QFVA 4TYJA 3SC1A 1J1CA 3FPMA 3UNZA 3ZO4A 2VWYA 4AU8A 5AIRA 2ZOQA 1YDRE 4AZFA 4FE2A 4PTGA 1OUKA 5JRQA 2XS0A 4F0GA 4JAJA 2C1AA 3EL7A 1PMVA 5HIDA 4FEQA 5KE0A 1PXNA 5IA1A 1PMNA 3MVJA 4LOOA 3A2CA 2FUMA 2F7XE 3BBTB 4YUQA 3Q9YA 4QMMA 4OTWA 3OFMA 4FYNA 5K5NA 4YGAA 4OGRA 4XHKB 4CFWA 3NW6A 4CXAA 3EL8A 5IF1A 2ZM1A 4MWIA 5AEPA 4ASDA 2EB2A 4PRJA 3Q53A 3FYKX 1KOAA 3CPBA 3NUSA 4HPTE 4O22A 4U44A 3UE4A 3IW7A 4F7NA 3K3JA 5DEWA 4PDSA 1VYZA 2I0HA 4C33A 4I23A 5E8XA 4FSMA 4M0ZA 3ULIA 1XQZA 2GQSA 3ZRMA 4QYGA 4TWCA 5H8BA 3NZ0A 5AUZA 1OL2A 5ANIA 3AGMA 3QF9A 3D2KA 1HCKA 4I6QA 2YIXA 4L52A 3EQBA 3NRMA 4G3CA 4YP8A 2R3LA 3C4ZA 1G8AA 2PUNA 1HCLA 2WMWA 5KZIA 2DS1A 4KS8A 5EYKA 5DYJA 5BMSA 3OCTA 4HVDA 3UG1A 5M09A 3TIZA 5HTCA 4FGRA 4DC2A 4FR4A 4RLLA 2XK9A 2B4SB 2F4JA 2AUHA 3GC7A 4O81A 2WELA 3NS9A 3EFLA 2OLCA 5CAQA 1OPLA 1Y6BA 2FB8A 3DBFA 3KRLA 4FMQA 4QO9A 4JOAA 4O38A 5GHVA 4EBVA 2XH5A 2W1FA 1YXVA 4I6BA 4JRVA 3PIZA 1KE7A 2VGPA 4CZYB 4IVBA 5EH0A 3GQIA 5EM7A 2FSOX 3DTWA 3DU8A 3V6RA 4ZLZA 3CGOA 4O0UA 1NVRA 2Z02A 3GCSA 3AC3A 3EFJA 3U55A 2PMIA 3F2NA 1H1QA 2GNGA 2JFMA 2YM5A 3I0OA 3OXZA 2UW0A 2JDVA 3MBLA 4FKQA 2X81A 4WG4A 3V5WA 4EK3A 3PP1A 5IQBA 4MNEB 5K4JA 4EOLA 4L6QA 4K2RA 4CCBA 2YM4A 4FTIA 4X2FA 3IW6A 3LZBA 4J8NA 3RK5A 5M08A 5J79A 2JGZA 5TO8A 3H4JA 4H3QA 1YXTA 2E2BA 2WMSA 5AP6A 4IX3A 5BYYA 4BTMA 1RQQA 4K1BA 1PKGA 1SVEA 5CU0A 4FTKA 1OL5A 4AGUA 2O0UA 2BKZA 3NUAA 2UVYA 4NTTA 5HD7A 3RCDA 4W4YA 1M7QA 2ZB0A 4NK9A 3VO3A 3L9LA 4FIIA 4KD1A 3HDNA 4QD6A 1JLUE 2OXXA 5AR7A 2F2UA 3A7HA 4Y85A 5EHYA 3LCOA 3R8PA 4JQ8A 4CEGA 3O51A 4D2RA 4TYHA 4FV8A 3CBLA 3QRUA 2RGPA 3DZOA 4PNKA 1BMKA 5D1JA 3ZZEA 3N9XA 3G9NA 5IH4A 3BHUA 4PP9A 1WAKA 1S9JA 4MH7A 2I0YA 2PE1A 2VWUA 2W1EA 4EOKA 2DWBA 2VWWA 3ZLSA 2C6OA 3CGFA 5HX6A 3O71A 4IW0A 3PA3A 5IA0A 4PUZA 5HE1A 1GZ8A 1MRVA 3NNXA 4W4VA 3A8WA 3CEKA 5CEPA 4EH3A 1JBPE 4UXQA 5FWKK 2UZNA 3VUHA 2BROA 3OTUA 4YZNA 3V5LA 5HU3A 4EL9A 4I0RA 3POOA 5A4TA 3A8XA 2OO8X 3LFQA 4I22A 1OBGA 4M68A 2G01A 3JS2A 4XMOA 5ETCA 1ZZ2A 3AT2A 4FIEA 1H0WA 4MX9A 3RALA 4FNZA 3DBQA 3FEGA 2R5TA 3IW8A 3PRFA 2PU8A 4ANSA 3AMAA 3E93A 2C5YA 2ACXA 2B9HA 4DFZE 3VQUA 4RWKA 1WBWA 2C3JA 4O7LA 1BL6A 4FNXA 4XV3A 3ORZA 4I21A 2BRBA 4XV9A 4PPBA 5K9IA 1UKHA 3ZLXA 1CM8A 3BGPA 1H25A 4RJ8A 5HE2A 1PKDA 5I0BA 2CLQA 3ODYX 1OL1A 4L3LA 2J5EA 2UZDA 3IGOA 4J95A 5E92A 4C2VA 4MXZA 4PPCA 4R3PA 5CLPA 2YM3A 2PMOX 2WD1A 4DFBA 4ACMA 3VBTA 5AAEA 3CC6A 1WBSA 4E7WA 4BIEA 3LMGA 4K77A 2BCJA 4FTQA 3PG1A 3UG2A 3QRIA 3V51A 5FTQA 4DEIA 2GFCA 3F61A 1YWVA 2WMAA 4QP1A 4TN6A 4CMOA 3PXFA 4GT5A 5KMOA 3CTJA 3FAAA 3WE8A 2JIUA 5EYDA 4RJ6A 4D28A 4EHZA 4JX3A 2XA4A 3MWUA 4O7YA 5M57A 3V01A 4Y83A 5KHXA 1ZY4A 3H9FA 2WMRA 3NGAA 5JRSA 4KWPA 4YTCA 1JPAA 3V5TA 4W9XA 4E4NA 2PVYA 4O1PA 5AAFA 2QOFA 2Y6MA 1ZYCA 3FSFA 3IOKA 1YOLA 4X2JA 4H05A 2CKEA 4WA9A 4I6FA 5B2MA 4M3QA 2BR1A 3I6WA 3ULZA 3CR0A 3ACKA 4AZEA 2UZLA 4I0TA 4RIWB 3FMEA 2WAJA 1E1XA 2C0OA 3QRKA 4B8LA 3EJ1A 3PRIA 4LV8A 4FT3A 5J9LA 5HGIA 1ZYSA 2BDFA 1IA8A 5CVGA 2JIVA 4YTHA 3VN9A 4J96A 5A4LA 2XNOA 5HVJA 1KE6A 5LMBA 3D5VA 5DG5A 4L67A 2VN9A 1W0XC 1VZOA 2VV9A 2Z7RA 2HXQA 2ZV7A 3KGAA 3QTWA 4M69B 2BALA 4AZTA 4BTKA 4C8BA 3ATSA 3LKMA 4BHZA 1QPDA 4IC8A 2VWXA 3F7WA 5J95A 4S2ZA 4RJ4A 2R9SA 3A4OX 1IASA 1SMHA 2QO7A 2XUUA 3DBCA 5L2IA 4ZS4A 2UW4A 4Y5QA 2E9PA 2GSFA 4IDTA 1ND4A 3RHXA 4DLJA 5DR9A 4F7JA 5GZAA 3SW7A 1OPJA 2J90A 4OTGA 3IECA 4AN3A 4BGGA 1YHSA 5LJJA 1OIQA 2BDWA 2YERA 3OWJA 4KBCA 5DR2A 4LOQA 3FYJX 4E5WA 3OC1A 3BLHA 4E6CA 4NCTC 2R3FA 1YQJA 3FC2A 4F1TA 4AGDA 3I0QA 2OJ9A 3PG3A 4TZRA 3V5PA 4QT1A 4FSQA 2QR8A 3Q04A 2R3OA 4JR7A 2AC5A 4QPAA 4EBWA 5JFVA 4RVMA 3GFWA 2XRUA 4DEBA 4LGHA 5AA8A 3D4QA 3AT4A 3IK3A 4CFUA 3EN9A 3EOCA 3V3VA 5TKDA 4NJDA 3RVGA 4FSUA 3C4FA 1OIUA 4DEEA 5LARA 4GYIA 4PMSA 3SVVA 2QKWB 2WTWA 4MK0A 2UW5A 4OBOA 5HNGA 4AZWA 5C9CA 3FUPA 2PVHA 5B2KA 4U80A 1PXJA 3RI1A 4UALA 3Q2MA 4UWYA 3O8UA 4PDPA 4YJPA 2YIYA 3NUPA 3D5XA 2WMQA 3TKUA 5DT3A 3LFSA 4JI9A 3DNDA 5J9YA 4I4FA 1J7LA 1XBCA 2X9EA 3DPKA 3JUHA 3KFAA 3QBNA 4X3FB 1ZYJA 3R9DA 3E7VA 3HNGA 3PVBA 4Y72A 3EN7A 5HIBA 3DK3A 4L00A 3WZDA 4BZOA 4W4WA 3U8WA 2UZUE 3R9HA 2FSMX 3SV0A 2Q0BA 4AS0A 4IWOA 4IXPA 2WTDA 4R5YA 4EH2A 2UUEA 2VTPA 2P33A 3PPKA 4H1JA 4XLIA 1DAWA 4E26A 3Q2JA 4FNWA 4X2GA 3A7GA 3ALNA 4B9DA 5GJFA 3VUGA 1GZOA 4F99A 1UA2A 2BZKB 3DT1A 4ASEA 1JSUA 2XYNA 4RJ7A 3L9PA 4EOIA 4KS7A 5DI1A 1B6CB 3QQJA 1VYWA 4QPSA 5J8IA 5CF4A 4ONAA 4FEXA 4AXAA 1ZARA 4YTFA 3R1YA 4TYIA 3BYMA 1ZZLA 4F4PA 4QMLA 5CANA 1UVRA 5CXHA 4J53A 4RIYA 1H08A 3DY7A 2J0IA 2BPMA 3GXLA 4K6ZA 3UQFA 1JKLA 2XK6A 1R0PA 2W1ZA 4EH7A 5AP4A 3OF0A 4C4HA 1JSTA 3OOMA 5HO7A 5D11A 2YLEA 1K3AA 4MNFA 1GOLA 4DEAA 3TG1A 4C34A 5DMZA 2C30A 2HZ0A 4JVGA 5JMSA 2O8YA 4YTIA 2XBAA 5DGZA 4M67A 3D7TA 2PVFA 3PVWA 1KV2A 4AOJA 1YDSE 4GG7A 4FIJA 4C4FA 3FI3A 4C37A 5HNIX 5JEBA 4EOPA 5AV4A 5CI7A 4B7TA 2EWAA 4WRGA 5CEQA 3EIDA 5H2UA 4D2PA 1OGUA 1YDTE 3RM6A 1OMWA 4B0GA 4YMJA 5D41A 4NCTA 1KUTA 1DM2A 4LUEA 3OG7A 2GTNA 2OJIA 4ZJIA 1SVHA 2R3QA 4G3EA 4FGBA 4ERWA 5FXRA 4RFMA 1KWPA 3PA5A 4MF1A 3UVQA 4ZTLA 4RIXB 5AX9A 2V5QA 4IEBA 4BI2A 4QMQA 4O7RA 3MH2A 4G31A 3VIDA 2O65A 4O7TA 3ROCA 4F9AA 5BUIA 4LFIA 2WTIA 3BX5A 3FZSA 3A99A 3B8RA 3BU6A 3QD4A 3EZRA 4EOOA 5AX3A 3BBWA 1OM1A 1M7NA 2B1PA 4G2FA 4RVLA 4XBRA 3EKKA 2GHGA 3F2RA 4CLJA 4C7TA 3PXZA 4IAZA 4WT6A 4ANLA 4E5BA 4U40A 2XIKA 1IRKA 5I9XA 4Z7HA 1TKIA 4FIFA 2XNNA 2FSLX 5KO1A 2R3MA 4KKEA 5LVPA 4RWJA 3D83A 4O21A 1OECA 4I3ZA 4AA5A 1E9HA 2GHLA 3NCZA 3OEFX 3TTJA 1ZYLA 2IWIA 5CU6A 3P79A 2C5NA 3V5JA 5IUIA 2B7AA 4F1OA 2C4GA 2GS7A 3AD5A 3F5XA 5DOSA 3OD6X 4L46A 2W7XA 1W82A 4FKJA 2Z7LA 4U5JA 3UOKA 3WBLA 4F64A 5GINE 1W84A 2HELA 2UW6A 3ORIA 4R5SA 5EQPA 4W4XA 5FEEA 3VF8A 5J5TA 4F9BA 2I6LA 1FBNA 5E91A 3NYNA 2BRGA 2X6EA 3FQHA 3MS9A 3ORTA 5J9ZA 4QYHA 1WZYA 4BDFA 2JKKA 3K5UA 3UIMA 1U59A 5F9EA 2BIKB 2ITXA 4QMVA 1WBPA 2GNLA 3MH0A 3PPJA 3FY2A 4IDVA 3V5QA 3A62A 3ZYAA 4C3FA 3KXNA 3NUUA 3NYXA 4LGGA 3VS0A 3W55A 4EC9A 1JNKA 3NYVA 3KXZA 1UU9A 3MIAA 4YURA 4NWMA 3TM0A 4X3JA 5M51A 2W05A 2JEDA 4ENXA 3E3BX 4BDCA 2QOCA 1H26A 4M14A 4W8EA 5ICPA 4PY1A 5TE0A 3TEIA 2PVLA 4MNEA 1OIYA 4FVPA 4A4LA 3BZ3A 4ARKA 4QP6A 4EZ3A 4CTBA 2FH9A 2OI4X 2JC6A 4M7IA 3CCNA 5ANKA 1H1PA 1CDKA 3NNWA 2RL5A 3QD0A 2BMCA 4PMMA 4HGSA 5K0KA 4PDOA 3WILA 5HQ0A 3U6HA 1XH7A 2EXCX 3Q5ZA 4FUXA 4NKAA 5DH3A 4IB1A 4UZHA 3ZHPC 1GIJA 3O2MA 2EXEA 2ZM4A 4C4GA 3W1FA 3BEGA 5JGBA 3QD3A 2HENA 4O83A 3W16A 4BICA 2WMTA 3CTQA 4C4JA 3TI1A 4MQ2A 5A6OA 2XEZA 3G6HA 1PW2A 4QP9A 3KF4A 2VX1A 1M2QA 2CJMA 4IBMA 4QMZA 3MH1A 4GRBA 2ETRA 4QTAA 5IISA 3DJ5A 4O0TA 3RKBA 4C38A 5JFWA 2R3GA 3P78A 3GU4A 4LOPA 1OPKA 2C1BA 3DKCA 3TT0A 3MFSA 2KTYA 2VO6A 3QRJA 3ZMMA 4BDJA 4EZ5A 4ZTRA 5HG8A 3F5PA 4YJSA 3P08A 3CD8A 3QTSA 1Q4LA 3G5DA 4G16A 2HY0A 4S34A 4EQCA 4A7CA 3ZSIA 4C0TA 3F7ZA 3CKWA 3E7OA 4U45A 1FVTA 3TWJA 5BYZA 4EJ7A 3A4PA 3GFEA 3RCJA 4ACCA 3BRBA 4MXAA 2OKRA 5DNRA 5GIPE 3MVLA 4HPUE 2YZLA 2VGOA 3ID6C 3KXHA 5JGDA 4USFA 4M66A 4IZYA 2JDRA 4YJVA 1VR2A 1WBVA 3H3CA 3ZBXA 2OF4A 4AT5A 2PHKA 1OZ1A 3O7LD 4F7LA 2DUVA 3RAKA 5G6VA 3AD6A 4WNMA 4QMSA 1G5SA 2WMXA 3DKFA 2WQMA 2W5BA 3E8CA 4RVKA 1REKA 1P4OA 2R3PA 3BPRA 3C51A 4BTFA 3JVSA 2IVVA 4K33A 2PZRA 4CKJA 5DPVA 1K9AA 4HVGA 2YZAA 5B2LA 2J0MB 4UMUA 4KIOA 4NM0A 3TUBA 1YHWA 4LUDA 5EI6A 4H58A 3DV3A 4DEHA 4BN1A 4IB0A 3SD0A 4AZVA 5AFVA 3SX9A 1R3CA 2B9IA 3THBA 5IEYA 4Q9SA 2UW9A 4QP2A 5EQYA 3N51A 3QQGA 3U9NA 3EQPA 5AV2A 4R7HA 3F82A 4YHJA 5KCVA 2UW3A 5GZ9A 5AIKA 3IQ7A 4EH5A 3IONA 5AM7A 2C0IA 2PTKA 2P2IA 4M15A 3DCVA 3KQ7A 5E9EA 2WOTA 1A06A 4FKUA 1J1BA 1YKRA 2VUWA 4OTQA 3R9NA 4DHFA 3F3ZA 5J1WA 4G6NA 5A4EA 3MA3A 4O86A 3QLFA 4FK6A 4EK8A 3FKNA 2CMWA 1I09A 1REJA 1B38A 2P0CA 3BEAA 3I79A 4QTCA 5HBHA 3UP7A 4BY9E 5GJGA 3TZ8A 5BNJA 2R64A 3R9OA 3R7OA 4FTRA 4N6YA 3ROYA 2QOKA 3BV3A 5A3XA 4F9WA 3BWFA 3HKOA 4IADA 3N4UA 4O6LA 3FZPA 4U97A 4YSMA 3SHEA 5CSPA 3D9VA 4BCKA 4ZK5A 2PUIA 2UZVA 3F3VA 3EQDA 2PL0A 4ITIA 2WQBA 5AR3A 2BAJA 4PDYA 4L3PA 3ZDUA 3TV4A 3MFRA 5HG7A 2QLUA 1XH8A 1JAMA 2BZJA 3P7CA 5DT0A 3ZLWA 1JWHA 3ZRKA 2F2CB 3QCSA 3LXNA 4JJRA 5FXSA 4KSQA 4MEDA 3FC1X 4QRCA 4R7IA 1WBNA 3D5UA 4RIWA 3SW4A 4GT3A 4R78A 5A6NA 2F7EE 3TZ9A 3U4WA 4KKGA 3F3TA 3ZFXA 4ZZNA 2I1MA 2RIOA 2GU8A 2X2MA 4EHEA 4DCEA 5I3RA 4O84A 2G2HA 3HAVA 2E9NA 4JG7A 3CLYA 3ZUVA 1LUFA 4ZS0A 1ZWSA 5FRIA 4XNEA 2G9XA 3BI6A 4M69A 4LM5A 4AN9A 1QPJA 3QTQA 4TXCA 3ZM4A 3AXWA 2ITNA 5T68A 3VUDA 4DYMA 5F4NA 2BDJA 1PXLA 2FGIA 3KK8A 4TWOA 5AUYA 4BCJA 3I7BA 4LMNA 3COMA 3KF7A 1WFCA 1NW1A 2V0DA 4LL0A 5AUTA 5M4UA 4XP2A 4P5QA 5CXZA 3I7CA 2QC6A 4CRSA 3F6XA 5F95A 3VF9A 4FC0A 5EHOA 4OBQA 2REIA 2YFXA 4N4SA 1UNLA 4E4MA 4TYHB 3SLSA 4FKWA 4F0FA 2B9FA 1W8CA 2UVXA 1O6KA 3KCFA 3QXPA 1MQBA 3DB8A 3PE2A 4MXXA 4WBBB 3W18A 3H30A 3R7IA 3RWQA 5LVNA 3FMNA 5AUWA 3BYUA 4DGOA 2ZB1A 4I92A 4GH2A 3VHEA 3W2QA 3U6IA 3R7EA 3PLSA 4RA5A 5AJQA 1XBAA 4BCHA 4CLIA 3FZOA 4CMTA 2OFUA 5CT7A 1PXIA 4UWBA 4TYEA 4E93A 3EFKA 3FLSA 3ZH8A 4Z3VA 2QURA 2JFLA 4TY1A 3HA8A 3S00A 3CJFA 3LCTA 4OR5A 2Z8CA 4I4EA 2IG7A 4CNHA 3MTLA 2W4JA 4BDAA 4EWHA 2ITZA 4B8MA 1PRYA 4X3FA 3NLBA 5I9ZA 1A9UA 5JH6A 5CENA 4BKYA 4FZDB 2QHNA 3MYGA 2C5OA 1MQ4A 1RW8A 1MRUA 2CGXA 4BWKA 5BVNA 3UMWA 4D58A 5E8SA 2HOGA 2PE0A 3U6JA 3PWYA 4WG5A 2H9VA 3G0FA 3PXRA 2UZTA 4FSWA 3AT3A 3QA0A 3C4XA 4C59A 5H8EA 3TJDA 3AC1A 4BDHA 4CT2A 5JZJA 4X6RA 4P90A 3FHRA 2GNHA 3VJNA 4UMRA 3CQEA 1U5RA 2GCDA 1XWSA 3DAEA 3K5VA 4XG7A 4I93A 4X0MA 1YXXA 4NTSA 3C4EA 3W2CA 4G34A 4DG0E 3MY0A 3T9TA 2F49A 4EEVA 5KMNA 2W9ZB 3MTFA 4U3YA 3UIXA 2CN5A 2W9FB 3BGQA 3MFUA 5CSVA 4BDIA 3FLWA 4D0WA 4HVSA 3DA6A 5CWZA 4GT4A 4ANBA 2QO9A 3GCQA 1R0EA 1RJBA 4GCJA 5DRDA 3KRWA 3VBQA 4FZ6A 5FEDA 5HG5A 1OKVA 2YWPA 3K2LA 4D0XA 4BIBA 1K2PA 4PL4A 2WTCA 2XK4A 2OZAB 3HUBA 2Q0NA 3MIYA 4QMXA 4R7BA 1Q8WA 4X21A 5AP2A 3FXZA 4BGHA 5E7RA 2BHEA 3ZDIA 3DAJA 1OVEA 3QCXA 5E8VA 1FOTA 2IZTA 3TNQB 4BDBA 1L3RE 2FO0A 3QYZA 3FLYA 5EW8A 2O64A 5A54A 4D2TA 2PMNX 2BHHA 5CSHA 5JZNA 5T3QA 4UEUA 4IZAA 5AP3A 2YM8A 4ZSLA 3VJOA 1OL6A 4IAAA 4A9TA 1W7HA 3PSCA 3MESA 2IZUA 5IQCA 3DK6A 2B0QA 1WVYA 2ESMA 5DEYA 5ANGA 5AP7A 2QG5A 3FLZA 3QQHA 3R02A 4FTTA 3QCQA 4RG0A 3V04A 2WQEA 5FXQA 1U54B 3QWJA 2CKPA 4IMYA 2PZIA 2Z7SA 4G3FA 4RJ3A 4ITHA 1YHVA 1DS5A 2HIWA 4QP7A 2WTJA 3AC5A 4YPSA 4XRJA 1YI4A 3CP9A 4AUAA 2LAVA 4ALWA 3OS3A 3F3UA 3P86A 3ZC6A 2G15A 4RIXA 1XH6A 2XP2A 3R8UA 3VWAA 4CTCA 4EH6A 5J5SA 5JN2A 2XIZA 4YJTA 4E3CA 3PIXA 4PTCA 3CY3A 3P1AA 3F88A 2ONLC 3R2YA 5HEZA 3UNJA 4BKZA 4CSVA 3GUBA 4JIAA 4F70A 3BELA 4GIHA 3ZEWA 3RPSA 2J50A 4FTMA 2XNBA 2QO2A 4AT3A 2NNWB 5EQEA 3MI9A 2X7GA 2X9FA 4UXLA 5AR4A 2HZNA 5DT4A 2OZOA 4BYIA 3MJ2A 5IUHA 1H28A 3L8XA 5AUUA 2PUPA 3KN6A 5EKNA 1ZXEA 3U54A 3R8MA 4NH1A 3UPZA 3SAYA 4G1WA 1X8BA 3I6UA 1XKKA 2F7ZE 3UBDA 5GNKA 2C5XA 1APME 2RF9A 4U8ZA 3ZU7A 4MQ1A 5E8UA 4BBEA 5D10A 5IPJA 4GL9A 4U81A 2CKQA 2J7TA 1NA7A 2C6LA 3R63A 2OIBA 1P4FA 4EK6A 2WIHA 3FHIA 3IG7A 3C0GA 1PHKA 3G0EA 1Q99A 4YHTA 4AGCA 3HMMA 3LOKA 4QQCA 3DLZA 4FSNA 2H34A 3ERKA 3FSKA 3ZFMA 2R7IA 3RNIA 4YR8A 5C4KA 3HV6A 2OH4A 5EG3A 3Q96A 4U7ZA 3MW1A 5IQAA 5ACBC 1JKKA 4RFZA 4Y73A 4O0YA 3CD3A 3R28A 5FQDC 3VNTA 2QOIA 3NVKI 2J9MA 3LLAA 5CAOA 4OW8A 2JIIA 2RSVA 1KOBA 4K8AA 4ZMFA 2I40A 3G9LX 4ZEGA 4E8AA 5CAUA 4XX9A 2WQOA 4LRJA 3PFQA 4L42A 3ORXA 2CLXA 4O27B 4AGWA 2EUFB 5LWMA 4GKIA 3ZEPA 2YACA 5HKMA 1H07A 3HECA 5CNOA 3L9NA 4EHGA 1QPCA 3VBXA 3V8SA 4HGEA 5BMMA 4AQCA 4HGTA 4EKKA 2ERZE 4N6ZA 2C47A 2HY81 3ANRA 1STCE 2YCRA 4FKVA 1UWHA 2DYLA 2VAGA 3FZRA 3OVVA 3QQLA 1FMOE 2BRNA 2JLDA 3QX4A 5KMIA 4RIOA 4DG3E 2YLFA 4TRLA 4YJRA 3Q9WA 3HRCA 3JY9A 4TNBA 4TWPA 3M2WA 4YO4A 5AA9A 1BI7A 2GFSA 5BX0A 3SGCA 2C3LA 4CRLA 4Z16A 2XKEA 1BL7A 5HI2A 4L01A 3GVUA 2GNJA 1ZYDA 3KY2A 5CEMA 1M2RA 1Q24A 3U9CA 3OTVA 3VS6A 5EM6A 2CNQA 3BHVA 4YHFA 5EW3A 2OSCA 1TQMA 4I5PA 3RAWA 4BR3A 4USDA 5CSWA 5HCZA 1BI8A 5E8ZA 3RTPA 3KXXA 5HBJA 3ZC5A 4DF3A 4CFNA 1WMKA 2ETKA 4G3GA 2YABA 3WYYA 4RQVA 2QOOA 2ZV8A 2ITWA 5BVKA 3O8PA 5HIEA 3MB6A 5FTOA 3IOPA 2B9JA 1M2PA 2QONA 3HEGA 4BGQA 4BZNA 3ETAA 3PVUA 2VTAA 4FG8A 3BE2A 4WKQA 4DH8A 1LR4A 2YIWA 3UVRA 3TDVA 3MVHA 4D5HA 3UDBA 2R3RA 3Q32A 3KA0A 4R1YA 5KNJA 3DTCA 4OTHA 3SRVA 2ITOA 4QNYA 5EHLA 5HZNA 2ITPA 2X6DA 5DR6A 5M53A 4DH3A 3R71A 4Q5EA 2PK9A 2V7OA 3FLNC 1ZRZA 4YZDA 2XF0A 2HW7A 4RZVA 3SA0A 3ZXZA 3B8QA 1FMKA 3KL8A 5CEIA 3M1SA 4G6OA 4RX8A 1XBBA 3QZIA 3PY1A 2AC3A 2XM8A 3GOKA 3LE6A 5E8TA 5DHJA 2E9UA 4FT0A 4RT7A 5E8WA 4N57A 4LYNA 5KKRC 3HV5A 4RMZA 4R1VA 4GU9A 2XJ1A 4IAFA 4NZWB 4BZDA 1UKIA 2R3HA 4DAWA 4EJNA 3LCSA 5CNNA 2OF2A 1DI9A 2C5VA 2OWBA 4D2WA 3OZ6A 4PL5A 1O6YA 3JVRA 4C36A 2WEIA 5M07A 1CTPE 4Q2AA 2X39A 3GEQA 5HCYA 4BWPA 2XMYA 3QGWA 1FPUA 2VTJA 5ANDA 2IZSA 4XH6A 3GC8A 3E88A 4QPMA 4K11A 3COHA 3RGFA 2VWZA 5IZFA 3WIGA 1Q97A 5I3OA 2XM9A 4RA4A 3BHYA 4FKRA 3DXQA 3C5IA 2G2FA 2FYSA 5DA3A 4XS2A 1UNGA 4DGMA 3VUMA 1JOWB 4KA3A 2QQ7A 2W5AA 4XG9A 4HVIA 2GHMA 5F1ZA 5H8GA 4CKRA 3ORPA 5HTIA 3I81A 5JQ5A 4DFNA 2YAAA 4OUCA 3Q9ZA 4HOKA 3WYXA 4HYHA 5FP6A 2JDSA 3C13A 3TIYA 5AWMA 3VRYA 3CS9A 5CQUA 4LG4A 3VUKA 4BB4A 1WBTA 4I94A 3CKXA 3MPTA 4S32A 4P7EA 1UU7A 5FP5A 1YXUA 3KXGA 2IW6A 3MPAA 4NM5A 4I0SA 3V6SA 2IZRA 1SZMA 4I1ZA 1BUHA 1Y57A 4EOJA 5LVMA 4IHPA 3DQXA 3ENMA 4HGLA 3G33A 4AP7A 3NUNA 5EFQA 3DBEA 1PXKA 3LFNA 5E8YA 2GQRA 3FL4A 2BAQA 4H1MA 4AN2A 3W2PA 4WO5A 4F63A 4O0XA 2IPXA 1Z9XA 3UPXA 3W8LA 3C0IA 3LJ2A 3TNIA 4YC3A 4FKTA 5AP0A 2R0UA 3C4CA 4RPVA 2X4ZA 4G6LA 4JL9A 1YWNA 2C69A 1IG1A 4FA2A 1GZKA 3VULA 4IM0A 4KIKA 3HDMA 1KE8A 2QOLA 3MGYA 5EDRA 5HG9A 4ZMEA 3LFEA 3GENA 4C35A 3VBWA 4FL1A 3PE1A 5KMKA 2J0KA 3F69A 3LFAA 1GIIA 4GK3A 4FV6A 2CGVA 4UX9A 4FICA 2B55A 4I5MA 3IDCA 4GG5A 4EQUA 4XG6A 4JR3A 4O6EA 4ACHA 5IDPA 4NYEA 3SXFA 5HBEA 3G6GA 3PXYA 3VW8A 4W8DA 4FVRA 3UIUA 1UV5A 3R7YA 2QOQA 2XNMA 4BF2A 4WSQA 4AE9A 3N4VA 2XK8A 3R83A 4FKPA 5B7VA 2I7QA 4CV8A 5FG8A 5CF8A 4C02A 3NX8A 4DBNA 4DGGA 1YVJA 2C6MA 3FI4A 1Q62A 4DH7A 3O8TA 4D1XA 5I5ZA 3U51A 3R21A 5I9UA 4IVCA 1OKZA 1SYKA 3FXWA 2RFDA 2YJRA 3EQCA 3OP5A 3H9RA 2JDOA 4QP3A 2W0JA 1H8FA 4XCUA 4E1ZA 3EKNA 2RKUA 4UYNA 1QPEA 3NW7A 2Q83A 3NIEA 3Q4ZA 5G1XA 3SXSA 5TT7A 3KVXA 1FGKA 4GIIA 4H3PA 5CYIA 4YSJA 4JNWA 3I5ZA 4A4OA 2H6DA 2UZOA 4G9RA 3E87A
chains in the Genus database with same CATH superfamily
5L2SA 3PY3A 3LFFA 2OIQA 1CSNA 3MH3A 4A9RA 4PX6A 3ATTA 3S2PA 4M13A 5JFXA 2QHMA 3CTHA 4FSZA 3RK9A 4QDVA 3EN5A 4F09A 2BFYA 3COKA 2J0JA 4M84A 4QQJA 4D55A 1JKSA 1R1WA 3A7IA 4H36A 3QL8A 4J98A 3R8LA 2XK7A 3PYYA 3NDMA 3UJGA 4ANQA 4P4CA 4WUNA 3NWWA 4DHZA 4ASXA 1SNXA 3BHTA 1XH5A 3BQRA 2B53A 1ZMWA 3HLLA 3KVWA 5CF5A 1YI3A 4BYJA 4GUBA 3L8VA 3ZO3A 3FMHA 2PZ5A 4I6HA 3NW5A 4YLLA 4CYJA 5HTBA 2O63A 4ASZA 1OITA 4C61A 5IQIA 4I24A 4MTAA 4RX7A 3TXOA 2Y4IC 2OXDA 1ZMVA 4UBAA 4YBJA 5M55A 4ZLYA 2XB7A 5DVRA 4MD9E 3RBWA 4CCUA 5M44A 3ZM9A 1WVXA 2JBPA 3TCPA 4IAIA 4TL0A 3T3UA 4O0VA 3LFCA 3UOLA 5M4IA 4O7SA 1UU8A 4QMOA 3TN8A 5I9YA 4XEYA 4FEVA 2OICA 2VNWA 5LMKC 4GUEA 2Y8OA 2HK5A 5EM8A 4XP0A 4ZSJA 1V0OA 4J71A 4UY9A 4IWDA 2VTMA 4GVJA 2EXMA 3QTUA 5HOAA 4BCNA 4QMYA 4BFMA 3DJ7A 1L8TA 3CE3A 4UB7A 4NFNA 3FLQA 4O91A 5HHWA 1UNHA 1Q3DA 4YNEA 4IH8A 5IH5A 3KMUA 4ERKA 3DJ6A 3QQFA 1GY3A 2QOHA 4A9SA 3LQ8A 1OIRA 4EOQA 4FV4A 5HICA 2ZJWA 2WMVA 1H1RA 3W0NA 4C4EA 2PZYA 3NIZA 5BVFA 1BYGA 1SM2A 3TUDA 2R3KA 2YCSA 5FM2A 2OZAA 3D2IA 3FL5A 1GIHA 2A2AA 2IJMA 3C1XA 2WEVA 4YJNA 4E6DA 4GU6A 4GKHA 3POZA 5IMXA 3MB7A 3R7GA 3HYHA 4TTHB 1CKJA 2UVZA 3BIZA 4LRKA 4FG9A 1Z5MA 4LQMA 4NU1A 3BWJA 4AW1A 3S1HA 4FTUA 3ZSHA 4JDJA 3UZTA 3QTZA 3QHWA 3HZTA 4JBQA 4ZTQA 4MCVA 1H0VA 3CIKA 4NUSA 3HL7A 1TQPA 3QXOA 4L9IA 3TMOA 3BLRA 4E6AA 5CQWA 4FSRA 3VS1A 1U54A 3O0GA 4U42A 3SRVB 4DFXE 3CQWA 4IVDA 4GFGA 3TV7A 3OY3A 2VX0A 4HNFA 3QGYA 3OROA 3QLGA 2XEYA 1JVPP 3W0QA 1W2DA 5L6OA 2VTSA 5EI8A 5IQDA 3VVHA 3QQKA 3AC2A 4CG8A 4E73A 3TZ7A 3LM0A 3KRRA 3P7BA 3PJCA 3QKKA 4LMUA 5CVHA 3EQIA 3QRTA 2JDTA 2WMBA 4U43A 2P4IA 4R3RA 4DTAA 5AAGA 4TPTA 5M4CA 3RZBA 4DG2E 5I4NA 4BKJA 2UZWE 4O0SA 3QYWA 4FL3A 3F3WA 3OT3A 3TL8A 2XNEA 4MUQA 4R3CA 1TQIA 4BCMA 5IEXA 4PWNA 4IJ9A 4Q5HA 1LPUA 1PF8A 2PVJA 3ZCLA 4BC6A 5IG1A 1IAJA 1JSVA 3G51A 5C03A 4MXOA 5C26A 1MUOA 4IWQA 2C6DA 3TACA 4YJQA 3HAMA 5HLWA 4DE4A 4PMPA 2PVMA 2WXVA 3MFTA 3F5UA 1H01A 4RVTA 4YC8A 3V8TA 3FMMA 1BX6A 3UO5A 3AQVA 4QYEA 4DITA 1URWA 3BE9A 3O7LB 4IB3A 3R1NA 5CALA 4FF8A 4UMQA 5L6WL 2QVSE 3HA6A 5IQFA 4ACDA 2VTNA 3QC9A 5K5XA 4R77A 2YDKA 3E8DA 4UN0C 4ZP5A 4RC3A 5TR6A 2R2PA 3G15A 1IEPA 3GB2A 3BYOA 5FBOA 3JPVA 3VBVA 2HZIA 4FVQA 3MJ1A 1XO2B 3QTXA 2NP8A 2Y6OA 2O2UA 1P14A 3C50A 5AV0A 4BRXA 1TFFA 3R9RA 4BHNA 4DFYA 4BCGA 1RE8A 3QKLA 4G5JA 3COIA 2XIYA 3ORKA 3UP2A 3KB7A 2XYUA 4WSYA 4IX4A 4J7BA 3LW0A 1J7UA 2X7OA 3D5WA 3BU5A 5M56A 2J0LA 4F9YA 5J7BA 1PXMA 2ZMDA 2ITQA 1Q61A 2P2HA 2FVDA 2Y4PA 2SRCA 4I5HA 5B0XA 1AGWA 2GNIA 4RJ5A 5F94A 4EI4A 4IX6A 3R00A 5LQFA 4OT6A 5K0XA 4L7FA 3L1SA 5HESA 3H0ZA 3SDJA 2YM6A 3EN4A 3PA4A 4JT3A 3FZTA 4KIKB 5IH6A 3D94A 4Z9LA 5K4IA 4IWPA 5KMLA 5L8KA 5LVOA 1XJDA 2UV2A 2W1IA 5BYLA 4GV1A 2HAKA 4QNAA 2JITA 1F3MC 4MYGA 5JT2A 3D15A 1Y8GA 3EQHA 4K9YA 1V0PA 3ZUTA 2XIRA 4BCQA 2PE2A 2WKMA 4S33A 4DN5A 4O7ZA 4O7NA 2ERKA 5L2TA 3F66A 1FVRA 3IO7A 4G3DA 3K54A 4EUTA 2EB3A 3VRZA 5EK7A 4Q9ZA 5HD4A 5C1QB 2XARA 4FV2A 3ZRLA 4RRVA 5FDXA 3RPOA 5IUGA 2NRUA 1U5QA 4UMPA 4BBMA 3VHKA 2PY3A 1H4LA 2XKDA 4ZXTA 4M0YA 4IACA 4F6UA 2GNFA 4FZFB 2W99B 1WCCA 3HV3A 3FV8A 2VO7A 4XOYA 5KKRB 1NXKA 3GC0A 3TKHA 4JIKA 2BVAA 3R22A 3PZHA 4O2PA 4AZSA 1BKXA 2WFYA 5HVYA 4IB5A 4Y5HA 4DFLA 2XKFA 3R01A 4AA0A 2ITYA 5CY3A 5CZIA 5DIAA 2XKCA 4GFMA 4RX9A 5LWNA 4NEUA 2PVKA 2CSNA 3LFBA 3SQQA 2GQGA 1BLXA 2GDOA 3A7FA 4C57A 5I9VA 3W2RA 4DFUA 4F0IA 2HWPA 4KUJA 4Y95A 3OXTA 1I44A 3BYSA 3UQCA 3UYTA 3R30A 2C6IA 3M42A 3WI6A 4C58A 4EH4A 4FT9A 4NL0A 5AUVA 4TT7A 4X7QA 1E1VA 1CKIA 1YXSA 2WTKC 2UZEA 4F6WA 5CF6A 3O23A 3FBVA 4AFEA 4JQ7A 5D9HA 1MP8A 4CFMA 2VWBA 2PZPA 4FUYA 2R0IA 4MVFA 5LCKA 1T45A 3GU5A 4J8MA 4RQKA 1NT2A 2WO6A 4RSSA 2GPHA 4IE9A 2HXLA 4V05A 2CHLA 3FI8A 4OTIA 4ANMA 3UZRA 2QOBA 4NJ3A 4YC6A 1O6LA 3R0TA 2BKKA 4II5A 3D0EA 4R8QA 3AD4A 4CVAA 2IO6A 2E9OA 4FG7A 2X1NA 3Q6WA 4HCUA 2R4BA 4NIFB 4CZTA 5CAVA 3OMVA 2BIYA 2QCSA 1PXOA 2PVRA 4G5PA 2VTLA 4NM7A 1RDQE 3WF5A 5HX8A 3QTRA 4U6RA 4QYFA 2NRYA 4FV3A 3LAUA 4HJOA 1PMUA 3LIJA 4EZ7A 3UVPA 3FKOA 3FPQA 4EK5A 3FDNA 2YIQA 2UW8A 5C01A 3TNHA 4PPAA 5KMJA 2HZ4A 2W96B 2H8HA 5A4CA 2NO3A 4OT5A 2RFEA 3OWLA 3BLQA 4V01A 3KREA 2VZ6A 3VQHA 3UTOA 4BCPA 3EH9A 5LOHA 2CKOA 3RAHA 4QMNA 3KMMA 4JDIA 4MBLA 4BCFA 2X4FA 2ITUA 3GBZA 5K3YA 3HX4A 3TKIA 4EC8A 5BVOA 4JBPA 3REPA 3HP5A 2V55A 3WZKA 4KIPA 1H00A 3L8SA 4Z7GA 2JKQA 3FWQA 4E20A 3EWHA 3R7UA 4B6LA 4NSTA 4OTDA 1KSWA 3HV7A 3LMIA 2VTRA 4D2SA 3UQGA 2OGVA 2GMXA 4FKSA 3FKLA 4G17A 4KINA 3R8VA 2NPQA 2HYYA 3JR1A 4AXFA 3UOHA 2A1AB 2IVSA 1JQHA 3ODZX 1PXPA 2FA2A 4BDDA 4PMTA 3RK7A 2CNVA 3GGFA 3KCKA 2BRMA 3G2FA 4OTPA 5IKWA 5KBQA 2VTQA 4WOVA 3AMYA 3HMPA 5CAPA 5BVWA 4YJOA 3PPZA 5AM6A 4NKSA 3GCPA 4RZWA 4ZSAA 3ALOA 4YNOA 2YCFA 3NNVA 4HYSA 4IM3A 3AMBA 4MAOA 3OW4A 3ZTXA 4XOZA 3K3IA 4ZJJA 4JG8A 3QHRA 4DHJA 5KBRA 5AR2A 4ZTMA 5D7VA 4FIHA 2UW7A 4NW5A 1FQ1B 2B52A 3QQUA 3PTGA 4KIQA 4MKCA 3B2WA 4FTAA 4LRMA 2OJGA 3PSBA 4DGNA 4EYJA 2LGCA 5IQEA 4ITJA 4FTJA 5M4FA 3ET7A 4FX3A 4XG4A 4WNKA 1ZY5A 3OT8A 3QCYA 1LEZA 1XH4A 4GK4A 1FVVA 3OWKA 2H96A 4A07A 1ERKA 5J7HA 4OAUC 4GSBA 4MD7E 3HMIA 5DLSA 3WF6A 3L9MA 4CD0A 5D12A 5HORA 5H3QA 2DQ7X 3LFDA 4FIGA 4WBOA 3UODA 4EONA 2KULA 2OK1A 5BUEA 3VBYA 3NAXA 2ZYBA 5CS6A 3HV4A 3C5UA 3G90X 4RX5A 3HMOA 3FQEA 4AACA 3NYOA 3OBGA 3QWKA 2J4ZA 2ZM3A 1OB3A 1V1KA 3EZVA 3KK9A 3BGZA 3IKAA 3RPVA 3ITZA 3DNEA 3DDQA 1F0QA 1TZDA 1Z57A 1T46A 4FKGA 4FTLA 2BFXA 3ENHA 3HRBA 3IS5A 3QU0A 4PV0A 4TYGA 4ZJVA 3IPHA 4FNYA 2Y4IB 1NVQA 4FV1A 3KULB 3TNPC 1ZAOA 3WF7A 2YAKA 4GJ3A 4KABA 4TKSA 3E5AA 4KBAA 3OY1A 3B2TA 4QOXA 1KV1A 2BTRA 3NAYA 2QG7A 5TF9A 2ZAZA 2I0VA 5BVEA 2PMLX 4GJ2A 4A06A 3S4QA 3OW3A 4LV5A 4DTBA 3WZUA 5LMAA 2PVNA 4AT4A 4IC7A 2O5KA 3BLAA 5FTGA 4I20A 3QUEA 4TNDA 3NUXA 4ZZOA 3A7JA 5CZHA 4H39A 2ZVAA 2JKMA 4OTRA 4ZLOA 4QTBA 4WUAA 4DEGA 4USEA 1Q41A 3KRXA 4O2ZA 1H1SA 5IA4A 3ZLYA 2W5HA 1YI6A 3O96A 4QMWA 3ZOSA 4MWHA 5AV3A 4C2WA 3S0OA 1PJKA 3Q3BA 1YRPA 4W9WA 3R2BA 4GW8A 3RM7A 2PPQA 4BL1A 4GYGA 3WF9A 3II5A 3VS3A 4BCIA 3DDPA 4RLKA 2YWVA 1G3NA 2Z7QA 1CMKE 5DRBA 4ALUA 2YEXA 3UMXA 2W1HA 5ANOA 4BDEA 2QODA 2JKOA 2XNPA 5AR8A 5ETFA 3W8QA 4QQ5A 4E5AX 4HYUA 2WMUA 4ZAUA 2V62A 4IQ6A 3DLSA 3IW4A 4XLVA 2PUUA 1OGYA 3GU7A 3TZMA 3ELJA 5L8LA 3ML1A 3C7QA 3C4WA 3A60A 2GTMA 2ITTA 3FE3A 4BIDA 4FZ7A 4IM2A 1KE5A 3W33A 2ITVA 2OW3A 2G2IA 4XRLA 1U46A 1ZMUA 4F1MA 4BJJA 4GVAA 2P3GX 1Y6AA 5HLPA 3WIKA 5IQGA 5ANEA 3KEXA 1Q8ZA 2VO3A 3ZUUA 3OUKA 4KAOA 2VTHA 2WU7A 4FSTA 5AP5A 1CKPA 4FT5A 2QR7A 5CEKA 4GEOA 1VEBA 2C68A 1VJYA 3WZEA 1V0BA 4RC4A 1O9UA 5AP1A 3LPBA 5AV1A 4ACGA 3FXXA 1FINA 1DI8A 5TOZA 4ZTSA 4O1OA 3DOGA 4JX7A 1XR1A 3OEZA 3HRFA 4S31A 4V0GB 3H0YA 4CV9A 4A4XA 4FBXA 3QAME 4D1ZA 2ONLA 2X8DA 3OXIA 4ZIMA 4AX8A 4QMTA 3S95A 3EMGA 3RMFA 2WOUA 3E3PA 2WTVA 5D7AA 2BUJA 2Y7JA 4X2KA 3PXQA 3QZHA 3BU3A 4FTNA 5FGKA 3ZO2A 5C27A 5BV3A 4ID7A 1AQ1A 2PSQA 3TV6A 3DFAA 2W1GA 3BCEA 3VUTA 4EK4A 5GJDA 5CU2A 2QD9A 3MPMA 5FUTA 3I60A 3F5GA 4D9TA 4RC2A 3C9WA 3AOXA 5L3AA 2HWOA 2A4LA 4XUFA 3FZ1A 1H1WA 3QALE 4H3BA 4WIHA 3RINA 4UWCA 3VC4A 4HYIA 4X2NA 2WZJA 4APPA 4CT1A 5BVDA 4AXDA 4XG3A 3LMHA 3LXPA 4FT7A 3VW6A 4QMUA 4EYMA 4FEWA 3O17A 3T8OA 3I1AA 4A9YA 3C0HA 2ZFYA 3I4BA 3PDTA 4AW2A 5HE0A 2YM7A 5JKGA 2F57A 4ZY4A 2YJSA 3KRJA 4L7SA 3Q52A 1Q3WA 4XV2A 3EB0A 5ITAA 3QZFA 3LHJA 2BTSA 4V04A 1OUYA 5EYCA 4MBJA 3H10A 2C6EA 2FSTX 2XANA 4BI1A 5I9WA 3MN3A 4D4SA 1S9IA 3D14A 3W10A 3FI2A 3AGLA 3Q4UA 2XVDA 4DINA 3NEWA 3QD2B 4Y8DA 4O0RA 4ORKA 4D2VA 2HCKA 4I41A 4KRCA 2PULA 4ZTHA 3WOWA 5T6KA 1YOJA 2CCHA 1W83A 4M97A 3OCGA 4O4CA 4OBPA 4UMTA 2CPKE 3TJCA 2IVUA 4HW7A 4FZAB 5C8KA 2CGWA 3CXWA 5IU2A 2C6KA 2VWIA 4HCTA 5ACKA 3EQRA 5EW9A 4CQGA 2WQNA 3PIYA 4O7VA 2VTTA 2WB8A 4I5CA 3KKVA 4FKLA 1EH4A 3RJCA 4J99A 3ZSGA 3KMWA 4E4XA 1OI9A 2F9GA 5DFPA 3SKCA 5CASA 3W0OA 1HOWA 4AXEA 2UZBA 4U41A 3FMLA 3OCBA 3QUPA 5ANJA 3BYVA 3PSDA 3PY0A 3U4UA 2VNYA 3HMNA 4M8TA 3RPYA 3PJ8A 3Q60A 3UO6A 1ZOEA 4ZSEA 2WU6A 2OJFE 4FOCA 3QA8A 1Q8YA 4F65A 3PUFC 2Z60A 4D5KA 5BUJA 4DGLC 2XZSA 3NR9A 4N70A 2I0EA 2XRWA 4IAYA 4EORA 5F20A 3DK7A 1J91A 4ZSGA 4AOTA 5AADA 1Q8UA 3WARA 4IZ7A 4AW0A 2EU9A 1H27A 2ZDUA 4MD8E 4F08A 1GJOA 4CFVA 4BWXA 4WD5A 3UO4A 5C8NA 3DXPA 3DKGA 2IW8A 4BBFA 4HCVA 3NPCA 1W98A 3ORNA 4DCAA 3QC4A 2OBJA 5LXMA 2C3IB 2XJ2A 3PXKA 2YDJA 2OFVA 3KN5A 3P7AA 3TNWA 1QCFA 3T3VA 5EDPA 1M14A 5CU4A 4AFJA 4AF3A 2X8EA 2XIXA 4WRSA 1H24A 4MBIA 3F2AA 4A9UA 5C8MA 3ZS5A 3W32A 4L43A 4YO6A 2JAMA 4RFYA 5A14A 3SG8A 3R73A 5L8JA 3ACJA 1LP4A 2BZHB 2WHBA 3DXNA 3EFWA 4KKHA 5EOLA 4D9UA 5IMEA 3WE4A 3ZXTA 2W17A 4CFFA 3ANQA 5FEQA 2OH0E 4WNOA 1ZOGA 1QL6A 2JAVA 3DQWA 4BDGA 4FOBA 2IN6A 2J2IB 4FTCA 4GFOA 4DT8A 2J51A 4EH9A 3GP0A 3RPRA 4AE6A 4APCA 4L45A 2WTKB 4QTDA 1AD5A 3HUCA 3R1QA 3JY0A 3MV5A 4L3JA 3R7VA 5KUPA 1XH9A 2YISA 2W1CA 3LJ0A 2JD5A 3LXKA 4EQMA 4UZDA 3AC8A 3GI3A 2Y9QA 1Y91A 4IAKA 2A0CX 4ZY6A 3S3IA 1GZNA 5EM5A 4IFCA 2AYPA 4FV5A 3NCGA 4IJPA 3VS5A 3A61A 5HNBA 2GS2A 2YDIA 5FD2A 4KB8A 5IA2A 4IIRA 5EKOA 3P5KA 3R6XA 2YN8A 3PWDA 1DAYA 2VX3A 3Q9XA 1GAGA 2C6TA 3Q4CA 4JBOA 4U3ZA 4FI1A 5DBXA 2QI8A 4QTEA 3E8NA 2X8IA 1P5EA 5E90A 5FM3A 4YZBA 5KX8A 2XBJA 5EDQA 3GT8A 3BQCA 3MDYA 4QYYA 4RWIA 4YJUA 3ZZWA 5J1VA 1R78A 4AW5A 4WNPA 5IA5A 2RFNA 1Q8TA 3RWPA 3LCKA 3UOJA 2ETMA 3BHHA 3GNIB 3OWPA 4K0YA 4NIFA 4AAAA 2AEGA 3R1SA 4J97A 3LVPA 4CKIA 2ZV9A 4WHZA 2WPAA 3PVGA 4IVAA 4MF0A 5GZ8A 4YZMA 5AMNA 1B39A 1IR3A 4DEDA 2ZMCA 5CEOA 3ZO1A 4D4YA 5EOBA 5FBNC 1M52A 3V8WA 3MSSA 4JBVA 3RZFA 4FTOA 3ORLA 4BCOA 4PNIA 2OG8A 3IGGA 3L8PA 3LLTA 4F9CA 4FL2A 2CGUA 3PJ1A 4ZZMA 1PYEA 2BRHA 4YBKA 2A19B 4DA5A 4LI5A 4EKLA 2QKRA 2C3KA 3GU8A 4FYOA 3RP9A 4R6VA 3IDPA 2QU6A 5ETAA 3GQLA 4B99A 2XNGA 3P0MA 5HU9A 2QLQA 4C3PA 3VS4A 4FODA 4EWQA 4FV9A 3W2OA 2BAKA 4TW9A 3D7ZA 1UU3A 5DE2A 2OXYA 1SVGA 3E63A 4QP4A 1FGIA 2XK3A 3LQ3A 4XYFA 3M11A 4DH1A 3NFGB 2VO0A 4FK3A 2X0PA 4XP3A 1WBOA 2V22A 4O4BB 5L2QA 3PJ3A 3Q6UA 4J52A 4TWNA 5LVLA 3VS2A 3JYAA 4BJJB 4XG2A 4NW6A 3UC3A 1JKTA 2R3IA 4L53A 2EVAA 4I6LA 4BVUA 4YLKA 1GNGA 3FMDA 2X2LA 1YOMA 2B54A 4Y46A 1WVWA 5CU3A 4CYIA 4JXFA 5JGAA 5LCJA 4GMYA 5KMMA 2W1DA 5E1SA 3HP2A 4EOMA 5IEVA 3LQ5A 2X2KA 4U9AA 5L4QA 1OBDA 5A9UA 5HO6A 2HW6A 4GS6A 4QP8A 3DKOA 3CJGA 4PP7A 2XCKA 4DT9A 4KBKA 4NT4A 3DAKA 3RHKA 4JDKA 4CMUA 2P55A 3GU6A 5KHWA 4D4RA 3TDWA 3KU2A 2J5FA 3QTIA 4CZUA 3NVMB 2IF8A 4DH5A 4FEUA 3JXWA 4O7WA 4D4VA 4FV7A 2ZV2A 4JAIA 4PF4A 3EQFA 2R7BA 3ZFYA 4WG3A 3LXLA 3GOPA 3DB6A 4RBLA 3E62A 3TTIA 4EHVA 2PYWA 3H9OA 3FMKA 3P23A 4QMPA 4U79A 3NMUF 1OL7A 4UYAA 5EI2A 4MXYA 3GCVA 2IVTA 5CT0A 5E4HA 3P9JA 4JDHA 4P5ZA 3QZGA 4OLIA 4P2KA 3SOAA 4CQEA 3PP0A 3U87A 2WIPA 4LGDA 1LEWA 4EOSA 1NY3A 5A4QA 2YA9A 3DZQA 5E1EA 4CG9A 2YIRA 4FV0A 4MXCA 3IW5A 2VU3A 3OHTA 4XJ0A 2GS6A 1A48A 3MVMA 2E9VA 3UGCA 4RGJA 4XV1A 3R04A 4ENYA 5EYMA 5KZ0A 4LL5A 1PYXA 3CPCA 3OUNB 2YCQA 5CI6A 5A46A 3BKBA 2VTIA 5BQ0A 4ZOGA 2VTOA 4Z55A 5HVKA 5CTPA 1R39A 3CY2A 3HGKA 1YWRA 3KULA 2OU7A 2J6MA 3DBDA 5CX9A 4AWIA 3N4TA 5AR5A 2XJ0A 3SG9A 2VD5A 3F9NA 3EHAA 3MY1A 4L44A 3P4KA 3VAPA 3AC4A 4DLIA 2W4KA 3BV2A 1XHAA 4C62A 2VWVA 3OBJA 5GIOE 1P2AA 2CDZA 1IAHA 1ATPE 4EUUA 4KSPA 4DBXA 4K18A 4O0WA 5LMKA 1M17A 4IX5A 4J1RA 4E6QA 4AAYA 3VS7A 4MHAA 2YHVA 4HZRA 4JS8A 3I5NA 5HO8A 4F6SA 5C4LA 3CSVA 1KE9A 3QKMA 5L2WA 3FMJA 2R3NA 1SNUA 3EYGA 1MRYA 1U4DA 4OTFA 4NM3A 2PWLA 4PTEA 2OJJA 3QUDA 4GK2A 3GC9A 3UIBA 2O3PA 4DTKA 4O96A 3UZPA 5JQ8A 1NVSA 3AG9A 4XG8A 5AUXA 5IA3A 4NFMA 4ANOA 3MY5A 1J7IA 1ZOHA 2R3JA 5DN3A 2VRXA 2CNUA 2C0TA 3OOGA 2OIDA 2RG6A 5FDPA 5HCXA 4X3FC 3E64A 3ZBFA 4OAVB 3WF8A 3WZJA 3MA6A 3EQGA 2A27A 3FY0A 2CN8A 1Q5KA 3GCUA 5J87A 1IA9A 1OKWA 2WNTA 4KRDA 1PMEA 4AG8A 4ANNA 4C4IA 2RFSA 3Q4TA 4IFGA 3KC3A 4B4LA 4N0SA 4YZ9A 4FKIA 3NUYA 2QU5A 2BILB 4JG6A 4L8MA 1OKYA 4PL3A 3R8ZA 5H9BA 4ZY5A 5BPYA 3RAIA 3QX2A 2Z2WA 1YW2A 4EH8A 3FJQE 4RIYB 3SOCA 2V7AA 1UWJA 5JK3A 4YZCA 3UC4A 4BTJA 2Y0AA 3NNUA 5HE3A 1PY5A 4JQEA 3Q5IA 5JFSA 3LCDA 4F7SA 3OCSA 4IZ5A 4FSYA 3E8EA 3RNYA 3BL9A 5IDNA 2QNJA 2X7FA 2W4OA 3UYSA 3ORMA 3DFCB 5M06A 5IQHA 4FKOA 3PUPA 1J3HA 2BZIB 1TVOA 4KNBA 3T9IA 5CVFA 4M12A 3DGKA 4AA4A 4YPDA 3VUIA 1Y8YA 2G1TA 3D7TB 4PQNA 4X6QC 4D1SA 3HVCA 4V0GA 4BDKA 4YU2A 3LM5A 2JBOA 4U0IA 5HLNA 4O82A 4CFXA 4YLJA 1W2FA 4S30A 2XCHA 1ZLTA 4HZSA 5FLFA 2YITA 1F5QA 1QMZA 2RG5A 3IDBA 4JLCA 3W2SA 4AOIA 4HNIA 3TUCA 2ZDTA 3ZONA 3EN6A 3DS6A 3CQUA 3FQSA 4L68A 4C3RA 3NSZA 2WGJA 3E92A 3PZEA 2W06A 4G9CA 5CSXA 4BI0A 4QQTA 2IW9A 1URCA 4RWLA 4HVHA 1G8SA 4IANA 2X0GA 3O50A 3UNKA 4CGAA 5L6PA 4ALVA 5ETIA 2CCIA 3SXRA 4ZTNA 3EYHA 3PJ2A 4E4LA 5JSMA 4JRNA 5DWRA 4UV0A 3PLAE 3KXMA 3LJ1A 3QFVA 4TYJA 3SC1A 1J1CA 3FPMA 3UNZA 3ZO4A 2VWYA 4AU8A 4AXCA 5AIRA 2ZOQA 1YDRE 4AZFA 4FE2A 4PTGA 1OUKA 5JRQA 2XS0A 4F0GA 4JAJA 2C1AA 3EL7A 1PMVA 5HIDA 4FEQA 5KE0A 3AKKA 1PXNA 5IA1A 1PMNA 3MVJA 4LOOA 3A2CA 2FUMA 2F7XE 3BBTB 4YUQA 3Q9YA 4QMMA 4OTWA 3OFMA 4FYNA 5K5NA 4YGAA 4OGRA 4XHKB 4CFWA 3NW6A 4CXAA 3EL8A 5IF1A 2ZM1A 4MWIA 5AEPA 4ASDA 2EB2A 4PRJA 3Q53A 3FYKX 1KOAA 3CPBA 3NUSA 4HPTE 4O22A 4U44A 3UE4A 3IW7A 4F7NA 3K3JA 5DEWA 4PDSA 1VYZA 2I0HA 4C33A 4I23A 5E8XA 4FSMA 4M0ZA 3ULIA 1XQZA 2GQSA 3ZRMA 4QYGA 4TWCA 5H8BA 3NZ0A 5AUZA 1OL2A 5ANIA 3AGMA 3QF9A 4O4FA 3D2KA 1HCKA 4I6QA 2YIXA 4L52A 3EQBA 3NRMA 4G3CA 4YP8A 2R3LA 3C4ZA 1G8AA 2PUNA 1HCLA 2WMWA 5KZIA 2DS1A 3PFYA 4KS8A 5EYKA 5DYJA 5BMSA 3OCTA 4HVDA 3UG1A 5M09A 3TIZA 5HTCA 4FGRA 4DC2A 4FR4A 4RLLA 2XK9A 2B4SB 2F4JA 2AUHA 3GC7A 4O81A 2WELA 3NS9A 3EFLA 2OLCA 5CAQA 1OPLA 1Y6BA 2FB8A 3DBFA 3KRLA 4FMQA 4QO9A 4JOAA 4O38A 5GHVA 4EBVA 2XH5A 2W1FA 1YXVA 4I6BA 4JRVA 3PIZA 1KE7A 2VGPA 4CZYB 4IVBA 5EH0A 3GQIA 5EM7A 3UDSA 2FSOX 3DTWA 3DU8A 3V6RA 4ZLZA 3CGOA 4O0UA 1NVRA 2Z02A 3GCSA 3AC3A 3EFJA 3U55A 2PMIA 3F2NA 1H1QA 2GNGA 2JFMA 2YM5A 3I0OA 3OXZA 2UW0A 2JDVA 3MBLA 4FKQA 2X81A 4WG4A 3V5WA 4EK3A 3PP1A 5IQBA 4MNEB 5K4JA 4EOLA 4L6QA 4K2RA 4CCBA 2YM4A 4FTIA 4X2FA 3IW6A 3LZBA 4J8NA</