1I09A

Structure of glycogen synthase kinase-3 (gsk3b)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
360
structure length
338
Chain Sequence
SMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structure of GSK3beta reveals a primed phosphorylation mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 338
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1i09A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1i09A01
4TYGA 4FT7A 5E8XA 1JVPP 4I5MA 3CC6A 3QGYA 2OK1A 5KHXA 4ACDA 4TWNA 4I92A 3KN5A 1IG1A 4YHFA 4IZ5A 3UIBA 1V0PA 2JITA 3OWLA 3LCKA 4RVLA 2VNYA 2Z7SA 4WNOA 4Y46A 4KRDA 5H9BA 4FTCA 3EFKA 3ELJA 3NUNA 4LL0A 5DNRA 3P78A 2OF4A 3SX9A 2HW6A 4UXQA 5AR4A 3I6WA 3R7YA 2JDTA 5CAQA 3ANRA 3BQCA 4N70A 5ANJA 5JGAA 2CDZA 4JQ8A 4YURA 4R5SA 3DXNA 3ZSHA 3PXRA 3ZM4A 3S4QA 3RAIA 1XKKA 3P1AA 4H3QA 5DR9A 3A60A 4RLKA 4GIIA 3HV6A 5HZNA 2JBOA 3AC4A 4GFOA 4B8LA 2QG5A 4IVBA 4EQCA 4GG7A 4BCHA 4R1YA 2BRHA 1PMEA 4TPTA 2UW3A 2YDKA 1WBOA 2H8HA 3GGFA 4GVJA 3C0HA 1PKDA 2UZNA 3V01A 2QVSE 4QMWA 4LGHA 4F70A 4GL9A 4FKUA 5DPVA 3C4WA 1XH6A 3FMDA 5AUYA 4X3FB 2WMSA 4XBRA 4RVTA 4IX3A 4FKOA 1WFCA 4QYGA 4E1ZA 2W5AA 1CDKA 3SRVB 1G5SA 1OL5A 3GCUA 2PZ5A 3MGYA 2I0YA 3P9JA 2OZAB 2C3KA 4ANSA 3SQQA 3UNZA 2XM9A 3FI4A 4BTKA 2QU5A 4QTCA 4LMNA 1KE8A 5KMIA 3G9NA 4RZWA 4I6FA 3R73A 4ZTSA 5KZ0A 4E20A 3AT2A 3HRBA 2C6LA 3I4BA 5JRQA 3F61A 3IW7A 4YP8A 2C0TA 3SDJA 4M13A 4IB1A 1Y6AA 4FSQA 1XBAA 2R3RA 3UP2A 5LWMA 3MY0A 1P5EA 2HZ4A 1H00A 4CFNA 2BDJA 3OEFX 4XRJA 4PDSA 4E5AX 2J0MB 4QP3A 2CPKE 3HGKA 5FTQA 5BVFA 2HWOA 3V5TA 3U55A 4FKIA 4AW1A 1OBDA 3D5XA 4FT0A 2W0JA 2C47A 3R8LA 4A06A 3E93A 3UJGA 2CMWA 3P7CA 3PJ8A 4RX7A 3G5DA 3D7ZA 3O2MA 3LW0A 4H58A 4CMTA 5BX0A 2C5OA 2WTIA 4V04A 4X6RA 4KSQA 3HNGA 4EWHA 2VTTA 3G90X 4FTRA 3VUHA 3GXLA 3LMIA 4J96A 2HZNA 2J0LA 4FSMA 3ROCA 1RE8A 3QUEA 3RWPA 3MDYA 3UOLA 3F5GA 4C7TA 3JXWA 5A4EA 4QMVA 4GK3A 3DJ7A 5AAEA 4JRNA 4DT8A 4XG2A 3TJDA 2PE1A 3VUMA 5JZJA 1GIHA 3GBZA 4C38A 2PYWA 4YJUA 3WZKA 3BYSA 1TKIA 3VS1A 5LCKA 1W7HA 1YXVA 5AV1A 3MH1A 3C13A 3NVKI 2IN6A 2C3IB 4O7YA 1Q24A 1VYWA 4E93A 5IH5A 4EOQA 4PUZA 4L00A 2P55A 3R04A 2PVRA 4E5BA 4KIOA 2PVLA 1ZOHA 3VBTA 3ZO1A 4FI1A 5A6NA 3W2OA 4AFJA 2GTMA 4ZSJA 3LZBA 4MXXA 3OXTA 2GMXA 2R7IA 4F9AA 5AV3A 1QPEA 3EFJA 2KULA 3KXHA 4ID7A 4RWKA 4M7IA 4BHNA 4FG7A 1ZYDA 2XB7A 3MFTA 4HYIA 5EI6A 3B2WA 3PJ1A 1WBTA 4TXCA 3RPSA 2G15A 3DAJA 3HA6A 3UG1A 1H1RA 4B6LA 5IEYA 2GFSA 3BHUA 4OBOA 4ASZA 2XKCA 5IEXA 5CWZA 1JWHA 3SA0A 3Q9YA 2PMLX 4GK4A 5DG5A 4DTAA 3I0OA 3TG1A 5EOBA 2XP2A 4AN2A 2YHVA 4CFXA 3C1XA 4XG7A 3WBLA 3VULA 3CBLA 3ZBXA 4TYHA 5JGBA 3FV8A 2OG8A 4X2KA 3GU5A 5F4NA 3PPZA 3PJCA 4IAFA 4QTDA 4I3ZA 3GFWA 3QD0A 5C8MA 4BYJA 3HV5A 3Q4CA 3VUKA 3VC4A 4DGLC 5IQEA 1OVEA 3MY5A 3DDPA 5H8BA 4TZRA 4RC2A 2X7GA 3FL5A 3PVUA 3I5ZA 1SYKA 3KXXA 4N6YA 4EZ3A 3HMMA 2OIQA 1FOTA 2JKMA 2UW9A 4MXOA 3LFSA 1ZOGA 3R0TA 2W1HA 2WEIA 4K77A 4HYUA 3QCSA 3EOCA 4RJ4A 4D4SA 3Q04A 3E87A 3F2NA 4FV4A 4P5QA 4BI1A 3R2BA 3RK9A 4E6AA 2OJGA 4OTHA 4RC4A 3RZBA 1UWJA 4HGTA 3BWJA 4JIKA 2GTNA 2XBJA 5EH0A 1WBNA 3FLWA 2HY0A 3FE3A 4LL5A 3WILA 4YTCA 1YDTE 5HD4A 5E8TA 5B0XA 1H24A 4L01A 2WMBA 4OBPA 2Y4IC 3COMA 3DKFA 3ZCLA 3PIYA 4M3QA 4ANQA 5K5XA 2NO3A 3EN4A 2A1AB 5BMSA 2AC5A 1LPUA 2EXMA 5IA2A 2J50A 4E6QA 3OCTA 2C68A 3OY1A 4QYEA 2PVYA 3W10A 2NRYA 2UZWE 3FQHA 4WSYA 1YWNA 5K3YA 1JKKA 2WXVA 4AQCA 4EORA 3PXQA 2XNOA 3F3UA 4JRVA 4V05A 2UV2A 3KA0A 5DR6A 3Q5ZA 4TRLA 3V8WA 4EH7A 2FVDA 4FV5A 2E9OA 3BBTB 4IC8A 1Q8ZA 3U9CA 4GU6A 3MJ1A 4QYFA 4RX9A 3AC8A 3LFCA 3QTIA 2O5KA 4YZMA 2W5HA 5C9CA 4QTAA 4EOIA 5CZHA 3W2QA 3NRMA 1GOLA 4LUEA 4OTGA 5JGDA 2PMIA 3FMEA 2OXDA 4BCIA 4GT4A 4CT2A 2XVDA 3ERKA 4HNIA 4PY1A 1RDQE 4RBLA 5AV2A 3R71A 3VUGA 2JEDA 3QAME 2P2IA 3FLQA 4MAOA 5C01A 3K3IA 2G9XA 3RAHA 3VBVA 3ZSIA 3A8WA 2W1ZA 4MCVA 5HTIA 4TY1A 4XJ0A 3E3PA 5GIOE 2JDVA 4YSJA 3RZFA 3SXSA 3KC3A 4FT5A 5CAUA 5GINE 3JVRA 2JLDA 2VWZA 3FJQE 2WGJA 5EI8A 1OITA 3P4KA 3F5PA 4AOTA 4BFMA 2FB8A 2OZOA 5EM8A 4DH8A 2QOFA 5CI6A 4LYNA 4AGDA 4Q9ZA 3PLAE 3AD5A 4ANLA 2QO9A 2GNHA 3UYSA 4DFBA 1PMVA 5LARA 2HOGA 1A48A 2O0UA 4CZTA 4BTFA 3E8EA 4QYHA 4FR4A 2OIBA 4DFXE 4IZAA 1NVRA 2PVFA 4QMUA 4DCEA 3DOGA 5BPYA 5GHVA 2ETKA 5HE1A 1MQBA 2RFNA 4MX9A 4NJ3A 4KKGA 2BRGA 1OPLA 3QLGA 2C4GA 4ZLYA 3C5UA 5DWRA 3ENMA 3ZFXA 4CFFA 4UMUA 4BDFA 4ZZMA 5AA9A 3BLHA 2YEXA 3O8UA 1SMHA 2VTIA 4RFZA 4G3FA 4QPMA 4M66A 3SOCA 3ORPA 5ANGA 1Q8TA 2FO0A 4NM5A 5L2IA 4J8MA 4BCQA 3HMIA 2DYLA 5D12A 1U59A 4D1XA 5L2QA 4PQNA 3I60A 3MS9A 4LI5A 2HELA 3JY0A 4U43A 3FZSA 4KB8A 2BAKA 3FHIA 3C4FA 4UALA 4YNEA 2ZMDA 4L46A 4EH2A 3FSFA 1M52A 2J90A 3PP0A 4KAOA 4ZTRA 5J8IA 5C27A 3UC4A 1Y57A 5DH3A 4D1ZA 3HP2A 4F6SA 3BIZA 3ATSA 3A62A 3E8CA 5EW9A 1GIJA 5M55A 4MNEA 3UODA 2BTSA 4HVGA 3VRZA 3NW5A 3ZBFA 1P2AA 4ITJA 4F9YA 2P3GX 5TF9A 2RGPA 4NIFA 1GZNA 4WG3A 4ZY4A 4XLIA 4R7BA 4WIHA 2CKPA 2XJ1A 2IPXA 2VWYA 3LCSA 3MFRA 4KS8A 4RA4A 3O96A 1FVVA 5GJDA 4QP9A 4AZVA 1R0PA 5H8GA 3IGOA 1WVYA 3NW6A 4DYMA 4AG8A 3FI2A 4ENYA 4ZZNA 2XK3A 2LAVA 4EC8A 4U45A 1JOWB 3ULZA 4FKTA 2QR7A 3RPYA 2W1CA 3UO6A 2UW6A 3QQGA 4Q9SA 4IXPA 3TEIA 3W16A 1YWRA 3FZPA 2OGVA 3ZO3A 4L8MA 2E9PA 4D9UA 3W55A 4EH8A 5I9UA 2O3PA 1XH9A 4E4NA 5J79A 5EQPA 5CVFA 4FIGA 3R83A 1NA7A 4CVAA 1GJOA 3P5KA 3KN6A 5KE0A 3G0FA 1OIQA 5DLSA 1F5QA 1XQZA 5CU2A 5HG7A 5JRSA 2XYUA 4A9YA 3U6IA 2BR1A 1P14A 1W83A 3AT3A 4YR8A 4O84A 4DGNA 3BGPA 4CG8A 3MV5A 4UN0C 2GS7A 3VS0A 4YZCA 3FLNC 2VGPA 2EXEA 2XK6A 4ZTNA 1KUTA 4R77A 4CRSA 1E1VA 2KTYA 3CPBA 3EYGA 4QP2A 2WMQA 4YTIA 4FZAB 3DTWA 2BRMA 3IG7A 3RAKA 4X2JA 3AC3A 3TNQB 4BVUA 3F6XA 5L6PA 5FEEA 4S2ZA 4IQ6A 2WOTA 5HKMA 3ORIA 3G0EA 2UW0A 4FL1A 5EW8A 1Q8UA 5CANA 3F2RA 1UU9A 5IF1A 4RVKA 1ZLTA 4C0TA 4DLIA 4Z7GA 4QNYA 4FUXA 2WFYA 4GH2A 3IW4A 3SKCA 2BTRA 2PPQA 4R7HA 4B99A 2VUWA 2Z60A 2UZBA 3R30A 3KF7A 5DEWA 3BQRA 1YI4A 3VJNA 4WBBB 3UZTA 3W2PA 4JR3A 4J53A 4P4CA 3LXLA 4U7ZA 4CLIA 4FTJA 4M68A 3D5UA 3P86A 4PRJA 4C37A 2R3JA 3CP9A 5J7BA 4FL2A 4AWIA 2X6EA 3QQJA 3QTXA 5DA3A 5ANOA 4EH5A 3QKKA 2VX0A 3VAPA 4DEHA 3CY3A 2AUHA 4FT9A 3QHWA 3IOKA 4PNIA 2BFXA 3H10A 3COKA 4UB7A 5ETCA 4GT5A 3VBQA 3FI3A 5A14A 4RIWA 5IA3A 4A4OA 2VZ6A 2CCHA 4TW9A 3BU6A 4O7LA 3BHVA 4BHZA 4NM3A 3EQPA 1REJA 1H0VA 4JJRA 1M7NA 3V8SA 3G15A 3CY2A 3SXRA 5HESA 4WT6A 5HVYA 2R3FA 2QKRA 4QQTA 3A61A 4L6QA 4QMQA 4F63A 3DA6A 4CT1A 3QALE 4G2FA 2NPQA 4U40A 1FINA 5HG8A 2PHKA 3PUPA 4K2RA 4HVHA 3NUSA 4PV0A 3H3CA 3HEGA 3PYYA 3SG9A 4IVDA 3R1QA 5AP1A 2FSOX 3R28A 2YLFA 4D2TA 1H4LA 4WKQA 3A7FA 5IUIA 3IW6A 3RJCA 4JDJA 5JH6A 2PMOX 4U9AA 3V5PA 5F20A 4BZDA 1JPAA 4FKJA 4MHAA 4FV9A 3TT0A 2B9IA 2J5EA 3OS3A 4ITHA 2EU9A 5HX8A 3F3VA 4QYYA 1LEZA 5HE2A 5BNJA 5KMLA 4EOOA 3UNKA 3QXPA 4MXCA 4IWPA 2ERZE 4E26A 2Z7RA 5ANIA 5L3AA 1JKLA 4IDTA 3ZEPA 5M51A 5CYIA 1OUKA 4FKRA 4G9RA 3KRLA 4P2KA 2VWWA 3NYNA 5D41A 3JR1A 1K3AA 1PW2A 2YFXA 4DH5A 4APPA 4RG0A 2ZOQA 1L8TA 2XM8A 4U44A 4E6DA 2NRUA 4C4IA 3I1AA 4PPAA 5HU3A 2XIRA 3D0EA 4YHJA 3HVCA 4ZK5A 4F1MA 3FKOA 4EH4A 5HLPA 3ZDUA 1PXPA 4ORKA 2QKWB 3F3WA 4FVQA 4FTAA 3OTUA 3DXQA 1U5RA 3RWQA 3IECA 3FLSA 3ZFYA 5DI1A 4FTKA 3CIKA 4YJVA 4FEVA 5C4LA 4BCGA 3CTJA 5LVPA 4K33A 4DE4A 1TQIA 4EOSA 4WOVA 2YWPA 4FZDB 4JG6A 2V0DA 3ZC6A 4BBMA 4YZDA 3UIUA 3AQVA 1XH5A 3FKNA 4I5HA 4C36A 5FM2A 3FMKA 4RSSA 4FSZA 2X6DA 3P08A 5E92A 3OWPA 2E9UA 4J7BA 3CKWA 5IDPA 5CEMA 4PL3A 5HVJA 1PXOA 4ZJIA 3V04A 3D7TB 4U8ZA 1Q62A 3D5WA 3M42A 3PFQA 4I5PA 2ZV7A 3ZC5A 3IO7A 3ORNA 5CNNA 5JK3A 3QD3A 2WQBA 3ZOSA 3MA6A 4ZMFA 4G6OA 4PWNA 2IWIA 2UW7A 4FTQA 4K9YA 3FLYA 3MY1A 1ZWSA 3EB0A 4TT7A 3QA0A 2WMVA 4FVPA 2HCKA 1MQ4A 3WYXA 3LQ3A 3EIDA 3JVSA 5M4UA 2XCKA 4CZUA 2HW7A 3EN9A 3TUDA 4DF3A 1LR4A 4CEGA 2YCQA 2Z2WA 4IW0A 3AMBA 2YIQA 4F9BA 1UKIA 3M1SA 4W4YA 3AC5A 4FSWA 4PDOA 3ENHA 3R6XA 4IVCA 4XUFA 5IA4A 3VO3A 1OM1A 4CFMA 5A6OA 2WAJA 4KINA 3RK5A 1Q5KA 4RQVA 4C02A 4BDGA 4YLKA 3TWJA 3QFVA 5BUIA 4L45A 4ZSAA 3R9HA 4UYNA 4F9WA 3EQGA 1XHAA 1YQJA 4JBPA 4YZ9A 5M08A 2ZV9A 2RIOA 3LFNA 4JS8A 1I44A 2VTQA 4JXFA 5H8EA 4DG0E 3C0IA 4RWIA 4RT7A 2QOKA 5T3QA 4IAKA 4AGWA 4BBFA 4FGBA 4IX4A 4PDYA 3E3BX 1O6YA 2XZSA 4IFCA 4BCJA 5CI7A 5HGIA 4E5WA 3EN7A 1JAMA 2JAMA 5AP2A 5KUPA 4J98A 4OTRA 5FG8A 3E88A 4K18A 1U46A 5LMBA 5BVNA 4NZWB 4XV2A 4DEIA 3G2FA 5CQUA 1DI9A 3UVRA 2YACA 4W9XA 5BQ0A 1NVSA 3V8TA 3LJ2A 5JFWA 3ZU7A 2AC3A 3EQRA 3NWWA 3A99A 3RBWA 2O2UA 1GNGA 3PWYA 3FXZA 4LRJA 3TM0A 4I23A 3LE6A 1YXUA 3U4WA 3EMGA 3NZ0A 5LJJA 5BVKA 2BMCA 4O0UA 1F0QA 4HCVA 4I21A 4LMUA 1CSNA 1ZYCA 3RP9A 5L8LA 4EOLA 4OW8A 4UV0A 3R7VA 4QMNA 3EL8A 3FQEA 3MN3A 5JMSA 5CY3A 2BRNA 4OUCA 4AUAA 4NWMA 3AC2A 2X81A 4EJ7A 4C58A 4WO5A 4KWPA 5JQ5A 4MNFA 3T3UA 4C61A 1KOBA 1JNKA 3U9NA 5L8KA 3UMWA 3UIMA 3DXPA 2W4KA 5ETAA 5HG5A 2B1PA 1DM2A 1M2QA 3L8XA 3QRTA 4D28A 3WARA 5AP6A 4AA0A 4WUNA 2VO7A 2XNNA 3A7JA 3NUUA 4XOYA 5AX9A 3O7LB 5D10A 3BEAA 3AGLA 3FXWA 4E4LA 1OPJA 4L43A 5M44A 3F5XA 4MBLA 3TIYA 2X39A 4GKIA 4XG4A 4O83A 3DK6A 5AAFA 4FG9A 2CNQA 3BHHA 2B9JA 3BKBA 4F65A 2P0CA 4FSNA 4EI4A 4EK3A 4JT3A 3MI9A 2GQSA 2VWXA 3V51A 4BGGA 1YOLA 5FM3A 4IBMA 3CQEA 4HJOA 4Q2AA 3V3VA 4W8EA 1JSTA 3DLZA 3IS5A 1H08A 3ITZA 3RCJA 3PE1A 5CAVA 4L3PA 4LOOA 4FK3A 3ZH8A 3EN5A 1KSWA 3PSDA 5FP5A 5FXRA 1R3CA 4QMOA 3THBA 5EM5A 3DNDA 4XP3A 3GUBA 5M4IA 1S9IA 2XNGA 3H0YA 2X8DA 4ZS4A 3T3VA 1J1CA 5T6KA 4XG6A 5C8KA 4KKHA 4O6EA 4KIPA 3PIZA 3RKBA 3LCOA 2GU8A 3TI1A 3MBLA 2E2BA 4JL9A 3FZRA 3VF8A 4E4XA 1BX6A 4MTAA 1AD5A 3LCDA 4R3CA 4XHKB 3RCDA 4DGMA 2F7XE 2PY3A 3ACKA 4KD1A 5M09A 3LLTA 1SVHA 4RIXA 4MQ1A 4C59A 2PVMA 3VN9A 4YSMA 5E9EA 3BLRA 1XWSA 2XK4A 4NW5A 2Y0AA 3QKMA 3BCEA 5L2TA 2ONLC 4KIKA 4O0RA 5IQCA 4GKHA 3S0OA 4PPBA 4HZSA 2UZOA 3GC0A 5D11A 3ANQA 3GQIA 4U5JA 4BDDA 2RF9A 2WMAA 4AZFA 3UC3A 2H34A 5LVLA 4ZEGA 2IO6A 3RINA 2W1EA 3MPTA 3U8WA 3VS7A 4BCPA 5C26A 4MD9E 3ZYAA 1H1PA 4M0ZA 1Q41A 2HENA 2VO6A 4XMOA 2CGVA 3R2YA 2QLUA 4I4FA 2UVXA 5HEZA 3PY1A 2WZJA 3I6UA 2CGXA 4L3JA 2XS0A 2GNFA 3NUXA 2WEVA 2YERA 3QTZA 4IX6A 4Y83A 2IW6A 3GI3A 3ZRLA 3PXFA 4IWDA 4IZYA 2ZV8A 4EUTA 3UQFA 5CF8A 3C4CA 3BX5A 4IACA 3DAKA 4FYOA 3GCQA 4ZTLA 5BUEA 3LCTA 3FL4A 3TKHA 3TV6A 2DQ7X 4U81A 3KMWA 5FTOA 1W0XC 4CKJA 4AN3A 3DZQA 2HXQA 2YN8A 3UPZA 4GJ3A 2VWIA 4O0WA 5CSWA 4E73A 1JBPE 4JLCA 5E8ZA 4ASEA 1UA2A 1YHSA 3LPBA 3PPKA 4W4XA 5GIPE 5IA5A 3A7HA 1PXNA 4J97A 1M2RA 4AS0A 2R64A 2OXXA 4D2VA 4YTFA 4M69B 2GSFA 2XNPA 5F94A 3VUTA 4RFYA 5HIDA 3KK8A 4EEVA 3BGQA 1H07A 3NYXA 4BL1A 2PUPA 1JSUA 4IVAA 1OIUA 4BKYA 4CKRA 3ALOA 4EOMA 1B38A 2VTLA 3G6HA 2BKZA 5IQIA 5CTPA 5EKOA 2OU7A 2JFLA 1W82A 2HK5A 3OW4A 2OJFE 2YIWA 3ZO4A 4QTEA 4H36A 3UMXA 2WMTA 3H30A 1OI9A 3HMPA 4FUYA 3P23A 3MSSA 2W7XA 1F3MC 3R8UA 3EZRA 4F08A 3RMFA 1IR3A 4GEOA 5DT0A 4C4HA 3ROYA 4C3PA 4D4VA 4RVMA 1ERKA 3QU0A 2XUUA 4N6ZA 3JY9A 2PE2A 3ZRMA 4F7NA 1O9UA 3KCKA 4GS6A 5EYMA 3SW4A 1M7QA 3U6JA 5FGKA 3IGGA 1YKRA 3QHRA 4MXYA 2ITNA 4WNKA 4UEUA 5EW3A 4XP2A 4DBXA 2XKEA 4WRSA 4LRKA 3UGCA 4BF2A 4DITA 3S2PA 5ITAA 5IUHA 3DU8A 5M53A 5CT7A 4CFVA 2RG6A 2VGOA 3H9OA 4FKVA 2RG5A 1UKHA 3CS9A 4OTQA 1DI8A 3AXWA 4DFNA 3R21A 2QO7A 5AV4A 3WE8A 5L6OA 5J9LA 4TYIA 5BVDA 3LXKA 2QHNA 4ZJVA 1AQ1A 5EYKA 1G8SA 2EB3A 5AUWA 4R3PA 4Y72A 3R8MA 5GJFA 3U6HA 3AGMA 1PXLA 4NJDA 5ETIA 5AJQA 3D5VA 4C4FA 4BWKA 3O7LD 5DVRA 4FEXA 5DRDA 4NK9A 4RJ3A 3ORZA 4XV9A 5I9ZA 4LGGA 3BV3A 2X2LA 4HPTE 4C35A 4F09A 2OJ9A 4FX3A 3W2CA 1RQQA 4FZFB 2XRWA 2B53A 2VO3A 3OBGA 5GJGA 4O27B 4RLLA 4FV6A 4G3GA 1LEWA 2R0IA 1OKWA 1OUYA 3HKOA 5BVEA 3DK7A 5EK7A 4FVRA 5FDPA 4GG5A 5J87A 4ZLZA 2AYPA 4OTFA 1VZOA 3H0ZA 4OTDA 1P4OA 2VWVA 3EHAA 3MWUA 4RZVA 2F9GA 4F0GA 5ACKA 1OECA 3TCPA 1P4FA 5HNBA 4NW6A 1XBCA 3ET7A 4N4SA 4B4LA 1CKIA 2BAJA 3SRVA 4AW2A 2ITOA 4H1MA 4FEWA 3R22A 4IAYA 1OMWA 2OZAA 5AX3A 2OH4A 4YGAA 5FTGA 3QWJA 3RM6A 3F82A 4FYNA 4USDA 2BZIB 3QTSA 4BDCA 4YPSA 4S34A 4KUJA 4ZZOA 4IEBA 4QQ5A 4BI2A 2WOUA 4FIEA 3QRKA 5A46A 1BLXA 4MF0A 3F7ZA 3QZFA 3PA3A 4FNWA 2I0EA 3FUPA 3PG3A 4UWYA 4JI9A 5CU3A 5IISA 3V5LA 4EH3A 4L53A 5HG9A 2WQOA 3HMOA 4GUEA 2X9FA 1OPKA 3CTHA 3ACJA 4QMXA 5DOSA 4HCUA 2V5QA 4O0SA 2JDSA 5EOLA 2W4OA 2UUEA 4EH9A 2F2UA 3HAMA 2PSQA 2WB8A 2OFVA 4NTSA 3P7AA 4FV1A 4YJQA 3DV3A 4QP6A 2PVNA 3OOMA 3HYHA 3PY0A 3O51A 3UOKA 4ZJJA 4QMSA 2PK9A 3I7CA 3TN8A 5IG1A 4F4PA 3EH9A 2HYYA 1XH8A 2Z8CA 3JUHA 4IM0A 4IDVA 4MNEB 3BI6A 3FBVA 4R6VA 5AP4A 4AW5A 4TYEA 5J9ZA 5KKRC 2Q83A 3KVXA 3F9NA 4O2ZA 2FSTX 4EHGA 4EUUA 3QZGA 1DS5A 4Y8DA 3ID6C 1CM8A 5HD7A 4NM0A 2A2AA 2BZJA 5E8VA 3TACA 3DBDA 3QWKA 4BIBA 5AR7A 4FICA 2HAKA 3CGFA 1DAWA 3IQ7A 2VTHA 4YUQA 3W33A 2B9HA 2W5BA 5AUVA 3QKLA 5HNIX 5EG3A 2WD1A 3FZ1A 4ZSLA 3V5WA 4A9SA 2UZTA 2X9EA 4NEUA 3UBDA 2C69A 2OICA 2VX1A 2ZVAA 3EKKA 3GC9A 5KBQA 1JSVA 4RFMA 2R3IA 2JBPA 2QOQA 1U4DA 3GU8A 1PXJA 3DBFA 1SZMA 4J8NA 4KBKA 2CNUA 4D5KA 2BVAA 4MEDA 4MWHA 4Y5QA 3TZMA 4M84A 5M56A 2WTDA 3C50A 5HCXA 3FDNA 4K6ZA 4O6LA 3GENA 3KREA 4PTGA 2JIVA 5HTBA 4V0GA 1URCA 2O64A 3EJ1A 3QQUA 3OP5A 4GYGA 3MTFA 4GVAA 4OAUC 2R3PA 5HCZA 2B0QA 4GFMA 5HORA 4BCOA 4NCTC 5D9HA 5AR5A 4FKWA 2ONLA 2XYNA 4KBCA 4BTJA 4CQEA 3ZLWA 4HGEA 4L44A 4FNZA 3QCQA 5EQEA 4KRCA 5AP3A 3Q4ZA 5FQDC 3QA8A 5FRIA 4A9RA 3QRUA 3N4VA 4AA4A 3PRIA 2X2MA 3EQFA 4D2SA 5A4LA 3LKMA 4X21A 3GU4A 3C9WA 4RWJA 4U97A 5E8UA 4RC3A 5A3XA 3WF6A 2Z7QA 2WNTA 1Y8YA 4MXZA 4DAWA 1BI8A 2WELA 2QO2A 4DH7A 3KGAA 2QLQA 1U5QA 4B8MA 4EJNA 2PUUA 3VIDA 4CFUA 4QPSA 4IJ9A 2R3LA 4LRMA 1FVTA 3PXZA 4G17A 2R3NA 4NU1A 3TZ7A 3WOWA 4DH1A 1PMNA 5IQBA 2OJIA 3TNHA 4GIHA 2C3JA 3PVGA 4R78A 5HCYA 3BYVA 4S33A 4AOIA 5E8WA 4BCNA 4Z9LA 4V01A 2R7BA 3BLQA 5DBXA 1R78A 3PJ3A 4L68A 3MJ2A 5AR8A 4BZOA 4YC8A 3PSCA 3ORMA 5L2SA 3HAVA 4CG9A 4FF8A 3G6GA 5DFPA 2BZKB 3R9OA 3GC8A 3QQFA 5LVMA 3JS2A 2VTPA 1XH7A 3UNJA 3EQIA 2OIDA 2CSNA 3IKAA 4EK4A 1ZMVA 3Q4UA 3D83A 3U54A 1IA9A 3KU2A 3W8QA 3QQHA 2ERKA 1GIIA 1XO2B 2PVHA 3QL8A 4X3JA 5B2LA 1U54B 3E64A 4XS2A 3MVMA 4C62A 4RA5A 4AU8A 3QQKA 2ZYBA 4JBVA 2RFEA 5I4NA 4FTTA 4JR7A 4YHTA 1IAHA 2PZPA 4OTIA 3L1SA 4HYHA 3VS2A 3CD3A 4DG3E 3WF8A 3MFSA 3OWJA 2B52A 4QRCA 3D15A 3Q6UA 4OTPA 1G3NA 5GZ9A 4CTBA 4B9DA 3KFAA 3MH0A 2VTNA 4GT3A 3U51A 4HYSA 3BHYA 3FXXA 1IAJA 2A19B 4IC7A 4XG8A 1G8AA 2YAAA 4JG8A 2WU7A 3VQUA 2ZDTA 5IU2A 2FYSA 2Y4IB 4M0YA 5AA8A 3NGAA 1YVJA 4TNDA 4NM7A 3CTQA 3KL8A 1GZKA 3OT3A 5CZIA 1ZRZA 2O65A 3DBQA 4JOAA 4KS7A 2F7EE 1ZOEA 1KV1A 1VR2A 4MXAA 3LFEA 3UYTA 4ANOA 4OAVB 3DPKA 3ETAA 4EOPA 3MA3A 3UQCA 3CLYA 3QTWA 2VU3A 4BWPA 4DFUA 2YIXA 5I9WA 4UY9A 5AUUA 3OXZA 3Q4TA 4HGSA 4I6QA 1XJDA 3PXYA 3SOAA 4AZEA 5CF6A 4FZ7A 4O81A 4HVDA 3NCZA 3TTIA 4I22A 2CN5A 2R4BA 5KMMA 3NPCA 4YO6A 5EM7A 4FTMA 5FEDA 3ZMMA 4JAJA 5LVNA 1TQPA 3KRXA 4DH3A 4F1OA 4TL0A 3OMVA 2EVAA 4I5CA 3SHEA 2CGWA 4G3EA 2QCSA 3ZDIA 1MRYA 3CJGA 3OFMA 3VBWA 4XP0A 3F5UA 3MPMA 4NSTA 5EDQA 5AM7A 3ORXA 4EKLA 4M8TA 4J95A 5C1QB 4GFGA 4O22A 4GRBA 5CU4A 4IE9A 2XKDA 4UBAA 3ZEWA 5CEPA 4BZNA 4F7LA 1YXXA 3RALA 1GAGA 3FAAA 3GCSA 4EHZA 3I0QA 3LMHA 5J5SA 3KULB 2WMRA 3PZHA 4MH7A 4ALVA 4P90A 2PE0A 3GB2A 4YBJA 2GNLA 5E8SA 3BRBA 3AOXA 2HY81 2VTOA 4CNHA 4CZYB 4QNAA 4UX9A 4C33A 2WTKC 3Q2MA 4EH6A 3N51A 5HLWA 4FTIA 4PPCA 2IJMA 3DCVA 3H4JA 3NYOA 4XG9A 5F1ZA 5CENA 4AF3A 4D2WA 4ALUA 4R8QA 5AFVA 5CSPA 4LV8A 1YW2A 2VWUA 4ZS0A 3G51A 3OUNB 5ANDA 3VHEA 2P33A 3LXPA 4UZDA 3AT4A 4J99A 2J0JA 3IDCA 5LQFA 4NUSA 3RI1A 3IK3A 4PMPA 4JBOA 3FMJA 4ZP5A 3LVPA 3S3IA 4AX8A 4MD7E 4UMTA 1GY3A 4U41A 4FC0A 4Y85A 1ZXEA 5JZNA 4QO9A 4NL0A 4RIYA 3OD6X 5ANKA 4HVIA 3UZPA 4UMRA 3LHJA 2ITZA 1YRPA 3RPRA 2VTAA 4IANA 4M12A 3R9RA 1WBWA 4D1SA 4CLJA 2YM5A 3E8NA 4IX5A 1URWA 1UU7A 2C6MA 1IASA 3AMYA 3CQUA 3ZFMA 3TKIA 3Q60A 4KNBA 4WA9A 1S9JA 4AXAA 4BWXA 4BR3A 1V0OA 3OROA 4O21A 4ZY6A 5IKWA 5EDPA 5J7HA 3KXZA 3PRFA 4FV0A 3MB7A 5AIKA 4C4GA 4CYJA 4XV1A 4AE9A 1UU3A 4G34A 4I1ZA 4I20A 5IEVA 3OHTA 3K5UA 3LFDA 1Q8WA 4M97A 4QPAA 2W1IA 4F6WA 2UZLA 4LG4A 5M4FA 5JFSA 5IQHA 4U3YA 2FSLX 4FKPA 5FD2A 3W1FA 2V7OA 2PZRA 3C0GA 3Q5IA 4MK0A 4DEEA 3VJOA 4NFMA 2BKKA 1YXTA 4CGAA 5I9YA 2GHMA 5ANEA 3UO4A 4HNFA 4O7NA 5TT7A 4R1VA 4W4WA 3L8SA 5K4IA 4J71A 1W8CA 4ZY5A 1UNGA 3DB8A 4BGHA 3G9LX 2J9MA 3UIXA 3DLSA 4F0FA 2I1MA 1ZYJA 2VRXA 1UVRA 2ZB1A 3SV0A 4BCFA 5FDXA 5EDRA 4QQCA 3F3TA 4RPVA 1FVRA 2UZDA 5FXQA 5IMEA 1PXMA 1BL7A 3OVVA 3M2WA 4NFNA 4E3CA 5KBRA 3DQXA 2H9VA 4XG3A 2C6DA 3L9PA 4U80A 4IAAA 2ZMCA 2W17A 5FP6A 5T68A 2C5NA 2C3LA 4WG5A 3NAYA 5CSVA 5L2WA 2VV9A 3VQHA 5M07A 4NCTA 4YLJA 5HBHA 3ZO2A 5HLNA 2GCDA 2Y8OA 1A9UA 3POZA 3NUPA 3D14A 3SD0A 4BKZA 2GPHA 2SRCA 4JAIA 3ZLSA 3Q2JA 1I09A 2B4SB 2YJRA 4ANMA 3ZXTA 5JKGA 4RJ7A 1J7IA 4GMYA 4ACMA 2PMNX 3DFCB 1AGWA 1NW1A 4PNKA 3OEZA 3T8OA 4WNMA 3MIAA 4NKAA 2WTCA 1ZZLA 1J91A 1UNLA 3DBCA 4RIOA 3EQDA 5IQAA 4EQMA 2YCRA 4L67A 4WSQA 4AN9A 2ZV2A 2ZAZA 5AR3A 3R7IA 5B2MA 2O63A 1ZY4A 4A9UA 4JDHA 3Q52A 1WBVA 3VVHA 3O71A 3FQSA 3DBEA 1H28A 4ZSEA 5E4HA 4U0IA 4DGGA 3DY7A 4OBQA 2O8YA 3QF9A 4K8AA 2CJMA 3ODYX 2PWLA 2F2CB 3LMGA 1UWHA 3QGWA 4JDKA 5CSHA 5DRBA 3S95A 3TXOA 4EONA 3UVPA 5DHJA 2XA4A 4Z16A 4D2RA 1KV2A 3WZEA 5C8NA 1Z5MA 4ZTMA 1WMKA 4MBIA 4X3FC 4FE2A 1Q99A 3CPCA 3GVUA 5M57A 3VBXA 3UOHA 4BB4A 3FI8A 4C3RA 4YPDA 3TUBA 3HUBA 2BDWA 5HVKA 4FV8A 5CXZA 1UU8A 2W1DA 3BEGA 2P2HA 4ANNA 4FIIA 2LGCA 2QU6A 3FWQA 4U42A 5IPJA 3IDBA 5EHOA 2R3OA 1ZY5A 4U3ZA 4AOJA 5K4JA 3MVLA 4KIKB 3UDBA 5FEQA 4I41A 4FTUA 4TWOA 2CN8A 5KHWA 3M11A 4JNWA 2NNWB 2VTMA 2G1TA 4D4RA 4C2WA 5IA1A 4HGLA 4WRGA 1JKSA 3F2AA 4F7SA 1Y6BA 2YDIA 4AT3A 2OWBA 2ITQA 4IMYA 3B2TA 4ZOGA 3WZJA 4A4XA 5CNOA 1KOAA 3ZSGA 3R1SA 3CE3A 4FT3A 4C4JA 1OL1A 1H1SA 2CGUA 4H3BA 2OW3A 3ZZWA 4RGJA 4FSYA 3QUDA 3O23A 5HX6A 4QT1A 1YOMA 1PYXA 3GOKA 4MBJA 3RPOA 5BYLA 4N0SA 1HOWA 4G3DA 3GNIB 3ULIA 3VS4A 2XEYA 4I6BA 1VJYA 5J1VA 4EYMA 4I0SA 4IZ7A 3WZUA 4BDBA 4IAZA 2YIYA 3QLFA 3SG8A 4LGDA 2X1NA 3DZOA 3C51A 2P4IA 4QMTA 3DDQA 2C1AA 3FMHA 4ZAUA 1B6CB 3Q9XA 5FUTA 1PXIA 3NNXA 1WBSA 4PP9A 3IPHA 2J5FA 3OCGA 3QX4A 4EKKA 4HVSA 4CYIA 4Y73A 3ZUVA 3TV4A 3HDMA 1GZ8A 1QPDA 3QD4A 3NX8A 2ZJWA 2PL0A 2JDRA 3A2CA 3MPAA 3WZDA 4EK8A 4ZLOA 2XRUA 2YM3A 2C6OA 1IEPA 2IVSA 2CKOA 1FQ1B 3E7VA 4FNYA 4FG8A 5BUJA 2PULA 4XNEA 2C6KA 4AP7A 1SNXA 5AAGA 3K2LA 4QOXA 4DEAA 3PA5A 3S1HA 4XOZA 1O6LA 3DNEA 3EQCA 4WNPA 4WD5A 1R1WA 4YMJA 4BDAA 3BZ3A 5M06A 1WBPA 5GNKA 3RPVA 3CGOA 5AR2A 3OXIA 4OLIA 5HE3A 2B7AA 1RJBA 5LOHA 1OGUA 1OKYA 4BDHA 3NCGA 2JKOA 2R0UA 3DK3A 4OT6A 3U87A 2RSVA 3A8XA 1V1KA 5I9XA 2W05A 5HOAA 4FIHA 4X7QA 5ACBC 4I93A 5LVOA 3UPXA 3GT8A 4O91A 5HICA 1Q97A 3QC4A 5I0BA 2PVKA 3V5QA 1E9HA 5EHLA 2ITVA 3KMUA 3OW3A 1FBNA 1XR1A 4RQKA 3V6RA 2ACXA 4EOJA 4I0RA 3RK7A 2DWBA 2XIYA 3QD2B 2J4ZA 5LMKC 2ITUA 4RWLA 2J0IA 1A06A 5CEIA 2VO0A 3QCXA 1KE6A 2GDOA 4IFGA 4Y5HA 4O0XA 3RNYA 4U6RA 3VNTA 3CD8A 1Q61A 2JKQA 2C5YA 2W9ZB 4IHPA 3NMUF 2JKKA 3KVWA 2W96B 5AP0A 2IW9A 5FWKK 5EI2A 2W99B 2XNEA 5E1EA 2GHLA 2JAVA 1TVOA 4DHFA 4EZ7A 4BKJA 3LQ5A 3FYKX 5M4CA 4DTKA 1H01A 4LQMA 2UZUE 2HWPA 3QC9A 3ZLYA 4AGUA 2PUNA 2VTSA 3C4XA 4I0TA 2OXYA 2DS1A 5EHYA 3ZUTA 2CNVA 2VTRA 3F69A 5DR2A 3QBNA 4O0TA 2UVYA 4FA2A 5G6VA 1ZMWA 4QQJA 2J2IB 3WIGA 1WCCA 1ZYSA 2IZTA 1K2PA 4FV3A 3QZIA 4TYJA 3QRJA 4DFYA 3UOJA 4FOBA 4I4EA 1J3HA 4IH8A 1YOJA 3ZUUA 4TYHB 1PY5A 4JX3A 4EWQA 3MIYA 3QRIA 4G6LA 4O0VA 1IRKA 2BCJA 5G1XA 3EFLA 2XK8A 3COIA 3RVGA 3FC1X 3PG1A 1EH4A 4CMUA 3NNVA 5EFQA 3N4UA 3UTOA 4OGRA 4YU2A 3OCBA 2A27A 5E91A 4L9IA 3UE4A 2WIHA 2XH5A 4J1RA 3FKLA 2XCHA 3KRWA 3HUCA 5H3QA 2ITTA 2WTWA 3NEWA 3F7WA 3DJ6A 3NNUA 4FTLA 4USEA 5BVOA 2QR8A 3NW7A 4S32A 4F64A 5KNJA 2Q0BA 2GS6A 4QP1A 2FGIA 1QMZA 3HP5A 4XBUA 3HZTA 3NNWA 3TDVA 4M15A 3IONA 4UZHA 4DEDA 3EFWA 3FLZA 3BPRA 2BAQA 2B55A 4Z55A 4BICA 5F95A 3VHKA 1TQMA 4BI0A 3TUCA 4M14A 3OUKA 3QQLA 4FMQA 3R7UA 3TTJA 2HIWA 1K9AA 2ETRA 3AD6A 2FH9A 4CXAA 3EYHA 5A4CA 3A7GA 4PMTA 1KWPA 5J1WA 3CJFA 4BRXA 2YCFA 3BWFA 4E8AA 3H9FA 4ASDA 3GU6A 4E7WA 4GSBA 3HRCA 5IMXA 2XJ2A 2XK9A 3V5JA 5L8JA 2QURA 3LXNA 4FNXA 4OTWA 3WYYA 3I79A 4AACA 4USFA 5KMNA 3ZS5A 3UO5A 3L9NA 2QOIA 3BHTA 2R3GA 1UNHA 5E1SA 4OT5A 3BBWA 4PX6A 1DAYA 3PZEA 4NTTA 4G3CA 4QMPA 1YXSA 3DT1A 2OBJA 4CKIA 3RNIA 1J7LA 5A4QA 5CVHA 2I40A 3NVMB 4CCBA 1NY3A 3FY0A 2XF0A 4I6HA 2IVUA 1KE9A 1WAKA 1OB3A 2PZYA 3AG9A 2EXCX 3W2SA 3PVWA 2UW5A 2ITYA 2QI8A 2YZAA 4GU9A 5GZ8A 3UQGA 2VN9A 5K5NA 4E4MA 3LJ0A 5ETFA 4X3FA 5AUXA 2QQ7A 4Y95A 5CLPA 3OWKA 5HQ0A 5IA0A 4FBXA 5DMZA 4PMSA 5I3RA 3KXNA 1Q8YA 4NT4A 2JDOA 2IW8A 2WKMA 4V0GB 1YHVA 3BGZA 3P79A 3NS9A 1MRVA 3LQ8A 3R02A 2WU6A 4S30A 3E62A 5IDNA 2G2FA 5JFXA 3GC7A 1HCKA 3SVVA 2YM4A 2UW8A 2XKFA 3HV3A 3PP1A 4W9WA 4YNOA 3TZ9A 5JSMA 2CHLA 2HZIA 1PKGA 3BU3A 2QOLA 4ZTHA 4M69A 2XIXA 5BYZA 4UMQA 4ALWA 4CTCA 4KSPA 2ITPA 2UW4A 2X2KA 4DINA 2ETMA 2XNMA 4MD8E 4IWOA 4CD0A 4JIAA 5J95A 2BALA 5TOZA 1H27A 2V7AA 5HNGA 4EHVA 2GNGA 3PSBA 3GU7A 2J7TA 5CAPA 2V62A 2H6DA 2X8EA 4K0YA 5HO7A 4UXLA 4FSUA 3UVQA 1J1BA 4FIJA 4O0YA 3OT8A 3PIXA 2UVZA 2YM7A 4O2PA 4D0WA 2QG7A 3OBJA 1X8BA 4HCTA 4BBEA 3DKOA 4GYIA 4DG2E 3O17A 4B7TA 4BC6A 3VF9A 4FSRA 4L52A 3KB7A 4H1JA 3GCVA 5IQFA 2GQRA 2FUMA 2HXLA 5LXMA 4NIFB 1W98A 4XRLA 3TV7A 3C5IA 3A4OX 4RRVA 1Q3DA 1M2PA 4X2FA 5HE0A 4IIRA 4WG4A 3NIEA 5IUGA 4UWBA 4AAAA 3DTCA 4QTBA 5K0XA 2ITWA 5HIEA 4QMZA 3G33A 4QMLA 4ASXA 2REIA 4G5PA 4TWPA 4EBWA 2YIRA 5KCVA 1QL6A 3LLAA 4FEUA 5AUZA 2F7ZE 3KXMA 3OF0A 5A54A 1Z57A 2G01A 4F0IA 3FEGA 5CALA 4C34A 4D55A 3PWDA 1YHWA 5CXHA 4BDEA 5AM6A 5E90A 1RW8A 3QTQA 2Y6OA 1T45A 3C7QA 5L4QA 1ZAOA 1O6KA 2BILB 2WQMA 4FSTA 2X8IA 3MYGA 3R7EA 4DBNA 1YI3A 3POOA 1CKJA 3REPA 2B9FA 3VUIA 5L6WL 1PRYA 4KKEA 1QCFA 3QX2A 4AZTA 1R0EA 2XIKA 1KE7A 4JDIA 4CCUA 3Q9WA 4HW7A 3LFQA 5FXSA 3HV7A 1VEBA 5KMKA 3CEKA 4R3RA 1FGIA 4YLLA 1ZYLA 3MH2A 4AFEA 4DC2A 3SGCA 4WBOA 2YLEA 4ANBA 3L8PA 2XMYA 3FHRA 1MUOA 3AD4A 4MYGA 5CQWA 4ACHA 4C8BA 4O7SA 3KEXA 4O96A 1BL6A 1H1QA 4PP7A 4BN1A 1HCLA 4CV9A 1T46A 2W06A 1OIYA 2FSMX 4MKCA 3ZM9A 4TNBA 4J52A 4FOCA 1H25A 4ACGA 4FODA 2VAGA 5LCJA 2Y9QA 3TNWA 3SLSA 4H39A 5D7VA 2R3QA 4NKSA 1OZ1A 4O38A 2VD5A 3Q3BA 4DTBA 5KZIA 5F9EA 4LOPA 4A07A 3A7IA 3BYMA 3FPMA 5C03A 4KBAA 3RHKA 3UP7A 3MVJA 3ZRKA 1SVEA 5HBJA 2QHMA 4TTHB 5IZFA 5DYJA 4IAIA 2BUJA 5FBNC 2WTVA 3ZZEA 2V55A 5EYCA 1STCE 4UWCA 2OI4X 1VYZA 2X0GA 4ERWA 4QMYA 4Q5EA 2PTKA 4MQ2A 3TKUA 4I24A 5GZAA 1BYGA 2R3KA 5I3OA 3FSKA 3R8ZA 1LUFA 4DFLA 3ORLA 4XYFA 4L7SA 4RJ8A 4C2VA 2X7OA 1APME 1Q3WA 1REKA 2OH0E 3I5NA 2WQNA 3ZLXA 3CSVA 4YJTA 3HECA 2Y7JA 3R8PA 4F7JA 4L42A 1B39A 4B0GA 4NYEA 4KIQA 3HDNA 1M14A 1YWVA 4D4YA 3BELA 3Q96A 5CF5A 4G6NA 4D58A 3ZTXA 5BYYA 3Q6WA 1V0BA 1Z9XA 4AT5A 2F4JA 5A4TA 4BTMA 2JC6A 3R01A 4RIWB 2Y6MA 4PL4A 1BMKA 1IA8A 3RM7A 2BIYA 4BCKA 2Z02A 4YJRA 4CV8A 3QYWA 3DB6A 3R63A 3OZ6A 3KQ7A 1WVXA 4U79A 4HPUE 2I6LA 4JQEA 1FGKA 4XLVA 4LFIA 3VUDA 3WI6A 4ACCA 4YC6A 2UZEA 4WUAA 4D5HA 4Z7HA 5ICPA 3TNPC 2YA9A 1SVGA 3IDPA 2C6EA 5FBOA 2QOCA 4FV2A 4KA3A 4PDPA 3MTLA 3MESA 2DUVA 4TKSA 1YDRE 5AEPA 2C6TA 3MW1A 3BYUA 4LV5A 5BVWA 4O7TA 2QONA 3AC1A 3SXFA 2ESMA 3TL8A 4CMOA 4QP4A 3BV2A 2WIPA 2QOHA 2BPMA 1JKTA 4IWQA 4BDIA 4A9TA 4HZRA 2W9FB 4EQUA 4YO4A 1ZZ2A 2I7QA 3PPJA 4RJ5A 3VW8A 3F3ZA 3AMAA 4WHZA 4XV3A 2C6IA 1PXKA 2CLXA 3KRJA 1PHKA 4XCUA 3PJ2A 4K11A 2BRBA 1R39A 5JQ8A 3TZ8A 4FGRA 2BIKB 3NYVA 5IH6A 4RIYB 4UYAA 3U4UA 3WF9A 5HI2A 3CR0A 2CKEA 3WF7A 2ZM4A 3DKGA 3F88A 5CSXA 3DS6A 4O1OA 2QC6A 3DAEA 4ENXA 3PDTA 3DJ5A 3TDWA 4ZMEA 5TO8A 2YM8A 2Z7LA 3BYOA 2F49A 4IADA 3R7OA 3UG2A 2WHBA 1YI6A 4JBQA 2OJJA 5KKRB 5J5TA 2CKQA 3KK9A 2XK7A 4OR5A 3W8LA 4P5ZA 3NUYA 4H05A 5CT0A 4EC9A 4XEYA 5DGZA 4O82A 4QD6A 3KCFA 5HO6A 2QD9A 2G2IA 3RHXA 3D94A 3O50A 4CRLA 4DEBA 3ORTA 4G9CA 2OSCA 3EN6A 3KMMA 4Z3VA 1ATPE 1FMOE 3VRYA 3D4QA 2C0OA 5JEBA 4AT4A 2JFMA 4C4EA 3VWAA 2YABA 2YWVA 4IM3A 4K1BA 5EYDA 3CKXA 3H9RA 3K3JA 5JT2A 4ITIA 4P7EA 4BDJA 3ORKA 2R2PA 2W1FA 3Q9ZA 2R3MA 5KMJA 2GHGA 2BZHB 4FEQA 2V22A 2WTJA 3NIZA 1OKZA 1ZMUA 4DN5A 3R7GA 5HBEA 5B2KA 3PA4A 3Q32A 1CKPA 3LFAA 4C57A 2R5TA 3BU5A 2JIUA 4IB0A 3L9MA 1UV5A 4BCMA 1Y8GA 1OKVA 3L9LA 5K0KA 3QZHA 3R1YA 4M67A 1M17A 5DT3A 3NDMA 3W32A 5AMNA 1ZARA 2FA2A 3DQWA 4G5JA 4IB3A 1SM2A 5AIRA 4FKGA 4PTCA 4EHEA 4ERKA 4L3LA 3LAUA 4X2GA 1Q4LA 5AUTA 4I94A 4S31A 5CASA 4IJPA 3COHA 3LFFA 4QP8A 3LIJA 2Q0NA 5DEYA 3TIZA 4FKLA 4D9TA 2OLCA 4RMZA 3OY3A 3EL7A 2EUFB 3FMLA 5HIBA 2OF2A 4ZXTA 5LMAA 4AE6A 3KY2A 3K5VA 2XBAA 2GS2A 2GNIA 3FMNA 2B54A 5JN2A 4QMMA 4R5YA 3LM5A 3IW5A 2YITA 1OBGA 3PE2A 3Q53A 4O7ZA 4GW8A 4EBVA 4JQ7A 1NT2A 2G2HA 1U54A 5AWMA 3R1NA 3QTUA 3PTGA 2PU8A 4YZBA 1CTPE 3FC2A 4II5A 4H3PA 2RFDA 4EZ5A 3EQHA 3N9XA 2VTJA 2YISA 3QXOA 3FZTA 2R9SA 3LJ1A 4DEGA 1FPUA 1E1XA 2IVVA 4G31A 2ZDUA 4X2NA 5TE0A 4YJSA 4BYIA 5AP7A 5IH4A 3HA8A 5CEQA 4YJPA 3SW7A 2WMWA 2HZ0A 4ZSGA 3CXWA 5TKDA 4UMPA 1QPJA 4BIDA 5LWNA 3VBYA 3MFUA 3OOGA 3UZRA 1PYEA 3NR9A 1W84A 2YDJA 2I0HA 2XEZA 2F57A 3MH3A 1CMKE 3PXKA 4F99A 5BMMA 4APCA 4IB5A 1H0WA 4QP7A 3D2KA 4DCAA 5E8YA 3T9TA 5HTCA 5I5ZA 2XNBA 3P0MA 1QPCA 4N57A 1LP4A 2QOOA 3F66A 1FMKA 3E8DA 3EZVA 3VW6A 3DFAA 5AADA 4ONAA 3V6SA 1OL6A 3LFBA 1SNUA 1YDSE 2YCSA 5HHWA 1NVQA 3LOKA 4LM5A 2J0KA 4DLJA 1NXKA 4PF4A 4F6UA 5KMOA 4O7RA 3NAXA 3R8VA 3GOPA 4IM2A 2WMXA 2ZM3A 3BE9A 2PZIA 3NLBA 1OL2A 4E6CA 3ZONA 3FZOA 2CLQA 3QCYA 2PVJA 4HOKA 2EWAA 3B8RA 2BDFA 5DT4A 2BFYA 3C4ZA 3RTPA 2VWBA 2VX3A 4G1WA 3VS3A 4ARKA 2IZUA 4EK6A 4O86A 5D1JA 3HV4A 3ZXZA 5DIAA 5TR6A 3GFEA 3KXGA 5KX8A 2XJ0A 4MF1A 5B7VA 1KE5A 4F9CA 2X4FA 3QTRA 2IG7A 3ALNA 3C4EA 2OKRA 3EWHA 4DFZE 3FMMA 4NH1A 5JFVA 2RKUA 3O8PA 2W1GA 4AZWA 4W4VA 4AGCA 4DA5A 2YJSA 4RX5A 3A4PA 3KULA 4DGOA 2IZRA 2UZVA 4G16A 4CQGA 3K54A 3BE2A 4KABA 5CS6A 1XH4A 4JX7A 3E7OA 3HMNA 2JIIA 1Y91A 4GK2A 4PMMA 3I81A 4JG7A 1L3RE 2NP8A 2Y4PA 2BROA 1OL7A 5CU6A 3PY3A 4FTNA 2C5VA 5EKNA 4BDKA 3CCNA 2BHHA 3IW8A 2PUIA 2C30A 2QNJA 3D2IA 3JYAA 3E63A 4GJ2A 5DN3A 3S00A 3P7BA 3WE4A 2QODA 3O8TA 4LUDA 3ODZX 5FLFA 3L8VA 2RFSA 2ZM1A 4X6QC 3R00A 2GQGA 3GQLA 4AA5A 5KO1A 5CF4A 4FZ6A 1OIRA 2VNWA 4EL9A 5J9YA 3NUAA 4EYJA 3PVBA 4EK5A 2JD5A 1ND4A 3JPVA 2YAKA 1PMUA 4FKSA 4DT9A 2H96A 4FIFA 4RIXB 2OFUA 3FPQA 1J7UA 3IOPA 4RJ6A 3MB6A 2C5XA 4W8DA 3HX4A 4XX9A 4CSVA 4YC3A 4BIEA 5DE2A 3OTVA 4GV1A 1BI7A 3ZHPC 3N4TA 2CCIA 2WQEA 1MRUA 5H2UA 5K9IA 3KF4A 4FL3A 4C3FA 3HLLA 1H26A 3GCPA 3HL7A 5IQDA 4FKQA 2ITXA 4CFWA 1H1WA 2E9NA 2X7FA 2WMUA 3OG7A 4X0MA 3R9NA 4O1PA 2IVTA 4JVGA 5CAOA 1JLUE 4L7FA 1H8FA 2WTKB 2X4ZA 2C1BA 4ZIMA 3DKCA 3WIKA 2A4LA 3VS5A 2BHEA 3TNIA 3E5AA 3II5A 5CU0A 5IQGA 4MVFA 3MVHA 1XBBA 4BGQA 2EB2A 3TJCA 4TWCA 4YTHA 2GFCA 2YM6A 3WF5A 5I9VA 4YJOA 3DGKA 3KRRA 4GCJA 3CQWA 5AP5A 1PF8A 2ZB0A 5CEOA 4R7IA 1BUHA 1JQHA 5HO8A 2R3HA 1WZYA 3T9IA 4F1TA 3D7TA 3GEQA 1PJKA 1WVWA 2J51A 4RX8A 5CVGA 4ZTQA 3SC1A 4FTOA 3I7BA 3QUPA 2QOBA 3W2RA 1BKXA 4YZNA 5E7RA 4PL5A 3D9VA 3OC1A 3EQBA 3E92A 3VS6A 3HRFA 2E9VA 4YBKA 4D0XA 3ATTA 4LOQA 5CX9A 4GUBA 5A9UA 4FV7A 5EM6A 4YJNA 4O7WA 2A0CX 2RL5A 3EKNA 5HU9A 2XIZA 3W18A 3SAYA 2WO6A 3R9DA 3O0GA 3RGFA 4BY9E 4XH6A 4A4LA 3LM0A 1MP8A 4Q5HA 4TN6A 4AW0A 5CEKA 3OCSA 4FK6A 5C4KA 5LMKA 4A7CA 2JGZA 3GP0A 4D2PA 2W4JA 3NSZA 2C0IA 2GNJA 3RAWA 3B8QA 4EOKA 2I0VA 3KKVA 2OO8X 2WPAA 4AZSA 1GZOA 3PLSA 3QYZA 4MWIA 3FY2A 3FYJX 4PTEA 2YZLA 5EQYA 5AV0A 4O7VA 2J6MA 2IZSA 5D7AA
chains in the Genus database with same CATH superfamily
4TYGA 4FT7A 5E8XA 1JVPP 4I5MA 3CC6A 3QGYA 2OK1A 5KHXA 4ACDA 4TWNA 4I92A 3KN5A 1IG1A 4YHFA 4IZ5A 3UIBA 1V0PA 2JITA 3OWLA 3LCKA 4RVLA 2VNYA 2Z7SA 4WNOA 4Y46A 4KRDA 5H9BA 4FTCA 3EFKA 3ELJA 3NUNA 4LL0A 5DNRA 3P78A 2OF4A 3SX9A 2HW6A 4UXQA 5AR4A 3I6WA 3R7YA 2JDTA 5CAQA 3ANRA 3BQCA 4N70A 5ANJA 5JGAA 2CDZA 4JQ8A 4YURA 4R5SA 3DXNA 3ZSHA 3PXRA 3ZM4A 3S4QA 3RAIA 1XKKA 3P1AA 4H3QA 5DR9A 3A60A 4RLKA 4GIIA 3HV6A 5HZNA 2JBOA 3W0RA 3AC4A 4GFOA 4B8LA 2QG5A 4IVBA 4EQCA 4GG7A 4BCHA 4R1YA 2BRHA 1PMEA 4TPTA 2UW3A 2YDKA 1WBOA 2H8HA 3GGFA 4GVJA 3C0HA 1PKDA 2UZNA 3V01A 2QVSE 4QMWA 4LGHA 4F70A 4GL9A 4FKUA 5DPVA 3C4WA 1XH6A 3FMDA 5AUYA 4X3FB 2WMSA 4XBRA 4RVTA 4IX3A 4FKOA 1WFCA 4QYGA 4E1ZA 2W5AA 1CDKA 3SRVB 1G5SA 1OL5A 3GCUA 2PZ5A 3MGYA 2I0YA 3P9JA 2OZAB 2C3KA 4DHIB 4ANSA 3SQQA 3UNZA 2XM9A 3FI4A 4BTKA 2QU5A 4QTCA 4LMNA 1KE8A 5KMIA 3G9NA 4RZWA 4I6FA 3R73A 4ZTSA 5KZ0A 4E20A 3AT2A 3HRBA 2C6LA 3I4BA 5JRQA 3F61A 3IW7A 4YP8A 2C0TA 3SDJA 1G8JA 4M13A 4IB1A 1Y6AA 4FSQA 1XBAA 2R3RA 3UP2A 5LWMA 3MY0A 1P5EA 2HZ4A 1H00A 4CFNA 2BDJA 3OEFX 4XRJA 4PDSA 4E5AX 2J0MB 4QP3A 2CPKE 3HGKA 5FTQA 5BVFA 2HWOA 3V5TA 3U55A 4FKIA 4AW1A 1OBDA 3D5XA 4FT0A 2W0JA 2C47A 3R8LA 4A06A 3E93A 3UJGA 2CMWA 3P7CA 3PJ8A 4RX7A 3G5DA 3D7ZA 3O2MA 3LW0A 4H58A 4CMTA 5BX0A 2C5OA 2WTIA 4V04A 4X6RA 4KSQA 3HNGA 4EWHA 2VTTA 3G90X 4FTRA 3VUHA 3GXLA 3LMIA 4J96A 2HZNA 2J0LA 4FSMA 3ROCA 1RE8A 3QUEA 3RWPA 3MDYA 3UOLA 3F5GA 4C7TA 3JXWA 5A4EA 4QMVA 4GK3A 3DJ7A 5AAEA 4JRNA 4DT8A 4XG2A 3TJDA 2PE1A 3VUMA 5JZJA 1GIHA 3GBZA 4O4CA 4C38A 4YJUA 3WZKA 2PYWA 3BYSA 1TKIA 3AKLA 3VS1A 5LCKA 1W7HA 1YXVA 5AV1A 3MH1A 3C13A 3NVKI 2IN6A 2C3IB 4O7YA 1Q24A 1VYWA 4E93A 5IH5A 4EOQA 4PUZA 4L00A 2P55A 3R04A 2PVRA 4E5BA 4KIOA 2PVLA 1ZOHA 3VBTA 3ZO1A 4FI1A 5A6NA 3W2OA 4AFJA 2GTMA 2XANA 4ZSJA 3LZBA 4MXXA 3OXTA 2GMXA 2R7IA 4QDEA 4F9AA 5AV3A 1QPEA 3EFJA 2KULA 3KXHA 4ID7A 4RWKA 4M7IA 4BHNA 4FG7A 1ZYDA 2XB7A 3MFTA 4HYIA 5EI6A 3B2WA 3PJ1A 1WBTA 4TXCA 3RPSA 2G15A 3DAJA 3HA6A 3UG1A 1H1RA 4B6LA 5IEYA 2GFSA 3BHUA 4OBOA 4ASZA 2XKCA 5IEXA 5CWZA 1JWHA 3SA0A 3Q9YA 2PMLX 4GK4A 5DG5A 4DTAA 3I0OA 3TG1A 5EOBA 2XP2A 4AN2A 2YHVA 4CFXA 3C1XA 4XG7A 3WBLA 3VULA 3CBLA 3ZBXA 4TYHA 5JGBA 3FV8A 2OG8A 4X2KA 3GU5A 5F4NA 3PPZA 3PJCA 4IAFA 4QTDA 4I3ZA 3GFWA 3QD0A 5C8MA 4BYJA 3HV5A 3Q4CA 3VUKA 3VC4A 4DGLC 4AXFA 1OVEA 3MY5A 5IQEA 3DDPA 5H8BA 4TZRA 4RC2A 2X7GA 3FL5A 3PVUA 3I5ZA 1SYKA 3KXXA 4N6YA 4EZ3A 3HMMA 2OIQA 1FOTA 2JKMA 2UW9A 4MXOA 3LFSA 1ZOGA 3R0TA 2W1HA 2WEIA 4K77A 4HYUA 3QCSA 3EOCA 4RJ4A 4D4SA 3Q04A 3E87A 3F2NA 4FV4A 4P5QA 4BI1A 3R2BA 3RK9A 4E6AA 2OJGA 2AEGA 4OTHA 4RC4A 3RZBA 1UWJA 4HGTA 3BWJA 4JIKA 2GTNA 2XBJA 5EH0A 1WBNA 3FLWA 2HY0A 3FE3A 4LL5A 3WILA 4YTCA 1YDTE 5HD4A 5E8TA 5B0XA 1H24A 4L01A 2WMBA 4OBPA 2Y4IC 3COMA 3DKFA 3ZCLA 3PIYA 4M3QA 4ANQA 5K5XA 2NO3A 3EN4A 2A1AB 5BMSA 2AC5A 1LPUA 2EXMA 5IA2A 2J50A 4E6QA 3OCTA 2C68A 3OY1A 4QYEA 2PVYA 3W10A 2NRYA 2UZWE 3FQHA 4WSYA 1YWNA 5K3YA 1JKKA 2WXVA 4AQCA 4EORA 3PXQA 2XNOA 3F3UA 4JRVA 4V05A 2UV2A 3KA0A 5DR6A 3Q5ZA 4TRLA 3V8WA 4EH7A 2FVDA 4FV5A 2E9OA 3BBTB 4IC8A 1Q8ZA 3U9CA 4GU6A 3MJ1A 4QYFA 4RX9A 3AC8A 3LFCA 3QTIA 2O5KA 4YZMA 2W5HA 5C9CA 4QTAA 4EOIA 5CZHA 3W2QA 3NRMA 1GOLA 4LUEA 4OTGA 5JGDA 2PMIA 3FMEA 2OXDA 4BCIA 4GT4A 4CT2A 2XVDA 3ERKA 4HNIA 4PY1A 1RDQE 4RBLA 5AV2A 3R71A 3VUGA 2JEDA 3QAME 2P2IA 3FLQA 4MAOA 5C01A 3K3IA 2G9XA 3RAHA 3VBVA 3ZSIA 3A8WA 2W1ZA 4MCVA 5HTIA 4TY1A 4XJ0A 3E3PA 5GIOE 2JDVA 4YSJA 3RZFA 3SXSA 3KC3A 4FT5A 5CAUA 5GINE 3JVRA 2JLDA 2VWZA 3FJQE 2WGJA 5EI8A 1OITA 3P4KA 3F5PA 4AOTA 4BFMA 2FB8A 2OZOA 5EM8A 4DH8A 2QOFA 5CI6A 4LYNA 4AGDA 4Q9ZA 3PLAE 3AD5A 4ANLA 2QO9A 2GNHA 3UYSA 4AXCA 4DFBA 1PMVA 5LARA 2HOGA 1A48A 2O0UA 4CZTA 4BTFA 3E8EA 4QYHA 4FR4A 2OIBA 4DFXE 4IZAA 1NVRA 2PVFA 4QMUA 4DCEA 3DOGA 5BPYA 5GHVA 2ETKA 5HE1A 1MQBA 2RFNA 4MX9A 4NJ3A 4KKGA 2BRGA 1OPLA 3QLGA 2C4GA 4ZLYA 3C5UA 5DWRA 3ENMA 3ZFXA 4CFFA 4UMUA 4BDFA 4ZZMA 5AA9A 3BLHA 2YEXA 3O8UA 1SMHA 2VTIA 4RFZA 4G3FA 4QPMA 4M66A 3SOCA 3ORPA 5ANGA 1Q8TA 2FO0A 4NM5A 5L2IA 4QDVA 4J8MA 4BCQA 3HMIA 2DYLA 5D12A 1U59A 4D1XA 5L2QA 4PQNA 3I60A 3MS9A 4LI5A 2HELA 3JY0A 4U43A 4MUQA 3FZSA 4KB8A 2BAKA 3FHIA 3C4FA 4UALA 4YNEA 2ZMDA 4L46A 4EH2A 3FSFA 1M52A 2J90A 3PP0A 4KAOA 4ZTRA 5J8IA 5C27A 3UC4A 1Y57A 3BLAA 5DH3A 4D1ZA 3HP2A 4F6SA 3BIZA 1VLRA 3ATSA 3A62A 3E8CA 5EW9A 1GIJA 5M55A 4MNEA 3UODA 2BTSA 4HVGA 3VRZA 3NW5A 3ZBFA 1P2AA 4ITJA 3O5AA 2AQXA 4F9YA 2P3GX 5TF9A 2RGPA 4NIFA 1GZNA 4WG3A 4ZY4A 4XLIA 4R7BA 4WIHA 2CKPA 2XJ1A 2IPXA 2VWYA 3LCSA 3MFRA 4KS8A 4RA4A 3O96A 1FVVA 5GJDA 4QP9A 4AZVA 1R0PA 5H8GA 3IGOA 1WVYA 3NW6A 4DYMA 4AG8A 3FI2A 3BL9A 4ENYA 4ZZNA 2XK3A 2LAVA 3W0PA 4EC8A 4U45A 1JOWB 3ULZA 4FKTA 2QR7A 3RPYA 2W1CA 3UO6A 2UW6A 3QQGA 4Q9SA 4IXPA 3TEIA 3W16A 1YWRA 3FZPA 2OGVA 3ZO3A 4L8MA 2E9PA 4D9UA 3W55A 4EH8A 5I9UA 2O3PA 1XH9A 4E4NA 5J79A 5EQPA 5CVFA 4FIGA 3R83A 1NA7A 4CVAA 1GJOA 3P5KA 3KN6A 5KE0A 3G0FA 1OIQA 5DLSA 1F5QA 1XQZA 5CU2A 5HG7A 5JRSA 2XYUA 4A9YA 3U6IA 2BR1A 1P14A 1W83A 3AT3A 4YR8A 4O84A 4DGNA 3BGPA 4CG8A 3MV5A 4UN0C 2GS7A 3VS0A 4YZCA 3FLNC 2VGPA 2EXEA 2XK6A 4ZTNA 1KUTA 4R77A 4CRSA 1E1VA 2KTYA 3CPBA 3EYGA 4QP2A 3UDTA 2WMQA 4YTIA 4FZAB 3DTWA 2BRMA 3IG7A 3RAKA 4X2JA 3AC3A 3TNQB 4BVUA 3F6XA 5L6PA 5FEEA 4S2ZA 4IQ6A 2WOTA 5HKMA 4AAYA 3ORIA 3G0EA 2UW0A 4FL1A 5EW8A 1Q8UA 5CANA 3F2RA 1UU9A 5IF1A 4RVKA 1ZLTA 4C0TA 4DLIA 4Z7GA 4QNYA 4FUXA 2WFYA 4GH2A 3IW4A 3SKCA 2BTRA 2PPQA 4R7HA 4B99A 2VUWA 2Z60A 2UZBA 3R30A 3KF7A 5DEWA 3BQRA 1YI4A 3VJNA 4WBBB 3UZTA 3W2PA 4JR3A 4J53A 4P4CA 3AKKA 3LXLA 4U7ZA 4CLIA 4FTJA 4M68A 3D5UA 3P86A 4PRJA 4C37A 2R3JA 3CP9A 5J7BA 4FL2A 4AWIA 2X6EA 3QQJA 3QTXA 5DA3A 5ANOA 4EH5A 3QKKA 2VX0A 4O4DA 3VAPA 4DEHA 3CY3A 2AUHA 4FT9A 3QHWA 3IOKA 4PNIA 2BFXA 3H10A 3COKA 4UB7A 5ETCA 4GT5A 3VBQA 3FI3A 5A14A 4RIWA 5IA3A 4A4OA 2VZ6A 2CCHA 4TW9A 3BU6A 4O7LA 3BHVA 4BHZA 4NM3A 3PFYA 3EQPA 1REJA 1H0VA 4JJRA 1M7NA 3V8SA 3G15A 3CY2A 3SXRA 4QEBA 5HESA 4WT6A 5HVYA 2R3FA 2QKRA 4QQTA 3A61A 4L6QA 4QMQA 4F63A 3DA6A 4CT1A 3QALE 4G2FA 2NPQA 4U40A 1FINA 5HG8A 2PHKA 3PUPA 4K2RA 4HVHA 3NUSA 4PV0A 3H3CA 3HEGA 3PYYA 3SG9A 4IVDA 3R1QA 5AP1A 2FSOX 3R28A 2YLFA 4D2TA 1H4LA 4WKQA 3A7FA 5IUIA 3IW6A 3RJCA 4JDJA 5JH6A 2PMOX 4U9AA 3V5PA 5F20A 4BZDA 1JPAA 4FKJA 4MHAA 4FV9A 3TT0A 2B9IA 2J5EA 3OS3A 4ITHA 2EU9A 5HX8A 3F3VA 4QYYA 1LEZA 5HE2A 5BNJA 5KMLA 4EOOA 3UNKA 3QXPA 4MXCA 4IWPA 2ERZE 4DDGA 4E26A 2Z7RA 5ANIA 5L3AA 1JKLA 4IDTA 3ZEPA 5M51A 5CYIA 1OUKA 4FKRA 4G9RA 3KRLA 4P2KA 2VWWA 3NYNA 5D41A 3JR1A 1K3AA 2XARA 1PW2A 2YFXA 4DH5A 4APPA 4RG0A 2ZOQA 1L8TA 2XM8A 4U44A 4E6DA 2NRUA 4C4IA 3I1AA 4PPAA 5HU3A 2XIRA 3D0EA 4YHJA 3HVCA 4ZK5A 4F1MA 3FKOA 4EH4A 5HLPA 3ZDUA 1PXPA 4ORKA 2QKWB 3F3WA 4FVQA 4FTAA 3OTUA 3DXQA 1U5RA 3RWQA 3IECA 3FLSA 3ZFYA 5DI1A 4FTKA 3CIKA 4YJVA 4FEVA 5C4LA 4BCGA 2X0OA 3CTJA 5LVPA 4K33A 3UDSA 4DE4A 1TQIA 4EOSA 4WOVA 2YWPA 4FZDB 4JG6A 2V0DA 3ZC6A 4BBMA 4YZDA 3UIUA 3AQVA 1XH5A 3FKNA 4I5HA 4C36A 5FM2A 3FMKA 4RSSA 4FSZA 2X6DA 3P08A 5E92A 3OWPA 2E9UA 4J7BA 3CKWA 5IDPA 5CEMA 4PL3A 5HVJA 1PXOA 4ZJIA 3V04A 3D7TB 4U8ZA 1Q62A 3D5WA 3M42A 3PFQA 4I5PA 2ZV7A 3ZC5A 3IO7A 3ORNA 5CNNA 5JK3A 3QD3A 2WQBA 3ZOSA 3MA6A 4ZMFA 4G6OA 4PWNA 2IWIA 2UW7A 4FTQA 4K9YA 3FLYA 3MY1A 1ZWSA 3EB0A 4TT7A 3QA0A 2WMVA 4FVPA 2HCKA 1MQ4A 3WYXA 3LQ3A 3EIDA 3JVSA 5M4UA 2XCKA 4CZUA 2HW7A 3EN9A 3TUDA 4DF3A 1LR4A 4CEGA 2YCQA 2Z2WA 4IW0A 3AMBA 2YIQA 4F9BA 1UKIA 3M1SA 4W4YA 3AC5A 4FSWA 4PDOA 3ENHA 3R6XA 4IVCA 4XUFA 5IA4A 3VO3A 1OM1A 4CFMA 5A6OA 2WAJA 3KIOC 4KINA 3RK5A 1Q5KA 4RQVA 4C02A 4BDGA 4YLKA 3TWJA 3QFVA 5BUIA 4L45A 4ZSAA 3R9HA 4UYNA 4F9WA 3EQGA 1XHAA 1YQJA 4JBPA 4YZ9A 5M08A 2ZV9A 2RIOA 3LFNA 4JS8A 1I44A 2VTQA 4JXFA 5H8EA 4DG0E 3C0IA 4RWIA 4RT7A 2QOKA 5T3QA 4IAKA 4AGWA 4BBFA 4FGBA 4IX4A 4PDYA 3E3BX 1O6YA 2XZSA 4IFCA 4BCJA 5CI7A 5HGIA 4E5WA 3EN7A 1JAMA 2JAMA 5AP2A 5KUPA 4J98A 4OTRA 5FG8A 3E88A 4K18A 1U46A 5LMBA 5BVNA 4NZWB 4XV2A 4DEIA 3G2FA 5CQUA 1DI9A 3UVRA 2YACA 4W9XA 5BQ0A 1NVSA 3V8TA 3LJ2A 5JFWA 3UDZA 3ZU7A 2AC3A 3EQRA 3NWWA 3A99A 3RBWA 2O2UA 1GNGA 3PWYA 3FXZA 4LRJA 3TM0A 4I23A 3LE6A 1YXUA 3U4WA 3EMGA 3NZ0A 5LJJA 5BVKA 2BMCA 4O0UA 1F0QA 4HCVA 4I21A 4LMUA 1CSNA 1ZYCA 3RP9A 5L8LA 4EOLA 4OW8A 4UV0A 3R7VA 4QMNA 3EL8A 3FQEA 3MN3A 5JMSA 5CY3A 2BRNA 4OUCA 4AUAA 4NWMA 3AC2A 2X81A 4EJ7A 4C58A 4WO5A 4KWPA 5JQ5A 4MNFA 3T3UA 4C61A 1KOBA 1JNKA 3U9NA 5L8KA 3UMWA 3UIMA 2XAOA 3DXPA 2W4KA 5ETAA 5HG5A 2B1PA 1DM2A 1M2QA 3L8XA 3QRTA 4D28A 3WARA 5AP6A 4AA0A 4WUNA 2VO7A 2XNNA 3A7JA 3NUUA 4XOYA 5AX9A 3O7LB 5D10A 3BEAA 3AGLA 3FXWA 4E4LA 1OPJA 4L43A 5M44A 3F5XA 4MBLA 3TIYA 2X39A 4GKIA 4XG4A 4O83A 3DK6A 5AAFA 4FG9A 2CNQA 3BHHA 2B9JA 3BKBA 4F65A 2P0CA 4FSNA 4EI4A 4EK3A 2XAMA 4JT3A 3MI9A 2GQSA 2VWXA 3V51A 4BGGA 1YOLA 5FM3A 4IBMA 3CQEA 4HJOA 4Q2AA 3V3VA 4W8EA 1JSTA 3DLZA 3IS5A 1H08A 3ITZA 3RCJA 3PE1A 5CAVA 4L3PA 4LOOA 4FK3A 3ZH8A 3EN5A 1KSWA 3PSDA 5FP5A 5FXRA 1R3CA 1XMMA 4DHZA 4QMOA 3THBA 5EM5A 3DNDA 4XP3A 3GUBA 5M4IA 1S9IA 2XNGA 3H0YA 2X8DA 4ZS4A 3T3VA 1J1CA 5T6KA 4XG6A 5C8KA 4KKHA 4O6EA 4KIPA 3PIZA 3RKBA 3LCOA 2GU8A 3TI1A 3MBLA 2E2BA 4JL9A 3FZRA 3VF8A 4E4XA 1BX6A 4MTAA 1AD5A 3LCDA 4R3CA 4XHKB 3RCDA 4DGMA 2F7XE 2PY3A 3ACKA 4KD1A 5M09A 3LLTA 1SVHA 4RIXA 4MQ1A 4C59A 2PVMA 3VN9A 4YSMA 5E9EA 3BLRA 1XWSA 2XK4A 4NW5A 2Y0AA 3QKMA 3BCEA 5L2TA 2ONLC 4KIKA 4O0RA 5IQCA 4GKHA 3S0OA 4PPBA 3ML1A 4HZSA 2UZOA 3GC0A 5D11A 3ANQA 3GQIA 4U5JA 3W0OA 4BDDA 2RF9A 2WMAA 4AZFA 3UC3A 2H34A 5LVLA 4ZEGA 2IO6A 3RINA 2W1EA 3MPTA 3U8WA 3VS7A 4BCPA 5C26A 4MD9E 3ZYAA 1H1PA 4M0ZA 1Q41A 2HENA 2VO6A 4XMOA 2CGVA 3R2YA 2QLUA 4I4FA 2UVXA 5HEZA 3PY1A 2WZJA 3I6UA 2CGXA 3W0QA 4L3JA 2XS0A 2GNFA 3NUXA 2WEVA 2YERA 3QTZA 4IX6A 4Y83A 2IW6A 3GI3A 3ZRLA 3PXFA 4IWDA 4IZYA 2ZV8A 4EUTA 3UQFA 5CF8A 3C4CA 3BX5A 4IACA 3DAKA 4FYOA 3GCQA 4ZTLA 5BUEA 3LCTA 3FL4A 3TKHA 3TV6A 2DQ7X 4U81A 3KMWA 5FTOA 1W0XC 4CKJA 4AN3A 3DZQA 2HXQA 2YN8A 3UPZA 4GJ3A 2VWIA 4O0WA 5CSWA 4E73A 2A98A 1JBPE 4JLCA 5E8ZA 4ASEA 1UA2A 1YHSA 3LPBA 3PPKA 4W4XA 5GIPE 5IA5A 3A7HA 1PXNA 4J97A 1M2RA 4AS0A 2R64A 2OXXA 4D2VA 4YTFA 4M69B 2GSFA 2XNPA 5F94A 3VUTA 4BJJA 4RFYA 5HIDA 3KK8A 4EEVA 3BGQA 1H07A 3NYXA 4BL1A 2PUPA 1JSUA 4IVAA 1OIUA 4BKYA 4CKRA 3ALOA 4EOMA 1B38A 2VTLA 3G6HA 2BKZA 5IQIA 5CTPA 5EKOA 2OU7A 2JFLA 1W82A 2HK5A 3OW4A 2OJFE 2YIWA 3ZO4A 4QTEA 4H36A 3UMXA 2WMTA 3H30A 1OI9A 3HMPA 4FUYA 3P23A 3MSSA 2W7XA 1F3MC 3R8UA 3EZRA 4F08A 3RMFA 1IR3A 4GEOA 5DT0A 4C4HA 3ROYA 4C3PA 4D4VA 4RVMA 1ERKA 2X0QA 3QU0A 2XUUA 4N6ZA 3JY9A 2PE2A 3ZRMA 4F7NA 1O9UA 3KCKA 4GS6A 5EYMA 3SW4A 1M7QA 3U6JA 5FGKA 3IGGA 1YKRA 3QHRA 4MXYA 2ITNA 4WNKA 4UEUA 5EW3A 4XP2A 4DBXA 2XKEA 4WRSA 4LRKA 3UGCA 4BF2A 4DITA 3S2PA 5ITAA 5IUHA 3DU8A 5M53A 5CT7A 4CFVA 2RG6A 2VGOA 3H9OA 4FKVA 2RG5A 1UKHA 3CS9A 4OTQA 1DI8A 3AXWA 4DFNA 3R21A 2QO7A 5AV4A 3WE8A 5L6OA 5J9LA 4TYIA 5BVDA 3LXKA 2QHNA 4ZJVA 1AQ1A 5EYKA 1G8SA 2EB3A 5AUWA 4R3PA 4Y72A 3R8MA 5GJFA 3U6HA 3AGMA 1PXLA 4NJDA 5ETIA 1ST4A 5AJQA 3D5VA 4C4FA 4BWKA 3O7LD 5DVRA 4FEXA 5DRDA 4NK9A 4RJ3A 3ORZA 4XV9A 5I9ZA 4LGGA 3BV3A 2X2LA 4HPTE 4C35A 4F09A 2OJ9A 4FX3A 3W2CA 1RQQA 4FZFB 2XRWA 2B53A 2VO3A 3OBGA 5GJGA 4O27B 4RLLA 4FV6A 4G3GA 1LEWA 2R0IA 1OKWA 1OUYA 3HKOA 5BVEA 2ZFYA 3DK7A 5EK7A 4FVRA 5FDPA 4GG5A 5J87A 4ZLZA 2AYPA 4OTFA 4JMQA 1VZOA 3H0ZA 4OTDA 1P4OA 2VWVA 3EHAA 3MWUA 4RZVA 2F9GA 4F0GA 5ACKA 1OECA 3TCPA 1P4FA 5HNBA 4NW6A 1XBCA 3ET7A 4N4SA 4B4LA 1CKIA 2BAJA 3SRVA 4AW2A 2ITOA 4H1MA 4FEWA 3R22A 4IAYA 1OMWA 2OZAA 5AX3A 2OH4A 4YGAA 5FTGA 3QWJA 3RM6A 3F82A 4FYNA 4USDA 2BZIB 3QTSA 4BDCA 4YPSA 4S34A 4KUJA 4ZZOA 4IEBA 4QQ5A 4BI2A 2WOUA 4FIEA 3QRKA 5A46A 1BLXA 4MF0A 3F7ZA 3QZFA 3PA3A 4FNWA 2I0EA 3FUPA 3PG3A 4UWYA 4JI9A 5CU3A 5IISA 3V5LA 4EH3A 4L53A 5HG9A 2WQOA 3HMOA 4GUEA 2X9FA 1OPKA 3CTHA 3ACJA 4QMXA 5DOSA 4HCUA 2V5QA 4O0SA 2JDSA 5EOLA 2W4OA 2UUEA 4EH9A 2F2UA 3HAMA 2PSQA 2WB8A 2OFVA 4NTSA 3P7AA 4FV1A 4YJQA 3DV3A 4QP6A 2PVNA 3OOMA 3HYHA 3PY0A 3O51A 3UOKA 4ZJJA 4QMSA 2PK9A 3I7CA 3TN8A 5IG1A 4F4PA 3EH9A 2HYYA 1XH8A 2Z8CA 3JUHA 4IM0A 4IDVA 4MNEB 3BI6A 3FBVA 4R6VA 5AP4A 4AW5A 4TYEA 5J9ZA 5KKRC 2Q83A 3KVXA 3F9NA 4O2ZA 2FSTX 4EHGA 4EUUA 3QZGA 1DS5A 4Y8DA 3ID6C 1CM8A 5HD7A 4NM0A 2A2AA 2BZJA 5E8VA 3TACA 3DBDA 3QWKA 4BIBA 3W0MA 5AR7A 4FICA 2HAKA 3CGFA 1DAWA 3IQ7A 2VTHA 4YUQA 3W33A 2B9HA 2W5BA 5AUVA 3QKLA 5HNIX 5EG3A 2WD1A 3FZ1A 4ZSLA 3V5WA 4A9SA 2UZTA 2X9EA 4NEUA 3UBDA 2C69A 2OICA 2VX1A 2ZVAA 3EKKA 3GC9A 5KBQA 1JSVA 4RFMA 2R3IA 2JBPA 2QOQA 1U4DA 3GU8A 1PXJA 3DBFA 1SZMA 4J8NA 4KBKA 2CNUA 4D5KA 2BVAA 4MEDA 4MWHA 4Y5QA 3TZMA 4M84A 5M56A 2WTDA 3C50A 5HCXA 3FDNA 4K6ZA 4O6LA 3GENA 3KREA 4PTGA 2JIVA 5HTBA 4V0GA 1URCA 2O64A 3EJ1A 3QQUA 3OP5A 4GYGA 3MTFA 4GVAA 4OAUC 2R3PA 5HCZA 3NFFB 2B0QA 4GFMA 5HORA 4BCOA 4NCTC 5D9HA 5AR5A 4FKWA 2ONLA 2XYNA 4KBCA 4BTJA 4CQEA 2XALA 3ZLWA 4HGEA 4L44A 4FNZA 3QCQA 5EQEA 4KRCA 5AP3A 3Q4ZA 5FQDC 3QA8A 5FRIA 4A9RA 3QRUA 3N4VA 4AA4A 3PRIA 3AKJA 2X2MA 3EQFA 4D2SA 5A4LA 3LKMA 4X21A 3GU4A 3C9WA 4RWJA 4U97A 5E8UA 4RC3A 5A3XA 3WF6A 2Z7QA 2WNTA 1Y8YA 4MXZA 4DAWA 1BI8A 2WELA 2QO2A 4DH7A 3KGAA 2QLQA 1U5QA 4B8MA 4EJNA 2PUUA 3VIDA 4CFUA 4QPSA 3W0SA 4IJ9A 2R3LA 4LRMA 1FVTA 3PXZA 4G17A 2R3NA 4NU1A 3TZ7A 3WOWA 4DH1A 1PMNA 5IQBA 2OJIA 3TNHA 4GIHA 2C3JA 3PVGA 4R78A 5HCYA 3BYVA 4S33A 4AOIA 5E8WA 4BCNA 4Z9LA 4V01A 2R7BA 3BLQA 5DBXA 1R78A 3PJ3A 4L68A 3MJ2A 5AR8A 4BZOA 4YC8A 3PSCA 3ORMA 5L2SA 3HAVA 4CG9A 4FF8A 3G6GA 5DFPA 2BZKB 3R9OA 3GC8A 3QQFA 5LVMA 3JS2A 2VTPA 1XH7A 3UNJA 3EQIA 2OIDA 2CSNA 3IKAA 4EK4A 1ZMVA 3Q4UA 3D83A 3U54A 1IA9A 3KU2A 3W8QA 3QQHA 2ERKA 1GIIA 1XO2B 2PVHA 3QL8A 4FRFA 4X3JA 5B2LA 1U54B 3E64A 4XS2A 3MVMA 4C62A 4RA5A 4AU8A 3QQKA 2ZYBA 4JBVA 2RFEA 5I4NA 4FTTA 4JR7A 4YHTA 1IAHA 2PZPA 4OTIA 3L1SA 4HYHA