1I09A

Structure of glycogen synthase kinase-3 (gsk3b)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
360
structure length
338
Chain Sequence
SMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structure of GSK3beta reveals a primed phosphorylation mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 338
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1i09A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1i09A01
3RAIA 4CFVA 3FZ1A 5IA5A 3N4VA 2YIQA 3FMDA 2PVRA 3PIXA 2FVDA 4AN9A 3BU5A 1I09A 3SRVA 1KV1A 3R0TA 4IIRA 2GCDA 5D7AA 3AQVA 3I5NA 4FZAB 2ZV7A 1S9IA 4OTWA 2XIRA 5FEDA 3ZZEA 1U46A 5EK7A 2UZDA 3W2PA 3WZEA 2FSMX 4DH1A 4UZHA 1BL6A 4AZEA 4L3JA 3KULB 1SNUA 4CCBA 3FI8A 3TKUA 2GPHA 1ZAOA 3PWYA 4PV0A 5AUXA 4W4VA 3ZXZA 4ALUA 4O7YA 3QHWA 3QXPA 3F69A 2G2IA 2B9FA 4GFMA 2UZVA 5KBRA 1OL5A 3Q4UA 4BF2A 4YLKA 2CGXA 5ACBC 3UPXA 4IVCA 3FC1X 3H3CA 4ZLYA 4O2ZA 4M84A 4U41A 4LYNA 3OOGA 4MXAA 4U3YA 4D4VA 2P55A 4M67A 3DKOA 2OIQA 3QX4A 4W9WA 5EYKA 3W2SA 4BDFA 5CEMA 2A1AB 5JH6A 3KRJA 1PF8A 2OXDA 3W8QA 1ZZLA 5J5TA 2YABA 3KMMA 5C1QB 4JG7A 1M2RA 4EHZA 4PNKA 4CGAA 3W2CA 5GHVA 4FOBA 1UU3A 1VZOA 1PYEA 5D9HA 4O7SA 2XYNA 4FC0A 3HV6A 4S30A 4YJTA 2QCSA 3ORIA 3NUAA 1PXNA 2GHLA 4QYHA 4WNKA 3JYAA 5EKNA 2F7EE 4GG7A 4YSMA 5HTBA 3U6HA 5A9UA 1IA9A 3R22A 4BZDA 2VWBA 5L2SA 3WYYA 4M68A 4OAUC 3FMEA 2QR8A 3OT3A 5G6VA 2J51A 2EXMA 3WF9A 4FTLA 5CALA 2E9NA 1Q3DA 4XX9A 3VO3A 2NO3A 3CR0A 5FWKK 1Q3WA 4BY9E 3OBGA 4O7RA 2XJ1A 4IADA 1I44A 2X6DA 4NH1A 4XP0A 3V5QA 2XKEA 4I6QA 3Q52A 4YJNA 5JRSA 3GCVA 2X39A 3RVGA 1H8FA 3V04A 3HMOA 3QTSA 4JX7A 4RVTA 3RWQA 3VAPA 4C2WA 4Z7GA 2YZLA 1B38A 3BIZA 2PPQA 4HNIA 4DFYA 5AJQA 3KRXA 4BBFA 5CEIA 3QTIA 4PTEA 5CS6A 4JBPA 3UE4A 1ZWSA 2XK3A 1UKHA 4FL2A 3NW6A 4NM5A 5HVYA 3NUPA 3PXZA 4ACGA 1XHAA 4OTGA 3AG9A 3CE3A 3SX9A 4BDIA 4N70A 4WNOA 4DGNA 3C4EA 3V5WA 4QP8A 3BYVA 3C5IA 4TPTA 4A4OA 3MWUA 1XH4A 2IW6A 3DBQA 4MNFA 5IQFA 5BQ0A 3ORLA 3NNXA 2HENA 1WFCA 3LCOA 5J9LA 3A8XA 2XF0A 4AUAA 3FE3A 3H30A 2QURA 3NYXA 1OB3A 4NEUA 4CT1A 4UYNA 4ANSA 2ZJWA 3PE2A 4MWHA 4A7CA 2VWXA 4YZBA 3DDPA 4FUXA 3LFEA 4F7SA 5JK3A 3NYOA 4KIQA 4QTEA 3HP2A 3PA5A 3RNYA 4CFWA 3U54A 4D28A 1O6LA 3KEXA 3QKLA 4C3PA 2W99B 4H1MA 3E3PA 4Q9SA 4DG3E 5CF5A 2RG5A 4S32A 4D9TA 4EONA 2GS6A 3F2NA 4FR4A 3IW8A 2B9HA 3FDNA 4HJOA 4JDIA 2VTSA 3E8CA 5B2LA 4JR7A 3PIYA 1VEBA 2ITZA 3LJ1A 3ZRMA 4ANQA 5L3AA 2R7BA 4C4EA 3PJ2A 4FODA 5LXMA 4GRBA 4KRDA 4FVPA 5FD2A 4RRVA 3Q4ZA 4FTRA 3LFBA 2XVDA 4XRJA 3EN7A 4PL3A 5HG5A 5FQDC 3ORZA 4RQKA 4X7QA 5LMAA 2VAGA 3OW4A 5BVEA 2AC3A 3OC1A 4KB8A 3VW8A 3TV6A 2EUFB 2P3GX 3W8LA 2WQEA 2HELA 2UZTA 4JG8A 4EZ3A 2Z7RA 1OBGA 3TN8A 4LQMA 4RX5A 4QTDA 4HVDA 1LEWA 3Q4CA 5IEYA 2BKKA 5LWNA 3C0IA 4ITIA 4ZSJA 4PMSA 4ZY6A 4KRCA 2YCRA 4JG6A 3D5XA 4K1BA 5I9UA 4GVJA 1PMNA 3RINA 2VWYA 3MN3A 4EH3A 5HU3A 4WIHA 3VW6A 4RGJA 2KULA 3WZJA 4TRLA 4H39A 5CEPA 2WMWA 5EQPA 4BCKA 4CZYB 4G9RA 5H9BA 4FTUA 5KCVA 1SM2A 1UWHA 2WTDA 4FTOA 4BGGA 1XBBA 1OIRA 5CSHA 3CD3A 4EC9A 2W1DA 4M66A 4DITA 3IW7A 4F9AA 3EZVA 5A4EA 4FKRA 3L9MA 2GS7A 2WELA 4FKSA 4B9DA 5IH6A 1Y8YA 2GMXA 4JQ8A 3KREA 3ORPA 4YLJA 4MXYA 4IWQA 5AV3A 3R9RA 2YERA 2QOCA 3NUNA 5AUYA 5CXZA 4HVHA 4HW7A 1OECA 4BZOA 2ITNA 2B55A 3DAEA 3K5UA 5HCXA 3G0EA 4BTJA 3W18A 3T3UA 5IDPA 4FKLA 4G3FA 4LV5A 3ZO4A 5HI2A 3A60A 3PUPA 4YZMA 4IM3A 3F7ZA 4GKIA 2A0CX 3EYHA 4QRCA 2FSLX 1R1WA 1U59A 3QQJA 2RKUA 3MY5A 2YAAA 3R1YA 4G6LA 4JQEA 4LGGA 4CT2A 4ANMA 4Q5EA 4WNPA 5CY3A 2BALA 2J0LA 2W1IA 3ERKA 3ZO1A 3PZHA 1M2QA 3O23A 3C4CA 3LLTA 1KV2A 4NFMA 4BZNA 4QQTA 5E7RA 4HVGA 2J6MA 2QKWB 3F5UA 4FMQA 4X3FC 3SXFA 4NJ3A 2R3PA 4YJOA 1ZOEA 2BZJA 2YIXA 4HVSA 1Q99A 3EQIA 4LMUA 3KK9A 2RFEA 1ZZ2A 2WQNA 3NAYA 2W1CA 5TKDA 5CU4A 4I3ZA 5C8MA 4RJ5A 3TUBA 2QO2A 3DLSA 3BELA 2JKMA 3V5LA 4ZS4A 3HMMA 5M4CA 1OBDA 3FLSA 1E9HA 1JPAA 1OL2A 3OWPA 3P5KA 1G5SA 3MJ2A 4W9XA 2FB8A 1XWSA 1IEPA 2IO6A 4R5SA 3FC2A 4CFFA 5AA9A 4A9SA 4IVAA 5CU6A 1FVVA 4ZMFA 4YP8A 2W4OA 4J8MA 4FI1A 2XJ2A 2B4SB 3KXGA 2DS1A 3NIEA 4NKSA 5CF6A 4QT1A 3BYOA 1YXUA 4JQ7A 3UVPA 4O83A 3AC4A 3UG1A 4MEDA 3VS4A 4PP7A 2HW6A 2EXEA 4YZDA 4Y95A 5EYCA 3UOLA 4BDAA 4FK3A 4YJSA 4RC4A 5CNOA 3F5PA 2C6EA 4IWPA 4CRSA 5CANA 2WMRA 3Q6WA 4YTHA 3UZTA 4R1YA 2LAVA 5F94A 3ROYA 3BEGA 3D2IA 3R8ZA 3VUGA 4FV4A 4BYJA 4F0IA 2OJFE 4UWBA 5JFVA 3FV8A 3P7BA 4R8QA 3MV5A 5CENA 2ITUA 2VNWA 4RIXA 4ASXA 3FMKA 1A48A 4AGDA 2AC5A 5LVOA 2J0KA 2RIOA 3SC1A 4F7NA 5M09A 1FOTA 2C3JA 3FLQA 4XRLA 3KN5A 3HAVA 4BB4A 4DEEA 3TIYA 4A9YA 4D0XA 5D41A 2W9ZB 4RG0A 5EM8A 1PXKA 4QMOA 3ZRKA 2ZM1A 4RFZA 2C6KA 3GT8A 4L52A 5AMNA 3RK9A 5BX0A 2PMOX 5DT3A 1ZYCA 5LWMA 1J7UA 4DF3A 3HMNA 2VTRA 3BU6A 4LGHA 4PMMA 4BWXA 3QGWA 3D0EA 4ZK5A 3DDQA 1PXPA 3U6JA 4EH9A 2JAVA 1ZMVA 2XK9A 2BVAA 2PY3A 3QF9A 2C0TA 1PMVA 4LL0A 5HBHA 3QTUA 4FSYA 4J97A 4D9UA 2IZSA 3R9OA 2BPMA 3B8QA 5CVHA 4U43A 1Q4LA 2CGUA 3LLAA 2OBJA 4IQ6A 5FTGA 4ZEGA 1AQ1A 4L43A 3NX8A 1WBWA 2YEXA 3Q60A 4I0RA 5AP2A 3RKBA 5K4IA 4BBEA 4H3QA 4BTMA 5AP5A 1H1QA 4R7BA 1WZYA 2F2CB 3QD4A 3RAWA 4DTKA 4F9CA 5LVMA 4ZSAA 2BFXA 4RC3A 3GQLA 5ACKA 2YIRA 4Y73A 3GC8A 3D5WA 2R3NA 3LPBA 5E1EA 5AIKA 4FA2A 4CNHA 5TO8A 4AE6A 3CQUA 2CGWA 3MBLA 2F49A 3G6GA 3R8UA 4C02A 2YM5A 3QRUA 4GYIA 4LOQA 3F2RA 4DEDA 4EOJA 3ITZA 4UWYA 3HNGA 4YJVA 2VUWA 2HZ4A 3KQ7A 3R2BA 1CMKE 1P4FA 1XO2B 2BRGA 3BHHA 4GUEA 1UU9A 3MH3A 2JD5A 3FY2A 4ITHA 3WZUA 5CASA 4FSQA 3FZSA 3GXLA 1XJDA 2DUVA 5EYDA 4C0TA 4KBKA 2OO8X 3QTRA 3FPMA 4WRSA 4D4RA 1BUHA 4JRVA 1YWRA 2BFYA 4B99A 1F5QA 3CJGA 3D7ZA 4NTTA 5AV0A 4HGTA 3LM5A 3I60A 2YCFA 2CGVA 3VULA 1J91A 3R21A 4RC2A 2UZOA 5M4IA 5K0XA 2G15A 3MVLA 3AOXA 4RLKA 2XIZA 1O9UA 4JDHA 4Q5HA 4ZZMA 3PA3A 5CU0A 4FEQA 5HE3A 4GMYA 1M52A 3ENHA 3F6XA 4WSYA 3UOKA 5CU3A 4FIFA 4I5CA 4IB0A 4UMRA 2B7AA 2H6DA 1RE8A 1QCFA 1KWPA 4MBJA 4K33A 3VIDA 5AV4A 3DZOA 5GJDA 4AN3A 3QBNA 4ZSLA 4QYGA 4F63A 2YFXA 4EZ7A 2QONA 2YLFA 4G17A 3BGQA 2IVVA 3D9VA 1PMUA 2H8HA 4G3DA 5FBNC 1Q8YA 4XEYA 3P9JA 4E3CA 2OJGA 3WIKA 2OJIA 3C13A 4ZJJA 4NUSA 1PW2A 2JFMA 4MD8E 5F95A 3C5UA 2WKMA 3FMNA 3W2RA 4E93A 3CY3A 3LW0A 3VHEA 4JL9A 1BI7A 3R7GA 1Z5MA 3QFVA 2C1BA 1H0VA 5I0BA 5IQBA 2NRYA 1JAMA 1YXSA 2VO0A 3S0OA 4UWCA 3MPAA 4IZYA 1NVQA 2FH9A 2Z7LA 3E87A 5HQ0A 3U6IA 4FEWA 4QYFA 2PVJA 5FM2A 3K3JA 4HZRA 4JS8A 4I21A 4AXAA 1UNHA 3C4XA 4U5JA 3VS1A 4BCGA 2VU3A 3ATTA 2G01A 3NUYA 3OVVA 4CQGA 1FMOE 2W5HA 1K9AA 1XH9A 3LXLA 3LFDA 5ETCA 5B2KA 1H1PA 3JPVA 1GNGA 2XIYA 4E4LA 2YACA 3GU4A 4KIKA 4G6OA 2HZNA 2B53A 4LUEA 3TKHA 5EQYA 4XS2A 5EOBA 3B8RA 4MD7E 3S4QA 1URCA 4LRKA 3L9LA 4HVIA 3O50A 4X3FB 3IDBA 3Q6UA 3TZ9A 4WG3A 3V5TA 4UZDA 4AA0A 1QPDA 1Z57A 2I0HA 4ZAUA 3MW1A 4GK3A 3CSVA 3V8TA 4ZTHA 4B8LA 4U44A 5K3YA 4CFMA 4O1OA 2C4GA 3MFSA 4ENXA 2IW8A 4CKJA 3R30A 4EWQA 4DHFA 3C0HA 1DAYA 2C5YA 5HKMA 2C6DA 2JGZA 3HEGA 2OF2A 4QMZA 3EFJA 3DBEA 2WEVA 4MVFA 3PJ3A 4AX8A 5AR5A 3LFSA 4FVQA 5IF1A 2OI4X 2R2PA 3W1FA 4U9AA 2RF9A 2E2BA 5CVGA 4IVDA 5KZ0A 3I7BA 3ENMA 3F2AA 5AP7A 4E26A 3THBA 1OPKA 2PTKA 5HBEA 1WAKA 5M57A 3CXWA 1LEZA 3BLQA 3BWFA 4IX4A 4O96A 4FSTA 5HE0A 3OMVA 3PP0A 3QC9A 3PLAE 2AYPA 3OTVA 4JOAA 3QUEA 4KA3A 2C47A 1VYWA 3OF0A 3NNWA 4DEBA 2QG5A 4C33A 5AR8A 3DTCA 2XCKA 2CNUA 3QCXA 4AT4A 4CRLA 2OLCA 3CC6A 1MQ4A 2GNFA 1FPUA 1JLUE 1E1XA 3AMBA 2UVZA 5E8VA 3G5DA 5AP3A 3FMJA 1PXJA 5K0KA 2BMCA 4FTQA 3SD0A 2QU5A 5DR9A 3UJGA 4YTFA 1JSUA 3BPRA 5HTCA 4N0SA 4O6LA 3CTJA 2YDJA 4XHKB 4EQCA 1SNXA 3CP9A 3CS9A 5H2UA 1ZARA 3FY0A 3SV0A 4AZWA 3PVWA 4XBUA 3L8XA 4MXXA 4FBXA 3ATSA 1F0QA 4XCUA 5CYIA 3QQFA 4L9IA 2XIKA 3GC7A 2W4JA 3A8WA 2UW9A 4MXOA 4CCUA 2PE2A 1H25A 2VGOA 2CPKE 3G33A 4ONAA 1DS5A 3IKAA 1MQBA 3QRTA 1CDKA 3QA0A 3LCDA 3M2WA 2R3QA 3E8EA 4V04A 3MA6A 1IG1A 3QGYA 5BYLA 4DE4A 4NJDA 2YM3A 4GT5A 5HORA 3RNIA 5H8EA 4FE2A 4W4YA 3VF9A 3PXYA 2C0OA 2HCKA 1NT2A 4ID7A 3BX5A 4RWIA 5JN2A 5L2WA 4PF4A 3CTQA 4TWCA 4JI9A 4CG8A 4ANLA 5M06A 3UODA 4AW1A 4XNEA 5HLPA 4FV3A 2OICA 3R04A 4HGSA 1VJYA 5HVJA 5IKWA 5L6WL 2CNVA 4KINA 2B0QA 2WMXA 4RJ8A 4EJ7A 1KSWA 1KE7A 2OG8A 5ANEA 2I40A 3G9LX 5CSVA 3FLZA 5KMNA 4BKJA 4DCAA 3Q3BA 3DB8A 4C4GA 4QP1A 5J7BA 1NVRA 3QWJA 4WNMA 2CDZA 2DYLA 2HIWA 2OIDA 3KCFA 3KRRA 2UVYA 5LJJA 1Q5KA 4NZWB 3QHRA 2CCHA 1XBAA 2HWPA 3ZEPA 2WMAA 4KAOA 1HCLA 3BE9A 4MWIA 4D2WA 2CCIA 2CSNA 5E8YA 4RLLA 4UYAA 3VC4A 3MB7A 4KBCA 5DI1A 4J95A 4E20A 4JBVA 4EOOA 1CKPA 2ZYBA 3OS3A 4BDGA 5IUGA 4YC8A 2YCSA 4FTMA 4XV1A 1KOAA 4FNXA 1GIIA 3HGKA 4G2FA 4KNBA 3K2LA 1JKLA 4QMQA 1TVOA 4O27B 1MUOA 4FZ7A 5AAFA 4HOKA 3R7EA 3GNIB 3KRWA 1YWVA 2XKCA 2ZV8A 3F88A 5KMKA 1OVEA 3KGAA 3DAJA 4L44A 2NNWB 1GZKA 2PZ5A 2WQOA 3QRIA 4AP7A 5I9YA 5DGZA 4OT6A 3R8PA 3H10A 2GFCA 3F61A 4MXZA 4QPAA 2EB2A 5AP6A 4EC8A 2IZTA 4I24A 4AGCA 2WGJA 3PFQA 2C0IA 4NFNA 5JGBA 5AX3A 3L8SA 3CCNA 4NWMA 4DEAA 3KF4A 4PDOA 3UVRA 3F3TA 4H05A 2BIKB 2JEDA 5AIRA 3WILA 2X2LA 4QP7A 4NSTA 3WF8A 4BCHA 5ANOA 2PE1A 2BROA 4LG4A 3U9CA 3ZXTA 4F1MA 3MFTA 3FI3A 3CEKA 4EWHA 3BCEA 4FSUA 4C4IA 5HD4A 4AU8A 5HGIA 1FGKA 3Q04A 3CKXA 3KVXA 4TWPA 3CPCA 4P5QA 2RSVA 3UP7A 2IZRA 3E3BX 3PP1A 5LMBA 2I7QA 1XKKA 3TEIA 3RWPA 2XNEA 4L45A 3DNEA 1YOLA 3UYTA 5JEBA 3ACKA 2ONLA 5HO7A 4L3PA 4RIOA 3GC9A 4H36A 3C4WA 4XP2A 2BHEA 4XOZA 3AD4A 2HYYA 5HX8A 3PJ1A 4TNBA 4GT3A 4F65A 3TWJA 2Z2WA 5IH5A 4ACMA 4BHZA 5FXRA 4MD9E 4PDYA 3OG7A 4FKJA 4FTIA 5EG3A 3NDMA 4QYEA 2PE0A 2PUIA 2ZOQA 4BCFA 5HEZA 5BVOA 4PPBA 3C4ZA 3ORXA 4QMPA 4O82A 5DEYA 3ZUUA 1MP8A 3BV3A 3NPCA 2J9MA 3KKVA 4L6QA 4AZVA 5B7VA 2SRCA 5DN3A 5A46A 4P2KA 3EL7A 2H9VA 4L7SA 4RIYA 2F57A 5HIDA 4BFMA 4TYHA 2ITTA 4PPCA 3UYSA 4CV8A 5EM6A 1OKZA 5AWMA 4CFNA 4XG8A 4Y83A 3RTPA 2W1HA 5T3QA 4E6QA 3H9FA 3RPYA 3TZMA 2XMYA 2B52A 2ITXA 3NSZA 5AV1A 5M51A 3RK7A 4X6QC 3TV4A 4R5YA 2ZAZA 4Z3VA 4FG8A 3ZO3A 4ERWA 5IQHA 3D7TB 4BGQA 3EIDA 4ZIMA 5DT4A 4FIHA 4AAAA 3ZSHA 4IMYA 4AOIA 2YZAA 2WMQA 1WVYA 4IB3A 2FSTX 2BCJA 2V62A 4O91A 2QOFA 3EKNA 3ZLSA 5KO1A 2V55A 5GZ8A 4XH6A 3H9OA 3A7JA 2BIYA 1SVGA 3PXFA 2G2FA 5AUVA 3U4UA 2A19B 3I0QA 5HE2A 1SYKA 3SHEA 1G3NA 1W82A 1CKJA 5HD7A 5IA0A 2PVYA 3RPVA 4BC6A 1MRYA 2VX3A 1HCKA 4IH8A 5E8XA 3TIZA 1FGIA 4A4XA 3A4PA 3AC8A 3H9RA 3MB6A 3IK3A 3LFAA 2P33A 3QKKA 4XV2A 4PL4A 4FTKA 5CI6A 3OUNB 3OY1A 2W1FA 4H3BA 3O2MA 4L3LA 4ZS0A 3VBTA 4O7LA 4DGGA 4CKIA 5BVDA 4U7ZA 2Z7QA 1QL6A 3DAKA 4NTSA 2RFSA 4OTHA 3CKWA 3V8WA 4FKVA 2WOTA 4G1WA 2X2MA 4CZTA 4JT3A 4C4JA 4BDCA 4O0UA 2R7IA 4TTHB 1JOWB 5CQWA 4EBWA 5CF4A 5L4QA 3D5VA 4BR3A 3HX4A 4UV0A 2XZSA 3EKKA 5EI8A 2J2IB 2ETMA 3VS0A 4ZSEA 1ZOGA 4C7TA 3PTGA 3R9NA 3IDCA 5BNJA 3E92A 5ANGA 2E9OA 2CMWA 4EK3A 3WZDA 4X3JA 4EYMA 4ZTSA 4OBOA 2ZB0A 3PSCA 2CKOA 5I5ZA 5DRBA 2ZVAA 5C8NA 1GZOA 3EQFA 5A54A 3TUDA 5M55A 3FI2A 1ERKA 2ITPA 2YITA 4X6RA 4TZRA 4QQCA 3MESA 2WTKC 4YNEA 4BDEA 3EFLA 2QOBA 3ORTA 2YHVA 1BL7A 3PVUA 4ANNA 3L9NA 1UVRA 3QYZA 4EOLA 5CF8A 2R0UA 3TTJA 5GIPE 4U3ZA 2X9EA 3W2OA 3K5VA 5BUIA 4GIHA 2JC6A 3QTQA 1UKIA 5DBXA 3VUTA 1PXMA 3NCZA 3QL8A 4FL1A 3FLYA 4MQ1A 1H27A 5HESA 3W16A 4AT5A 3GVUA 3Q9XA 3TT0A 3N4TA 3GENA 4ZP5A 3RPSA 3MJ1A 4FV1A 3KK8A 2HY81 4FSMA 4HPTE 4ASDA 3QQUA 1KE5A 1WVXA 2QOKA 2F7XE 3R71A 1OIYA 1YHWA 2C30A 3RI1A 3RM7A 4DAWA 4R78A 3EQDA 5HNGA 1SVEA 4FSZA 3QRJA 4PUZA 3RALA 3T8OA 5EH0A 4I20A 5C4LA 5A4TA 4O7WA 3EN4A 4PDSA 3TJDA 3P08A 3V5PA 1JVPP 5C01A 4BCQA 2GNLA 4WOVA 4A07A 4RPVA 4G3CA 5DWRA 4HGEA 1PKGA 1JKTA 5E8UA 1OGUA 3EL8A 4WRGA 5EDQA 5AR2A 4W8EA 5AR7A 5FLFA 2ITQA 3OP5A 3A7FA 3VBVA 4I41A 4XP3A 4I5MA 3ORKA 4V05A 3LFFA 4F1OA 1OPLA 3GFWA 2Y6MA 2W7XA 1FMKA 3LMIA 5GZAA 5HG7A 3V6RA 4WHZA 2V0DA 1H07A 4DA5A 1YI4A 5CI7A 4QMVA 5J87A 2O8YA 5CT7A 5HG9A 3PSDA 2XKFA 3Q5IA 4RIWB 4I22A 4CKRA 4GU9A 5EHYA 4OTFA 5T68A 3FJQE 2VTJA 5KHXA 3BKBA 4GW8A 4BIDA 2R3OA 4AW2A 1YI6A 5C9CA 2WNTA 2WMBA 4O22A 1ATPE 4NW6A 3QUPA 4RA5A 3BHYA 1A9UA 3FEGA 3F7WA 3P4KA 5HVKA 5GIOE 3Q2MA 4AFEA 4YNOA 5CNNA 3AD5A 4X2GA 4U40A 4CEGA 4FF8A 3SRVB 4FV8A 2QU6A 3HA8A 5EYMA 3MY1A 1YOMA 4H3PA 3FXZA 4KWPA 5D11A 5KHWA 2ETRA 3EQPA 3FUPA 4L00A 4BCOA 4FT7A 3LAUA 2C3LA 3WE8A 4QPMA 4RA4A 4BIEA 3AMYA 3ZRLA 4CFXA 4E6AA 3C1XA 1DAWA 2BZIB 5HIEA 2WZJA 2QO7A 3EFKA 4BI0A 3ODZX 1TQIA 3POZA 4P90A 3MPMA 4XG2A 3UVQA 4EQUA 5HO8A 1H1SA 3KXXA 4Y8DA 2FA2A 3HA6A 2GFSA 4G34A 4NKAA 4FT5A 4RJ4A 3VJOA 5BUEA 4NL0A 3R6XA 4A9UA 3FYKX 1ZY4A 5LVNA 3R2YA 3DTWA 2R3JA 3O8PA 2XEZA 3A7GA 5A4CA 5J95A 5HOAA 3ZZWA 1FVRA 1H4LA 4S34A 5C4KA 4RIYB 2GQGA 4AW0A 3CPBA 3MI9A 3PG1A 3QTWA 4CTCA 5D12A 3PXRA 3LZBA 4ANBA 4DH8A 3U55A 5C03A 2WTIA 5JMSA 5BUJA 5JQ8A 1OL6A 1H1WA 4KSQA 4KIOA 5IQDA 4XG6A 3Q4TA 3JUHA 2ZM3A 3D2KA 3RCDA 5LARA 4EBVA 3A7IA 3QZIA 5HX6A 2X8IA 3F82A 3CLYA 3R73A 4L46A 3FLNC 4FSNA 2EB3A 4OTIA 3EHAA 5CAPA 2ZDUA 2GNJA 3DKCA 3CJFA 3HMPA 2O3PA 4MHAA 3UNJA 2IPXA 4LOPA 4QP4A 3GQIA 2E9VA 3KXNA 5I9ZA 5J9ZA 5EW9A 3IG7A 2VWWA 4D0WA 5HO6A 2R3IA 2O65A 5AX9A 3DQWA 4QP6A 4RVKA 3D14A 4F4PA 4TYGA 5IG1A 4IC7A 3ELJA 2X7GA 3TG1A 2OGVA 4C3RA 3IOPA 5DFPA 3COKA 3H4JA 3FZOA 3O51A 5EDRA 3ZC6A 4BDKA 3FKOA 1F3MC 4HYSA 3OWKA 4F70A 2OZAA 5HBJA 3AC2A 3NVKI 4M12A 1OZ1A 1W8CA 4ACHA 1XH6A 3VUKA 4BGHA 1TKIA 1ZMWA 3ALOA 2CLXA 5TE0A 2GNIA 2XK8A 3GEQA 3MH0A 4ACDA 4DGOA 4QMNA 3OW3A 4LI5A 4ZLZA 1IA8A 2B1PA 4RWKA 4YHTA 5EDPA 4DEIA 4UY9A 3D94A 4JIKA 4CLIA 3DPKA 4LMNA 2BAJA 3S95A 3EH9A 3ZFXA 4F0FA 4YZCA 4FT3A 5H8GA 5JFXA 2GSFA 4BDHA 3O7LD 4BTKA 3EN9A 5ITAA 3HAMA 1NY3A 4ALVA 4YHJA 3PDTA 3LCTA 3DCVA 2VWUA 4PP9A 4JJRA 4QP2A 3AMAA 4D1XA 1OKYA 4GH2A 4M13A 2B9IA 4IM2A 4RVLA 4BIBA 5CAQA 4C4FA 3O0GA 3R00A 3WF7A 4YBKA 3MH1A 4HYIA 5IA1A 4FIGA 2J50A 5D1JA 3WYXA 3KN6A 2JFLA 4CXAA 2IVSA 5J7HA 3F5XA 4Z16A 3WZKA 2FO0A 5FP6A 3MTLA 1J7IA 4N6YA 4NCTC 3I7CA 2E9UA 3F3VA 3MA3A 4U79A 1W0XC 2X8DA 3BWJA 3MS9A 5F9EA 2PUUA 1MRUA 2BHHA 3IDPA 4WD5A 4O0XA 2C6TA 3WI6A 5IU2A 2CN5A 2UZWE 2OFVA 1YOJA 2WTKB 2X6EA 4RJ6A 1JSVA 3HV3A 4ZOGA 5EI6A 4F1TA 5JZJA 4E4MA 3BBWA 2YJSA 2XB7A 4P4CA 4DINA 5TOZA 4KD1A 4CLJA 4NCTA 3VBYA 2WEIA 4MNEA 3VQHA 3TDWA 1LR4A 1KOBA 2R3GA 3SXRA 3UIMA 2XM8A 3T3VA 2FUMA 2I0YA 3DK3A 3EOCA 3WE4A 2F4JA 4QMTA 4RVMA 4O7VA 4CZUA 2QC6A 4C58A 4D5HA 3DY7A 5FUTA 3OCTA 3OXIA 2YCQA 4ZTRA 5KMLA 1R78A 4P5ZA 1XH5A 3BI6A 2CHLA 4ALWA 2YLEA 4QMLA 3COIA 4IAIA 4MBIA 3KF7A 4AOJA 3AXWA 2VTAA 4CMUA 3M11A 2PL0A 2Y7JA 4C62A 2YIWA 4EK6A 3QA8A 4USDA 3CTHA 2OZOA 4GG5A 1M7NA 2QOLA 2C68A 2VD5A 5FBOA 2BRMA 3H0ZA 1OI9A 4F0GA 5ETAA 4X2NA 2BDFA 3I5ZA 3E8DA 4C34A 4MBLA 3AT4A 1OPJA 3R1NA 4F7LA 1UU8A 3SQQA 4FTCA 1YRPA 5B2MA 1OITA 2CLQA 2GS2A 4XLIA 5EI2A 3S00A 4EJNA 4GIIA 5AUZA 4YPDA 2JITA 2QKRA 4FIIA 4IAAA 3RGFA 1URWA 4K77A 4QTCA 4O0SA 3TZ8A 3PRIA 2ZDTA 2O2UA 4N57A 2BZHB 3REPA 4C61A 4FTJA 2XS0A 2BKZA 3FL4A 4O81A 4BTFA 2O64A 2P0CA 3JVRA 4YPSA 2WPAA 2YDKA 1S9JA 2XNBA 4BBMA 1HOWA 2QI8A 4QP3A 4FKUA 4Q2AA 2UZLA 4RZWA 5M4FA 4QMMA 4AS0A 2DQ7X 3HDMA 1H28A 4RBLA 3HYHA 5A14A 3BE2A 3VUMA 2BTRA 3DQXA 4IB5A 4A06A 5KX8A 4JX3A 1TQMA 3TXOA 3UQGA 3ORMA 4JAIA 2HXLA 4E6CA 3A62A 2XJ0A 4L53A 1ZYLA 4OTQA 4QPSA 3ZYAA 2QNJA 5IPJA 2RFNA 3KFAA 2X8EA 2VZ6A 3MVJA 3OOMA 2OXYA 4E5BA 5HLNA 1NW1A 1GZ8A 2W5AA 2XK4A 3FWQA 2XCHA 4IZ7A 2CKPA 4IVBA 4DT8A 4RMZA 4K6ZA 5A3XA 1XR1A 3QLGA 5HTIA 3OZ6A 1YDTE 4APCA 3DK7A 2B9JA 3K54A 1GIJA 4CQEA 3FXXA 4X2JA 4QTBA 3E62A 3Q96A 3BHVA 3HLLA 3QU0A 4M97A 4E5AX 4TYIA 2BILB 2QLQA 5ETFA 5JGAA 2HXQA 2QHNA 3DBFA 3HRFA 4YJPA 4ZSGA 2BDJA 4FNYA 1RQQA 1LPUA 4O0WA 4BHNA 2PU8A 3ZLWA 2VNYA 4D4SA 1WBTA 4G3EA 5CAOA 1FVTA 1Z9XA 4HNFA 2C6MA 1KE9A 2C1AA 4ZMEA 2X7OA 4PNIA 5L6OA 4KUJA 4FG7A 3UO6A 5IQIA 1YQJA 2J0MB 2QD9A 3ZDIA 2VX0A 4EZ5A 4TNDA 4ZY4A 4OUCA 3G90X 2H34A 2Y8OA 4E8AA 3L8PA 4JXFA 5EM5A 4GFGA 5HIBA 5IQAA 3OBJA 3A99A 4HYHA 2VV9A 3RM6A 4FK6A 3OWLA 4EHEA 4YC3A 4IC8A 4CG9A 4JDKA 1IAJA 4BDDA 3S3IA 1WBNA 3RK5A 3QCYA 4DBXA 4RIXB 4BVUA 3UO5A 3VBWA 4S2ZA 3FXWA 4AWIA 1XBCA 3ZUVA 5EQEA 3OEFX 1PXOA 4O38A 5IEXA 2H96A 3COHA 2V7AA 2I0VA 1RW8A 3KXMA 4FZ6A 2OJ9A 4I93A 4K2RA 4YJUA 5I3OA 4HYUA 5M53A 3C4FA 3EN6A 3GGFA 3G2FA 3O96A 4L8MA 4ACCA 2HW7A 3FQSA 2PWLA 2QO9A 3LHJA 2OH0E 4KS7A 4NT4A 4R6VA 1FINA 4IX6A 3SA0A 3SG9A 5LMKC 5AP1A 4DCEA 4WBOA 2PVHA 4AE9A 4IAFA 4JIAA 4M7IA 2EWAA 3LCKA 3F9NA 2F7ZE 2G2HA 5I3RA 5LOHA 1P5EA 3KVWA 5KMIA 1PRYA 3NGAA 3F3ZA 1H01A 2C5NA 3FKNA 3ZH8A 3UNKA 2Z02A 3BGZA 1JKKA 1YI3A 5LMKA 3FMLA 3SG8A 3VUIA 5DH3A 4J53A 3U87A 1K3AA 5K5NA 3FKLA 5KMJA 4AQCA 3GFEA 3QQLA 2ERKA 3OCBA 5DR6A 4NIFA 3NIZA 4QO9A 5E92A 3U9NA 4NM3A 3SAYA 3EZRA 3ZM4A 4IWOA 2W4KA 3R7YA 3UOHA 4WSQA 5FGKA 2BR1A 2FYSA 5HZNA 3DXQA 4ITJA 5AM6A 2YM8A 4MX9A 4GCJA 4G16A 4TYJA 3Q5ZA 4AW5A 1NVSA 2PMNX 2PZRA 3NW7A 1Y6AA 4I94A 4U0IA 3O71A 4IANA 4XV9A 5CZHA 1CTPE 2C3IB 3WIGA 4B0GA 4FNWA 3TNHA 3JY0A 3GU6A 4ANOA 4EH8A 4YSJA 5IQGA 2O0UA 3GCUA 5EOLA 5L6PA 3BQRA 4DH5A 3LKMA 5I9VA 4FEVA 5JT2A 2I1MA 2UZEA 5EKOA 3AGMA 3TUCA 4HCVA 1B39A 1DI9A 2UUEA 3DLZA 4ERKA 3WOWA 3QC4A 2VTMA 4DH7A 2PVLA 4R7IA 4D2TA 2Z7SA 4I6BA 5L2QA 1NXKA 5HCZA 4EHVA 2X81A 1CM8A 3FMMA 4YZNA 3ZFMA 1QPCA 4AFJA 3LM0A 1FQ1B 2OIBA 3FQHA 3R83A 3IW5A 3KCKA 3A2CA 3QALE 3GOKA 4O2PA 4EH2A 2HZIA 4AG8A 3UMXA 2F2UA 3VRYA 5BVKA 5FEQA 1UA2A 5I4NA 3P7AA 1XH8A 4FV7A 1CSNA 3UZRA 1O6KA 3PE1A 2C6OA 4FSRA 3UC4A 5DR2A 4WG4A 3ZSIA 4EI4A 3TNWA 2ITVA 3NVMB 5CSPA 3QKMA 2QHMA 2GTMA 4MTAA 1R39A 2F9GA 3PY3A 5CLPA 3S1HA 4XG4A 3DOGA 3NYVA 5KNJA 3E8NA 4FT9A 3PVGA 3E7VA 3F3UA 4FV6A 4LV8A 4DG0E 3NMUF 3LQ5A 2UW5A 2WO6A 4R7HA 2GU8A 3GI3A 1YKRA 3ZS5A 4YR8A 1APME 1H0WA 4EYJA 5IUIA 2ONLC 4FSWA 3ZONA 4D58A 3MFUA 4K18A 4X21A 1SZMA 4JBQA 5BVFA 3BBTB 4RWJA 4TWOA 2C3KA 2WIPA 3I4BA 3HV4A 2Z8CA 3QZHA 3KMUA 3FHIA 2Q0NA 3DJ5A 5EW3A 4XV3A 1BLXA 4CYIA 4D2VA 1OL1A 5DE2A 4UMPA 4KKGA 4G5PA 1V0BA 4O1PA 4FZDB 1J3HA 3PSBA 2RG6A 4CFUA 2WQMA 3SVVA 4RFMA 4PRJA 2ZMDA 2J5EA 2VTHA 1YWNA 1VYZA 3ANRA 4O0VA 3QCSA 4PMTA 3TM0A 1Q41A 4UX9A 3V51A 3R01A 4KIKB 3OTUA 4CTBA 3EN5A 3QD0A 3FL5A 3NWWA 4F9YA 3RAKA 3ZTXA 4EUTA 3QQKA 4XYFA 3MFRA 4EOMA 1ZLTA 4RX9A 3EYGA 2UZNA 2ACXA 4GK4A 1JKSA 4I6FA 2UZBA 4QMUA 5FXQA 4H58A 1OUKA 3FZRA 4EK8A 2C5OA 2V5QA 4FKQA 4LL5A 3VN9A 4F9BA 4IJPA 5JFWA 1YXTA 2G9XA 3E64A 4I0SA 3BQCA 3E7OA 3QTZA 3DGKA 3SKCA 4XLVA 1YVJA 4G6NA 2I0EA 4FV0A 3NZ0A 3FAAA 2YM6A 2J90A 4FYNA 4KS8A 5G1XA 3UG2A 3UTOA 3R8MA 2B54A 3IGGA 1ZY5A 4CV9A 1OUYA 4BL1A 2OH4A 3II5A 4BI2A 3JR1A 5CWZA 4B7TA 3AC1A 4GYGA 3WF6A 3HP5A 3I0OA 4BRXA 5M56A 3KXHA 3AC3A 3HVCA 2C5VA 3NNUA 4DTAA 3GU5A 2EU9A 4WT6A 2JDTA 3PIZA 4ARKA 5HE1A 2PK9A 3DBDA 4IE9A 4J98A 4MK0A 4TN6A 3EFWA 4IXPA 2QVSE 3T9TA 2PZPA 4W8DA 1X8BA 3QZGA 2YWVA 2IWIA 4K11A 5HICA 4F08A 5TF9A 4IHPA 5M44A 3HV5A 2HAKA 5CZIA 3HRBA 4ZTMA 2JIUA 4KABA 5BPYA 1JSTA 4G3GA 4G5JA 4EKKA 5AUWA 4IWDA 2CJMA 1WBVA 4GT4A 4FEUA 3MSSA 1REJA 3Q53A 1W84A 2JAMA 4WKQA 2XA4A 1FBNA 3P78A 4YZ9A 2OSCA 4I92A 5JRQA 2UW0A 2OU7A 5JZNA 3LMGA 4EOPA 3RAHA 5E91A 2UW3A 2JKOA 3P79A 5CX9A 3DBCA 3UNZA 4G31A 4O7ZA 2VWVA 4RZVA 3DXPA 1IASA 2WTWA 1Y8GA 2XH5A 4JBOA 4YUQA 5F4NA 5A4QA 3FQEA 2R3LA 4LOOA 3T9IA 4YTCA 1Q8WA 2ETKA 5C26A 4OBPA 2ITYA 4FKWA 4EQMA 3TNPC 3RPRA 3UO4A 4DG2E 4M3QA 2DWBA 2OJJA 2HY0A 4IACA 5CTPA 3MIAA 2BTSA 3EMGA 3OHTA 4S33A 4WG5A 3VUHA 5CT0A 3ZUTA 3D15A 4BCNA 3LXPA 3RCJA 4NIFB 4FTTA 4GJ2A 1DI8A 3R7OA 4EOIA 4KKHA 1OIQA 1REKA 3O8TA 3ET7A 3LCSA 1YW2A 2JDOA 2WTVA 4QNYA 2W1EA 3P1AA 3SGCA 5BYYA 4C35A 4RQVA 3VWAA 2ZV9A 5F20A 1IRKA 5IMXA 5I9WA 1AGWA 3R9HA 2VGPA 4B8MA 2FSOX 3PWDA 1L3RE 2XP2A 3NLBA 3RHXA 4N4SA 5AV2A 3QD3A 4IZAA 3ZEWA 5L8LA 3TI1A 2XUUA 2YJRA 4P7EA 4C36A 2PUPA 2Q83A 1XQZA 3ANQA 3OXTA 4ZZOA 5CAVA 5DT0A 4ZTQA 3CBLA 1R3CA 2PHKA 4U80A 5EW8A 4BCMA 5JGDA 1UV5A 1WCCA 5BVWA 4O6EA 4EORA 3QTXA 2XK7A 3QCQA 4IEBA 3IO7A 3LVPA 4GK2A 5CEOA 3G51A 4GUBA 4IFGA 1GAGA 3FYJX 4NK9A 4AA4A 3BZ3A 4IDTA 2VRXA 3OCSA 4OTPA 3IW4A 2NPQA 3MTFA 3P86A 1M2PA 4HPUE 3RJCA 4C3FA 5DPVA 2PMLX 4ZJIA 1QMZA 4R77A 3BYMA 2UW4A 4YTIA 4L68A 3RZBA 3MIYA 2PYWA 3TCPA 4RX7A 3I1AA 3R8LA 2VTQA 3BYUA 2HK5A 4BCPA 2VX1A 3ETAA 5L8KA 2CKQA 4PQNA 2WMSA 3FZPA 5ANDA 3KMWA 4OT5A 1JWHA 3MVMA 3U8WA 4OGRA 5DA3A 4DFLA 4D2RA 4WUNA 3ZBXA 4JAJA 3C0GA 1E1VA 5D10A 5L8JA 3NCGA 3G6HA 5DRDA 3Q32A 3W10A 4FEXA 2W06A 3BV2A 1PXLA 4J8NA 3EQGA 3LFCA 4EL9A 4XOYA 4OAVB 5CU2A 2RL5A 3Q9WA 3UDBA 4I1ZA 4DFBA 2UW6A 3P23A 5DIAA 5GJGA 4XUFA 2X1NA 5AEPA 1YXXA 2VO6A 3KXZA 3B2WA 2VWIA 4JNWA 2EXCX 3HUBA 4YGAA 4V01A 3UP2A 3BLRA 5L2TA 2WMTA 4F6UA 3RMFA 4J71A 5J1VA 2OK1A 3DK6A 3MH2A 3OD6X 3ZLXA 2QODA 2PVFA 1YXVA 2YM4A 4QMWA 4C59A 5AFVA 4EH5A 2XYUA 3A4OX 4TXCA 3VVHA 5DHJA 4IX3A 3VS3A 4HCTA 2PVMA 3QD2B 3RBWA 4DLJA 3DZQA 5CAUA 2OF4A 4BDBA 4RX8A 3VUDA 4BKYA 1Q24A 2GDOA 2YM7A 3I81A 3KRLA 3W32A 4I4EA 3UIUA 4A9TA 1ND4A 1STCE 3R7VA 1PHKA 1ZMUA 1LUFA 5CEKA 3ULZA 4M69A 2W5BA 5KZIA 1KE8A 2XNPA 3C50A 3GC0A 4OLIA 4QP9A 4V0GA 3OY3A 4F6SA 1CKIA 3HRCA 3WARA 3BLHA 3CY2A 2VTIA 3E5AA 3K3IA 4YO6A 4IFCA 5H3QA 4ENYA 4X0MA 3VS5A 5AAEA 5FM3A 5H8BA 3I6WA 1BX6A 3GCQA 2JIVA 3DKFA 2Q0BA 4FZFB 5AUUA 3OXZA 2X2KA 4UXQA 2ITWA 2IJMA 3UIBA 1VR2A 3RHKA 1RJBA 3IONA 3ACJA 4JRNA 5DVRA 4PMPA 4USEA 5IUHA 2CNQA 3UQFA 4FV9A 2Y4IC 3G15A 2WU6A 5DEWA 2Z60A 1GZNA 5FG8A 4L7FA 4DEGA 2JLDA 3SOCA 2R3HA 4CSVA 2A2AA 4ASEA 1PJKA 3Q2JA 2ITOA 4BKZA 3ZOSA 2Y6OA 3R9DA 1U54A 5IZFA 4IAYA 2X0GA 4OW8A 1YDRE 4U8ZA 2PVKA 3F66A 4TYHB 3L8VA 2GNGA 3ZDUA 1OKWA 4YBJA 3V01A 5I9XA 4I0TA 5LVLA 3WBLA 5LQFA 1RDQE 4C37A 1PY5A 3E88A 3TL8A 3LXNA 3EQRA 4X2FA 3VJNA 5HNIX 3NW5A 2C69A 4I4FA 4RFYA 2PSQA 2VTLA 4BWPA 2WTCA 4USFA 1G8SA 4C57A 4CVAA 2J7TA 5E9EA 2OWBA 4BI1A 3TTIA 4BN1A 2UV2A 4X3FA 2IVUA 3NS9A 4PDPA 2WIHA 4U6RA 1Q8TA 4XMOA 4LRMA 3VHKA 3VS6A 3ZSGA 4DEHA 5J5SA 1UNLA 3PPZA 2RGPA 2XM9A 4UBAA 4YJRA 4DYMA 5BMSA 3DB6A 1PKDA 2QOQA 3RP9A 3OWJA 5KE0A 4AZFA 4CMTA 4ZTNA 4NM0A 5IISA 3V6SA 5JSMA 1W7HA 4QMSA 4N6ZA 4QNAA 1DM2A 2W96B 3NEWA 4O7TA 4UN0C 3BGPA 2EVAA 5HLWA 3IPHA 3QYWA 3TNIA 2QR7A 4A9RA 1GIHA 3POOA 4Y5QA 4Y5HA 3Q9YA 3R28A 4HCUA 5CSWA 4PPAA 3FSKA 2PZYA 3AGLA 4FGBA 4I5PA 4DGLC 5E4HA 4E4NA 4ZJVA 4LFIA 3ZLYA 4KSPA 4K0YA 4M0YA 2BZKB 2YISA 5M08A 3OFMA 4AA5A 3VS2A 3LOKA 3UBDA 2R3KA 2BRBA 5KKRC 1PMEA 3HV7A 5J8IA 4DH3A 3NYNA 3FHRA 4IJ9A 5C27A 2R0IA 5E8WA 1G8AA 4DTBA 4ZXTA 3QAME 5JKGA 4C8BA 1QPJA 2J4ZA 3B2TA 3LXKA 4W4WA 5IEVA 5JQ5A 3D5UA 2R9SA 3PVBA 4R3CA 3ID6C 3BEAA 5ANIA 5AP4A 1PXIA 4EK5A 4NU1A 3PZEA 2W05A 3D4QA 3FZTA 3AD6A 2JKKA 3TV7A 4E7WA 4C4HA 4E73A 2QLUA 4WA9A 3UIXA 3E63A 4I5HA 3ALNA 3VS7A 5GZ9A 1OL7A 2G1TA 5E90A 3UQCA 3GCSA 3R8VA 4M15A 3KC3A 2ZM4A 1MRVA 2PZIA 4Y85A 4AGWA 3P0MA 3RZFA 4UMUA 3UOJA 3GCPA 2XRWA 4X2KA 5E8ZA 1JQHA 2C6LA 4BICA 3GBZA 2PULA 5FTQA 4HZSA 5A6NA 3HKOA 4JLCA 2BAKA 2X4ZA 4PL5A 3A7HA 5CVFA 3FBVA 1A06A 4EK4A 1OIUA 4O21A 1KE6A 3IW6A 3PJ8A 2YDIA 4TY1A 4F09A 1ZYJA 4QD6A 2XEYA 3MYGA 4KIPA 4GSBA 5AM7A 3GU8A 3N4UA 3JVSA 2IG7A 4OTRA 2VTPA 4GU6A 4J99A 4FICA 4GJ3A 4LM5A 3EQBA 4OR5A 4QYYA 2R5TA 3AC5A 4FYOA 3ZHPC 4TYEA 3FPQA 5A6OA 2W1GA 4EH7A 1Y91A 4R3RA 4J96A 4JVGA 3R7IA 4GFOA 3BU3A 3IQ7A 3SDJA 1WBPA 4QTAA 5IA4A 1BKXA 2NP8A 3QX2A 2ZV2A 5D7VA 4BWKA 3C9WA 3QUDA 5FP5A 4AOTA 4EHGA 5M07A 4O0YA 1GJOA 4IW0A 4FTNA 4DC2A 1TQPA 4FG9A 2VWZA 3HL7A 3MY0A 3TJCA 3QZFA 4YMJA 4WBBB 5E8SA 4FIEA 2HWOA 1UNGA 3GOPA 1T46A 3EQCA 3FI4A 4F9WA 2UZUE 4PWNA 4D1ZA 4M0ZA 3VBXA 4Q9ZA 4GL9A 3HDNA 1AD5A 2ERZE 5ICPA 3FSFA 5IA2A 2QG7A 1EH4A 1J7LA 3EWHA 5K4JA 3HZTA 3NNVA 1H26A 4U45A 5AR4A 1O6YA 4IAZA 1BYGA 1H1RA 1IR3A 1U4DA 5LCKA 4AGUA 2WTJA 2ESMA 3HMIA 1V0PA 3H0YA 3OROA 4MXCA 2BUJA 4D55A 2WFYA 5IA3A 3EB0A 4LGDA 4PX6A 1H08A 3N51A 3R1SA 3DT1A 5CXHA 4M69B 4TW9A 5J79A 4A4LA 3DA6A 2VTTA 3L9PA 2WXVA 4IX5A 4V0GB 2XRUA 3PLSA 3I79A 4Y72A 1YHSA 2PVNA 1M7QA 3V8SA 4E4XA 3HECA 5FEEA 5M4UA 5HCYA 3IS5A 4IZ5A 4QQ5A 4TT7A 5EHOA 2WMVA 4XG9A 5F1ZA 3RPOA 2HOGA 3ZMMA 4D4YA 2OKRA 3PJCA 1P4OA 2GNHA 2WOUA 3L1SA 4J7BA 1NA7A 5TR6A 4HGLA 3W33A 2WD1A 4DFZE 2V22A 4ZTLA 1BMKA 2FGIA 3NR9A 5AADA 4QOXA 3DXNA 3LQ8A 2YN8A 4PTGA 4EKLA 3ZM9A 2X4FA 2O63A 4DLIA 2QQ7A 4O7NA 4MQ2A 3JXWA 4FV2A 5KBQA 5FDXA 3KY2A 3CGOA 3KA0A 3TACA 5EFQA 3C7QA 1ZYSA 2W9FB 2VO3A 3DFAA 2XK6A 3LMHA 4GVAA 1U54B 4GS6A 4TWNA 2A27A 4NW5A 2Y4IB 3BRBA 4TKSA 1U5QA 1KUTA 1Q61A 4Z7HA 4AN2A 5BYZA 3CGFA 2X9FA 3FLWA 3PY1A 1T45A 4EOSA 3SLSA 4BDJA 4AT3A 4DFNA 1LP4A 4E6DA 2YAKA 3KULA 1B6CB 4O0RA 4EOQA 2VN9A 2KTYA 4JR3A 3QQGA 4TL0A 3R02A 1Q8UA 1P2AA 5IH4A 3VRZA 3UZPA 5IMEA 3ULIA 3MDYA 4XBRA 4R3PA 5DNRA 4U42A 3DJ7A 4GKHA 3HUCA 1P14A 4AZTA 4D2SA 4ZY5A 3E93A 2GHMA 2YWPA 4ZZNA 5J9YA 3QQHA 2IN6A 2W17A 4BYIA 2XBJA 2WAJA 4R1VA 5DG5A 3F5GA 3KL8A 3SXSA 5AA8A 1U5RA 4NYEA 3NAXA 2VTNA 4I6HA 1PYXA 4W4XA 3TDVA 4XG3A 2P4IA 1W83A 5GINE 4MCVA 1R0EA 2R3FA 2XNOA 3GUBA 5FXSA 2P2HA 3PPKA 4K9YA 2YIYA 4MAOA 2WU7A 3CQEA 3V5JA 1V1KA 5LCJA 1H00A 1OMWA 4LRJA 2IZUA 1M17A 2BRHA 4JDJA 3LQ3A 2QOOA 5BMMA 2W1ZA 4IDVA 4FTAA 4XG7A 2Y9QA 2C5XA 3MGYA 2OZAB 3IGOA 4O0TA 4QMXA 4XJ0A 5AAGA 2JDRA 1Q62A 3AT2A 4ORKA 4ZLOA 2XKDA 3D7TA 3WF5A 4MYGA 2GHGA 3I6UA 5B0XA 5IQCA 4DFXE 3R63A 3SW7A 4UXLA 4F7JA 5BVNA 2WQBA 5ANKA 5C8KA 3PY0A 3LJ0A 4L42A 3NUXA 4FKOA 2LGCA 4MF0A 3PXQA 4FGRA 5FTOA 4UMTA 4EH6A 1YDSE 3VF8A 4RJ7A 4O86A 1IAHA 4RWLA 3OCGA 5GNKA 4F6WA 5KUPA 3ORNA 4FOCA 3PRFA 1ZYDA 4LUDA 4F99A 2O5KA 3VQUA 4UALA 1YHVA 1ZRZA 1ZOHA 2RFDA 5KKRB 4DT9A 4Y46A 3TNQB 2JIIA 4MKCA 2JBPA 4WUAA 2OW3A 3EJ1A 5HNBA 4FIJA 2Y4PA 2PUNA 4IB1A 1H24A 2OFUA 4BCJA 4O84A 4YLLA 4OTDA 2XNMA 4UMQA 2XIXA 4C38A 3M1SA 2BRNA 4ASZA 4D5KA 5K9IA 2CN8A 3O7LB 4RT7A 4AACA 1W98A 4G9CA 3ZC5A 3OEZA 1V0OA 4Z55A 2IW9A 4L67A 1ZXEA 5AP0A 4AZSA 3DV3A 4C2VA 5FRIA 3PA4A 3QRKA 1GOLA 4FUYA 3VBQA 3ODYX 4EUUA 2R3RA 3JS2A 3A61A 3MPTA 2J0IA 3LFQA 4DN5A 4GEOA 4EH4A 5K5XA 4FT0A 1L8TA 3KU2A 5HU9A 2X7FA 4BCIA 2UVXA 4CYJA 1QPEA 2ZMCA 1K2PA 3AT3A 2GTNA 3ZFYA 3C51A 4D2PA 1SVHA 5AR3A 3UMWA 3O17A 3PPJA 4AF3A 2XNNA 3G9NA 4Z9LA 5DOSA 3BYSA 3W2QA 5E1SA 4MNEB 3SOAA 4PTCA 4U81A 3IOKA 3ROCA 4F64A 3PXKA 3P7CA 5CSXA 4FV5A 3LE6A 4E1ZA 3IECA 3R7UA 4RJ3A 2BAQA 4S31A 3ZCLA 4J1RA 1M14A 4IM0A 2GQSA 4KKEA 1WVWA 3CIKA 4FVRA 4YC6A 4CMOA 5HHWA 1Y6BA 3U51A 3EQHA 1OM1A 4DBNA 4B4LA 4NM7A 5T6KA 1GY3A 1J1CA 1OKVA 4DFUA 2BDWA 3GB2A 4CD0A 2WHBA 5IDNA 1J1BA 5J1WA 5DYJA 2UW7A 3LIJA 2YA9A 3NUSA 3CQWA 4I23A 4EEVA 5JFSA 3ZBFA 4IBMA 4APPA 3R1QA 4MH7A 4U97A 3QXOA 1Q8ZA 2OXXA 3UPZA 2Y0AA 3G0FA 3OT8A 2R4BA 4FKPA 4QQJA 2R3MA 5DLSA 3F3WA 1Q97A 3ZU7A 2E9PA 1WBOA 3TZ7A 2A4LA 1JNKA 2I6LA 2QOHA 2XNGA 5EM7A 2PMIA 4GV1A 3TKIA 4YURA 4II5A 3V3VA 5DMZA 1SMHA 3CD8A 4YU2A 5FDPA 3PYYA 5ANJA 2WB8A 5GJFA 4DGMA 3COMA 2CKEA 3LFNA 3NRMA 3DS6A 3GP0A 3PG3A 5A4LA 4KBAA 3DNDA 3GU7A 2VTOA 5HG8A 4M14A 3UC3A 4FKTA 4B6LA 1XH7A 5KMOA 4EOKA 2QOIA 1BI8A 1JBPE 2ZB1A 2XBAA 2AUHA 2R64A 3BHTA 1UU7A 4M8TA 3UGCA 3FMHA 1WBSA 4UEUA 3W55A 2J0JA 3O8UA 4YHFA 1Y57A 3BHUA 4PY1A 3QLFA 4FKGA 2IVTA 2WMUA 4K8AA 1R0PA 4WO5A 5ETIA 2REIA 3M42A 3NUUA 4FNZA 3U4WA 5AUTA 4MF1A 5KMMA 2JBOA 3QWKA 4FX3A 4D1SA 5IQEA 2JDSA 3KB7A 4RSSA 3JY9A 2P2IA 2HZ0A 5TT7A 3DU8A 5LVPA 5E8TA 3SW4A 4OBQA 5CEQA 3LJ2A 3S2PA 4QMYA 3VNTA 3N9XA 1WMKA 2W0JA 3D83A 2JKQA 4IAKA 5CQUA 2VO7A 4E5WA 2C6IA 3OUKA 4FL3A 4RIWA 2UW8A 1UWJA 5EHLA 3DJ6A 3Q9ZA 3DFCB 5L2IA 3ZO2A 4L01A 4YO4A 4FKIA 2GQRA 4YJQA 2J5FA 2NRUA 2JDVA 4J52A 3MVHA 4H1JA 2V7OA 3DKGA 4UB7A
chains in the Genus database with same CATH superfamily
3RAIA 4CFVA 3FZ1A 5IA5A 3N4VA 2YIQA 3FMDA 2PVRA 3PIXA 2FVDA 4AN9A 3BU5A 1I09A 3SRVA 1KV1A 4LV7A 2AQXA 3R0TA 2GCDA 4IIRA 3AQVA 3I5NA 4FZAB 5D7AA 2ZV7A 1S9IA 4OTWA 4DHIB 2XIRA 5FEDA 3ZZEA 1U46A 5EK7A 2UZDA 3W2PA 3WZEA 2FSMX 4DH1A 4UZHA 1BL6A 4AZEA 4L3JA 3KULB 1SNUA 3TYKA 4CCBA 3FI8A 3TKUA 2GPHA 1ZAOA 3PWYA 4PV0A 5AUXA 4W4VA 3ZXZA 4ALUA 4O7YA 3QHWA 3QXPA 3F69A 2G2IA 2B9FA 4GFMA 2UZVA 5KBRA 1OL5A 3Q4UA 4BF2A 4YLKA 2CGXA 5ACBC 3UPXA 4IVCA 3FC1X 3H3CA 4ZLYA 4O2ZA 4M84A 4U41A 4LYNA 3UDTA 3OOGA 4MXAA 4U3YA 4D4VA 2P55A 4M67A 3DKOA 2OIQA 3QX4A 4W9WA 5EYKA 3W2SA 4BDFA 5CEMA 2A1AB 5JH6A 4AXEA 3KRJA 1PF8A 2OXDA 3W8QA 4JMQA 1ZZLA 5J5TA 2YABA 3KMMA 5C1QB 4JG7A 1M2RA 4EHZA 4PNKA 4CGAA 3W2CA 5GHVA 4FOBA 1UU3A 1VZOA 1PYEA 5D9HA 4O7SA 2XYNA 4FC0A 3HV6A 4S30A 4YJTA 2QCSA 3ORIA 3NUAA 1PXNA 2GHLA 4QYHA 4WNKA 3JYAA 5EKNA 2F7EE 4GG7A 4YSMA 5HTBA 3U6HA 5A9UA 1IA9A 3R22A 4BZDA 2VWBA 5L2SA 3WYYA 4M68A 4OAUC 3FMEA 2QR8A 3OT3A 5G6VA 2J51A 2EXMA 3WF9A 4FTLA 5CALA 2E9NA 1Q3DA 4XX9A 3VO3A 2NO3A 3CR0A 5FWKK 1Q3WA 4BY9E 3OBGA 4O7RA 2XJ1A 4IADA 1I44A 2X6DA 4NH1A 4XP0A 3V5QA 2XKEA 4I6QA 3Q52A 4YJNA 5JRSA 3GCVA 2X39A 3RVGA 1H8FA 3V04A 3HMOA 3QTSA 4JX7A 4RVTA 3RWQA 3VAPA 4C2WA 4Z7GA 2YZLA 1B38A 3BIZA 2PPQA 4HNIA 4DFYA 5AJQA 3KRXA 4BBFA 5CEIA 3QTIA 4PTEA 5CS6A 4JBPA 3UE4A 1ZWSA 2XK3A 1UKHA 4FL2A 3NW6A 4NM5A 5HVYA 3NUPA 3PXZA 4ACGA 1XHAA 4OTGA 3AG9A 3CE3A 3SX9A 4BDIA 4N70A 4WNOA 4DGNA 3C4EA 3V5WA 4QP8A 3BYVA 3C5IA 4TPTA 4A4OA 3MWUA 1XH4A 3W0QA 2IW6A 3DBQA 4MNFA 5IQFA 5BQ0A 3ORLA 3NNXA 2HENA 1WFCA 3LCOA 3VONA 5J9LA 3A8XA 2XF0A 4AUAA 3FE3A 3H30A 2QURA 3NYXA 1OB3A 4NEUA 4CT1A 4UYNA 4ANSA 2ZJWA 3PE2A 4MWHA 4A7CA 2VWXA 4YZBA 3DDPA 4FUXA 3LFEA 3AKJA 2A98A 4F7SA 5JK3A 3NYOA 4KIQA 4QTEA 3HP2A 3PA5A 3RNYA 4CFWA 3U54A 4D28A 1O6LA 3KEXA 3QKLA 4C3PA 2W99B 4H1MA 3E3PA 4Q9SA 4DG3E 5CF5A 2RG5A 4S32A 4D9TA 4EONA 2GS6A 3F2NA 4FR4A 3IW8A 2B9HA 3FDNA 4HJOA 4JDIA 2VTSA 3E8CA 5B2LA 4JR7A 3PIYA 1VEBA 2ITZA 3LJ1A 3ZRMA 4ANQA 5L3AA 2R7BA 4C4EA 3PJ2A 4FODA 5LXMA 4GRBA 4KRDA 4FVPA 5FD2A 4RRVA 3Q4ZA 4FTRA 3LFBA 2XVDA 4XRJA 3EN7A 4PL3A 5HG5A 5FQDC 3ORZA 4RQKA 4X7QA 5LMAA 2VAGA 3OW4A 5BVEA 2AC3A 3OC1A 4KB8A 3VW8A 3TV6A 2EUFB 2P3GX 3W8LA 2WQEA 2HELA 2UZTA 4JG8A 4EZ3A 2Z7RA 1OBGA 3TN8A 4LQMA 4RX5A 4QTDA 4HVDA 1LEWA 3Q4CA 5IEYA 2BKKA 5LWNA 3C0IA 4ITIA 4ZSJA 4PMSA 4ZY6A 4KRCA 2YCRA 4JG6A 3D5XA 4K1BA 5I9UA 4GVJA 1PMNA 3RINA 2VWYA 3MN3A 4EH3A 5HU3A 4WIHA 3VW6A 4RGJA 2KULA 3WZJA 4TRLA 4H39A 5CEPA 2WMWA 5EQPA 4BCKA 4CZYB 3W0NA 4G9RA 5H9BA 4FTUA 5KCVA 1SM2A 1UWHA 2WTDA 4FTOA 4BGGA 1XBBA 1OIRA 5CSHA 3CD3A 4EC9A 2W1DA 4M66A 4DITA 3IW7A 4F9AA 3EZVA 5A4EA 4FKRA 3L9MA 2GS7A 2WELA 4FKSA 4B9DA 5IH6A 1Y8YA 2GMXA 4JQ8A 3KREA 3ORPA 4YLJA 4MXYA 4IWQA 5AV3A 3R9RA 2YERA 2QOCA 3NUNA 5AUYA 5CXZA 4HVHA 4HW7A 1OECA 4BZOA 2ITNA 2B55A 3DAEA 3K5UA 5HCXA 4QEBA 3G0EA 4BTJA 3W18A 3T3UA 5IDPA 4FKLA 4G3FA 4LV5A 3ZO4A 5HI2A 3A60A 3PUPA 4YZMA 4IM3A 3F7ZA 4GKIA 2A0CX 3EYHA 4QRCA 2FSLX 1R1WA 1U59A 3QQJA 2RKUA 3MY5A 2YAAA 3R1YA 4G6LA 4JQEA 4LGGA 4CT2A 4ANMA 4Q5EA 4WNPA 5CY3A 2BALA 2J0LA 2W1IA 3UDSA 3ERKA 3ZO1A 3PZHA 1M2QA 3O23A 3C4CA 3LLTA 1KV2A 4NFMA 1OGYA 4BZNA 4QQTA 5E7RA 4HVGA 2J6MA 2QKWB 3F5UA 4FMQA 4X3FC 3SXFA 4NJ3A 2R3PA 4YJOA 1ZOEA 2BZJA 2YIXA 4HVSA 1Q99A 3EQIA 4LMUA 3KK9A 2RFEA 1ZZ2A 2WQNA 3NAYA 2W1CA 5TKDA 5CU4A 4I3ZA 5C8MA 4RJ5A 3W0SA 3TUBA 2QO2A 3DLSA 3BELA 2JKMA 3V5LA 4ZS4A 3HMMA 5M4CA 1OBDA 3FLSA 1E9HA 1JPAA 1OL2A 3OWPA 3P5KA 1G5SA 3MJ2A 4W9XA 2FB8A 1XWSA 1IEPA 2IO6A 4R5SA 3FC2A 4CFFA 5AA9A 4A9SA 4IVAA 5CU6A 1FVVA 4ZMFA 4YP8A 2W4OA 4J8MA 4FI1A 2XJ2A 2B4SB 3KXGA 2DS1A 3NIEA 4NKSA 5CF6A 4QT1A 3BYOA 1YXUA 4JQ7A 3UVPA 4O83A 3AC4A 3UG1A 4MEDA 3VS4A 4PP7A 2HW6A 2EXEA 4YZDA 4Y95A 5EYCA 3UOLA 4BDAA 4FK3A 4YJSA 4RC4A 5CNOA 3F5PA 2C6EA 4IWPA 4CRSA 5CANA 2WMRA 3Q6WA 4YTHA 3UZTA 4R1YA 2LAVA 5F94A 3ROYA 3BEGA 3D2IA 3R8ZA 3KIOC 3VUGA 4FV4A 4BYJA 4F0IA 2OJFE 4UWBA 5JFVA 3FV8A 3P7BA 4R8QA 3MV5A 5CENA 2ITUA 2VNWA 4RIXA 4ASXA 3FMKA 1A48A 4AGDA 2AC5A 5LVOA 2J0KA 2RIOA 3SC1A 4F7NA 5M09A 1FOTA 2C3JA 3FLQA 4XRLA 4QDEA 3KN5A 3HAVA 4BB4A 4DEEA 3TIYA 4A9YA 4D0XA 5D41A 2W9ZB 4RG0A 5EM8A 3BL9A 1PXKA 4QMOA 3ZRKA 2ZM1A 4RFZA 2C6KA 3GT8A 2X0PA 4L52A 5AMNA 3RK9A 5BX0A 2PMOX 5DT3A 1ZYCA 5LWMA 1J7UA 4DF3A 3HMNA 2VTRA 3BU6A 4LGHA 4PMMA 4BWXA 3QGWA 3D0EA 4ZK5A 3DDQA 1PXPA 3U6JA 4EH9A 2JAVA 1ZMVA 2XK9A 2BVAA 2PY3A 3QF9A 2C0TA 1PMVA 4LL0A 5HBHA 3QTUA 4FSYA 4J97A 4D9UA 2IZSA 3R9OA 2BPMA 3B8QA 5CVHA 4U43A 3UDZA 1Q4LA 2CGUA 3LLAA 2OBJA 4IQ6A 5FTGA 4ZEGA 1AQ1A 4L43A 3NX8A 1WBWA 2YEXA 3Q60A 4I0RA 5AP2A 3RKBA 5K4IA 4BBEA 4H3QA 4BTMA 5AP5A 1H1QA 4R7BA 1WZYA 2F2CB 3QD4A 3RAWA 4DTKA 4F9CA 5LVMA 4ZSAA 2BFXA 4RC3A 3GQLA 5ACKA 2YIRA 4Y73A 3GC8A 3D5WA 2R3NA 3LPBA 5E1EA 5AIKA 4FA2A 4CNHA 5TO8A 4AE6A 3CQUA 2CGWA 3MBLA 2F49A 3G6GA 3R8UA 4C02A 2YM5A 3QRUA 4GYIA 4LOQA 3F2RA 4DEDA 4EOJA 3ITZA 4UWYA 3HNGA 4YJVA 2VUWA 1W2CA 2HZ4A 3KQ7A 3R2BA 1CMKE 1P4FA 1XO2B 2BRGA 3BHHA 4GUEA 1UU9A 3MH3A 2JD5A 3FY2A 4ITHA 3WZUA 5CASA 4FSQA 3FZSA 3GXLA 1XJDA 2DUVA 5EYDA 4C0TA 4KBKA 2OO8X 3QTRA 3FPMA 4WRSA 4D4RA 1BUHA 4JRVA 1YWRA 2BFYA 4B99A 1F5QA 3CJGA 3D7ZA 4NTTA 5AV0A 4HGTA 3LM5A 3I60A 2YCFA 2CGVA 3VULA 1J91A 3R21A 4RC2A 2UZOA 5M4IA 5K0XA 2G15A 3MVLA 3AOXA 4RLKA 2XIZA 1O9UA 4JDHA 4Q5HA 4ZZMA 3PA3A 5CU0A 4FEQA 5HE3A 4GMYA 1M52A 3ENHA 2XAMA 3F6XA 4WSYA 3UOKA 5CU3A 4FIFA 4I5CA 4IB0A 4UMRA 2B7AA 2H6DA 1RE8A 1QCFA 1KWPA 4MBJA 4K33A 3VIDA 5AV4A 3DZOA 5GJDA 4AN3A 3QBNA 4ZSLA 4QYGA 4F63A 2YFXA 4EZ7A 2QONA 2YLFA 4G17A 3BGQA 2IVVA 3D9VA 1PMUA 2H8HA 4G3DA 5FBNC 1Q8YA 4XEYA 3P9JA 4E3CA 2OJGA 3WIKA 2OJIA 3C13A 4ZJJA 4NUSA 1PW2A 2JFMA 4MD8E 5F95A 3C5UA 2WKMA 3FMNA 3W2RA 4E93A 3CY3A 3LW0A 3VHEA 4JL9A 1BI7A 3R7GA 1Z5MA 3QFVA 2C1BA 1H0VA 5I0BA 5IQBA 2NRYA 1JAMA 1YXSA 2VO0A 2XAOA 3S0OA 4UWCA 3MPAA 4IZYA 1NVQA 2FH9A 2Z7LA 3E87A 5HQ0A 3U6IA 4FEWA 4QYFA 2PVJA 5FM2A 3K3JA 4HZRA 4JS8A 4I21A 4AXAA 1UNHA 3C4XA 4U5JA 3VS1A 4BCGA 2VU3A 3ATTA 2G01A 3NUYA 3OVVA 4CQGA 1FMOE 2W5HA 1K9AA 1XH9A 3LXLA 3LFDA 5ETCA 5B2KA 1H1PA 3JPVA 1GNGA 2XIYA 4E4LA 2YACA 3GU4A 4KIKA 4O4BB 4G6OA 2HZNA 2B53A 4LUEA 3TKHA 5EQYA 4XS2A 5EOBA 3B8RA 4MD7E 3S4QA 1URCA 4LRKA 3L9LA 4HVIA 3O50A 4X3FB 3IDBA 3Q6UA 3TZ9A 4WG3A 3V5TA 4UZDA 4AA0A 1QPDA 1Z57A 2I0HA 4ZAUA 3MW1A 2XANA 4GK3A 3CSVA 3V8TA 4O4FA 4ZTHA 4B8LA 4U44A 5K3YA 4CFMA 4O1OA 2C4GA 3MFSA 4ENXA 2IW8A 4CKJA 3R30A 4EWQA 4DHFA 3C0HA 1DAYA 2C5YA 5HKMA 2C6DA 2JGZA 3HEGA 2OF2A 4QMZA 3EFJA 3DBEA 2WEVA 4MVFA 3PJ3A 4AX8A 5AR5A 3LFSA 4FVQA 5IF1A 2OI4X 2R2PA 3W1FA 4U9AA 2RF9A 2E2BA 5CVGA 4IVDA 5KZ0A 3I7BA 3ENMA 3F2AA 5AP7A 4E26A 3THBA 1OPKA 2PTKA 5HBEA 1WAKA 5M57A 3CXWA 1LEZA 3BLQA 3BWFA 4IX4A 4O96A 4FSTA 5HE0A 3OMVA 3PP0A 3QC9A 3PLAE 2AYPA 3OTVA 4JOAA 3QUEA 4KA3A 2C47A 1VYWA 3OF0A 3NNWA 4DEBA 2QG5A 4C33A 5AR8A 1W2FA 3DTCA 2XCKA 2CNUA 3QCXA 4AT4A 4CRLA 2OLCA 3CC6A 1MQ4A 2GNFA 1FPUA 1JLUE 1E1XA 3AMBA 2UVZA 5E8VA 3G5DA 5AP3A 3FMJA 1PXJA 5K0KA 2BMCA 4FTQA 3SD0A 2QU5A 5DR9A 3UJGA 4YTFA 1JSUA 3BPRA 5HTCA 4N0SA 4O6LA 3CTJA 2YDJA 4XHKB 4EQCA 1SNXA 3CP9A 3CS9A 5H2UA 1ZARA 3FY0A 3SV0A 4AZWA 3PVWA 4XBUA 3L8XA 4MXXA 4FBXA 3ATSA 1F0QA 4XCUA 5CYIA 3QQFA 1VLRA 4L9IA 2XIKA 3GC7A 2W4JA 3A8WA 2UW9A 4MXOA 4CCUA 2PE2A 1H25A 2VGOA 2CPKE 3G33A 4ONAA 1DS5A 3IKAA 1MQBA 3QRTA 1CDKA 3QA0A 3LCDA 3M2WA 2R3QA 3E8EA 4V04A 3MA6A 1IG1A 3QGYA 5BYLA 4DE4A 4NJDA 2YM3A 4GT5A 5HORA 3RNIA 5H8EA 4FE2A 4W4YA 3VF9A 3PXYA 2C0OA 2HCKA 1NT2A 4ID7A 3BX5A 4RWIA 5JN2A 5L2WA 4PF4A 3CTQA 4TWCA 4JI9A 4CG8A 4ANLA 5M06A 3UODA 4AW1A 4BJJA 4XNEA 5HLPA 4FV3A 2OICA 3R04A 4HGSA 1VJYA 5HVJA 5IKWA 5L6WL 2CNVA 4KINA 2B0QA 2WMXA 4RJ8A 4EJ7A 1KSWA 1KE7A 2OG8A 5ANEA 2I40A 3G9LX 5CSVA 3FLZA 5KMNA 4BKJA 4DCAA 3Q3BA 3DB8A 4C4GA 4QP1A 5J7BA 1NVRA 3QWJA 4WNMA 2CDZA 2DYLA 2HIWA 2OIDA 3KCFA 3KRRA 2UVYA 5LJJA 1Q5KA 4NZWB 3QHRA 2CCHA 1XBAA 2HWPA 3ZEPA 2WMAA 4KAOA 1HCLA 3BE9A 4MWIA 4D2WA 2CCIA 2CSNA 5E8YA 4RLLA 4UYAA 3VC4A 3MB7A 4KBCA 5DI1A 4J95A 4E20A 4JBVA 4EOOA 1CKPA 2ZYBA 3OS3A 4BDGA 5IUGA 4YC8A 2YCSA 4FTMA 4XV1A 1KOAA 4FNXA 1GIIA 3HGKA 4G2FA 4KNBA 3K2LA 1JKLA 4QMQA 1TVOA 4O27B 1MUOA 4FZ7A 5AAFA 4HOKA 3R7EA 3GNIB 3KRWA 1YWVA 2XKCA 2ZV8A 3F88A 5KMKA 1OVEA 3KGAA 3DAJA 4L44A 2NNWB 1GZKA 2PZ5A 2WQOA 3QRIA 4AP7A 5I9YA 3NFFB 5DGZA 4OT6A 3R8PA 3H10A 2GFCA 3F61A 4MXZA 4QPAA 2EB2A 5AP6A 4EC8A 2IZTA 4I24A 4AGCA 2WGJA 3PFQA 2C0IA 4NFNA 5JGBA 5AX3A 3L8SA 3CCNA 4NWMA 4DEAA 3KF4A 4PDOA 3UVRA 3F3TA 4H05A 3W0RA 2BIKB 2JEDA 5AIRA 3WILA 2X2LA 4QP7A 4NSTA 3WF8A 4BCHA 5ANOA 2PE1A 2BROA 4LG4A 3U9CA 3ZXTA 4F1MA 3MFTA 3FI3A 3CEKA 4EWHA 3BCEA 4FSUA 4C4IA 5HD4A 4AU8A 5HGIA 1FGKA 3Q04A 3CKXA 3KVXA 4TWPA 3CPCA 4P5QA 2RSVA 3UP7A 2IZRA 3E3BX 3PP1A 5LMBA 2I7QA 1XKKA 3TEIA 3RWPA 2XNEA 4L45A 3DNEA 1YOLA 3UYTA 5JEBA 3ACKA 2ONLA 5HO7A 4L3PA 4RIOA 3GC9A 4H36A 3C4WA 4XP2A 2BHEA 4XOZA 3AD4A 2HYYA 5HX8A 3PJ1A 4TNBA 4GT3A 4F65A 3TWJA 3BL7A 2Z2WA 5IH5A 4ACMA 4BHZA 5FXRA 4MD9E 4PDYA 3OG7A 4FKJA 4FTIA 5EG3A 3NDMA 4QYEA 2PE0A 2PUIA 2ZOQA 4BCFA 5HEZA 5BVOA 4PPBA 3C4ZA 3ORXA 4QMPA 4O82A 5DEYA 3ZUUA 1MP8A 3BV3A 3NPCA 2J9MA 3KKVA 4L6QA 4AZVA 5B7VA 2SRCA 5DN3A 5A46A 4P2KA 3EL7A 4DDIA 2H9VA 4L7SA 4RIYA 2F57A 5HIDA 4BFMA 4TYHA 2ITTA 4PPCA 3UYSA 4CV8A 5EM6A 1OKZA 5AWMA 4CFNA 4XG8A 4Y83A 3RTPA 2W1HA 5T3QA 4E6QA 3H9FA 3RPYA 3TZMA 2XMYA 2B52A 2ITXA 3NSZA 5AV1A 5M51A 3RK7A 4X6QC 3TV4A 4R5YA 2ZAZA 4Z3VA 4FG8A 3ZO3A 4ERWA 5IQHA 3D7TB 4BGQA 3EIDA 4ZIMA 5DT4A 4FIHA 4AAAA 3ZSHA 4IMYA 4AOIA 2YZAA 2WMQA 1WVYA 4IB3A 2FSTX 2BCJA 2V62A 4O91A 2QOFA 3EKNA 3ZLSA 5KO1A 2V55A 5GZ8A 4XH6A 3H9OA 3A7JA 2BIYA 1SVGA 3PXFA 2G2FA 5AUVA 3U4UA 2A19B 3I0QA 5HE2A 1SYKA 3SHEA 1G3NA 1W82A 1CKJA 5HD7A 5IA0A 2PVYA 3RPVA 4BC6A 1MRYA 2VX3A 1HCKA 4IH8A 5E8XA 3TIZA 1FGIA 4A4XA 3A4PA 3AC8A 3H9RA 3MB6A 3IK3A 3LFAA 2P33A 3QKKA 4XV2A 4PL4A 4FTKA 5CI6A 3OUNB 3OY1A 2W1FA 4H3BA 3O2MA 4L3LA 4ZS0A 3VBTA 4O7LA 4DGGA 4CKIA 5BVDA 4U7ZA 2Z7QA 1QL6A 3DAKA 4NTSA 2RFSA 4OTHA 3CKWA 3V8WA 4FKVA 2WOTA 4G1WA 2X2MA 4CZTA 4JT3A 4C4JA 4BDCA 4O0UA 2R7IA 4TTHB 1JOWB 5CQWA 4EBWA 5CF4A 5L4QA 3D5VA 4BR3A 3HX4A 4UV0A 2XZSA 3EKKA 5EI8A 2J2IB 2ETMA 3VS0A 4ZSEA 1ZOGA 4C7TA 3PTGA 3R9NA 3IDCA 5BNJA 3E92A 5ANGA 2E9OA 2CMWA 4EK3A 3WZDA 4X3JA 4EYMA 4ZTSA 4OBOA 2ZB0A 3PSCA 1XMMA 5I5ZA 2CKOA 5DRBA 2ZVAA 5C8NA 1GZOA 3EQFA 5A54A 3TUDA 5M55A 3FI2A 1ERKA 2ITPA 2YITA 4X6RA 4TZRA 4QQCA 3MESA 2WTKC 4YNEA 4BDEA 3EFLA 2QOBA 3ORTA 2YHVA 1BL7A 3PVUA 4ANNA 3L9NA 1UVRA 3QYZA 4EOLA 1G8JA 5CF8A 2R0UA 3TTJA 5GIPE 4U3ZA 2X9EA 3W2OA 3K5VA 5BUIA 4GIHA 2JC6A 3QTQA 1UKIA 5DBXA 3VUTA 1PXMA 3NCZA 3QL8A 4FL1A 3FLYA 4MQ1A 1H27A 4O4CA 5HESA 3W16A 4AT5A 3GVUA 3Q9XA 3TT0A 1ST4A 3N4TA 3GENA 4ZP5A 3RPSA 3MJ1A 4FV1A 3KK8A 2HY81 4FSMA 4HPTE 4ASDA 3QQUA 1KE5A 1WVXA 2QOKA 2F7XE 3R71A 1OIYA 1YHWA 2C30A 3RI1A 3RM7A 4DAWA 4R78A 3EQDA 5HNGA 1SVEA 4FSZA 3QRJA 4PUZA 3RALA 3T8OA 5EH0A 4I20A 5C4LA 5A4TA 4O7WA 3EN4A 4PDSA 3TJDA 3P08A 3V5PA 1JVPP 5C01A 4BCQA 2GNLA 4WOVA 4A07A 4RPVA 4G3CA 5DWRA 4HGEA 1PKGA 1JKTA 5E8UA 1OGUA 3EL8A 4WRGA 5EDQA 5AR2A 4W8EA 5AR7A 5FLFA 2ITQA 3OP5A 3A7FA 3VBVA 4I41A 4XP3A 4I5MA 3ORKA 4V05A 3LFFA 4F1OA 4DHZA 1OPLA 3GFWA 2Y6MA 2W7XA 1FMKA 3LMIA 5GZAA 5HG7A 3V6RA 4WHZA 2V0DA 1H07A 4DA5A 1YI4A 5CI7A 4QMVA 5J87A 2O8YA 5CT7A 5HG9A 3PSDA 2XKFA 3Q5IA 4RIWB 4I22A 4CKRA 4GU9A 5EHYA 4OTFA 5T68A 3FJQE 2VTJA 5KHXA 3BKBA 4GW8A 4BIDA 2R3OA 4AW2A 1YI6A 5C9CA 2WNTA 2WMBA 4O22A 1ATPE 4NW6A 3QUPA 4RA5A 3BHYA 1A9UA 3FEGA 3F7WA 3P4KA 5HVKA 5GIOE 3Q2MA 4AFEA 4YNOA 5CNNA 3AD5A 4X2GA 4U40A 4CEGA 4FF8A 3SRVB 4FV8A 2QU6A 3HA8A 5EYMA 3MY1A 1YOMA 4H3PA 3FXZA 4KWPA 5D11A 5KHWA 4FJVA 2ETRA 3EQPA 3FUPA 4L00A 4BCOA 4FT7A 3LAUA 2C3LA 3WE8A 4QPMA 4RA4A 4BIEA 3AMYA 3ZRLA 4CFXA 4E6AA 3C1XA 1DAWA 2BZIB 5HIEA 2WZJA 2QO7A 3EFKA 4BI0A 3ODZX 1TQIA 3POZA 4P90A 3MPMA 4XG2A 3UVQA 4EQUA 5HO8A 1H1SA 3KXXA 4Y8DA 2FA2A 3HA6A 2GFSA 4G34A 4NKAA 4FT5A 4RJ4A 3VJOA 5BUEA 4NL0A 3R6XA 4A9UA 3FYKX 1ZY4A 5LVNA 3R2YA 3DTWA 2R3JA 3O8PA 2XEZA 3A7GA 5A4CA 5J95A 5HOAA 3ZZWA 1FVRA 1H4LA 4S34A 5C4KA 4RIYB 2GQGA 4AW0A 3CPBA 3MI9A 3PG1A 3QTWA 4CTCA 5D12A 3PXRA 3LZBA 4ANBA 4DH8A 3U55A 5C03A 2WTIA 5JMSA 5BUJA 5JQ8A 1OL6A 1H1WA 4KSQA 4KIOA 5IQDA 4XG6A 3Q4TA 3JUHA 2ZM3A 3D2KA 3RCDA 5LARA 4EBVA 3A7IA 3QZIA 5HX6A 2X8IA 3F82A 3CLYA 3R73A 4L46A 3FLNC 4FSNA 2EB3A 4OTIA 3EHAA 5CAPA 2ZDUA 2GNJA 3DKCA 3CJFA 3HMPA 2O3PA 4MHAA 3UNJA 2IPXA 4LOPA 4QP4A 3GQIA 2E9VA 3KXNA 5I9ZA 5J9ZA 5EW9A 3IG7A 2VWWA 4D0WA 5HO6A 2R3IA 2O65A 5AX9A 3DQWA 4QP6A 4RVKA 3D14A 4F4PA 4TYGA 5IG1A 4IC7A 3ELJA 2X7GA 3TG1A 2OGVA 4C3RA 3IOPA 5DFPA 3COKA 3H4JA 3FZOA 3O51A 5EDRA 3ZC6A 4BDKA 3FKOA 1F3MC 4HYSA 3OWKA 4F70A 2OZAA 5HBJA 3AC2A 3NVKI 4M12A 1OZ1A 1W8CA 4ACHA 1XH6A 3VUKA 4BGHA 1TKIA 1ZMWA 3ALOA 2CLXA 5TE0A 2GNIA 2XK8A 3GEQA 3MH0A 4ACDA 4DGOA 4QMNA 3OW3A 4LI5A 4ZLZA 1IA8A 2B1PA 4RWKA 4YHTA 5EDPA 4DEIA 4UY9A 3D94A 4JIKA 4CLIA 3DPKA 4LMNA 2BAJA 3S95A 3EH9A 3ZFXA 4F0FA 4YZCA 4FT3A 5H8GA 5JFXA 2GSFA 4BDHA 3O7LD 4BTKA 3EN9A 5ITAA 3HAMA 1NY3A 4ALVA 4YHJA 3PDTA 3LCTA 3DCVA 2VWUA 4PP9A 4JJRA 4QP2A 3AMAA 4D1XA 1OKYA 3TMOA 4GH2A 2X0QA 4M13A 2B9IA 4IM2A 4RVLA 4BIBA 5CAQA 4C4FA 3O0GA 3R00A 3WF7A 5BV3A 4YBKA 3MH1A 4HYIA 5IA1A 4FIGA 2J50A 5D1JA 3WYXA 3KN6A 2JFLA 4CXAA 2IVSA 5J7HA 3F5XA 4Z16A 3WZKA 2FO0A 5FP6A 3MTLA 1J7IA 4N6YA 4NCTC 3I7CA 2E9UA 3F3VA 3MA3A 4U79A 1W0XC 2X8DA 3BWJA 3MS9A 5F9EA 2PUUA 1MRUA 2BHHA 3IDPA 4WD5A 4O0XA 2C6TA 3WI6A 5IU2A 2CN5A 3PUFC 2UZWE 2OFVA 1YOJA 2WTKB 2X6EA 4RJ6A 1JSVA 3HV3A 4ZOGA 5EI6A 4F1TA 5JZJA 3BLAA 4E4MA 3BBWA 2YJSA 2XB7A 4P4CA 4DINA 5TOZA 4KD1A 4CLJA 4NCTA 3VBYA 2WEIA 4MNEA 3VQHA 3TDWA 1LR4A 1KOBA 2R3GA 3SXRA 3UIMA 2XM8A 3T3VA 2FUMA 2I0YA 3DK3A 3EOCA 3WE4A 2F4JA