4XG2A

Crystal structure of ligand-free syk
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
259
Chain Sequence
b'YLDRKLLTLEELGSTVKKGYYQMKKVVKTVAVKILKNPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 259
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xg2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xg2A01
4EH5A 5K3YA 3R8LA 3OUKA 4IB1A 1OUKA 3P5KA 4MBLA 3PZEA 2XYNA 4AGDA 4FZAB 3FI8A 2EXMA 5I9UA 4PPCA 2C0OA 3HV6A 3IQ7A 1LPUA 2B0QA 3UIBA 4RIWB 3F61A 4C35A 4E6AA 4V01A 1GIHA 2O64A 5E8UA 2GNGA 3OZ6A 4WRGA 2VTSA 3F3UA 4IX4A 4L3JA 4G6OA 3HDNA 4H1MA 3GCQA 4TYHB 5M09A 4O0TA 2ITYA 2QOKA 3QXOA 3LLAA 4M84A 3W18A 2ITWA 2XK6A 2QOOA 2UZDA 3R63A 4JT3A 3DXQA 3TDWA 3C13A 4LRMA 3OWPA 4EBVA 3KXGA 3LVPA 4WNKA 5B2MA 5DMZA 2FVDA 3QA8A 3QKMA 3QTIA 4RJ4A 3LMGA 2Z2WA 2JKMA 4GT3A 4AX8A 5A4LA 3LPBA 4TNBA 5CSVA 2ZB1A 2W1IA 3BLHA 2B53A 2IN6A 3WZUA 1CMKE 1VR2A 4CFWA 4CYIA 2NRUA 4Z55A 5AADA 4RIYB 2FSOX 4FKTA 3R8VA 3PPJA 5H9BA 3BWFA 1OPKA 3FMJA 4QMWA 1YHVA 2B9HA 1Q3WA 4D58A 4FSYA 4QMZA 5LWMA 3C4CA 3V5JA 2XKDA 5IU2A 4BYIA 4BDKA 1PY5A 4AP7A 2QOHA 3KVWA 3FY0A 3UPZA 5FXSA 4BDJA 2UW5A 2JDOA 5CALA 3HECA 3OD6X 5CNNA 4MXXA 2R3JA 4IANA 1SVHA 4QMPA 4PMMA 3AQVA 1XO2B 4HPUE 4W9XA 5A4QA 3ZM9A 3SAYA 5J7BA 1OITA 4XUFA 3C5UA 4O21A 4BCNA 3PA3A 1YDRE 4LL0A 4FNXA 2C4GA 4YLJA 4C02A 1PJKA 4XS2A 4XYFA 5A6NA 3DGKA 1M2RA 4A9TA 4FNYA 2PULA 2VAGA 1IA9A 5D9HA 5AV2A 2BPMA 4O0SA 4OTDA 5T6KA 3FSKA 3ZC5A 1ZYSA 4ONAA 3NX8A 5E8WA 3PE1A 3L9MA 2W7XA 4IEBA 3EQRA 5CENA 4D28A 4LL5A 4X2JA 4G9RA 3R83A 2J6MA 4IAIA 3AD4A 3BGQA 3KF4A 4NKSA 3RAHA 2ZDUA 3BCEA 3RTPA 4EH8A 1GIIA 4IX3A 4CD0A 4L53A 3AC1A 3EHAA 5KO1A 3K5UA 3A4OX 4QYHA 4U45A 2ITTA 2BZIB 3E8NA 3EQIA 2XEZA 5CLPA 3TNQB 1PXKA 3AMBA 4YPSA 3HUCA 2PZPA 2EB2A 1B38A 3GU5A 2QKWB 4O0XA 2OH4A 3LFNA 5JFVA 4OTGA 1YQJA 2XRWA 3E3PA 3SG8A 5CF8A 4HVSA 3DK6A 2OXDA 2ZMDA 4M0YA 3R8ZA 3FHIA 3QWKA 4EL9A 4QMSA 4DINA 3R00A 3DDQA 3DBCA 4IHPA 4E4LA 4PX6A 3KXHA 3E88A 2I1MA 5HORA 5GIPE 3BIZA 2A4LA 3KQ7A 3L8VA 4TY1A 5IH4A 2QHMA 3MDYA 3MVMA 3Q9XA 4C57A 4IMYA 2C30A 3RJCA 4NEUA 1JBPE 4EUUA 2Z60A 4QPMA 4QTCA 3EL8A 4JAJA 3BZ3A 3VRYA 3HV7A 3ZYAA 5KHXA 3PE2A 2RL5A 4N6ZA 1YOMA 3PA5A 1K3AA 4EOQA 3WZEA 1Q8TA 4E5BA 4OTPA 1ZZ2A 4FZ7A 5C8MA 3RPSA 3VBYA 1PXPA 4UZHA 4IWDA 3G51A 2XNNA 4IB0A 4J98A 3MI9A 1ZOHA 4DEGA 2ZB0A 2QO2A 4U5JA 1ATPE 2WPAA 3TDVA 1ERKA 4RC3A 4K1BA 3R1QA 4PMTA 1ZOEA 1YDSE 4PP9A 1OL1A 4O1PA 2YZAA 3MH1A 3TACA 5IA0A 4NJDA 2EWAA 3D9VA 5D7AA 2J51A 1JPAA 3Q9WA 2HK5A 4JL9A 1CKPA 3NW5A 2XB7A 4LOOA 4YC3A 5FGKA 4HOKA 2ETMA 4J53A 3CLYA 1LEWA 5BUIA 3OTUA 3PUPA 4FG7A 4AW2A 4EH7A 1SM2A 3GXLA 3MYGA 1J1BA 3NEWA 2JBPA 3BGPA 1P4OA 2A1AB 4FI1A 4KKGA 4KS8A 5AP1A 3C0IA 4FNWA 3FZRA 3MGYA 3LXNA 5L2SA 4FV2A 4LGHA 1FQ1B 2XK9A 3NW7A 3HRFA 5M06A 2YM7A 4ZOGA 2RG6A 4WBOA 4YZMA 4D2SA 3OP5A 4AE6A 3ACKA 2W1EA 4YPDA 3VS7A 4DC2A 2C5YA 1OBDA 3OW4A 4FTUA 2XP2A 3R8UA 5KHWA 2VGOA 4WUAA 1YKRA 5E1EA 5CQWA 3VS4A 1WBNA 4FA2A 1YWVA 1PXLA 2YJRA 1GNGA 4NL0A 2WMBA 4JBOA 1URWA 3R21A 5F20A 2J5EA 3QTQA 4RWIA 4B7TA 3GEQA 4X2NA 5HE3A 3ZEWA 3D4QA 3NNXA 3TV7A 2BDWA 3I5ZA 3NPCA 4FUYA 4QQ5A 4FTMA 4O82A 4NFNA 2UW3A 4C4GA 3LOKA 4EZ5A 4M0ZA 5CAUA 2X4FA 4HNFA 4RVKA 4HGEA 5AP6A 4O7RA 3ZO1A 3B2TA 3ZFMA 4C34A 2J90A 5D41A 4DGMA 3A60A 5HQ0A 2W96B 2BCJA 4HVHA 3D15A 4IC8A 1Q4LA 3SRVB 4A9UA 4ZLYA 4BR3A 3EJ1A 4P5QA 1FINA 3E87A 5FUTA 4AG8A 4C4HA 1WCCA 4PPBA 4QPSA 2XJ0A 1OIYA 1NY3A 3TV6A 3UDBA 4EJ7A 4V04A 2DWBA 2WNTA 3DTWA 3DTCA 2JDVA 3P23A 3QXPA 4DEAA 5CU0A 4CG9A 4BCJA 4RQKA 3UBDA 5HX6A 2X7FA 4GT5A 4YLLA 3WARA 3UQFA 3RMFA 4M3QA 4AT5A 2YDJA 4MD7E 2VTOA 2YAKA 3N4UA 3KVXA 4EKLA 5AA8A 4LUDA 2OG8A 2FO0A 5DT4A 5AUWA 5HVJA 1OGUA 4W4VA 1XBBA 1J91A 4D9TA 4XRJA 1O6KA 3IK3A 3VVHA 4IDTA 2E9PA 3BRBA 2BROA 4YNEA 1H1QA 3FY2A 3O2MA 4AW1A 2VTPA 2OGVA 3Q4TA 4S33A 5AV1A 3FUPA 3WF7A 1F5QA 4RFYA 3K3IA 4YZBA 3GNIB 4HGLA 4YSJA 5J95A 1OPJA 2C0IA 1GZNA 4KWPA 3T3VA 4CRSA 4RWJA 4EOIA 4ZIMA 3NUYA 2O65A 1OIUA 3ANRA 2WGJA 3DDPA 2ZOQA 2QQ7A 3FPMA 2C47A 2F49A 5ETCA 3Q04A 3ORPA 3EQHA 4XV2A 1H24A 3JY9A 3ZLYA 3UQCA 4ZS0A 2H96A 5IQIA 4IFCA 3GVUA 4LOQA 5CSWA 3AMYA 4O2ZA 3PDTA 5DYJA 3QTZA 4A07A 4FG9A 2YITA 4GK3A 5HICA 2XK4A 4OW8A 2IPXA 3KRWA 4EH4A 3D83A 4Q5EA 3Q6UA 4FTIA 4E7WA 4ITHA 2EXEA 2E9UA 3OOMA 1RE8A 1WFCA 4AAAA 5IQGA 3QHRA 4CKRA 3DCVA 5TKDA 4NH1A 2WXVA 3GU7A 5JZJA 2QOQA 3ACJA 2WQMA 3NNUA 3H0YA 4ZTHA 1SYKA 3H9RA 2EU9A 5TR6A 3UOKA 4C4EA 3P78A 4KABA 4MNFA 3DK3A 3RM7A 3ZM4A 1Y6BA 1M14A 5AV3A 4FV3A 4APCA 4CT1A 3UVQA 3E92A 2CLQA 4FE2A 5ETAA 3KRLA 4I1ZA 3R9DA 3G5DA 4A4LA 3OCGA 3GU4A 4CT2A 4CFXA 4KINA 2JIIA 4HNIA 3EB0A 4WIHA 4HZRA 4IE9A 4HCVA 4N70A 2OH0E 1ZXEA 3LCOA 3VF9A 3BQRA 5ANIA 2OXYA 4F64A 4KBAA 3BBWA 3FLZA 2PZRA 4XG9A 5HHWA 2I40A 2F7ZE 5LARA 4PNIA 3VUDA 1SVEA 2JD5A 3FI3A 3QUPA 1Y8YA 4HYSA 4I6BA 4U42A 4XP0A 5FM2A 4C8BA 4EHGA 3LFDA 1YOJA 3UOLA 5F95A 3RKBA 3NYOA 3QQLA 2ONLA 4IAAA 2PE0A 3CJGA 5B2KA 4TW9A 4QRCA 3NYVA 2VTAA 4II5A 3TEIA 5EQPA 4I6QA 4GS6A 2OKRA 3G0FA 3IKAA 3HP2A 2WIPA 4FTRA 1YOLA 5H8GA 3TIYA 3TN8A 2VTJA 4D4YA 3QCQA 3C0GA 2BAJA 3TNIA 3CR0A 3BHHA 1QPEA 2DUVA 3W8QA 4GFGA 2ITVA 3MTFA 4GG7A 4AOJA 2PMLX 2OIDA 4J7BA 4AW0A 3ZRMA 4M7IA 4ERKA 5IA1A 4CFVA 2IG7A 2QNJA 4IWPA 3DBDA 4BL1A 5IISA 2BALA 4FIFA 5I4NA 2GQGA 2FB8A 4PWNA 4S32A 1VZOA 3LJ1A 1GJOA 3CTJA 3QQFA 5EYDA 3QRIA 3A8WA 4CMUA 4EWQA 3TZ8A 2R3KA 3FXZA 3RHKA 5M51A 2OBJA 1TQPA 4ANBA 5JH6A 2X39A 3ORMA 5EM8A 2IW8A 4GKIA 2VWXA 4FKSA 2RFDA 3HVCA 4W4YA 3TTIA 3W2RA 3V01A 2KTYA 4FEXA 3LAUA 3EN5A 4O7ZA 4MKCA 2X6EA 4TTHB 4FIIA 4I92A 3U6JA 4GG5A 1FBNA 4ZJIA 3FYKX 3NSZA 3BU6A 2WTIA 5DNRA 2VTRA 1XBAA 3MPAA 4BIEA 4E93A 3SW4A 5IUGA 2ITZA 2YERA 4AWIA 4BI0A 3MESA 5AAGA 5M53A 5J7HA 4BVUA 3CD3A 4O7WA 3FC2A 3NUUA 4FTNA 2QO7A 4PL4A 1OM1A 3AG9A 4YUQA 2WEVA 1JKTA 3DA6A 2QU5A 4YTHA 5E9EA 5D10A 4C3FA 3C4WA 4OTIA 4C38A 2UVZA 1Q8WA 5BVNA 2CGUA 3W16A 4U79A 2YAAA 4CMOA 3C7QA 4G3CA 1G3NA 1Z9XA 2PUUA 1H0WA 1PKGA 2J0IA 4FOCA 4QTBA 4BBFA 2WAJA 5EDQA 4FSUA 4NM0A 4O7YA 4NW6A 2AC5A 4ZEGA 5DFPA 4BGHA 3C51A 3SOCA 1U46A 1M17A 1FVVA 4J96A 3MBLA 5HE0A 4FSWA 5M08A 4IZ7A 4RLKA 2C3KA 5D11A 3L8SA 3ZLXA 5J9YA 4PTEA 2A27A 5HU9A 3F6XA 4NZWB 2HENA 4XRLA 3P4KA 1BKXA 3PJ3A 4AT3A 4CRLA 2HY81 4Y5HA 2F9GA 2PMNX 3WYXA 4ENYA 2C3JA 3W2PA 4A4OA 3OCSA 1XKKA 3PVUA 3MS9A 3QRUA 4ENXA 1Y8GA 2HYYA 3WZJA 4ASZA 3QX2A 4RPVA 5A54A 4WD5A 4PTGA 4A06A 5GJDA 1GOLA 5EM7A 4ZTSA 3Q2JA 3HV3A 4IZAA 4OBQA 3RAWA 5E91A 1NXKA 2R5TA 2QVSE 5TE0A 3KRRA 4S2ZA 2X7GA 4W8EA 3CC6A 3QLFA 4CSVA 3NMUF 3PY0A 3PXZA 5CVHA 4O0UA 5GZ8A 4X6QC 4CGAA 2V62A 5GIOE 5L8JA 2XK7A 4G34A 1SVGA 5JQ5A 2I0VA 4M66A 3NUNA 1OKZA 3D7TA 3O7LD 4YHTA 4AZFA 5L8KA 3G2FA 4DYMA 2C69A 5DEWA 5KZIA 5EQYA 2C6TA 3G90X 4C62A 4L3LA 5ANKA 4JDHA 2VTHA 2GS6A 3DPKA 3BQCA 4GW8A 1ZZLA 4X2KA 5EW8A 1PHKA 4X7QA 4F70A 3R9RA 2UW6A 1U5QA 4DG0E 3S00A 2CKQA 4U41A 4L6QA 3TCPA 1MQBA 3ZHPC 1KE6A 2WTCA 2X7OA 5LCKA 2P33A 3FKLA 4RZVA 3W2OA 4O7SA 1UU9A 3CPCA 5AR3A 2SRCA 2BILB 3WE8A 1DAWA 3UYTA 3FMNA 3ELJA 2YFXA 4O7TA 1WBSA 3DJ6A 3FV8A 3IW5A 4MAOA 3V6SA 4YMJA 2CHLA 3L1SA 4MNEB 2OJGA 3VUTA 5JK3A 4QTAA 4U3ZA 5BYYA 5JGDA 4RFMA 5KBQA 2IZRA 2H8HA 4CLJA 4FT7A 2G01A 2UZVA 1KE7A 3RNYA 1CSNA 2WTKB 2BTSA 3UOHA 1M2QA 4KKEA 2CDZA 4F6SA 3B8QA 3RPRA 3BV3A 2GS7A 3E8EA 3UODA 2REIA 4R3CA 4BYJA 2WIHA 4AF3A 4D4VA 3SX9A 2B9IA 2VNYA 2WZJA 1ZMVA 4FVQA 1E1XA 3NUSA 4G31A 4IM0A 4D1SA 5C8NA 2XNBA 3KMWA 2H34A 4O6EA 5CU4A 3SDJA 1M7QA 3SOAA 3U54A 4YJQA 1UKIA 3V51A 1WMKA 2BDJA 3PY1A 3PXYA 4I4EA 4FKGA 3W1FA 4X3FB 4QMQA 2IJMA 4DFLA 2CN8A 3WF6A 3ZCLA 5IKWA 4P7EA 4PUZA 3GCPA 4DF3A 2R3GA 2YIWA 4BCKA 3ZXZA 4PQNA 3RPVA 4FKUA 1Q62A 2GNJA 4CFMA 2WU7A 3BU5A 5DRBA 1JNKA 2YDKA 3LJ2A 3MFUA 5CI6A 2ITQA 1QPCA 3E93A 4MQ1A 4H3QA 3R7EA 3LW0A 3QQGA 3ULZA 3KULB 3K3JA 5DLSA 2X9EA 3R7GA 4G2FA 4C3RA 4F0GA 4JG6A 5A6OA 4UB7A 2FSMX 4WRSA 1Q5KA 2HZIA 3QD3A 4XLIA 5HO7A 4P4CA 2WQEA 2RKUA 3R04A 4IC7A 3PVBA 3UIXA 3UO6A 5FDPA 3Q60A 2WMQA 4QMLA 5FRIA 4I94A 3ZUTA 3CGOA 2BRMA 2UZNA 3FPQA 3S0OA 2W9ZB 5HLPA 3EYGA 3R9NA 4FKRA 4WNMA 5JEBA 4ZSGA 3A61A 1M7NA 3HGKA 3Q5ZA 5I9VA 3KXNA 2O63A 1FVRA 2HELA 3DQXA 4EOLA 2UZLA 5JFWA 1IEPA 4C33A 5HBEA 3FL5A 4R3RA 3QA0A 3UMXA 2OFUA 3IOKA 2WU6A 3OWKA 3RK9A 4O0RA 3BKBA 3ZSIA 1REKA 1YXSA 3HV4A 2H9VA 1ZRZA 3HEGA 3ZBXA 2Q0BA 4GK4A 4RJ8A 5IMEA 4FIHA 3R8MA 4K6ZA 3DLZA 3QZGA 5KX8A 3REPA 5AR4A 2Y4PA 3FHRA 4RC2A 2WHBA 3QZFA 1WVWA 4IX6A 4QPAA 4ZLZA 1H26A 2PL0A 3HP5A 2PMOX 4F63A 3TM0A 1JQHA 4O96A 3FE3A 1URCA 3ETAA 3C4EA 3IGGA 4R3PA 3I7BA 4HPTE 3M42A 1XQZA 5BUJA 4AGWA 2VU3A 3EFJA 3UNZA 4AA0A 3MVJA 3IONA 5AX3A 4BDDA 2WTVA 4JNWA 3W2SA 5AAEA 5M4UA 5J1VA 4E26A 4L68A 4IVAA 4EOJA 3FZOA 4MCVA 2HW7A 2VTIA 3DNEA 1TQIA 3MH2A 1XWSA 4AA5A 4U43A 2OJFE 2C6DA 2XF0A 3T9IA 3VHKA 3U6IA 4A7CA 4DN5A 4FKQA 3C9WA 4QMMA 4S34A 3EKNA 4BCOA 4L8MA 2UZOA 2Y6OA 4AGUA 3COHA 3SLSA 3QX4A 4F1MA 2WOTA 3WBLA 1LUFA 4Y85A 5C1QB 4QNYA 4WKQA 1JLUE 3MA3A 4O22A 1XR1A 3AC5A 4QMVA 3DKOA 3E7OA 3MVLA 2UZEA 4PY1A 3MSSA 3NZ0A 3F88A 1NW1A 4Y73A 4M69B 3N4VA 3EKKA 2CN5A 1T45A 2XJ2A 3DNDA 4QP3A 4BB4A 2ERKA 5HU3A 2AC3A 2J50A 2QHNA 4V0GB 2P2HA 4GT4A 3R6XA 4U40A 5HTBA 1KE8A 5HE1A 3DZOA 5JQ8A 3GC0A 3ZONA 3G0EA 3Q32A 4ZSJA 2HZ0A 2XVDA 3FMMA 4YJUA 5BVEA 4CMTA 4L46A 5EI2A 1VEBA 2V22A 5M4CA 3ZO2A 2QOIA 1XH8A 4UN0C 4MF0A 4FGBA 4ALUA 4IDVA 4XG7A 3EN7A 2IWIA 4GL9A 4EWHA 4EI4A 3PXKA 4AQCA 5K4IA 2VD5A 4LG4A 1K2PA 5GZ9A 2PVFA 2C6KA 4NIFB 5CT7A 4EONA 4YTIA 5JMSA 2X8IA 4ZMFA 3OROA 2C5VA 3QRTA 5EDPA 3C50A 2I7QA 4ANNA 3FSFA 5FG8A 1BI7A 3CQUA 2XM8A 4G6LA 3DS6A 4I24A 3TI1A 1SNUA 3FKOA 4MWIA 5HBJA 5BVKA 2YWVA 4TZRA 3IW6A 3VUKA 4Z16A 3UC3A 4F7LA 4U44A 5E92A 4EH2A 2X0GA 2ZDTA 5HIBA 3I79A 2CPKE 2YCFA 3BI6A 3MH0A 4FSRA 5EM5A 2ZYBA 3PSBA 3EYHA 1P4FA 4IM3A 5CAVA 3NRMA 4HYIA 3R30A 2J9MA 3EN4A 4K11A 4TYEA 4RA4A 3H3CA 4U80A 4N4SA 3SC1A 2JAVA 5CEMA 2R64A 2VUWA 4K9YA 4ASEA 5I9XA 4DFUA 3VS6A 4BTKA 1H1PA 4DE4A 4EHEA 4AU8A 1RJBA 1AGWA 1OUYA 1Y91A 4YLKA 2XBAA 2VX0A 1K9AA 3Q4ZA 5L2QA 2IVUA 3GCSA 3QCXA 2BR1A 4FKVA 3QQJA 4FTLA 2XIYA 4JLCA 3CGFA 4B99A 4KIKA 4AT4A 4KBCA 3CQEA 2JFLA 3U51A 3PXRA 2V5QA 4ZTRA 3VW6A 2X8EA 2W1ZA 2YLEA 3K2LA 3PWDA 4EORA 2ACXA 4OUCA 5ANEA 2E9OA 3UOJA 4EOMA 3IS5A 3AC4A 5BNJA 4H3BA 2Y7JA 3PYYA 3TKUA 4LM5A 1PXNA 3SV0A 4F9WA 5BUEA 4JQ7A 3ZFXA 4DGNA 2WTKC 4BI1A 4X2GA 4EQMA 3IECA 3Q96A 2F57A 3II5A 3QKKA 4O27B 2CGXA 3VUHA 3RZBA 1H00A 2WMAA 5CY3A 2R3RA 4ZAUA 2VNWA 3TG1A 3ZFYA 4E6QA 5GNKA 2PVYA 4JJRA 4HGTA 5HG5A 5CVGA 4C58A 4EQUA 5LWNA 4Y95A 5FEDA 2IVVA 5CZIA 2GPHA 2B52A 3UZRA 3QTWA 2BRGA 3QD0A 3AMAA 4CKIA 3I1AA 3ORKA 3O0GA 4RIXB 4G5PA 4QQJA 5IUIA 4BHZA 4D2WA 2PPQA 4X3FC 5CEKA 4EOOA 4BDHA 2Z8CA 3QZHA 5BVWA 2BZJA 4XCUA 1P5EA 4A9SA 4G3FA 2R3NA 3IDCA 4J71A 4CV8A 4HVIA 2W05A 5L2IA 4QO9A 4I5PA 4JDIA 4XG6A 5EM6A 3BHUA 3VUIA 3MY0A 4QYEA 2OWBA 4YO6A 5FP5A 1J7IA 4C61A 1QMZA 5HNGA 1ZY5A 2PE2A 3G9NA 3W2CA 5CXZA 2HWOA 4ANSA 5C9CA 3A8XA 3Q9YA 4J52A 4J95A 4RFZA 1AQ1A 2ETRA 1UWJA 3DB8A 3UMWA 4AGCA 2A2AA 4G17A 2W4OA 1ZWSA 5CF4A 4IVDA 2CKOA 3ZTXA 4M15A 1JVPP 1OIQA 3ZS5A 3KK9A 3GB2A 5IZFA 3JY0A 5DWRA 3ZC6A 1T46A 5CU6A 4P90A 5IQFA 2XS0A 3SXSA 2YN8A 5I0BA 5JFXA 3H9FA 4FSZA 2PVKA 5EHLA 5BVFA 3CTHA 2VRXA 3C5IA 5AR8A 3MPTA 3LFAA 3W55A 3CXWA 1U54B 3R9HA 3V04A 1J1CA 1YWNA 3QC4A 2ITXA 5K5NA 4NW5A 4K77A 1A48A 4UBAA 4DG3E 3RK7A 4DEDA 1W83A 5LVPA 5CF6A 1YRPA 4DBNA 3QWJA 3ZH8A 3VS3A 3R1SA 5HCXA 2R4BA 2C68A 1VYWA 4YJRA 5ANOA 5J87A 2UW8A 4C4FA 5KKRB 5EQEA 4YZDA 3QRKA 1FOTA 3G6GA 4B9DA 3HYHA 3SKCA 3NLBA 3MTLA 1PMNA 1XHAA 3ZZWA 3PP0A 5D12A 2R0IA 4XBUA 3EN6A 5AP5A 5EKNA 4CLIA 1S9IA 2QOLA 1ZMUA 4FC0A 4EHZA 1LR4A 4ANLA 3LQ3A 4WT6A 3QALE 2WMVA 4WG3A 5M44A 4IH8A 3PLAE 5HTCA 2W4JA 3O8UA 5F1ZA 4DEEA 2VWIA 2NPQA 5E8XA 3R02A 4LMUA 3VULA 5L2WA 5AP2A 3COIA 4C0TA 1WAKA 2VWBA 5E8ZA 3ZZEA 1V0PA 4Y8DA 5EK7A 1ZY4A 2JLDA 4ZTLA 3R2BA 4EH6A 2WELA 5IG1A 3ZO4A 5FTOA 4RX8A 3EFWA 1YXUA 1OB3A 2OIBA 4G3GA 3I6WA 1A06A 3FZ1A 4E73A 4TYIA 3ODZX 2QODA 5AM6A 1O6LA 1IAHA 5CI7A 3BGZA 4ACHA 4Z7GA 5IEYA 3ORNA 2B55A 2C6EA 3R1NA 4FTCA 3ROCA 4F4PA 2GCDA 5GJGA 5A4CA 3HAMA 5G1XA 1OL2A 3Q6WA 3UIMA 3A62A 4F0IA 4O81A 1H1RA 4D4RA 1Q99A 2J4ZA 3KRXA 3QAME 4FT9A 5HGIA 4FZ6A 3SW7A 5IDNA 5KMMA 3HRCA 3LXLA 2UUEA 4IJ9A 4PTCA 3QHWA 4GEOA 4ITIA 4ERWA 3EQDA 5TO8A 3POZA 4FL3A 5DIAA 5EW3A 3VWAA 3HMPA 1YHSA 2W1FA 3LFSA 4EZ3A 4FT5A 4RWLA 5LVOA 5ANGA 3UC4A 4QP4A 3SG9A 1GZKA 3VBWA 4TL0A 4HJOA 4NCTC 5DR6A 3BPRA 2BVAA 4RVTA 4USFA 2YM6A 2J0JA 3CY3A 4FIJA 4O2PA 2XIXA 3D14A 3FC1X 3NCZA 3DJ5A 5JZNA 4BTMA 5AUTA 3KGAA 2ETKA 2CCIA 2FSLX 3FI2A 2B54A 4XV9A 4BCPA 4X21A 2R3QA 2WO6A 5DA3A 2JGZA 3F3TA 3DKCA 3MPMA 3GQIA 3OHTA 3OWLA 4P5ZA 4XJ0A 3KN6A 4KUJA 4TWOA 4X0MA 1O6YA 3FXXA 3I0OA 4RJ7A 3O96A 4FTOA 1OECA 1OIRA 3I5NA 2GHMA 4F9CA 5KMLA 1B39A 4KS7A 4C3PA 2VO0A 3O23A 1PRYA 2NP8A 5AR5A 4AA4A 4AFJA 3ZUVA 4OAUC 2ITUA 4BZOA 5A3XA 2PZIA 1MUOA 5HNBA 4JQEA 5KMNA 2R7BA 4OTWA 2F7EE 1MRYA 3VS2A 3KB7A 2VO7A 4UXQA 3RCDA 3P7CA 3F3ZA 3MH3A 4LUEA 2RIOA 2I0EA 3BYOA 4FKPA 2WOUA 4R5SA 4DTKA 1PMVA 5HZNA 1YDTE 2GNIA 2QG5A 4BCHA 4MXAA 5AUVA 5H8EA 3GC8A 3NVMB 4ALWA 2OLCA 5JRQA 4AS0A 3WI6A 4RVLA 4GRBA 4CEGA 1U4DA 4ZZMA 2X2KA 1PYXA 5AEPA 3I6UA 4CV9A 3F9NA 4KKHA 1HCLA 2XK3A 4RJ6A 5C27A 5J79A 3FMKA 4ZJJA 4F6WA 3BEAA 3LCSA 5M55A 2OJJA 4UYAA 3NAYA 2UW7A 2BMCA 4FSQA 5FLFA 4QP7A 2PE1A 2CJMA 2XNPA 3GCVA 3FLWA 4L52A 1SZMA 4OBPA 4G16A 4BKZA 3N4TA 1UU8A 4XP3A 4AZEA 4IWQA 4U9AA 4YNOA 1OKVA 4C4IA 1Z5MA 1G8SA 2GSFA 4I22A 5HTIA 3HNGA 4Z3VA 4D0XA 3Q53A 3ENHA 4M12A 4MH7A 1DM2A 5HEZA 1FMKA 2W0JA 3VQUA 2HWPA 3QGWA 4U7ZA 5HD4A 4GYGA 2PK9A 3DAEA 4WOVA 4NTSA 3FLSA 3L9NA 2I6LA 1JKLA 5FXRA 4ZS4A 3GU6A 2YEXA 3N51A 1BI8A 5AM7A 2J5FA 2ZAZA 2X4ZA 4BI2A 3AT4A 3ORZA 2YACA 3QQHA 1RDQE 1Q97A 1H0VA 5H8BA 3HMMA 3DXNA 3ET7A 4IJPA 2HOGA 4O0VA 3E5AA 5DI1A 3ZOSA 2OK1A 3D5WA 3E8DA 1XH6A 3KN5A 1BL7A 4RSSA 4E8AA 3U87A 1WVXA 2BAQA 4JDKA 2C3IB 3SXRA 1OBGA 4XNEA 4EHVA 2DS1A 4FKLA 4IAKA 4OTQA 4OLIA 4AN2A 3ANQA 3ORTA 3RWQA 3GQLA 4DEBA 2QOCA 1YWRA 4WSYA 2WMSA 4XV1A 2ZM4A 2ESMA 4EK8A 1UNHA 4MHAA 1U5RA 5IQHA 1NVQA 4L67A 4I20A 3DLSA 1V1KA 1W0XC 1G5SA 2CCHA 4ID7A 3L8PA 1ZMWA 3HA6A 4R77A 4O6LA 3W8LA 4EH3A 4PDPA 2UZWE 2VO3A 4MNEA 2JEDA 4CZUA 3GCUA 4BDIA 3TXOA 3A7FA 5KNJA 4B8MA 5K5XA 4FUXA 5J1WA 1KE9A 1H4LA 2VWVA 5EOLA 2LGCA 5CNOA 1IG1A 3BHYA 3DAJA 5CF5A 4ANQA 5LVNA 3JUHA 1PXMA 3RBWA 3ZO3A 4ZXTA 5AIRA 2EVAA 3PWYA 4UWYA 5KKRC 3KREA 3G15A 4BDEA 3RAIA 4FV9A 2BIYA 4LGDA 4L00A 4DTBA 3FMEA 3OCTA 4FNZA 4NWMA 3RWPA 3R8PA 5HE2A 4GU9A 5CAOA 2XIRA 1CM8A 5GJFA 5A46A 3VJNA 3VS5A 3JS2A 2HW6A 4MXZA 3ORLA 4W9WA 3GI3A 3W33A 2ZMCA 4X3FA 3ZU7A 3OT3A 4ASDA 5L6OA 3D5XA 4J97A 2W4KA 4YC8A 5EI8A 4HVDA 2ITOA 2WTJA 3LCTA 4L45A 4X2FA 5FWKK 2OICA 5A4EA 4RLLA 5IQEA 4UEUA 3Q2MA 3PG3A 2YJSA 2PVNA 1IASA 2RG5A 3O50A 1RQQA 4E4NA 5HIDA 3OG7A 5E8SA 4KSPA 3VAPA 4YZNA 4Z7HA 3UPXA 5A9UA 5K0XA 1CKIA 3DT1A 4TWCA 2Z7LA 2VTNA 1S9JA 3R7YA 1SNXA 3BV2A 4FV4A 2HXQA 4GJ3A 4JR3A 1R3CA 3FI4A 3OEFX 3LJ0A 3PLSA 2ZM1A 3E8CA 4ZJVA 3F5PA 3BHVA 4MD9E 3OTVA 4RC4A 5HCZA 2PZYA 5EYKA 4OTHA 2XKCA 3DKGA 2IVSA 4DH5A 4O91A 4M8TA 3P1AA 4YHFA 3QRJA 2JAMA 3AC8A 4FKWA 1FPUA 3MV5A 4FT3A 3QZIA 2UZTA 3VS1A 4EEVA 2C5OA 2Q0NA 2OO8X 5IDPA 2XUUA 4DAWA 4OAVB 3EQGA 3FZSA 1R39A 4I6HA 5L4QA 3AD6A 4KBKA 2JDSA 3JVRA 3NIZA 4Q5HA 4DT8A 3MIAA 3D0EA 5EH0A 1W82A 1OPLA 4YURA 3PPZA 2PU8A 2FSTX 4BTFA 5M4FA 1ZYDA 1OI9A 3UNKA 4F9BA 1WVYA 4KD1A 4I4FA 4E6CA 3HL7A 3JR1A 4L7FA 5IH6A 3DAKA 3NUXA 1JKKA 2RSVA 2EXCX 1QPJA 2OF2A 4A9YA 4MXOA 2HIWA 4EK3A 2Z7QA 5CXHA 4UMRA 4TPTA 4V05A 2OZAA 3WIGA 1ZOGA 2W99B 4UALA 5KE0A 3QF9A 5ETFA 4YU2A 2BIKB 1UU7A 1OVEA 2CNQA 4FEVA 4F65A 2XA4A 4IVBA 3A2CA 2ERZE 5HG7A 3V8TA 3CPBA 4UMPA 4ZMEA 1AD5A 5LOHA 5AP0A 4E3CA 4QTDA 4QD6A 2Q83A 4OT5A 3Q4CA 4ACCA 2P2IA 2Y9QA 1GZ8A 3LLTA 4DFXE 5JGAA 4E1ZA 4PNKA 2EB3A 3PIYA 3UQGA 1W7HA 4M67A 4CTBA 1Q8YA 3Q5IA 4NJ3A 3UYSA 4Z9LA 5FQDC 5FTGA 4ITJA 4ZY5A 2PMIA 5JFSA 1L8TA 4F0FA 4TWPA 2PVMA 2CGVA 3F66A 4F9YA 4IFGA 3L9PA 3COMA 4V0GA 5CQUA 4MF1A 3EFKA 4LRKA 4XG2A 1E1VA 2HZ4A 2GDOA 4YZ9A 2JDRA 3A7GA 4FICA 3KCFA 2V0DA 2AYPA 3ENMA 3QFVA 3CJFA 4WNPA 4RBLA 4DITA 3NIEA 4QQTA 4RIWA 3KEXA 2X2MA 2EUFB 5T3QA 1PXJA 2YIRA 1PMUA 4NCTA 2XK8A 5M57A 4L44A 4BF2A 4TYHA 2VWYA 4DGLC 4JBPA 3FMHA 3M11A 4FBXA 4IW0A 3D2KA 4XLVA 3F2RA 3FLNC 3GFEA 3OF0A 5C4KA 5FEQA 3CQWA 3KRJA 4NM5A 4FV8A 3FWQA 4B4LA 3F5UA 4L43A 3R1YA 2GNLA 1WZYA 1YHWA 3POOA 4FYNA 5DR9A 2RFNA 2WB8A 1Q24A 3RGFA 1XH9A 3DBQA 5I5ZA 4BCQA 4UXLA 3BYSA 4BDBA 3QLGA 3U8WA 3FLYA 5FM3A 3TZMA 5IH5A 5CEOA 4RIYA 3UP7A 4EJNA 3KFAA 4ZSAA 1XH7A 2YIXA 4LFIA 3PG1A 4FL2A 3GC7A 2A19B 4CCBA 3A99A 3QCSA 4DH3A 4PMPA 5L8LA 2Y0AA 3DV3A 3ZRKA 3CD8A 1QPDA 5LMKC 3RAKA 2PUIA 4QP2A 5HO6A 2HZNA 4WHZA 2ZV8A 3IOPA 4GJ2A 5BVOA 3VBQA 1ZYLA 5LCJA 1WBWA 2VN9A 2CLXA 3F5GA 3FMLA 5LXMA 3G6HA 1JWHA 3TZ9A 1H01A 1YI3A 4AACA 3MFRA 4GFMA 4P2KA 2ZV2A 2IZTA 3AC2A 5EFQA 4KSQA 3T8OA 4ACMA 2CKPA 4FGRA 2X6DA 4TN6A 5AAFA 4DCAA 4Y83A 2JDTA 5HIEA 3GFWA 1QL6A 2H6DA 3O51A 4G5JA 3CS9A 4PL5A 3PVWA 5KCVA 4O83A 4GUEA 3L8XA 3VO3A 3D2IA 4IADA 3NUPA 4BWPA 3EOCA 2V7OA 3QTXA 5AP4A 4JOAA 2OJIA 4R7BA 4F7SA 3D7TB 4J8NA 4KAOA 1BL6A 4LGGA 4FODA 5CVFA 1OL6A 3NYXA 3DOGA 2R3HA 3PXQA 3OXIA 3LXPA 4F1TA 2WMRA 3I60A 4RA5A 1MRVA 2IZSA 5H3QA 5CAQA 1DAYA 3A4PA 3UG1A 4R78A 1O9UA 3CKXA 2W17A 5CEQA 5J9ZA 1QCFA 3DFCB 3LXKA 4E4MA 4YSMA 5AJQA 3KXZA 1BMKA 2R9SA 2Y4IB 3NNVA 4F7NA 4L01A 3F3WA 3UGCA 5AR7A 5D1JA 2J7TA 1KOBA 3S1HA 3PY3A 5DN3A 3AGLA 4ARKA 5F9EA 2VV9A 3MJ1A 1UWHA 4GIIA 4PL3A 4TNDA 3F2AA 5F4NA 2R3PA 3UE4A 3UJGA 3LMHA 2OIQA 3MIYA 5GHVA 1J3HA 1PMEA 2R3MA 2VGPA 3KL8A 4ZTNA 3EQCA 5ANDA 3G33A 5IA5A 5LVLA 4RJ5A 3RNIA 3UNJA 2GNHA 5EYMA 4D4SA 4O7VA 5HKMA 2C0TA 4HCUA 2ZM3A 4Q9ZA 4ZLOA 3PSCA 3QD4A 4EOSA 4YC6A 3NS9A 4BICA 4MYGA 2YLFA 3F69A 5KBRA 4K18A 5LVMA 2JIVA 3D5VA 4MEDA 3H4JA 2CMWA 5CTPA 2Z7SA 1H08A 1ZARA 4PDSA 5DEYA 3RPYA 4YTFA 5L3AA 3OS3A 1B6CB 4I0SA 4QMTA 2R3IA 3R71A 1XH5A 2P3GX 1H8FA 4JIAA 3CIKA 4FEQA 5EG3A 4UMQA 3VC4A 4I93A 3ZMMA 3UP2A 3AC3A 1U54A 3MW1A 1PKDA 4QYFA 4YJPA 5IMXA 3QUEA 3R2YA 2R0UA 3NGAA 3CY2A 4FV0A 1FGKA 2WD1A 3QBNA 4EOKA 2QR8A 4JG7A 5IQAA 3KKVA 2CNVA 5FTQA 4BBMA 1BLXA 2YABA 3C4FA 3COKA 5L6WL 3DKFA 3LCKA 3HDMA 3THBA 4USEA 2YWPA 3V5WA 4ALVA 4DH1A 4M68A 1XBCA 5EDRA 5TT7A 2OU7A 1JSTA 4FYOA 4YP8A 4D0WA 3A7JA 4GK2A 1F0QA 3S95A 3R7IA 1GAGA 3NNWA 3SHEA 4IQ6A 2B1PA 3D5UA 3A7IA 3HMNA 4IX5A 4IACA 5DGZA 4KA3A 4FTTA 3TNWA 1I09A 3H0ZA 4QP6A 3Q52A 5LQFA 3UZPA 3Q9ZA 3SA0A 2OXXA 3I81A 2DYLA 4E6DA 4WG5A 1KSWA 2WKMA 3C1XA 5AP3A 4TRLA 1Q61A 5CEIA 3T9TA 4BZNA 2ONLC 4BZDA 4Q9SA 3H10A 3R28A 4BN1A 4O84A 3HZTA 3O8TA 2YM4A 4FK6A 4DEIA 3NUAA 5HD7A 4JXFA 1PYEA 4YJVA 4D5HA 3FL4A 4EYJA 4IAYA 2XMYA 4GVJA 4UWCA 4YZCA 3WF5A 4UMUA 2ZV9A 1OZ1A 2UZUE 4DHFA 4NM7A 4HW7A 5AUYA 2J0LA 3ZXTA 4DGOA 4RMZA 3RVGA 4YJOA 3BE9A 4IIRA 3HKOA 4QMUA 4S30A 3AD5A 2GHLA 2WQNA 4MX9A 3BYMA 3LFEA 4PMSA 3LQ5A 3LKMA 3FXWA 2P4IA 2JKOA 5C8KA 3TV4A 2YIYA 3NW6A 4UZDA 3LFCA 4IWOA 2XRUA 3V5PA 3NCGA 2F2CB 4CQEA 1H1WA 1TKIA 3LFFA 2P0CA 4A4XA 3OXZA 4XBRA 5BYLA 5AUXA 4OGRA 1SMHA 5AFVA 3EQFA 4FTAA 4KIOA 3SRVA 4E20A 3MA6A 3PJ2A 5IQCA 2GS2A 5CAPA 3CSVA 4WSQA 3MB7A 5CSPA 5CANA 2X9FA 2YZLA 4ZZOA 4C59A 1MRUA 2VX1A 2A0CX 1MP8A 3PP1A 3LM0A 4RZWA 5L6PA 3OT8A 3Q3BA 2G2HA 5DG5A 1M2PA 4F7JA 1VYZA 2WTDA 2IVTA 5I3OA 2HY0A 4DH8A 3O7LB 3TNHA 3R73A 4HZSA 5GZAA 1W8CA 3K54A 2O5KA 4TKSA 2W5AA 1TQMA 4U81A 2PUNA 3Q4UA 4AOIA 2PVLA 3RALA 4EK6A 4L9IA 4CYJA 2W5BA 4I0RA 1H27A 2G2IA 3LFBA 4NM3A 2WQBA 4JX3A 2W06A 4FIEA 1GZOA 1APME 2RF9A 2E9NA 2XIZA 3QCYA 4JBVA 5CZHA 2NRYA 4LMNA 3ZLSA 5IA2A 5ACKA 3VBVA 4YBKA 1R1WA 2BRNA 4TYGA 5HI2A 3G9LX 4CFFA 3CTQA 2OSCA 4OT6A 3HUBA 3MFTA 5T68A 1WBPA 2XIKA 5BMMA 3TKHA 5C01A 5AX9A 2JC6A 2QG7A 3ZEPA 3NVKI 3QTRA 4NKAA 2R3LA 4ANOA 2BKKA 3RK5A 3GENA 3BEGA 4JI9A 5DPVA 1KV1A 2X81A 2XBJA 4MD8E 4EQCA 4O7LA 4CVAA 1H25A 1UA2A 3GBZA 4U6RA 2YISA 3F82A 4IAZA 5B2LA 5DOSA 4WUNA 4UWBA 2F7XE 1WBTA 2GMXA 2GTMA 3F7ZA 4I0TA 3KK8A 5E8YA 5M4IA 4XX9A 1PXOA 3R01A 4GH2A 3KA0A 3S3IA 2RFSA 4FG8A 3U9CA 3U6HA 3KY2A 4MXYA 3RI1A 3OC1A 3PSDA 3ZSGA 4G6NA 4BDCA 4GIHA 5HO8A 3IGOA 5M56A 3HA8A 4BWKA 4DA5A 4XG4A 3VHEA 4YGAA 5EHYA 4F1OA 2E9VA 5HLNA 4QYGA 3QC9A 3FQSA 3DBEA 3P79A 3ZDUA 4DGGA 5IQBA 4MBJA 3KMMA 4NYEA 4EOPA 2OW3A 3FZPA 3PRIA 4N0SA 3UG2A 4DFNA 5AA9A 4MTAA 1BUHA 5DBXA 4F6UA 2X2LA 4H39A 4O0WA 4CKJA 2GHGA 4DT9A 5IA4A 1H1SA 2XCHA 4G1WA 4IM2A 2XCKA 5HNIX 2WFYA 4AFEA 2QONA 1OKWA 3TUBA 4ACGA 2PHKA 3QL8A 5CX9A 2X8DA 2PY3A 2PSQA 4WA9A 5EKOA 2PUPA 4R5YA 3B8RA 4J99A 1OL5A 4FV6A 2OZOA 5AMNA 5EYCA 4QQCA 5JKGA 2Y4IC 1H28A 5EOBA 4BGGA 5C4LA 5DE2A 3JYAA 3LIJA 4EK4A 4EUTA 3FEGA 4KIKB 2G1TA 3LQ8A 4K8AA 4TXCA 3JXWA 3MJ2A 4FL1A 5HX8A 4Y46A 4FX3A 4YJSA 2QI8A 4F08A 3QGYA 4FEUA 5BVDA 4FKOA 4R7HA 2Z02A 4YJTA 4K0YA 2VWUA 4DLJA 5LMKA 2WMWA 2V55A 4AZSA 4DEHA 1YXXA 4RX5A 3FBVA 3NAXA 3HX4A 3IW4A 2JKKA 1Y57A 2X1NA 3DQWA 4XMOA 3UO4A 1KUTA 2WQOA 2RGPA 4IAFA 4JDJA 5DT0A 5EW9A 1IAJA 4RGJA 2J2IB 4DFYA 3QD2B 5CEPA 4G9CA 4PP7A 4TWNA 3BX5A 4C7TA 1UV5A 2XJ1A 4H1JA 5HVKA 3CCNA 5BX0A 4NTTA 1YW2A 3R7OA 4F09A 4PPAA 4ANMA 3PXFA 5FEEA 4AOTA 4JRNA 5GINE 2G9XA 3RZFA 4FMQA 4M97A 1Q8UA 3KU2A 1PF8A 2QCSA 2QOBA 3KMUA 5JRSA 2PYWA 4QOXA 4FTJA 3V6RA 2PVJA 3UVPA 3E3BX 4R1YA 3TIZA 2VX3A 3UIUA 4JVGA 4RIOA 4CCUA 5CU3A 3P7AA 2P55A 5EI6A 4MWHA 3ATSA 4AZWA 4H05A 3H30A 3RINA 3TUCA 5DRDA 4USDA 2QLUA 4FK3A 5LMBA 5I3RA 2QURA 3HAVA 3S2PA 3ITZA 4ZTMA 4CFUA 5JT2A 4U97A 2HAKA 2QLQA 5CT0A 4CZTA 3O17A 2UZBA 4FZFB 4GCJA 4OTRA 5L2TA 2QOFA 3BYUA 2G15A 5CS6A 2UW0A 4FZDB 4KRCA 3R9OA 4FKIA 2WEIA 2VTTA 4JBQA 1M52A 5BYZA 3EH9A 4NSTA 5JN2A 2W1HA 3ZDIA 3QYZA 3IO7A 4HCTA 4PRJA 2VZ6A 5CYIA 3VQHA 4EK5A 1R0PA 2XNOA 4GV1A 4S31A 3R7UA 2GTNA 2UV2A 4D2VA 5JSMA 2F4JA 4NFMA 1UNGA 3S4QA 1A9UA 1ZYCA 3RP9A 4IZ5A 4CNHA 3EZRA 4QMNA 1YVJA 3A7HA 3C4XA 4BDGA 4UV0A 1Q41A 2QO9A 4FV1A 1PW2A 1JAMA 5A4TA 3TTJA 4WO5A 4B8LA 4N57A 1ZAOA 2CKEA 2QD9A 4MQ2A 4KB8A 4GMYA 1P2AA 2ITPA 4OR5A 5AR2A 2CSNA 3ALNA 3BU3A 2BHEA 3CP9A 3E62A 3C0HA 4LRJA 4XOZA 5H2UA 3ULIA 4ASXA 4RVMA 5HLWA 3QYWA 2XKEA 4MXCA 4HVGA 5I9YA 3PTGA 4EBWA 4APPA 5KUPA 1NVRA 3PJ8A 4KIQA 1W98A 2O0UA 2R7IA 3OFMA 4PF4A 3TNPC 2OFVA 2ITNA 5FD2A 3I4BA 3BLRA 4D1XA 4JR7A 4NUSA 3DK7A 2GQRA 3SGCA 5AUUA 3U55A 2XNMA 1HOWA 5C26A 5KMOA 1VJYA 4FSMA 3RCJA 1E9HA 4LV5A 2E2BA 3FJQE 4BKYA 4M13A 3IW8A 5ACBC 3WZDA 5IEXA 4BBEA 3O8PA 3CBLA 3W2QA 3GOKA 1OMWA 4BCFA 2Y8OA 5HBHA 4EC9A 4NU1A 5CSHA 5TOZA 2C1BA 4MK0A 4AXAA 4UMTA 4L3PA 4BC6A 3KF7A 5LJJA 3KC3A 1BX6A 2W1DA 3FAAA 3MY5A 2QU6A 3IW7A 1YI6A 3MFSA 4JRVA 3SVVA 5FBNC 4B6LA 2KULA 2C5NA 3BWJA 2BZHB 2C3LA 5K0KA 1LP4A 4D2RA 4FTQA 3ZLWA 2OF4A 3QU0A 1CTPE 5LMAA 3UTOA 5CU2A 2VO6A 5DVRA 5BMSA 4W4XA 1R78A 3NR9A 3M1SA 4GFOA 3MY1A 2BRBA 2C6MA 2YCRA 3OW3A 3WYYA 2WMTA 3GUBA 3VNTA 2JBOA 3MWUA 5HG9A 3WZKA 3RHXA 5F94A 1Q3DA 2O8YA 4M14A 4TYJA 3VJOA 2YM5A 3V8WA 1DI8A 3O71A 2C6IA 3PFQA 4I5HA 4ZZNA 3WF8A 3JVSA 3TJCA 4BKJA 3LM5A 2CNUA 3NYNA 3PJ1A 3P0MA 3SXFA 4BGQA 1FVTA 2WMXA 4YTCA 4K33A 2VWWA 3D94A 4DLIA 2NNWB 1ZYJA 2XZSA 4UY9A 3CE3A 2XKFA 5AUZA 1J7UA 4FEWA 4WG4A 1DI9A 3DY7A 4RX9A 1JKSA 2R3OA 4FOBA 3DU8A 4W4WA 2YM8A 1TVOA 4GSBA 3FQHA 4W8DA 5E1SA 2PVRA 4U3YA 3OMVA 2BZKB 3VIDA 4E5WA 4XEYA 2F2UA 2G2FA 3DBFA 4ZTQA 4AN3A 2UVYA 2AUHA 3VBXA 4RQVA 5E90A 5IUHA 5HOAA 4HYHA 3P7BA 3IDBA 3GP0A 3SQQA 2JITA 3TT0A 5I9WA 2VTQA 2LAVA 4Q2AA 4L7SA 2GFCA 3SD0A 3P9JA 4JX7A 1NVSA 4JS8A 1KWPA 1CKJA 4L42A 3OOGA 1YXTA 2B9FA 4J1RA 5E8VA 5D7VA 3VUMA 1UU3A 4JG8A 1GY3A 3PPKA 4QP1A 1STCE 4RG0A 3ROYA 4EZ7A 4FIGA 4LI5A 3PJCA 3ORIA 5KMKA 4QT1A 5FXQA 3KULA 3R7VA 4NK9A 4I5MA 4O7NA 1F3MC 2BHHA 2WTWA 2GNFA 2VWZA 3WIKA 4TT7A 2PVHA 3OCBA 1HCKA 5IQDA 4CXAA 2I0HA 4H3PA 3V5QA 1XH4A 4N6YA 2O2UA 5HG8A 1LEZA 1J7LA 4FR4A 3AT2A 5M07A 4BY9E 1KOAA 2Z7RA 3R22A 3OEZA 4FVRA 4KRDA 2JIUA 5HVYA 3TL8A 4RRVA 3ODYX 4DTAA 3OY3A 3BELA 2BFXA 5AP7A 3NDMA 3OBGA 4WNOA 5KZ0A 4CQGA 4R8QA 1Q8ZA 3EN9A 4GVAA 2YIQA 4KIPA 4QP8A 4CTCA 4CG8A 4AN9A 4UX9A 4QMXA 3AT3A 3DFAA 4O1OA 4WBBB 3V5LA 1V0BA 2FYSA 4XG3A 3UZTA 2VTLA 3I0QA 4QTEA 3PA4A 4FF8A 2GU8A 3F5XA 4G3EA 5FBOA 5CWZA 3W10A 4R7IA 2CGWA 2RFEA 3HLLA 3EIDA 3V3VA 5E4HA 5ETIA 3V5TA 4F99A 3OBJA 1GIJA 5CASA 2QKRA 3FZTA 4D2PA 1JSVA 3WILA 5I9ZA 2XM9A 3NWWA 4MVFA 1YI4A 1IA8A 5DR2A 2BAKA 4R6VA 2FGIA 2YM3A 5KMIA 2BTRA 4PDOA 4F9AA 2IW6A 4XG8A 5HCYA 5ANJA 4QYYA 4X6RA 4BCIA 3MVHA 3KXMA 2HCKA 4H58A 4D5KA 2Y6MA 2ZV7A 3PZHA 5AWMA 5ICPA 2XEYA 4IB5A 1FGIA 3U4UA 3EQPA 4ZY6A 3ID6C 3RPOA 4I6FA 4O86A 2BKZA 5B0XA 3ZRLA 5C03A 4I5CA 3HRBA 4GUBA 4XV3A 2PWLA 3T3UA 5HESA 4EC8A 4C2WA 5FDXA 3EL7A 3QTSA 3B2WA 2IW9A 4BHNA 5BPYA 1XJDA 2OI4X 4IVCA 3GU8A 3E64A 4O0YA 4O38A 1NT2A 3VN9A 2JFMA 2QR7A 2IZUA 4FSNA 1R0EA 4FKJA 4FSTA 3FKNA 3GC9A 1NA7A 3FYJX 4I3ZA 3ATTA 1OKYA 2GFSA 1YXVA 3H9OA 5G6VA 2ZVAA 2JKQA 4XHKB 3DZQA 2J0KA 1MQ4A 3CEKA 4M69A 3KCKA 4Y72A 3QQUA 3EWHA 2C1AA 3RM6A 3TWJA 2J0MB 4BIDA 1UVRA 1PXIA 4BRXA 3LCDA 4YR8A 3ALOA 4AE9A 2PZ5A 2YDIA 3WE4A 4G3DA 3R0TA 4C36A 4EKKA 3E7VA 3AOXA 4AW5A 5IA3A 2B9JA 4BWXA 5KMJA 3BHTA 5E7RA 4C2VA 5AIKA 3PIZA 3DXPA 1WBVA 4X3JA 4PDYA 5JGBA 3IG7A 3FDNA 3F3VA 2B4SB 3QKLA 1KE5A 4R1VA 4AUAA 4DG2E 4ZY4A 3VW8A 2B7AA 4FTKA 4EYMA 3VF8A 4A9RA 1UKHA 1RW8A 2C5XA 2W1GA 4NIFA 3L9LA 4GU6A 4LV8A 4JIKA 4UYNA 4H36A 1EH4A 2ZJWA 4ZSEA 5BQ0A 2R2PA 4E5AX 3P08A 3V8SA 4C4JA 4K2RA 3CKWA 1BYGA 3LFQA 3QUDA 2IO6A 3BLQA 4JQ8A 3UVRA 4PV0A 4C37A 4Y5QA 4QNAA 4BDAA 4YO4A 3EMGA 2NO3A 5FP6A 4KNBA 5K9IA 4GKHA 3AXWA 3D7ZA 3PIXA 4DCEA 3LMIA 5IF1A 4BCMA 1JOWB 4NT4A 1Y6AA 2UVXA 4IZYA 3ZBFA 3WOWA 2R3FA 3LHJA 4HYUA 3FQEA 4RT7A 2BRHA 2FA2A 2YHVA 3ZUUA 2FH9A 1OL7A 3C4ZA 4LQMA 4ZP5A 3TJDA 4RWKA 5E8TA 3HMOA 2YA9A 1CDKA 3E63A 4QMOA 2XNEA 1X8BA 2XH5A 4LOPA 5EHOA 5AV0A 4I23A 4XH6A 4IXPA 3VBTA 2XYUA 1UNLA 4JAIA 3I7CA 3WF9A 3ERKA 1Z57A 2PTKA 3ZSHA 4BIBA 5J5SA 4ZSLA 2WMUA 1ND4A 3EFLA 3N9XA 1H07A 4D55A 4XOYA 3P86A 3DJ7A 5ITAA 3EQBA 2XNGA 2W9FB 2I0YA 3GGFA 3U9NA 4D2TA 4MBIA 4D9UA 4E4XA 4DFZE 3ORXA 4DBXA 4IBMA 4BTJA 3DB6A 4OBOA 3M2WA 2HXLA 3FLQA 4ACDA 3LZBA 3TZ7A 2VTMA 5AV4A 3OXTA 1ZLTA 4QP9A 3VS0A 1W84A 3GT8A 4RX7A 3OY1A 5CSXA 3W32A 4ORKA 2OJ9A 5A14A 4IB3A 4U8ZA 3F7WA 3JPVA 4FVPA 4OTFA 3TUDA 1I44A 3QTUA 3MN3A 4CFNA 3UO5A 2BUJA 4BFMA 4GYIA 3PVGA 4YJNA 4AZVA 4CZYB 5IPJA 3AGMA 2BFYA 5TF9A 3EZVA 3BE2A 1IRKA 2C6LA 4FV5A 2V7AA 4ZK5A 3OUNB 3IDPA 4RIXA 5DH3A 4EH9A 1JSUA 4BDFA 4DH7A 5B7VA 3FMDA 2OZAB 3VUGA 2C6OA 2YCQA 3BYVA 3MB6A 4XP2A 3GOPA 2UW4A 1KV2A 4YHJA 4U0IA 4AZTA 4I41A 3VRZA 3OWJA 1V0OA 3HV5A 2W1CA 3LE6A 3OVVA 4FV7A 4LYNA 5K4JA 1REJA 2QC6A 5J8IA 2UW9A 4DFBA 3BBTB 5J9LA 4FT0A 4HGSA 4J8MA 2O3PA 3KXXA 3TKIA 1U59A 3IPHA 5DT3A 3HMIA 4YBJA 2DQ7X 1WBOA 5IEVA 5J5TA 3QQKA 3F2NA 4QMYA 2YCSA 1L3RE 4I21A 3U4WA 2W5HA 1G8AA 2FUMA 1IR3A 2BDFA 1P14A 5DHJA 4B0GA 1FMOE 3PRFA 1DS5A 3K5VA 4D1ZA 4RJ3A 2GQSA 4BCGA
chains in the Genus database with same CATH superfamily
4EH5A 5K3YA 3R8LA 3OUKA 4IB1A 1OUKA 3P5KA 4MBLA 3PZEA 2XYNA 4AGDA 4FZAB 3FI8A 2EXMA 5I9UA 4PPCA 2C0OA 3HV6A 4QEBA 3IQ7A 1LPUA 2B0QA 3UIBA 4RIWB 3F61A 4C35A 4E6AA 4V01A 1GIHA 2O64A 5E8UA 2GNGA 3OZ6A 4WRGA 2VTSA 3F3UA 4IX4A 4L3JA 4G6OA 3HDNA 4H1MA 3GCQA 4TYHB 5M09A 4O0TA 2ITYA 2QOKA 3QXOA 3LLAA 4M84A 3W18A 2ITWA 2XK6A 2QOOA 2UZDA 3R63A 1VLRA 4JT3A 3DXQA 3TDWA 3C13A 4LRMA 3OWPA 4EBVA 3KXGA 3LVPA 4WNKA 5B2MA 5DMZA 2FVDA 3QA8A 3QKMA 3QTIA 4RJ4A 3LMGA 2Z2WA 2JKMA 4GT3A 4AX8A 5A4LA 3LPBA 4TNBA 5CSVA 2ZB1A 2W1IA 3BLHA 2B53A 2IN6A 3WZUA 1CMKE 1VR2A 4CFWA 4CYIA 2NRUA 4Z55A 5AADA 4RIYB 2FSOX 4FKTA 3R8VA 3PPJA 5H9BA 3BWFA 1OPKA 3FMJA 4QMWA 1YHVA 2B9HA 1Q3WA 4D58A 4FSYA 4QMZA 5LWMA 3C4CA 3V5JA 2XKDA 5IU2A 4BYIA 4BDKA 1PY5A 4AP7A 3W0PA 2QOHA 3KVWA 3FY0A 3UPZA 5FXSA 4BDJA 2UW5A 4O4BB 2JDOA 5CALA 3HECA 3OD6X 5CNNA 4MXXA 2R3JA 4IANA 1SVHA 4QMPA 4PMMA 3AQVA 1XO2B 4HPUE 4W9XA 5A4QA 3ZM9A 3SAYA 5J7BA 1OITA 4XUFA 3C5UA 4O21A 4BCNA 3PA3A 1YDRE 4LL0A 4FNXA 2X0QA 2C4GA 4YLJA 4C02A 1PJKA 4XS2A 4XYFA 5A6NA 3DGKA 1M2RA 4A9TA 4FNYA 2PULA 2VAGA 1IA9A 5D9HA 5AV2A 4O4DA 2BPMA 4O0SA 4OTDA 5T6KA 3FSKA 3ZC5A 1ZYSA 4ONAA 3NX8A 5E8WA 3PE1A 3L9MA 2W7XA 4IEBA 3EQRA 5CENA 4D28A 4LL5A 4X2JA 4G9RA 3R83A 2J6MA 4IAIA 3AD4A 3BGQA 3KF4A 4NKSA 3RAHA 2ZDUA 3BCEA 3RTPA 4EH8A 1GIIA 4IX3A 4CD0A 4L53A 3AC1A 3EHAA 5KO1A 3K5UA 3A4OX 4QYHA 4U45A 2ITTA 2BZIB 3E8NA 3EQIA 2XEZA 5CLPA 3TNQB 1PXKA 3AMBA 4YPSA 3HUCA 2PZPA 2EB2A 1B38A 3GU5A 2QKWB 4O0XA 2OH4A 3LFNA 5JFVA 4OTGA 1YQJA 2XRWA 3E3PA 3SG8A 5CF8A 4HVSA 3DK6A 2OXDA 2ZMDA 4M0YA 3R8ZA 3FHIA 2XANA 3QWKA 4EL9A 4QMSA 4DINA 3R00A 3DDQA 3DBCA 4IHPA 4E4LA 5BV3A 4PX6A 3KXHA 3E88A 2I1MA 5HORA 5GIPE 3BIZA 2A4LA 3KQ7A 3L8VA 4TY1A 5IH4A 2QHMA 3MDYA 3MVMA 3Q9XA 4C57A 4IMYA 2C30A 3RJCA 4NEUA 1JBPE 4EUUA 2Z60A 4QPMA 4QTCA 3EL8A 4JAJA 3BZ3A 3VRYA 3HV7A 3ZYAA 5KHXA 3PE2A 2RL5A 4N6ZA 1YOMA 3PA5A 1K3AA 4EOQA 3WZEA 1Q8TA 4E5BA 3W0RA 4OTPA 1ZZ2A 4FZ7A 5C8MA 3RPSA 3VBYA 1PXPA 4UZHA 4IWDA 3G51A 1XMLA 2XNNA 4IB0A 4J98A 3MI9A 1ZOHA 4DEGA 2ZB0A 2QO2A 4U5JA 1ATPE 2WPAA 3TDVA 1ERKA 4RC3A 4K1BA 3R1QA 4PMTA 1ZOEA 1YDSE 4PP9A 1OL1A 4O1PA 2YZAA 3MH1A 3TACA 5IA0A 4NJDA 2EWAA 3D9VA 5D7AA 2J51A 1JPAA 3Q9WA 2HK5A 4JL9A 1CKPA 1W2FA 2XB7A 3NW5A 4LOOA 4YC3A 5FGKA 4HOKA 2ETMA 4J53A 3CLYA 1LEWA 5BUIA 3OTUA 4DDIA 3PUPA 4FG7A 4AW2A 4EH7A 1SM2A 3GXLA 3MYGA 1J1BA 3NEWA 2JBPA 3BGPA 1P4OA 2A1AB 4FI1A 4KKGA 4KS8A 5AP1A 3C0IA 4FNWA 3FZRA 3MGYA 3LXNA 5L2SA 4FV2A 4LGHA 1FQ1B 2XK9A 3NW7A 3HRFA 5M06A 2YM7A 4ZOGA 2RG6A 4WBOA 4YZMA 4D2SA 3OP5A 4AE6A 3ACKA 2W1EA 4YPDA 3VS7A 4DC2A 2C5YA 1OBDA 3OW4A 4AXCA 4FTUA 2XP2A 3R8UA 5KHWA 2VGOA 4WUAA 1YKRA 5E1EA 5CQWA 3VS4A 1WBNA 4FA2A 1YWVA 1PXLA 2YJRA 1GNGA 4NL0A 2WMBA 4JBOA 1URWA 3R21A 5F20A 2J5EA 3QTQA 4RWIA 4B7TA 3GEQA 4X2NA 5HE3A 3ZEWA 3D4QA 3NNXA 3TV7A 3W0NA 2BDWA 3I5ZA 3NPCA 4FUYA 4QQ5A 4FTMA 4O82A 4NFNA 2UW3A 4C4GA 3LOKA 4EZ5A 4M0ZA 5CAUA 2X4FA 4HNFA 4RVKA 4HGEA 5AP6A 4O7RA 3ZO1A 3B2TA 3ZFMA 4C34A 2J90A 5D41A 4DGMA 3A60A 5HQ0A 2W96B 2BCJA 4HVHA 3D15A 4IC8A 1Q4LA 3SRVB 4A9UA 4O4FA 4ZLYA 4BR3A 3EJ1A 4P5QA 1FINA 3E87A 5FUTA 4AG8A 4C4HA 1WCCA 4PPBA 4QPSA 2XJ0A 1OIYA 1NY3A 3TV6A 3UDBA 4EJ7A 4V04A 2DWBA 2WNTA 3DTWA 3DTCA 2JDVA 3P23A 3QXPA 4DEAA 5CU0A 4CG9A 4BCJA 4RQKA 3UBDA 5HX6A 2X7FA 4GT5A 4YLLA 3WARA 3UQFA 3RMFA 4M3QA 4AT5A 2YDJA 4MD7E 2VTOA 2YAKA 3N4UA 3KVXA 4EKLA 5AA8A 4LUDA 2OG8A 2FO0A 5DT4A 5AUWA 5HVJA 1OGUA 4W4VA 1XBBA 1J91A 4D9TA 4XRJA 1O6KA 3IK3A 3VVHA 4IDTA 2E9PA 3BRBA 2BROA 4YNEA 1H1QA 3FY2A 3O2MA 4AW1A 2VTPA 2OGVA 3Q4TA 4S33A 5AV1A 3FUPA 3WF7A 1F5QA 4RFYA 3K3IA 4YZBA 3GNIB 4HGLA 4YSJA 5J95A 1OPJA 2C0IA 1GZNA 4KWPA 3T3VA 4CRSA 4RWJA 4EOIA 4ZIMA 3NUYA 2O65A 1OIUA 3ANRA 2WGJA 3DDPA 2ZOQA 2QQ7A 3FPMA 2C47A 2F49A 5ETCA 3Q04A 3ORPA 3EQHA 4XV2A 1H24A 3JY9A 3ZLYA 3UQCA 4ZS0A 2H96A 5IQIA 4IFCA 3GVUA 4LOQA 5CSWA 3AMYA 4O2ZA 3PDTA 5DYJA 3QTZA 4A07A 4FG9A 2YITA 4GK3A 5HICA 2XK4A 4OW8A 2IPXA 3KRWA 4EH4A 3D83A 4Q5EA 3Q6UA 4FTIA 4E7WA 4ITHA 2EXEA 2E9UA 3OOMA 1RE8A 1WFCA 4AAAA 5IQGA 3QHRA 4CKRA 3DCVA 5TKDA 4NH1A 2WXVA 3GU7A 5JZJA 1TFFA 2QOQA 3ACJA 2WQMA 3NNUA 3H0YA 4ZTHA 1SYKA 3H9RA 2EU9A 5TR6A 3UOKA 4C4EA 3P78A 4KABA 4MNFA 3DK3A 3RM7A 3ZM4A 1Y6BA 1M14A 5AV3A 4FV3A 4APCA 4CT1A 3UVQA 3E92A 2CLQA 4FE2A 5ETAA 3KRLA 4I1ZA 3R9DA 3G5DA 4A4LA 3OCGA 3GU4A 4CT2A 4CFXA 4KINA 2IEWA 2JIIA 4HNIA 3EB0A 4WIHA 4HZRA 4IE9A 4HCVA 4N70A 2OH0E 1ZXEA 3LCOA 3VF9A 3BQRA 5ANIA 2OXYA 4F64A 4KBAA 3BBWA 3FLZA 2PZRA 4XG9A 5HHWA 2I40A 2F7ZE 5LARA 4PNIA 3VUDA 1SVEA 2JD5A 3FI3A 3QUPA 1Y8YA 4HYSA 4I6BA 4U42A 4XP0A 5FM2A 4C8BA 4EHGA 3LFDA 1YOJA 3UOLA 5F95A 3RKBA 3NYOA 3QQLA 2ONLA 4IAAA 2PE0A 3CJGA 5B2KA 4TW9A 4QRCA 3NYVA 2VTAA 4II5A 3TEIA 5EQPA 4I6QA 4GS6A 1TZDA 3BL9A 2OKRA 3G0FA 3IKAA 3HP2A 2WIPA 4FTRA 1YOLA 5H8GA 3TIYA 3TN8A 2VTJA 4D4YA 3QCQA 3C0GA 2BAJA 3TNIA 3CR0A 3BHHA 1QPEA 2DUVA 3W8QA 4GFGA 2ITVA 3MTFA 4GG7A 4AOJA 2PMLX 2OIDA 4J7BA 4AW0A 3ZRMA 4M7IA 4ERKA 5IA1A 4CFVA 2IG7A 2QNJA 4IWPA 3DBDA 4BL1A 5IISA 2BALA 4FIFA 5I4NA 2GQGA 2FB8A 4PWNA 4S32A 1VZOA 3LJ1A 1GJOA 3CTJA 3QQFA 5EYDA 3QRIA 3A8WA 4CMUA 4EWQA 3TZ8A 2R3KA 3FXZA 3RHKA 5M51A 2OBJA 1TQPA 4ANBA 5JH6A 2X39A 3ORMA 5EM8A 2IW8A 4GKIA 2VWXA 4FKSA 2RFDA 3HVCA 4W4YA 3TTIA 3W2RA 3V01A 2KTYA 3AKJA 3LAUA 3EN5A 4FEXA 4O7ZA 4MKCA 2X6EA 4TTHB 4FIIA 4I92A 3U6JA 4GG5A 1FBNA 4ZJIA 3FYKX 3NSZA 3BU6A 2WTIA 5DNRA 2VTRA 1XBAA 3MPAA 4BIEA 4E93A 3SW4A 5IUGA 2ITZA 2YERA 4AWIA 4BI0A 3MESA 5AAGA 5M53A 5J7HA 4BVUA 3CD3A 4O7WA 3FC2A 3NUUA 4FTNA 2QO7A 4PL4A 1OM1A 3AG9A 4YUQA 2WEVA 1JKTA 3DA6A 2QU5A 4YTHA 5E9EA 5D10A 4C3FA 3C4WA 4OTIA 4C38A 2UVZA 1Q8WA 5BVNA 2CGUA 3W16A 4U79A 2YAAA 4CMOA 3C7QA 4G3CA 1G3NA 1Z9XA 2PUUA 1H0WA 1PKGA 2J0IA 4FOCA 4QTBA 4BBFA 2WAJA 5EDQA 4FSUA 4NM0A 4O7YA 4NW6A 2AC5A 4ZEGA 5DFPA 4BGHA 3C51A 3SOCA 4AQKA 1U46A 1M17A 1FVVA 4J96A 3MBLA 5HE0A 4FSWA 5M08A 4IZ7A 4RLKA 2C3KA 5D11A 3L8SA 3ZLXA 5J9YA 4PTEA 2A27A 5HU9A 3F6XA 4NZWB 2HENA 4XRLA 3P4KA 1BKXA 3PJ3A 4AT3A 4CRLA 3AKLA 2HY81 4Y5HA 2F9GA 2PMNX 3WYXA 4ENYA 2C3JA 3W2PA 4A4OA 3PUFC 3OCSA 1XKKA 3PVUA 3MS9A 3QRUA 4ENXA 1Y8GA 2HYYA 3WZJA 4ASZA 3QX2A 4RPVA 5A54A 4WD5A 4PTGA 4A06A 5GJDA 1GOLA 5EM7A 4ZTSA 3Q2JA 3HV3A 4IZAA 4OBQA 3RAWA 5E91A 1NXKA 2R5TA 2QVSE 5TE0A 3KRRA 4S2ZA 2X7GA 4W8EA 3CC6A 3QLFA 4CSVA 3NMUF 3PY0A 3PXZA 5CVHA 4O0UA 5GZ8A 4X6QC 4CGAA 2V62A 5GIOE 5L8JA 2XK7A 4G34A 1SVGA 5JQ5A 2I0VA 4M66A 3NUNA 1OKZA 3D7TA 3O7LD 4YHTA 4AZFA 5L8KA 3G2FA 4DYMA 4LDTA 2C69A 5DEWA 5KZIA 5EQYA 2C6TA 3G90X 4C62A 4L3LA 5ANKA 4JDHA 2VTHA 2GS6A 3DPKA 3BQCA 4GW8A 1ZZLA 4X2KA 5EW8A 1PHKA 4X7QA 4F70A 3R9RA 2UW6A 1U5QA 4DG0E 3S00A 2CKQA 4U41A 4L6QA 3TCPA 1MQBA 3ZHPC 1KE6A 2WTCA 2X7OA 5LCKA 2P33A 3FKLA 4RZVA 3W2OA 4O7SA 1UU9A 3CPCA 5AR3A 2SRCA 2BILB 3WE8A 1DAWA 3UYTA 3FMNA 3ELJA 2YFXA 4O7TA 1WBSA 3DJ6A 3FV8A 3IW5A 4MAOA 3V6SA 4YMJA 2CHLA 3L1SA 4MNEB 2OJGA 3VUTA 5JK3A 4QTAA 4U3ZA 5BYYA 5JGDA 4RFMA 5KBQA 2IZRA 2H8HA 4CLJA 4FT7A 2G01A 2UZVA 1KE7A 3RNYA 1CSNA 2WTKB 2BTSA 3UOHA 1M2QA 4KKEA 2CDZA 4F6SA 3B8QA 3RPRA 3BV3A 2GS7A 3E8EA 3UODA 2REIA 4R3CA 4BYJA 2WIHA 4AF3A 4D4VA 3SX9A 2B9IA 2VNYA 2WZJA 1ZMVA 4FVQA 1E1XA 3NUSA 4G31A 4IM0A 4D1SA 5C8NA 2XNBA 3KMWA 2H34A 4O6EA 5CU4A 3SDJA 1M7QA 3SOAA 1XMMA 3U54A 4YJQA 1UKIA 3V51A 1WMKA 2BDJA 3PY1A 3PXYA 4I4EA 4FKGA 3W1FA 4X3FB 4QMQA 2IJMA 4DFLA 2CN8A 3WF6A 3ZCLA 5IKWA 4P7EA 4PUZA 3GCPA 4DF3A 2R3GA 2YIWA 4BCKA 3ZXZA 4PQNA 4FRFA 3RPVA 4FKUA 1Q62A 2GNJA 4CFMA 2WU7A 3BU5A 5DRBA 1JNKA 2YDKA 3LJ2A 3MFUA 4O4EA 5CI6A 2ITQA 1QPCA 3E93A 4MQ1A 4H3QA 4DDGA 3R7EA 3LW0A 3QQGA 3ULZA 3KULB 3K3JA 5DLSA 2X9EA 3R7GA 4G2FA 4C3RA 4F0GA 4JG6A 5A6OA 4UB7A 2FSMX 4WRSA 1Q5KA 2HZIA 3QD3A 4XLIA 5HO7A 4P4CA 2WQEA 2RKUA 3R04A 4IC7A 3PVBA 3UIXA 3UO6A 5FDPA 3Q60A 2WMQA 4QMLA 5FRIA 4I94A 3ZUTA 3CGOA 2BRMA 2UZNA 3FPQA 3S0OA 2W9ZB 5HLPA 3EYGA 3R9NA 4FKRA 4WNMA 5JEBA 4ZSGA 3A61A 1M7NA 3HGKA 3Q5ZA 5I9VA 3KXNA 2O63A 1FVRA 2HELA 3DQXA 4EOLA 2UZLA 5JFWA 1IEPA 1W2CA 4C33A 5HBEA 3FL5A 4R3RA 3QA0A 3UMXA 2OFUA 3IOKA 2WU6A 3OWKA 3RK9A 4O0RA 3BKBA 3ZSIA 3KIOC 1REKA 1YXSA 3HV4A 2H9VA 1ZRZA 3HEGA 3ZBXA 2Q0BA 4GK4A 4RJ8A 5IMEA 4FIHA 3R8MA 4K6ZA 3DLZA 3QZGA 5KX8A 3REPA 5AR4A 2Y4PA 3FHRA 4RC2A 2WHBA 3QZFA 1WVWA 4IX6A 4QPAA 4ZLZA 1H26A 2PL0A 3HP5A 2PMOX 4F63A 3TM0A 1JQHA 4O96A 3FE3A 1URCA 3ETAA 3C4EA 3IGGA 4R3PA 3I7BA 4HPTE 3M42A 1G8KA 1XQZA 5BUJA 4AGWA 2VU3A 3EFJA 3UNZA 4AA0A 3MVJA 3IONA 5AX3A 4BDDA 2WTVA 4JNWA 3W2SA 5AAEA 5M4UA 5J1VA 4E26A 4L68A 4IVAA 4EOJA 3FZOA 4MCVA 2HW7A 2VTIA 3DNEA 1TQIA 3MH2A 1XWSA 4AA5A 4U43A 2OJFE 2C6DA 2XF0A 3T9IA 3VHKA 3U6IA 4A7CA 4DN5A 4FKQA 3C9WA 4QMMA 4S34A 3EKNA 4BCOA 4L8MA 2UZOA 2Y6OA 4AGUA 3COHA 3SLSA 3QX4A 4F1MA 2WOTA 3WBLA 1LUFA 4Y85A 5C1QB 4QNYA 4WKQA 1JLUE 3MA3A 4O22A 1XR1A 3AC5A 4QMVA 3DKOA 3E7OA 3MVLA 2UZEA 4PY1A 3MSSA 3NZ0A 3F88A 1NW1A 4Y73A 4M69B 3N4VA 3EKKA 2CN5A 1T45A 2XJ2A 3DNDA 4QP3A 4BB4A 2ERKA 5HU3A 2AC3A 2J50A 2QHNA 4V0GB 2P2HA 4GT4A 3R6XA 4U40A 5HTBA 1KE8A 5HE1A 3DZOA 5JQ8A 3GC0A 3ZONA 3G0EA 3Q32A 4ZSJA 2HZ0A 2XVDA 3FMMA 4YJUA 5BVEA 4CMTA 4L46A 5EI2A 1VEBA 2V22A 5M4CA 3ZO2A 2QOIA 1XH8A 4UN0C 4MF0A 4FGBA 4ALUA 4IDVA 4XG7A 3EN7A 2IWIA 4GL9A 4EWHA 4EI4A 3PXKA 4AQCA 5K4IA 2VD5A 4LG4A 1K2PA 5GZ9A 2PVFA 2C6KA 4NIFB 5CT7A 4EONA 4YTIA 5JMSA 2X8IA 4ZMFA 3OROA 2C5VA 3QRTA 5EDPA 3C50A 2I7QA 4ANNA 3FSFA 5FG8A 1BI7A 3CQUA 2XM8A 4G6LA 3DS6A 4I24A 3TI1A 1SNUA 3FKOA 4MWIA 5HBJA 5BVKA 2YWVA 4TZRA 3IW6A 3VUKA 4Z16A 3UC3A 4F7LA 4U44A 5E92A 4EH2A 2X0GA 2ZDTA 5HIBA 3I79A 2CPKE 2YCFA 3BI6A 3MH0A 4FSRA 5EM5A 2ZYBA 3PSBA 3EYHA 1P4FA 4IM3A 5CAVA 3NRMA 4HYIA 3R30A 2J9MA 3EN4A 4K11A 4TYEA 4RA4A 3H3CA 4U80A 4N4SA 3SC1A 2JAVA 5CEMA 2R64A 2VUWA 4K9YA 4ASEA 5I9XA 4DFUA 3VS6A 4BTKA 1H1PA 4DE4A 4EHEA 4AU8A 1RJBA 1AGWA 1OUYA 1Y91A 4YLKA 2XBAA 2VX0A 1K9AA 3Q4ZA 5L2QA 2IVUA 3GCSA 3QCXA 2BR1A 4FKVA 3QQJA 4FTLA 2XIYA 4JLCA 3CGFA 4B99A 4KIKA 4AT4A 4KBCA 3CQEA 2JFLA 3W0QA 3U51A 3PXRA 2V5QA 4ZTRA 3VW6A 2X8EA 2W1ZA 2YLEA 3K2LA 3PWDA 4EORA 2ACXA 4OUCA 5ANEA 2E9OA 3UOJA 4EOMA 3IS5A 3AC4A 5BNJA 4H3BA 2Y7JA 3PYYA 3TKUA 4LM5A 1PXNA 3SV0A 4F9WA 5BUEA 4JQ7A 3ZFXA 4DGNA 2WTKC 4BI1A 4X2GA 4EQMA 3IECA 3Q96A 2F57A 3II5A 3QKKA 4O27B 2CGXA 3VUHA 3RZBA 1H00A 2WMAA 5CY3A 2R3RA 4ZAUA 2VNWA 3TG1A 3ZFYA 4E6QA 5GNKA 2PVYA 4JJRA 4HGTA 5HG5A 5CVGA 4C58A 4EQUA 5LWNA 4Y95A 5FEDA 2IVVA 5CZIA 2GPHA 2B52A 3UZRA 3QTWA 2BRGA 3QD0A 3AMAA 4CKIA 3I1AA 3ORKA 3O0GA 4RIXB 4G5PA 4QQJA 5IUIA 4BHZA 4D2WA 2PPQA 4X3FC 5CEKA 4EOOA 4BDHA 2Z8CA 3QZHA 5BVWA 2BZJA 4XCUA 1P5EA 4A9SA 4G3FA 2R3NA 3IDCA 4J71A 4CV8A 4HVIA 2W05A 5L2IA 4QO9A 4I5PA 4JDIA 4XG6A 5EM6A 3BHUA 3VUIA 3MY0A 4QYEA 2OWBA 4YO6A 5FP5A 1J7IA 4C61A 1QMZA 5HNGA 1ZY5A 2PE2A 3G9NA 3W2CA 5CXZA 2HWOA 4ANSA 5C9CA 3A8XA 3Q9YA 4J52A 4J95A 4RFZA 1AQ1A 2ETRA 1UWJA 3DB8A 3UMWA 4AGCA 2A2AA 4G17A 2W4OA 1ZWSA 5CF4A 4IVDA 2CKOA 3ZTXA 4M15A 1JVPP 1OIQA 3ZS5A 4AAYA 3KK9A 3GB2A 5IZFA 3JY0A 5DWRA 3ZC6A 1T46A 5CU6A 4P90A 5IQFA 2XS0A 3SXSA 2IF8A 2YN8A 5I0BA 5JFXA 3H9FA 4FSZA 2PVKA 5EHLA 5BVFA 2VRXA 3CTHA 3C5IA 5AR8A 3MPTA 3LFAA 3W55A 3CXWA 1U54B 3R9HA 3V04A 1J1CA 1YWNA 3QC4A 2ITXA 5K5NA 4NW5A 4K77A 1A48A 4UBAA 4DG3E 3RK7A 4I6LA 4DEDA 1W83A 5LVPA 5CF6A 1YRPA 4DBNA 3QWJA 3ZH8A 3VS3A 3R1SA 5HCXA 2R4BA 2C68A 1VYWA 4YJRA 5ANOA 5J87A 2UW8A 4C4FA 5KKRB 5EQEA 4YZDA 3QRKA 1FOTA 3G6GA 4B9DA 3HYHA 3SKCA 3NLBA 3MTLA 1PMNA 1XHAA 3ZZWA 3PP0A 5D12A 2R0IA 4XBUA 3EN6A 5AP5A 5EKNA 4CLIA 1S9IA 2QOLA 1ZMUA 4FC0A 4EHZA 1LR4A 4ANLA 3LQ3A 4WT6A 3QALE 2WMVA 4WG3A 5M44A 4IH8A 3PLAE 5HTCA 2W4JA 3O8UA 5F1ZA 4QDEA 4DEEA 2VWIA 2NPQA 5E8XA 3R02A 4LMUA 3VULA 5L2WA 5AP2A 3COIA 4C0TA 1WAKA 2VWBA 5E8ZA 3ZZEA 1V0PA 4Y8DA 5EK7A 1ZY4A 2JLDA 4ZTLA 3R2BA 4EH6A 2WELA 5IG1A 3ZO4A 5FTOA 4RX8A 3EFWA 1YXUA 1OB3A 2OIBA 4G3GA 3I6WA 1A06A 3FZ1A 4E73A 4TYIA 3ODZX 2QODA 5AM6A 1O6LA 1IAHA 5CI7A 3BGZA 4ACHA 4Z7GA 5IEYA 3ORNA 2B55A 2C6EA 3R1NA 4FTCA 3ROCA 4F4PA 2GCDA 5GJGA 5A4CA 3HAMA 5G1XA 1OL2A 3Q6WA 3UIMA 3A62A 4F0IA 4O81A 1H1RA 4D4RA 1Q99A 2J4ZA 3KRXA 3QAME 4FT9A 5HGIA 4FZ6A 3SW7A 5IDNA 5KMMA 3HRCA 3LXLA 2UUEA 4IJ9A 4PTCA 3QHWA 4GEOA 4ITIA 4ERWA 3EQDA 5TO8A 3POZA 4FL3A 5DIAA 5EW3A 3VWAA 3HMPA 1YHSA 2W1FA 3LFSA 4EZ3A 4FT5A 4RWLA 5LVOA 5ANGA 3UC4A 3NFFB 4QP4A 3SG9A 1GZKA 3VBWA 4TL0A 4HJOA 4NCTC 5DR6A 3BPRA 2BVAA 4RVTA 4USFA 2YM6A 2J0JA 3CY3A 4FIJA 4O2PA 2XIXA 3D14A 3FC1X 3NCZA 3DJ5A 5JZNA 4BTMA 5AUTA 3KGAA 2ETKA 2CCIA 2FSLX 3FI2A 2B54A 4XV9A 4BCPA 4X21A 2R3QA 2WO6A 5DA3A 2JGZA 3F3TA 3DKCA 3MPMA 3GQIA 3OHTA 3OWLA 4P5ZA 4XJ0A 3KN6A 4KUJA 4TWOA 4X0MA 1O6YA 3FXXA 3I0OA 4RJ7A 3O96A 4FTOA 1OECA 1OIRA 3I5NA 2GHMA 4F9CA 5KMLA 1B39A 4KS7A 4C3PA 2VO0A 3O23A 1PRYA 2NP8A 5AR5A 4AA4A 4AFJA 3ZUVA 4OAUC 2ITUA 4BZOA 5A3XA 2PZIA 1MUOA 5HNBA 4JQEA 5KMNA 2R7BA 4OTWA 2F7EE 1MRYA 4DHIB 3VS2A 3KB7A 2VO7A 4UXQA 3RCDA 3P7CA 3F3ZA 3MH3A 4LUEA 2RIOA 2I0EA 3BYOA 4FKPA 2WOUA 4R5SA 4DTKA 1PMVA 5HZNA 1YDTE 2GNIA 2QG5A 4BCHA 4MXAA 5AUVA 2XAMA 5H8EA 3GC8A 3NVMB 4ALWA 2OLCA 5JRQA 4AS0A 3WI6A 4RVLA 4GRBA 4CEGA 1U4DA 4ZZMA 2X2KA 1PYXA 5AEPA 3I6UA 4CV9A 3F9NA 4KKHA 1HCLA 2XK3A 4RJ6A 5C27A 5J79A 3FMKA 4ZJJA 4F6WA 3BEAA 3LCSA 5M55A 2OJJA 4UYAA 3NAYA 2UW7A 2BMCA 4FSQA 5FLFA 4QP7A 2PE1A 2CJMA 2XNPA 3GCVA 3FLWA 4L52A 1SZMA 4OBPA 4G16A 4BKZA 3N4TA 1UU8A 4XP3A 4AZEA 4IWQA 4U9AA 4YNOA 1OKVA 4C4IA 1Z5MA 1G8SA 2GSFA 4I22A 5HTIA 3HNGA 4Z3VA 4D0XA 3Q53A 3ENHA 4MUQA 4M12A 4MH7A 1DM2A 5HEZA 1FMKA 2W0JA 3VQUA 2HWPA 3QGWA 4U7ZA 5HD4A 4GYGA 2PK9A 3DAEA 4WOVA 4NTSA 3FLSA 3L9NA 2I6LA 1JKLA 2X0OA 5FXRA 4ZS4A 2A98A 3GU6A 2YEXA 3N51A 1BI8A 5AM7A 2J5FA 2ZAZA 2X4ZA 4BI2A 3AT4A 3ORZA 2YACA 3QQHA 1RDQE 1Q97A 1H0VA 5H8BA 3HMMA 3DXNA 3ET7A 4IJPA 2HOGA 4O0VA 3E5AA 5DI1A 3ZOSA 2OK1A 3D5WA 3E8DA 1XH6A 3KN5A 1BL7A 4RSSA 4E8AA 3U87A 1WVXA 2BAQA 4JDKA 2C3IB 3SXRA 1OBGA 4XNEA 4EHVA