4XG2A

Crystal structure of ligand-free syk
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
259
Chain Sequence
YLDRKLLTLEELGSTVKKGYYQMKKVVKTVAVKILKNPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 259
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xg2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xg2A01
3E7OA 4FYOA 2PMNX 3TL8A 4XBUA 4QMVA 2H96A 2RFNA 4BDDA 5DMZA 3KRXA 5FG8A 4FODA 4BCHA 2BAQA 3TZ8A 3KCKA 2QNJA 4Y73A 4I6QA 1RDQE 4AA5A 4XV3A 4IM3A 2HENA 2UW6A 4HVHA 4EORA 2QLUA 1YHWA 3DJ6A 3MFRA 5DT0A 1V0BA 3C0HA 3EMGA 2FSMX 3ZZWA 3E87A 2PVYA 2YEXA 3T3VA 2E2BA 5HX6A 5ANDA 4ZTMA 4QPSA 4BIDA 3QUDA 2BROA 2QI8A 1A06A 4HYUA 1VEBA 2R3LA 4R7HA 4C37A 3BZ3A 2JAMA 5DIAA 5JT2A 1YHVA 3R0TA 5F95A 2QR7A 4I4EA 4CLIA 2VGPA 2PK9A 4KNBA 2PVLA 4XOZA 3R7IA 2PZYA 3FZPA 3PJ2A 3GP0A 1WAKA 3MA6A 1SVHA 5HCXA 2P2HA 3DLSA 4MQ2A 3PZHA 3R63A 2PVNA 2UZUE 4X2KA 4R7BA 4FTLA 5K4JA 5C4LA 3QTIA 3EYGA 3RMFA 2E9VA 4J98A 3TI1A 5AX3A 4AZTA 4BWPA 3UZTA 5JQ8A 4QMXA 3CEKA 5E8YA 4EEVA 2FGIA 3E8EA 2VTLA 2RGPA 3F66A 3LFNA 2ITTA 3BYVA 4IB1A 4ZLYA 5HNIX 2G2IA 3MN3A 4YC6A 3OZ6A 1H4LA 4TZRA 3EYHA 4IB3A 4PTEA 3LJ1A 4XG9A 4DEGA 4HVSA 2BVAA 2Z02A 5BVFA 1ERKA 5DE2A 3CCNA 3NLBA 4ITHA 4E5BA 3TDVA 4LOOA 5HG9A 4FVPA 4NM7A 5H9BA 3W16A 3TT0A 3DFCB 4DFYA 4ZY4A 4LUDA 1IEPA 3ORMA 5BYLA 3OY3A 4GU6A 3VUKA 4G3GA 2ITOA 3HMNA 4M66A 5DA3A 3G33A 1XBCA 3QKLA 2RG5A 3BE9A 3ZLXA 2JKKA 4F9WA 1MP8A 3R2YA 4I20A 1OUKA 5EHOA 4FSNA 4BZNA 3VUHA 3QZHA 3D5VA 5DGZA 5CF8A 5LVNA 3C4CA 4O6EA 5JQ5A 2ERKA 3FI3A 3RI1A 4FSMA 1SZMA 4FNZA 3UP2A 4P5QA 4ZXTA 4UN0C 4UV0A 3FSFA 1O6YA 4KIQA 1XJDA 1XH9A 1U5QA 1CSNA 2X39A 3MPTA 4FKRA 4GIHA 3V01A 4F6UA 3UIXA 4YLLA 3QHRA 4YZCA 2WIHA 4RX9A 2GSFA 3R1QA 1QCFA 3GCQA 4BICA 4XV1A 1BI7A 2GQSA 1S9JA 4XG7A 5DRBA 2F2UA 1KE6A 1XO2B 4PP9A 4DH7A 4JIAA 5AV3A 2XP2A 4DBXA 4NM5A 4LQMA 4TTHB 2AUHA 1GIJA 2UW4A 2VWXA 4FZAB 3RKBA 4F70A 4C36A 2HAKA 3H10A 5M55A 1TVOA 1CKJA 4FVRA 3VS7A 4B4LA 2BRHA 5A4QA 4G3CA 2JC6A 2WFYA 2VWWA 3ZU7A 4E3CA 4TL0A 5DLSA 3DJ7A 4I5HA 3BEAA 4GSBA 3QCSA 5K0KA 5LWMA 1U5RA 2IW8A 3C5IA 3GU6A 5D9HA 5F20A 3UG1A 1TQIA 3MB7A 2CHLA 4K0YA 2Q83A 3EFKA 4M67A 1P4FA 4I0TA 1WVXA 2XNPA 4FTOA 5IG1A 4JLCA 2PYWA 4G3DA 4I6HA 4I4FA 4D4RA 3DGKA 3PXZA 3NEWA 4JBPA 1XWSA 3HKOA 1FVTA 5M09A 1XQZA 2OLCA 2XJ1A 2XNNA 3EQCA 3P78A 4M0ZA 1PYEA 4XMOA 3FKNA 3NIEA 3NAYA 3QQJA 4U97A 4D1SA 5BMSA 5I9VA 3Q96A 2WEIA 2YDJA 3CSVA 4Y5HA 5I9YA 2JEDA 2Z2WA 2X2LA 3FC1X 2YISA 2XS0A 4O0RA 4O2PA 3U4UA 1Q41A 3O0GA 4I22A 1RW8A 4EH7A 2VV9A 4U42A 4AZFA 5ACBC 3JVSA 4PMTA 1REKA 3KB7A 4S32A 4JDHA 4BDBA 3SGCA 1PMVA 4L7SA 2FYSA 5DHJA 4H1MA 4FT3A 4NM0A 4QMSA 4G2FA 2Z7LA 3D5UA 1A9UA 3SXRA 3AD6A 4RC4A 2W1EA 4KUJA 4HCTA 4D2VA 4K18A 3REPA 3TUBA 4GK4A 3LHJA 1REJA 2OJGA 2WMAA 3GCPA 3LAUA 3DZQA 5FM3A 3UOKA 3P9JA 4XHKB 5LMKC 1WMKA 4XOYA 3CKXA 4FSYA 1VJYA 2YWPA 4QTBA 4JR3A 3VW8A 5HTIA 1NY3A 4FG9A 4FKQA 2ZM4A 4E6CA 4L44A 3IKAA 4ZTRA 3UVPA 4EC9A 2B4SB 3BE2A 5CT7A 4TKSA 3UIUA 4NM3A 1ZARA 2YN8A 4AOJA 3FI2A 4JBOA 2HZNA 3WZEA 1VYWA 4UMUA 1MQ4A 4PDYA 3NCZA 3EN4A 3V8TA 3AGMA 4YBKA 5TOZA 5I9ZA 4F0GA 3OT8A 4KS8A 1UU9A 4ZTHA 1OL2A 2W96B 4V0GB 4XS2A 4ZAUA 4QMYA 4A9SA 4EH6A 3U87A 3EQHA 4HVDA 1LP4A 5LXMA 1UV5A 3D4QA 3KMMA 4FIEA 4L3JA 3KK9A 5IKWA 2C6EA 5DNRA 2XK3A 4RIOA 4AW2A 4ONAA 2WQEA 4KIKA 3CJGA 4O7WA 1ZOHA 2WAJA 2W9ZB 2I1MA 4RIYA 2H6DA 4TYGA 2XA4A 4NTSA 4WRSA 3KF7A 2OZOA 3BCEA 5BUEA 1WVWA 4OBQA 3PP0A 3Q4CA 3ROCA 3EB0A 3FMEA 4N6YA 3VQHA 2QOOA 2PULA 4FGBA 4O38A 4Y72A 5AR5A 5FQDC 4BDGA 2A27A 4LMNA 5IEYA 2BRGA 1Y8YA 5J9ZA 3A7JA 2I7QA 4WNMA 3W18A 2VO0A 2BFXA 2YJSA 3L9PA 2OJIA 3ZFMA 2JDVA 3HECA 4DFLA 3CS9A 3KU2A 1XH5A 3ZS5A 5FTGA 1G8AA 4EBVA 4CVAA 4IVBA 4JBQA 2WTCA 4FKJA 4UMQA 4BY9E 1SNUA 4A9UA 4MCVA 1IRKA 2XJ0A 5CEKA 4IWOA 2IZTA 2OGVA 3KQ7A 4XCUA 4A4LA 4JDIA 5D10A 1GJOA 4FSRA 5HG8A 4BGHA 4W9XA 1E9HA 4PL3A 2JDSA 4K8AA 1ZYCA 4QMWA 4AGWA 4KKEA 4DFUA 4RSSA 2V7OA 4U3ZA 4YUQA 2JKOA 1H1PA 3LCDA 2X0GA 5DT3A 4QMQA 2R0IA 3UO5A 4EZ7A 1P5EA 3DQXA 1WZYA 4IM2A 5GJGA 5IF1A 3QA0A 4RFMA 2NNWB 3PRIA 4YHJA 3QFVA 4TWPA 3OWKA 4ZY6A 1Q24A 4GS6A 3HAMA 1H01A 1FVRA 2J50A 3R04A 4IVCA 4S30A 5CI6A 4G3EA 2C5XA 3UOLA 4GFGA 4KAOA 3NYVA 3ZDIA 3H9RA 2X8DA 2YABA 2PZPA 5AUZA 3CQWA 2I0HA 4JT3A 3RAKA 4BIEA 3RK5A 2VTSA 4QMLA 3KXNA 1YWVA 3FBVA 3W2SA 2O64A 3QRJA 2V55A 2VNYA 4XG2A 5GZAA 3DBQA 1OL5A 1ZRZA 2BDWA 5E8ZA 4RLLA 2XIKA 2ETKA 2ITWA 2X9EA 4FIGA 4L46A 3TIZA 3CGOA 3IOPA 4DF3A 3FZ1A 4WIHA 2YFXA 1WBTA 2F2CB 5IUIA 4FL3A 3H30A 3GQLA 4JIKA 4D4YA 1OMWA 3F5XA 3O17A 4KIKB 3SXFA 2RFSA 3E64A 2IO6A 4C59A 3BQRA 3BX5A 2ZDTA 3SW4A 1J3HA 4FKOA 1BX6A 4FKUA 4FSZA 4ZLZA 2GTNA 4F7LA 4FUYA 3RK7A 2B7AA 4C3RA 5JFSA 4I0RA 4O27B 3NVMB 1J7IA 5M06A 4U6RA 4GKIA 3GU5A 4NK9A 3NUNA 4IJ9A 4ACCA 2G15A 3SAYA 3GCVA 3NNVA 5TF9A 3TKUA 5AAGA 4X3FA 2PPQA 5K4IA 2A19B 5M53A 3W2OA 3R28A 3LKMA 4FYNA 2GQGA 1MQBA 2R2PA 3PJ8A 3IGOA 4L01A 4NIFA 4UEUA 3H9OA 3FLYA 1NVRA 4BF2A 5CASA 2ITZA 2REIA 1M7QA 3HRFA 3AMAA 3PA3A 3UPZA 5M4UA 3PY3A 1HCLA 1PXOA 5FBOA 1PXPA 3VF9A 3ZLWA 4GW8A 4CZUA 3ZM9A 3U6HA 4A9TA 3ZLYA 4AWIA 4EUTA 3ATSA 4IAZA 4TYHB 4LGGA 4EK3A 4NL0A 2QOLA 4WA9A 4FV6A 1K3AA 3FMMA 4RRVA 3TKIA 4DFZE 1G3NA 3I5ZA 4ACMA 4AW0A 5CQUA 2V5QA 4W8DA 3EZRA 4F1MA 5CAVA 4ZSAA 4DA5A 3CTQA 4OT5A 5HE0A 3ENMA 4W4YA 2ITXA 1YRPA 5HEZA 3QCQA 3FLSA 4G5JA 5L3AA 3LM0A 4E20A 1YXXA 5EK7A 5EW3A 4RG0A 3RNIA 2C3IB 3BGZA 3C0GA 3LW0A 2EXEA 4ITJA 4RWJA 1YWNA 4O0UA 2JAVA 4OBPA 5KE0A 4QQJA 1URCA 1IA9A 2BDFA 3I0QA 4CQEA 5HQ0A 3TEIA 3EQRA 3MGYA 4PF4A 1SNXA 3HA6A 2P55A 3HV3A 5CNNA 5AR7A 3PE1A 4JNWA 3ULIA 3S0OA 3VS6A 4BTKA 1J7UA 3KXGA 2Y8OA 3TNHA 4RPVA 3HV7A 4K2RA 3LFCA 3OG7A 3R7VA 4EK8A 3KKVA 4O0SA 4P7EA 3TIYA 3K5VA 3ZRLA 4NUSA 3E63A 2ZM1A 3UYSA 3V5TA 4CEGA 5HE3A 2BAKA 3KK8A 2ZV8A 3MA3A 3ORNA 4BHNA 2J4ZA 2NRUA 5DEYA 2JKMA 3N4UA 5EQEA 4FMQA 5LCJA 3SRVB 4EHVA 1OM1A 2WU7A 3PSBA 3UGCA 3VHKA 3P4KA 4UXQA 5J7HA 4IQ6A 4AAAA 3BV2A 4IC8A 1PRYA 3U55A 2A0CX 2VRXA 2R3OA 3AC2A 3ULZA 3R7GA 3EQPA 3MH2A 4DHFA 4FEUA 3OWJA 3T3UA 3KCFA 5JZJA 2R5TA 4E5WA 4CLJA 1H07A 4QP8A 5L2TA 3AXWA 2VTQA 3OXTA 3V5QA 3W1FA 2XRWA 3HP2A 4UMTA 4M7IA 4H36A 4APPA 2ITVA 2R3NA 5DFPA 4IE9A 2F7XE 3COMA 1UKIA 1W7HA 2BTSA 3UC4A 5JFXA 1PXNA 5L8LA 4O7YA 1H1SA 1IASA 1PXLA 1OPLA 3KF4A 4HZSA 2WMUA 3R2BA 5HCZA 5TT7A 2FB8A 2GS7A 5CANA 5ETIA 4RWIA 3LLAA 2VTNA 2WTJA 4JX7A 4O0TA 3UP7A 3LQ5A 5BYYA 2CNQA 3BGPA 3Q52A 1ZY4A 3QQGA 1F0QA 2PZRA 3DNEA 4LV5A 3UODA 2G1TA 4PMPA 3BQCA 4EH2A 2E9PA 3OCSA 1SM2A 4RVTA 5H8BA 1YXTA 5IA1A 3BBWA 2AC5A 2DQ7X 2GU8A 2YCQA 4J96A 3DKGA 3RWPA 2QURA 1J1BA 2WKMA 2FSTX 1YWRA 2YIXA 4FKGA 4IBMA 4MQ1A 4MF1A 1CMKE 1PMUA 2ONLA 3VS3A 4AF3A 4YO4A 3JR1A 1Q97A 2PE1A 3QRUA 4OBOA 4EOQA 5KX8A 3D5XA 4H3QA 3ZOSA 3OTVA 4FSTA 5I9XA 4AFEA 3DNDA 4RZWA 3CQUA 5C8KA 4FNWA 2YIYA 3UOJA 4PUZA 5CY3A 5DT4A 2AYPA 3NWWA 4E93A 4KABA 5A4CA 3ODZX 5A4EA 3HV5A 3O8PA 4U80A 2PVMA 1PKGA 3TV6A 3TTJA 3L8PA 5I9UA 4K6ZA 3RZFA 4ORKA 4U8ZA 5DPVA 2C68A 3EZVA 3UIMA 3ZSGA 2CGVA 5M4IA 1WBWA 3BU6A 5EI2A 3FI4A 3MTFA 1EH4A 4ANLA 2X6DA 3AC4A 2WMTA 5E1SA 4TXCA 3VS5A 2X8EA 4HYHA 5EHYA 3VJNA 3A62A 4EOJA 3CIKA 3KN5A 4DBNA 3TG1A 3ZDUA 3AMYA 3KXXA 2NPQA 3VC4A 3L8SA 4F1OA 2X2KA 2YIQA 4D58A 3LFQA 1AD5A 4DT8A 4O7LA 2O5KA 2OH4A 3O50A 4UY9A 1FOTA 4TW9A 3QTSA 2WO6A 1H26A 4FV8A 5CSPA 1ZZ2A 2Z60A 4NFMA 3R71A 4FKIA 5B7VA 3QQHA 2CKQA 2IVSA 1H28A 4LMUA 5AR3A 2YWVA 4OTPA 3UC3A 2B55A 1OVEA 4FSQA 4MF0A 2YM3A 4EOMA 1V0OA 2X2MA 2JDOA 5CWZA 3AG9A 4LV8A 3VAPA 4L45A 5JGDA 2EU9A 5KMKA 2CKPA 4L9IA 2XF0A 3A7IA 3UDBA 4CKIA 4M8TA 3QCXA 3OXIA 3HUBA 4OTFA 1PXMA 4PL4A 4PQNA 3QU0A 5J1VA 4V05A 2WMXA 3KEXA 2RFDA 5LOHA 4R8QA 1H1QA 1KE9A 3FMNA 4FA2A 4QYGA 4YJTA 2HXLA 3WF7A 4D28A 1H8FA 2J2IB 5GIPE 2IVUA 1Q3WA 3PYYA 4IAYA 1VYZA 4BCGA 3FMJA 2PTKA 4J71A 3CY3A 2QODA 3OBGA 1JVPP 2Y4IB 3B2WA 1IR3A 3NSZA 3PJCA 4G6OA 3W2CA 2C5OA 4FKLA 4IAFA 2PUNA 5CTPA 3S00A 2YM5A 4EH9A 3QHWA 5ANIA 3JY9A 3ERKA 4YZBA 4D4SA 3FLQA 3ENHA 3UYTA 5HVKA 4FKTA 3KRLA 3N51A 4P4CA 3DB8A 4RQKA 3ZRMA 1FBNA 2C6OA 5AV0A 1GZOA 2ZAZA 3NPCA 1ZLTA 3QD0A 4QOXA 5J79A 5LMAA 3IONA 2GFSA 3VJOA 2VGOA 3PA4A 3IW5A 2YDKA 4FNYA 2QOFA 3KULB 3E92A 3NUPA 3TZ9A 2C69A 3BLRA 4BTFA 3DXQA 4DCAA 3ZEWA 2UW7A 5D11A 3KXZA 3ACJA 3AOXA 3HP5A 1UU3A 3D15A 3OHTA 5CS6A 3QGWA 4XLVA 5KKRB 5HZNA 2QQ7A 2ZMCA 3D9VA 1I09A 3GVUA 4UWCA 3S4QA 4M68A 4CFWA 1TKIA 2VWVA 2R3JA 2YLFA 2PU8A 5F4NA 5LARA 4EK5A 5CALA 5E4HA 3IS5A 3PVWA 2X8IA 5I0BA 5AP5A 2R7IA 4U43A 2HW7A 4QQTA 2WNTA 4ZSEA 3FY2A 3EL8A 4BI0A 4HGTA 4Z3VA 3QUPA 4GJ3A 4BGQA 3RWQA 4AW1A 4X0MA 4CYJA 1SYKA 5CVGA 4B6LA 3C4FA 3PFQA 4FTQA 3MPMA 4WSYA 5AX9A 2CGXA 4EWHA 2WQBA 5DWRA 4EYJA 4KB8A 2CPKE 3DKFA 3WE4A 4IZYA 3V8SA 3B8RA 2W4KA 4BGGA 4M3QA 4FIIA 4FF8A 5E8XA 5HOAA 5G1XA 3NUXA 3H9FA 5B0XA 4XBRA 3TNQB 5EW8A 2HCKA 2Y4PA 2OG8A 3O7LD 3DZOA 1BI8A 1KOBA 2EWAA 4EOIA 5IZFA 2HXQA 2VO6A 5HO8A 3IDPA 3NW7A 4AOIA 2W17A 5CLPA 5F1ZA 4IACA 5EKOA 4FEVA 2GQRA 2KTYA 1NVQA 4XG8A 3ZSHA 1JAMA 2O8YA 2PL0A 4O2ZA 4APCA 3LXKA 4MD8E 3Q9WA 4J99A 2JIUA 5B2KA 4LM5A 2BMCA 3A7HA 5IH6A 2XNGA 3C4ZA 4G3FA 3VNTA 2AC3A 1X8BA 5JEBA 1H1WA 3DJ5A 4R3RA 4F65A 3ORLA 3RJCA 3ZRKA 3VS4A 4R78A 3M11A 1KSWA 4FT7A 1SMHA 3G15A 3VS1A 5EQYA 3NIZA 2VN9A 5J95A 4QP2A 2F4JA 1GIHA 5CSWA 3WZKA 4M15A 5M4FA 1IAHA 4BC6A 4D2RA 5KCVA 3U6JA 3F88A 4IZ5A 3SC1A 4BCMA 3ITZA 5G6VA 3ZO4A 2WMQA 4FNXA 4W4WA 1Z5MA 4RIWA 4CKRA 1DM2A 1NW1A 3VBVA 2B53A 4M0YA 4E6DA 5BUIA 1AGWA 5C27A 5KHXA 2ZB1A 4R5YA 5EQPA 4CT1A 1MRVA 3R8LA 2LGCA 5DRDA 3P08A 4IFCA 1Q5KA 2XKEA 3G5DA 5J1WA 3M42A 3MVMA 3A61A 3F2RA 4IVAA 3GUBA 4QO9A 2EXCX 2Y4IC 3Q4UA 4FT0A 1K2PA 3D7TA 4AT3A 4M97A 5EDQA 2QG5A 4DEDA 5HESA 4BWKA 4TWOA 2FH9A 2XNMA 1WVYA 1OIQA 4K1BA 5KZIA 2C6DA 4C02A 3LQ3A 3BU3A 3D2IA 3FMHA 4NCTC 3ZBXA 5K9IA 4RVKA 3W33A 2VTOA 3OF0A 2C6LA 3H0YA 1DAYA 2PVKA 4RC3A 2YM8A 4K33A 5CQWA 2VX3A 3DDPA 3I4BA 3F69A 1JKLA 4NEUA 4R1YA 5I9WA 1R0EA 4MXYA 4CRLA 3I60A 1JLUE 3ORIA 1ZWSA 1MRUA 3BYMA 5IMXA 3NRMA 3ZYAA 1G8SA 5EKNA 4YGAA 4Y95A 3LCKA 4ANBA 3KY2A 4QQ5A 4U3YA 3UE4A 4DLJA 5KKRC 3PXFA 5BYZA 3AD4A 4ZTSA 2OI4X 3S95A 3TNWA 5E7RA 4FC0A 4ANOA 4CXAA 3FXXA 4DINA 4F7JA 5KBRA 3HEGA 3Q4ZA 3KXMA 4JAJA 4PTGA 5EM8A 2W1FA 2UV2A 3TM0A 4X2NA 3NAXA 2JITA 5CT0A 2X6EA 1OIUA 2I40A 4EOPA 3OY1A 3QC9A 3UQCA 4NTTA 4FSWA 1OPKA 4ALWA 3WYXA 2EB2A 3DY7A 2UZWE 4DYMA 2C6MA 2FSOX 2ITNA 3A7GA 3K3IA 4MEDA 4ZOGA 1U59A 2BRBA 2OFVA 5AP7A 3RCJA 4C58A 4EKKA 2WMVA 4C3PA 5CZIA 4RWLA 4BDIA 4LL0A 4IX4A 5FEQA 1QMZA 5BNJA 3IG7A 3HGKA 4I3ZA 1FGKA 1PXIA 1V1KA 1GY3A 4L68A 5EM6A 3R73A 1PF8A 4WNKA 3CPBA 4YTIA 2B1PA 3NYOA 4BCJA 5LWNA 3PJ3A 3PXYA 4QP7A 3WIGA 1U46A 2C1AA 5FEEA 3A60A 1UNHA 4FZ6A 4LRJA 3C5UA 2JBOA 4HGLA 4W9WA 1WBPA 4OTHA 3WZDA 2C0OA 2YZLA 2JD5A 4DTAA 3DV3A 2OJJA 5HX8A 5C01A 1WBOA 3HX4A 4JOAA 2Z7QA 3C13A 5AIKA 4F99A 5HLPA 4FIHA 4K11A 4TN6A 5E8TA 1U54A 3RM6A 1Q8UA 3TNIA 4A9YA 4MTAA 2C3JA 5AR2A 4BDJA 2ETMA 3MS9A 4DGMA 4WUNA 3LFEA 3UVRA 4CTBA 2J0LA 4NW5A 1XH6A 2HIWA 4Y8DA 5EYKA 3R8MA 4WBBB 3B2TA 3GXLA 3C51A 4FZ7A 5IQIA 4BCNA 3EFWA 1CKPA 3EOCA 5AP0A 3GQIA 2FSLX 4RX8A 4TPTA 3SV0A 2OSCA 4EZ3A 5KMMA 2UZLA 4N70A 2Z7SA 4CYIA 4HZRA 3BYOA 2BUJA 3P79A 3DAEA 2CGUA 4EOKA 3VBTA 1KUTA 4J97A 3TTIA 2WU6A 2J51A 5TO8A 4BKZA 4O7RA 4R77A 4YC3A 1H27A 2HYYA 3ETAA 3I7CA 4GL9A 3V5WA 4EQUA 2NO3A 5E9EA 5AUTA 2IZUA 2IWIA 3MW1A 4O6LA 3Q6UA 4BFMA 1QPEA 5A54A 3SDJA 5C8MA 2ZMDA 3E7VA 4O22A 4BI2A 3LJ2A 4R5SA 2CN5A 4YHTA 4BTMA 3ZC5A 2YIWA 4FV4A 4JJRA 3ZUUA 2Q0NA 2HY81 2EUFB 2G9XA 2ZV7A 1ZOGA 4GT3A 5TE0A 3AT2A 3ORPA 4CQGA 5I5ZA 4O82A 3FLNC 5CI7A 5KZ0A 4AE6A 2VTAA 3BI6A 3JUHA 3R9DA 3VBQA 2PZ5A 3W55A 4FV7A 3VW6A 3DKOA 3RAHA 3BEGA 4Y46A 1YXVA 2WMSA 5IDNA 1PYXA 2GNLA 3Q2JA 1XKKA 4QMMA 4XX9A 1OECA 3P23A 5B2LA 1Y6BA 1JSUA 3Q4TA 3LCOA 4ZSLA 3PUPA 4WKQA 4DFNA 3F2AA 3TJCA 1P4OA 4IH8A 4KINA 5ITAA 2CCIA 1PY5A 3LXNA 3Q60A 5HO7A 3R6XA 2HZIA 2UW3A 3FPMA 4IAAA 4U45A 3FLWA 2W5HA 4DC2A 1NXKA 4U7ZA 3NDMA 4CFVA 3KREA 4UX9A 1YXSA 1BUHA 4ZEGA 4QP3A 5FM2A 2XBJA 4AW5A 3DK6A 1Q99A 1YHSA 1WFCA 4NWMA 4L6QA 1YDTE 5EG3A 3LLTA 4S2ZA 3KXHA 3ZUVA 3WZJA 4YMJA 3G9NA 4G9CA 4ERWA 1OITA 1K9AA 4IFGA 3F3VA 4HPUE 3KGAA 2PMIA 3JY0A 4IX5A 4KA3A 3SOCA 3UTOA 5HGIA 4F7SA 5HTCA 4MX9A 4FZDB 1YDSE 4M12A 5K3YA 4I5PA 3DFAA 5HBJA 1QL6A 2W1CA 5B2MA 2ZYBA 2WB8A 4K77A 1OL7A 4LG4A 3ACKA 1PXKA 4IB5A 2IVTA 2R4BA 3GEQA 3EQBA 1Z9XA 1YOJA 4WG5A 5HNGA 4W4XA 4EL9A 5HHWA 3RPOA 4X2FA 4AS0A 3OOGA 4KIOA 1Y57A 4I21A 3R7YA 4AACA 3FJQE 3JYAA 2I6LA 4EBWA 4RJ3A 5HVJA 4EHGA 4JDKA 4II5A 4YO6A 3LMHA 4MXXA 2VWIA 3LFDA 2UZBA 4FVQA 2XM8A 3CD8A 4FI1A 3R21A 4QRCA 4BHZA 4CMTA 2YDIA 5EDPA 1FMOE 3Q04A 1M2RA 4AGUA 3FZRA 4O1OA 3DS6A 2NP8A 4JDJA 4DH3A 5J8IA 4ZY5A 5C26A 3SX9A 4A4OA 4ACGA 5M57A 3M1SA 2CMWA 4MWIA 2XK9A 3QA8A 5GHVA 3SD0A 2UZNA 4IWQA 3RBWA 2P0CA 3QCYA 5CU0A 2UW8A 4FV9A 3Q9YA 2QLQA 3R8PA 3N4VA 5IQBA 4W4VA 5EOLA 1XBBA 3VS2A 3DK3A 2J0KA 2XK6A 4O84A 3OMVA 4WHZA 3V04A 5EM5A 4XV9A 2C6KA 4AE9A 4BCKA 3RP9A 5M56A 3FEGA 5CEPA 2BZKB 5J5TA 5J9YA 3O8TA 1Q8WA 3G0EA 2R3IA 3CR0A 3R30A 5L8JA 4ANMA 2HZ4A 3F7ZA 2YERA 3FZSA 5FXSA 1M2QA 3QD4A 3E93A 1GIIA 4XLIA 3E3PA 3DDQA 3QTWA 4JXFA 3JXWA 3P1AA 2BIKB 2YCRA 5CAQA 4P5ZA 4CT2A 4K9YA 4TYEA 3KVWA 3KRJA 1JKSA 4PY1A 3SXSA 2BAJA 2YIRA 3IW7A 4YJVA 5JH6A 4MNEA 4X3JA 3R1NA 4CRSA 4QTDA 2SRCA 4OTDA 5CSVA 5CAOA 2PUPA 5AR8A 4A06A 4B8LA 4YTFA 5AJQA 3RPRA 2VX0A 5HTBA 1IA8A 4QTCA 2IJMA 2YM7A 2F7ZE 2VNWA 3ET7A 3GC7A 2QOQA 3MVHA 2B9FA 5CEQA 3RCDA 3SVVA 4LRMA 2CN8A 1UA2A 3E3BX 4XYFA 1DI9A 4IZ7A 2O0UA 5JFVA 3TNPC 2R3RA 4RIYB 3RINA 3WBLA 5CXZA 2OU7A 2DUVA 3D5WA 3NVKI 3PIYA 4R7IA 3F5UA 5E91A 4DGLC 5DOSA 4QNYA 5JGAA 2XNOA 2WZJA 3FL5A 3UG2A 4BIBA 4CZYB 3SG9A 1DI8A 3PJ1A 1UWHA 4MK0A 5K5XA 4TWCA 2UZEA 4U41A 4QTAA 5AP6A 1Q62A 4PWNA 4AT4A 4BBFA 1BKXA 5IQFA 4WRGA 1L8TA 5FTQA 4HW7A 3D7ZA 4PPBA 4JRNA 2GTMA 3VVHA 5E8VA 4I24A 3G2FA 4DCEA 3F5GA 2R3PA 3ZSIA 2YITA 4GG7A 2Y0AA 4RJ4A 5DYJA 3F61A 4XJ0A 4F9YA 1I44A 1VZOA 2CLXA 4C0TA 3KRWA 5DR9A 4NSTA 4ALVA 5HIEA 5M4CA 4FBXA 5FTOA 2GHLA 4GEOA 4D55A 3LIJA 1DAWA 4YJOA 4AX8A 3L9NA 2QOBA 3HL7A 3PPJA 3TV7A 3I79A 1R39A 4UMRA 3I6WA 3K3JA 2GMXA 4QP6A 3LXPA 5JRQA 5LVOA 4MBJA 2XUUA 5C8NA 4B0GA 4O0YA 4AN2A 2CCHA 3BBTB 4GVJA 4U9AA 5M51A 3FPQA 4DITA 5T3QA 2PZIA 3HDMA 4FV5A 3UVQA 4O0WA 1ZMUA 2UZTA 4FKWA 2VWZA 3CP9A 3QC4A 2OIDA 2W1DA 4EUUA 3BIZA 3PSCA 2NRYA 3FZOA 1O6KA 3COIA 4FT5A 5FP5A 4AZVA 4RFZA 3Q32A 5AM7A 1CKIA 3LFBA 1FINA 3MIAA 4ARKA 4KS7A 3R9NA 2YAAA 2R0UA 5C9CA 4CCUA 5JKGA 3FHRA 3GBZA 4PNIA 3G51A 4BR3A 3E62A 2CNVA 2XK4A 1ZY5A 2W9FB 5H8EA 2C1BA 4LYNA 3R9RA 5LVLA 3QRIA 1UNLA 4TY1A 2J0MB 2ERZE 3VUDA 3FL4A 2XEZA 3MY1A 4KRCA 4BDCA 4QNAA 2BIYA 2FO0A 4GKHA 1PW2A 4UALA 5AUWA 2CKEA 4L42A 4JL9A 1LEZA 4X2GA 2PY3A 1OBGA 4YZ9A 4A07A 2FVDA 5J87A 2YAKA 4RA4A 4D2TA 4D2WA 4XEYA 4FGRA 1NVSA 3F7WA 1M52A 1YXUA 4O91A 5FXRA 4H1JA 4AZEA 1UNGA 2QO9A 4XUFA 2VTJA 3I0OA 2H9VA 3KRRA 3Q9ZA 4JR7A 4N0SA 4RZVA 4TYIA 2PMLX 3ROYA 2QG7A 4X3FB 4YPDA 5ETAA 3FV8A 4E7WA 4PPCA 5A6OA 4NIFB 5LQFA 3WZUA 4D0WA 4NZWB 3QLGA 2QKWB 4UB7A 4PDOA 4EK6A 2WD1A 3MH3A 5HD4A 4MBLA 2WTVA 4B9DA 4UMPA 5BVDA 2YCSA 4HOKA 2CGWA 4L53A 4AZWA 4A9RA 5BUJA 4RA5A 4UBAA 3ORTA 3EL7A 3LMIA 2GS6A 3MJ1A 1T45A 3MDYA 4QYHA 3V8WA 4FEWA 4DAWA 3GT8A 4X21A 3PVGA 1J1CA 4I41A 4AA4A 3GC8A 5JSMA 5HLNA 3EQIA 4MAOA 2ZVAA 4O81A 3MH1A 3U8WA 1Z57A 5KMNA 2GHMA 3MFSA 3O51A 2ACXA 3HV6A 4IIRA 1OKVA 5AUYA 5ACKA 4AG8A 4DGOA 5AR4A 5J5SA 3O2MA 3DTCA 4MHAA 2ITQA 3ATTA 4RVLA 2Y7JA 3QAME 3QZIA 4HVGA 4ERKA 1OZ1A 2OIBA 5A4TA 4FL1A 1GNGA 3PXKA 3QQLA 4FTMA 4HCVA 1URWA 4YJNA 3QQFA 2XM9A 3RK9A 2BILB 3A99A 3G0FA 4GT4A 2VD5A 2UVXA 4I92A 3TKHA 4C38A 4KBKA 4EJ7A 1HCKA 3ZHPC 4BWXA 3DOGA 3TV4A 2XIYA 5L6PA 5HIBA 2G01A 3K2LA 3PG1A 4GU9A 3C50A 3BLHA 4CSVA 3R8UA 4IX6A 4BN1A 2PWLA 1TQPA 3C4XA 2OIQA 3Q53A 4BL1A 4GK2A 3EN6A 4U40A 4BBMA 3BPRA 1O6LA 3BLQA 1OKZA 1Q3DA 2RG6A 2GFCA 4NW6A 4F64A 2I0YA 5HO6A 2CKOA 4HPTE 3VS0A 4KBCA 2OXDA 2RSVA 3CD3A 5IQEA 3OCBA 4OTQA 3U54A 4EC8A 4DE4A 1FQ1B 2OZAA 4OAUC 2HY0A 3BHYA 2WTDA 4IZAA 4L67A 3WI6A 2X7OA 3TUDA 4ZMFA 2QCSA 3AC8A 4OTIA 2X4FA 5H8GA 3ZFXA 4YURA 5EOBA 1R1WA 3MFTA 3RAWA 4BDFA 2WGJA 2WTIA 4L00A 4ASZA 2E9OA 4R3PA 3P0MA 3VUGA 4IAKA 5IUHA 2QO7A 3IPHA 1B38A 3VRZA 2X7FA 3BHTA 4NT4A 2WTKB 5JGBA 5D7VA 2IPXA 5I4NA 1ZMVA 4FG8A 3K54A 4XV2A 2WHBA 5AUUA 1GZ8A 1ND4A 4WG4A 3R00A 5GNKA 5A3XA 3VUIA 2GNGA 2HWOA 3CBLA 5CU6A 4QMZA 3QTRA 4ZSJA 1UVRA 3R9OA 2X1NA 2E9NA 4F7NA 3NCGA 2ZJWA 5BVWA 1JNKA 3SLSA 2XZSA 3VRYA 4RJ5A 4TRLA 4PMMA 4YBJA 3UMXA 1OBDA 1IAJA 3W2RA 1VR2A 3IO7A 3I1AA 3U51A 4ZLOA 4J8NA 2W5BA 3GOKA 4EOLA 1Q8TA 4M69A 2JGZA 5AEPA 5HORA 2YM4A 4J8MA 3G9LX 4ZMEA 2XKCA 2Z8CA 4OT6A 4YHFA 3N9XA 2IW9A 5TKDA 5M07A 1OIYA 4DG2E 3VBXA 4NYEA 2Y6MA 3PG3A 4C34A 3NW6A 4RBLA 3IGGA 3KFAA 3P7BA 3F2NA 3ZEPA 1H00A 4CFXA 5GZ9A 5LJJA 4D5HA 2JBPA 3IK3A 4N6ZA 4ZP5A 5E92A 4ID7A 4X3FC 4Q5EA 3NNUA 3NZ0A 4O0VA 3NX8A 3RALA 4E6QA 5K5NA 1KOAA 2C30A 3PIXA 4OW8A 2EB3A 1PXJA 1U4DA 3AGLA 3HZTA 4XRLA 5FXQA 4EI4A 4EK4A 3BYUA 3OWLA 3V5PA 4KBAA 2VTHA 3OVVA 5EM7A 3TDWA 3QZGA 4QMPA 5L2SA 3LZBA 3NNXA 4ANSA 2J5FA 4BDEA 2OK1A 4I5CA 3PSDA 4HVIA 5A46A 2W1ZA 5FP6A 3UO4A 1JOWB 3QXPA 4BCPA 2WTWA 2ZOQA 4ZK5A 4BYIA 3CKWA 2A2AA 3RVGA 4JRVA 5H3QA 4KRDA 3OS3A 2LAVA 4E73A 4LUEA 4F0FA 2XCKA 5AIRA 4DGGA 2HOGA 3IW8A 3EH9A 1W82A 4NFNA 5EW9A 3WF5A 3FE3A 4I94A 2QOKA 3GFEA 4FK6A 4J7BA 4JS8A 4IX3A 4FSUA 5A14A 3C9WA 2DYLA 4RC2A 3R8VA 3D94A 4UXLA 2YLEA 3HLLA 3QKMA 3DQWA 1SVEA 3GC9A 1F5QA 4O7TA 4MBIA 5HE2A 4BDKA 1P2AA 4GG5A 5EI8A 1ZYJA 4UWYA 2IN6A 1UKHA 4DEIA 3OCGA 3RM7A 3O23A 5AAEA 3R9HA 2VWUA 3ELJA 2CSNA 2JKQA 5I3RA 4F08A 3E88A 3EN7A 4NJDA 4RFYA 4W8EA 3UZPA 4GV1A 1FPUA 3DT1A 3QTXA 5DG5A 4FV3A 4EQCA 4CFUA 4O7SA 3PY1A 3PXRA 4G16A 3R01A 4XRJA 5IA5A 4EH3A 3I6UA 4DEAA 4YR8A 3CJFA 1KE7A 4HCUA 4Q9SA 3EQFA 5CU2A 2ITPA 3FQHA 4PPAA 3EN9A 1BL7A 5T6KA 4ZS0A 4MVFA 1Q4LA 4CD0A 4FK3A 4GT5A 4QP1A 1H1RA 5D41A 1W83A 3R83A 5JMSA 2RL5A 5JRSA 4MXOA 3F82A 4EHZA 3G90X 2WEVA 4TT7A 3AT3A 1BYGA 3QYWA 4FL2A 4DEBA 3K5UA 3PY0A 4E4NA 5KHWA 2BDJA 4AN9A 1E1VA 4XP3A 1TQMA 3TZ7A 1Q61A 1Y91A 4BDHA 2WMWA 4FOCA 4O96A 5C1QB 2WTKC 2UW0A 3GCSA 3MI9A 3C0IA 5CX9A 1ZYSA 3L8VA 4D0XA 2GNIA 4QMNA 3PXQA 4WNOA 4FIFA 4N4SA 4BZDA 4DG0E 4EQMA 3QWKA 4JQ7A 3IW4A 1B39A 4GK3A 4GVAA 2X4ZA 3F3ZA 4G1WA 2BZJA 4BKYA 3O96A 4I0SA 2WPAA 4C57A 3BU5A 1R3CA 4IVDA 3QQUA 4HNIA 4FKVA 4OGRA 5HBHA 5TR6A 1FMKA 4XG3A 2OXYA 2JDTA 1UWJA 3NYXA 4QYFA 4BVUA 1FVVA 3CXWA 1OKWA 3FYKX 3QKKA 4JQ8A 4U5JA 4DTKA 4A4XA 3F5PA 3PZEA 4O86A 2BKZA 3T8OA 2ONLC 3BGQA 4NKSA 4HJOA 3MPAA 2VU3A 2F57A 2OICA 4H3PA 5IDPA 5L2IA 2F9GA 4U0IA 2VTIA 4EJNA 4BYJA 5T68A 3Q6WA 2CLQA 2WOUA 3V3VA 4MH7A 1IG1A 4UYAA 2W05A 2XKFA 5E1EA 2OWBA 4PP7A 3JS2A 2B52A 2P2IA 2A1AB 4C2WA 5CVHA 2UZVA 2QHNA 2J5EA 3FZTA 5AP4A 4C4IA 3UZRA 3FQSA 1JKTA 2B9IA 3FYJX 1YI4A 3FSKA 4FTRA 4L43A 3V5LA 4HYIA 5KBQA 2R3QA 5GINE 4BCQA 2XYNA 1UU8A 4N57A 1YDRE 4L3LA 1RE8A 2VO3A 5EDRA 3WF8A 1LPUA 2XVDA 2Q0BA 2HELA 5KMJA 5BVEA 4IB0A 2XJ2A 4PRJA 3A8XA 2GHGA 3DTWA 5E90A 3A2CA 3RPVA 3C1XA 1H08A 3LMGA 3SOAA 5JFWA 1W0XC 3MESA 4O7VA 4YNEA 3GCUA 4S33A 4F9AA 5CF4A 3BWJA 2C5VA 4CNHA 5IQGA 1L3RE 5L2WA 2XK8A 5ETFA 1H24A 2JFMA 3R7EA 3TUCA 4RWKA 4GJ2A 2OBJA 4C61A 4KWPA 1W98A 2RF9A 4BRXA 3II5A 5EYCA 1M2PA 3PDTA 4FUXA 4FTNA 3DBFA 1QPJA 2VTRA 2WOTA 3T9IA 3BHUA 3EFJA 2QC6A 3QALE 4JG8A 4ZJIA 4F9BA 4LFIA 3UNZA 3AC3A 3FQEA 4YC8A 4PDSA 3COHA 1KV1A 2VAGA 4UWBA 4IWPA 4OTRA 3ZTXA 5HLWA 3HRCA 4IADA 1Y6AA 4ZS4A 4F9CA 1XH8A 2V22A 3Q9XA 4MXCA 3MJ2A 2IW6A 4RIWB 3VQUA 3QD2B 2XNBA 2UZDA 5HBEA 3TXOA 4D1XA 1JPAA 4GUEA 3FAAA 3ZM4A 2J7TA 2H8HA 4YP8A 1QPDA 4IJPA 3OCTA 3OW3A 3H0ZA 4RGJA 5IQDA 4FICA 1PKDA 5IPJA 3OXZA 2A4LA 3WE8A 4B7TA 4Z9LA 5FD2A 2ITUA 2GCDA 4CV9A 3WARA 2H34A 3MFUA 4F6WA 2EXMA 2XKDA 3QGYA 3VHEA 4CCBA 2C0IA 5DR6A 4QT1A 3D7TB 3V6SA 5GJFA 3QWJA 1ATPE 2QU6A 3PVUA 3L1SA 3MSSA 5GZ8A 2ZV9A 4RJ8A 1ZAOA 1JSVA 5E8UA 2XCHA 3AC5A 4G31A 4JG7A 5IH4A 1R0PA 2WMRA 5FBNC 4ZTQA 2WQMA 2XEYA 3E5AA 3S2PA 3CTJA 2X81A 3BV3A 4OTGA 4E8AA 3QL8A 3FMKA 3DAJA 4IHPA 2UVZA 2ESMA 5DI1A 2Z7RA 5BX0A 4V0GA 5D7AA 4DN5A 4HGEA 5IUGA 2G2HA 1XR1A 2WXVA 1WBNA 3O71A 3L9LA 5C4KA 4PDPA 3UQGA 4MWHA 3HA8A 4QMUA 5HD7A 3O8UA 4O7NA 5AV2A 3QF9A 2Y6OA 3RNYA 4AZSA 1G5SA 3C7QA 2C3LA 5AP2A 5AMNA 3LFFA 2JIIA 4J95A 2W7XA 4RT7A 2J90A 1E1XA 3OBJA 3A7FA 3VBYA 4DLIA 3ANRA 3GENA 1YOLA 4NKAA 3A8WA 3UNKA 4YJUA 2OJFE 3V6RA 3EIDA 2R3KA 2IZSA 5HIDA 1GAGA 3HVCA 5M08A 4ASDA 5J9LA 4WD5A 4C7TA 2P3GX 3FKOA 3CY2A 3UPXA 5AFVA 4IMYA 2B54A 1WCCA 5F94A 4BZOA 3OD6X 3EN5A 3ODYX 4L3PA 4L7FA 4B99A 3EQDA 4HGSA 3FI8A 4LL5A 4R3CA 1YI6A 1YQJA 3S3IA 3PE2A 4J52A 3ZC6A 4CZTA 1R78A 5AWMA 4WSQA 3DXNA 5CF6A 4D2SA 3HMIA 3AT4A 1YOMA 1ZOEA 2UVYA 3OTUA 1M17A 4TWNA 5FLFA 4AUAA 2QHMA 3IECA 3GNIB 1JKKA 2PVFA 1XHAA 5C03A 4D9UA 4OUCA 3OEZA 2BZHB 2GNHA 3N4TA 4E26A 3FC2A 3GU7A 2C5YA 2BFYA 3IDCA 3UOHA 1ZXEA 3NW5A 4QP4A 1W84A 3CQEA 3DXPA 5AADA 4I1ZA 1OB3A 4XP0A 4PTCA 5AUVA 5HNBA 4QPMA 1OUYA 2C6IA 4YTCA 2G2FA 5CEIA 1U54B 4E6AA 4CGAA 4FV0A 4G6NA 2IVVA 4M14A 3ANQA 3HMMA 2UZOA 1FGIA 2W0JA 3QTQA 3BELA 5ANJA 5ANEA 3RTPA 4ASEA 4ASXA 1M7NA 3PWYA 3SKCA 4R6VA 3WF6A 4BKJA 3LCSA 3PTGA 5CSXA 4QMTA 3NGAA 3UQFA 5EH0A 3VWAA 3U4WA 2BHEA 4FT9A 3FY0A 4ZSGA 2P4IA 2R9SA 3W8LA 5IA4A 1STCE 1YKRA 2C0TA 4YLKA 4DG3E 4WT6A 2JLDA 4F09A 5FUTA 1BLXA 3FLZA 4FEQA 4YZMA 2GS2A 3F3TA 5HU3A 3IDBA 4CTCA 3OOMA 2C3KA 4C2VA 4XP2A 4IDVA 3WYYA 5CF5A 1YW2A 3I7BA 3Q3BA 4IW0A 5DEWA 3H4JA 4RIXA 3ZLSA 1MUOA 5IISA 2R3FA 4YZNA 4YNOA 2QO2A 2ITYA 4JBVA 1NA7A 3D2KA 5EI6A 4C4GA 2QR8A 5H2UA 4USDA 4AXAA 3M2WA 3D14A 4ACHA 2CNUA 4H3BA 2C4GA 1P14A 3FDNA 3BRBA 4YJPA 3ORKA 4X7QA 3FXWA 5A4LA 4YSJA 2O63A 3A4PA 4J53A 4FIJA 1KV2A 4DH5A 3MVLA 2R3HA 4QYEA 4D5KA 5CEMA 5IEVA 3DAKA 5CXHA 4Y83A 3SA0A 1F3MC 3MH0A 2OKRA 5JK3A 4CG8A 3KN6A 3SG8A 4BBEA 3MVJA 4UYNA 4IWDA 4QP9A 4RMZA 3GU4A 4C35A 4NJ3A 3OT3A 3P7CA 4IM0A 4HNFA 2O65A 2OH0E 4JQEA 3CLYA 4AP7A 2QOCA 4TYHA 3NMUF 3LQ8A 3PP1A 4QD6A 1JBPE 3LPBA 3UO6A 5F9EA 3FMDA 3WIKA 1Q8ZA 3DA6A 1KE8A 1SVGA 3NNWA 4PL5A 1GOLA 3LJ0A 4UZDA 5D12A 3UJGA 1OKYA 3KVXA 4ENXA 3MV5A 5CENA 1BMKA 2UUEA 5IH5A 3HNGA 4FOBA 4EH8A 1V0PA 4FTUA 3EWHA 2W99B 1JWHA 4QPAA 5HKMA 3RPYA 1J7LA 2WMBA 4QMOA 5GJDA 1UU7A 5CVFA 4U81A 3W2QA 2O2UA 2W1HA 4X6RA 1B6CB 1XBAA 4OLIA 1T46A 3ALNA 2GPHA 5EYDA 2PMOX 3OFMA 4YJRA 1PHKA 3EQGA 4GFMA 3EKNA 3QRTA 4FTAA 1JSTA 2BCJA 4I6BA 5HICA 4F63A 4MNFA 3QTUA 4B8MA 5A9UA 5CAUA 3IOKA 2XNEA 3F9NA 4S31A 2B0QA 4I5MA 4YU2A 2YCFA 2YACA 2XBAA 4LI5A 5AV1A 3R7OA 4XNEA 2J9MA 3BWFA 3LFAA 4P2KA 4D4VA 4RIXB 4U44A 2BTRA 3PA5A 4FV1A 2OW3A 1Y8GA 3SRVA 5CSHA 4H39A 4S34A 4CFFA 2Y9QA 4KKHA 5CU4A 4IANA 2QOHA 4ZZMA 3ID6C 4M13A 3MY0A 4LGHA 2W1GA 2J6MA 1BL6A 5IA3A 3AC1A 4Y85A 4YZDA 3TWJA 3ZZEA 3QQKA 4Z16A 2VTMA 2VZ6A 3FXZA 1GZKA 2BRMA 3EKKA 2PE2A 5BMMA 3AMBA 2CJMA 1LR4A 4ANNA 2C47A 5IQCA 4RX5A 4QTEA 4FTIA 2XK7A 4GMYA 4UZHA 2E9UA 5A6NA 3VUMA 2W06A 3DPKA 5EYMA 3TACA 3RPSA 2B9HA 4FZFB 4JAIA 4EZ5A 4CMUA 3FKLA 4AGCA 3TN8A 3E8DA 3ORZA 3TJDA 5BQ0A 4Z7GA 3Q5ZA 4TNDA 4RX7A 2UW5A 2PVJA 4I6FA 4WG3A 3CE3A 5FDXA 4AFJA 4C4EA 4EWQA 2XIRA 5L6OA 5IQHA 3GC0A 3R7UA 4WNPA 2YHVA 3PIZA 2QVSE 1OGUA 2OJ9A 4DTBA 1ZYLA 3UMWA 4ZZOA 3KC3A 4EOOA 3DKCA 4FV2A 5ANKA 4AA0A 2XB7A 5ANOA 4CMOA 4DEHA 3UNJA 3VN9A 4C4FA 4KD1A 2F7EE 2HW6A 4WUAA 3A4OX 5CU3A 3QYZA 4RJ6A 5J7BA 4FG7A 1A48A 5AM6A 4JI9A 5LMBA 3W10A 5AA9A 3U6IA 4KSQA 4C4HA 5FRIA 3RGFA 4MNEB 3WF9A 5CEOA 5JN2A 3GFWA 3MIYA 4USEA 3BHVA 3VBWA 2PVHA 2V7AA 3FWQA 4IAIA 2BPMA 1OIRA 3ALOA 3HUCA 5ETCA 4I23A 2XH5A 5ANGA 3DBCA 3W32A 3SQQA 1PMEA 4BCFA 2KULA 2R7BA 3L8XA 3EFLA 4FTJA 3ZMMA 3LFSA 4KSPA 2O3PA 3L9MA 3W2PA 5KMOA 5HU9A 4F1TA 4ENYA 5IA0A 3MY5A 3GB2A 2VUWA 3LE6A 1QPCA 3POOA 3ZBFA 4DT9A 3LCTA 3H3CA 3PLSA 2XIZA 4GH2A 4XG6A 2UW9A 4F6SA 5AV4A 3HMOA 3GGFA 2P33A 1Q8YA 4FE2A 2QKRA 3P86A 3NR9A 3R1YA 4NU1A 2YA9A 3CGFA 4GYIA 2RIOA 3POZA 3ZH8A 1OL1A 3ZO2A 5AP1A 4E4LA 3BKBA 3OEFX 3VIDA 1CTPE 4AU8A 4V01A 3F3WA 2DS1A 4FTTA 3WOWA 5HG5A 3HV4A 3R1SA 5CYIA 5HE1A 1PJKA 5BVKA 5L6WL 5LVPA 3OUNB 3KMUA 2J0IA 1PMNA 5AA8A 4DH8A 4ZZNA 2W1IA 2XIXA 4EONA 4TNBA 3OW4A 5IEXA 4GYGA 4IEBA 3CPCA 2I0VA 3IW6A 5AAFA 3QZFA 3UIBA 4Z55A 4D1ZA 3SW7A 1YVJA 3OROA 5L2QA 2YJRA 4G5PA 3V51A 4EKLA 4NH1A 5D1JA 4BB4A 3LM5A 2XYUA 5E8SA 4RLKA 4IC7A 2EVAA 4Q9ZA 4O7ZA 3OC1A 4G17A 3LOKA 4ZTLA 4MXAA 2CDZA 4YTHA 5EFQA 4MD7E 3ZCLA 4PMSA 2XRUA 4BCIA 1ZZLA 3NS9A 4EH5A 2W5AA 4CKJA 5IMEA 2B9JA 2BZIB 4X2JA 5HG7A 4M84A 3VO3A 4MXZA 4YJQA 4F0IA 3S1HA 2OF2A 3NUAA 3C4WA 3JPVA 4GUBA 4YJSA 3IQ7A 4ITIA 5IQAA 3P7AA 5EHLA 3NYNA 3F6XA 3I81A 4EYMA 4C62A 5CAPA 4FX3A 1J91A 5BVOA 4PV0A 3ZXZA 3ZXTA 4NCTA 4GIIA 4PX6A 4Q2AA 3NUUA 2PUIA 4HYSA 3RHXA 1WBVA 4GRBA 3DBDA 5HCYA 2VWYA 3FMLA 3TZMA 4RJ7A 4Y5QA 2C6TA 5L8KA 1LEWA 3DCVA 5DH3A 2PUUA 3KULA 5KO1A 2JDRA 4L52A 3THBA 4AGDA 4LGDA 1H0VA 1NT2A 3U9CA 3W8QA 4C4JA 4FKPA 4QQCA 3VF8A 4DFXE 3I5NA 4OAVB 2ETRA 3ZO1A 3COKA 5IA2A 4GFOA 4MKCA 4LRKA 3QRKA 2WIPA 5DVRA 2R3MA 2IZRA 4A7CA 4DGNA 5FWKK 2BALA 5I3OA 3D83A 3BHHA 4BI1A 3KL8A 3EJ1A 5ICPA 4BTJA 4EH4A 1GZNA 4TYJA 2X7GA 2YZAA 3QXOA 3R22A 3UBDA 4JVGA 4AOTA 3RZBA 5CZHA 5KMIA 3PPZA 1CM8A 2VTTA 3LVPA 5AP3A 2VO7A 2GNJA 3OWPA 4L8MA 4YPSA 2OFUA 3G6GA 1AQ1A 3B8QA 1O9UA 3JVRA 1RJBA 2QU5A 3OP5A 1RQQA 1DS5A 5DN3A 2W4JA 5DR2A 3MWUA 5BVNA 4G34A 2R64A 5GIOE 5KNJA 4WOVA 4MD9E 3PPKA 3KMWA 3ZO3A 4USFA 4H58A 4FR4A 3R02A 1APME 4LOPA 3O7LB 2VWBA 4F4PA 3ZONA 2XMYA 3AD5A 5JZNA 3PLAE 3EHAA 5E8WA 1KWPA 3R8ZA 5CNOA 5K0XA 2HWPA 3OUKA 4JX3A 4KKGA 2BRNA 3MB6A 4ZIMA 2BKKA 4OR5A 1LUFA 2VTPA 2ZDUA 4KIPA 4FEXA 4IXPA 4YLJA 5FDPA 3CC6A 3GOPA 5IU2A 4D9TA 4GCJA 2WELA 5BPYA 3T9TA 2GDOA 4JG6A 3TCPA 1M14A 2HZ0A 2JFLA 3SHEA 3HAVA 3FHIA 1HOWA 4D2PA 2X9FA 3DB6A 3Q5IA 4RVMA 3QTZA 3QD3A 2PSQA 3G6HA 1W8CA 3PRFA 5FEDA 3LXLA 5AUXA 2JIVA 4AT5A 4RQVA 3D0EA 1YI3A 2OXXA 1OL6A 3DU8A 3PVBA 5FGKA 4DFBA 4V04A 4WO5A 3HRBA 4DEEA 3GI3A 2YM6A 2PHKA 4I93A 3U9NA 5KUPA 4H05A 2I0EA 3GU8A 3PWDA 2FUMA 2OZAB 4Z7HA 4AN3A 1MRYA 4MYGA 4XG4A 4E1ZA 3QX2A 1OPJA 2RFEA 3VUTA 4YSMA 2V0DA 1WBSA 1XH7A 2QD9A 2HK5A 3NUSA 2V62A 4EHEA 4R1VA 3QBNA 2IG7A 4QYYA 2ZB0A 3DBEA 4C3FA 4J1RA 2WQOA 3HYHA 4XH6A 5HVYA 2R3GA 4WBOA 4E4XA 1KE5A 4G9RA 4IDTA 4ACDA 4BDAA 2PVRA 3E8NA 5DBXA 4O1PA 3CTHA 5LVMA 4CFNA 3QUEA 3KA0A 4O83A 5LCKA 3F3UA 4DH1A 4X6QC 4BCOA 3NUYA 2BHHA 4AQCA 5HI2A 4ZJJA 3VULA 2WQNA 4Q5HA 2F49A 4OTWA 3ZUTA 4PNKA 2C5NA 2PE0A 4ALUA 3DLZA 4P90A 3WILA 3E8CA 1CDKA 5L4QA 4FKSA 1XH4A 4ANQA 2FA2A 3FUPA 5LMKA 4U79A 4ZTNA 3MTLA 4M69B 3BYSA 4E5AX 2ZM3A 3RHKA 4CV8A 5KMLA 5M44A 1OI9A 4O21A 3AQVA 1ZMWA 3MYGA 3ZFYA 3HMPA 1H0WA 3ORXA 4FTCA 2QOIA 3C4EA 3QLFA 4O0XA 4ZJVA 2ZV2A 4E4MA 4EOSA 4C33A 2GNFA 3DK7A 2J0JA 2DWBA 1JQHA 1S9IA 3V5JA 2W4OA 4FTKA 4CG9A 2BR1A 3HDNA 4G6LA 4C8BA 2RKUA 4CFMA 2QONA 3P5KA 3Q2MA 3RAIA 1H25A 4LOQA 2OO8X 2VX1A 2OF4A 3MBLA 1ZYDA 3QX4A
chains in the Genus database with same CATH superfamily
3E7OA 4FYOA 2PMNX 3TL8A 4XBUA 4QMVA 2H96A 2RFNA 4BDDA 5DMZA 4F78A 3KRXA 5FG8A 4FODA 4BCHA 2BAQA 3TZ8A 3KCKA 2QNJA 4Y73A 4I6QA 1RDQE 4AA5A 4XV3A 4IM3A 2HENA 2UW6A 4HVHA 4EORA 2QLUA 1YHWA 3DJ6A 3MFRA 5DT0A 1V0BA 3C0HA 3EMGA 2FSMX 3ZZWA 3E87A 2PVYA 2YEXA 3T3VA 2E2BA 5HX6A 5ANDA 4ZTMA 4QPSA 4BIDA 3QUDA 2BROA 2QI8A 1A06A 4HYUA 1VEBA 2R3LA 4R7HA 4C37A 3BZ3A 2JAMA 5DIAA 5JT2A 1YHVA 3R0TA 5F95A 2QR7A 4I4EA 4CLIA 2VGPA 2PK9A 4KNBA 2PVLA 4XOZA 3R7IA 2PZYA 3FZPA 3PJ2A 2XAMA 3GP0A 1WAKA 3MA6A 1SVHA 5HCXA 2P2HA 3DLSA 4MQ2A 3PZHA 3R63A 2PVNA 2UZUE 4X2KA 4R7BA 4FTLA 5K4JA 5C4LA 3QTIA 3EYGA 3RMFA 2E9VA 4J98A 3TI1A 5AX3A 4AZTA 4BWPA 3UZTA 5JQ8A 4QMXA 3CEKA 5E8YA 4EEVA 2FGIA 3E8EA 2VTLA 2RGPA 3F66A 3LFNA 2ITTA 3BYVA 4IB1A 4ZLYA 5HNIX 2G2IA 3MN3A 4YC6A 3OZ6A 1H4LA 4TZRA 3EYHA 4IB3A 4PTEA 3LJ1A 4XG9A 4DEGA 4HVSA 2BVAA 2Z02A 5BVFA 1ERKA 5DE2A 3CCNA 3NLBA 4ITHA 4E5BA 3TDVA 4LOOA 5HG9A 4FVPA 4NM7A 5H9BA 3W16A 3TT0A 3DFCB 4DFYA 4ZY4A 4LUDA 1IEPA 3ORMA 5BYLA 3OY3A 4GU6A 3VUKA 4G3GA 2ITOA 3HMNA 4M66A 5DA3A 3G33A 1XBCA 3QKLA 2RG5A 3BE9A 3ZLXA 2JKKA 4F9WA 1MP8A 3R2YA 4I20A 1OUKA 5EHOA 4FSNA 4BZNA 3VUHA 3QZHA 3D5VA 5DGZA 5CF8A 5LVNA 3C4CA 4O6EA 5JQ5A 2ERKA 3FI3A 3RI1A 4FSMA 1SZMA 4FNZA 3UP2A 4P5QA 4ZXTA 4UN0C 4UV0A 3FSFA 1O6YA 4KIQA 1XJDA 1XH9A 3P5JC 2IEWA 1U5QA 1CSNA 2X39A 3MPTA 4FKRA 4GIHA 3V01A 4F6UA 3UIXA 4YLLA 3QHRA 4YZCA 2WIHA 4RX9A 2GSFA 3R1QA 1QCFA 3GCQA 4BICA 4XV1A 1BI7A 2GQSA 1S9JA 4XG7A 5DRBA 2F2UA 1KE6A 1XO2B 4PP9A 4DH7A 4JIAA 5AV3A 2XP2A 4DBXA 4NM5A 4LQMA 4TTHB 2AUHA 1GIJA 2UW4A 2VWXA 4FZAB 3RKBA 4F70A 4C36A 2HAKA 3H10A 5M55A 1TVOA 1CKJA 4FVRA 3VS7A 4B4LA 2BRHA 5A4QA 4G3CA 2JC6A 2WFYA 2VWWA 3ZU7A 4E3CA 4TL0A 5DLSA 3DJ7A 4I5HA 3BEAA 4GSBA 3QCSA 5K0KA 5LWMA 1U5RA 2IW8A 3C5IA 3GU6A 5D9HA 5F20A 3UG1A 1TQIA 3MB7A 2CHLA 4K0YA 2Q83A 3EFKA 4M67A 1P4FA 4I0TA 1WVXA 2XNPA 4FTOA 5IG1A 4JLCA 2PYWA 4DDIA 4G3DA 4I6HA 4I4FA 4D4RA 3DGKA 3PXZA 3NEWA 4JBPA 1XWSA 3HKOA 1FVTA 5M09A 1XQZA 2OLCA 2XJ1A 2XNNA 3EQCA 3P78A 4M0ZA 1PYEA 4XMOA 3FKNA 3NIEA 3NAYA 3QQJA 4U97A 4D1SA 5BMSA 5I9VA 3Q96A 2WEIA 2YDJA 3CSVA 4Y5HA 5I9YA 2JEDA 2Z2WA 2X2LA 3FC1X 2YISA 2XS0A 4O0RA 4O2PA 3U4UA 1Q41A 3O0GA 4I6LA 4I22A 1RW8A 4EH7A 2VV9A 4U42A 4AZFA 5ACBC 3JVSA 4PMTA 1REKA 3KB7A 4S32A 4JDHA 4BDBA 3SGCA 4DHJA 1PMVA 4L7SA 2FYSA 5DHJA 4H1MA 4FT3A 4NM0A 4QMSA 4G2FA 2Z7LA 3D5UA 1A9UA 3SXRA 3AD6A 4RC4A 2W1EA 4KUJA 4HCTA 4D2VA 4K18A 3REPA 3TUBA 4GK4A 3LHJA 1REJA 2OJGA 2WMAA 3GCPA 3LAUA 3DZQA 5FM3A 3UOKA 3P9JA 4XHKB 5LMKC 1WMKA 4XOYA 3CKXA 4FSYA 1VJYA 2YWPA 4QTBA 4JR3A 3VW8A 5HTIA 1NY3A 4FG9A 4FKQA 2ZM4A 4E6CA 4L44A 3IKAA 4ZTRA 3UVPA 4EC9A 2B4SB 3BE2A 5CT7A 4TKSA 3UIUA 4NM3A 1ZARA 2YN8A 1XMLA 4AOJA 3FI2A 4JBOA 2HZNA 3WZEA 1VYWA 4UMUA 1MQ4A 4PDYA 3NCZA 3EN4A 3V8TA 3AGMA 4YBKA 5TOZA 5I9ZA 4F0GA 3OT8A 4KS8A 1UU9A 4ZTHA 1OL2A 2W96B 4V0GB 4XS2A 4ZAUA 4QMYA 4A9SA 4EH6A 3U87A 3EQHA 4HVDA 1LP4A 5LXMA 1UV5A 3D4QA 3KMMA 4FIEA 4L3JA 3KK9A 5IKWA 2C6EA 5DNRA 2XK3A 4RIOA 4AW2A 4ONAA 2WQEA 4KIKA 3CJGA 4O7WA 1ZOHA 1W2CA 2WAJA 2W9ZB 2I1MA 4RIYA 2H6DA 4TYGA 2XA4A 4NTSA 4WRSA 3KF7A 2OZOA 3BCEA 5BUEA 3AKJA 1WVWA 4OBQA 3PP0A 3Q4CA 3ROCA 3EB0A 3FMEA 4N6YA 3VQHA 2QOOA 2PULA 4FGBA 4O38A 4Y72A 5AR5A 5FQDC 4BDGA 2A27A 4LMNA 5IEYA 2BRGA 1Y8YA 5J9ZA 3A7JA 2I7QA 4WNMA 3W18A 2VO0A 2BFXA 2YJSA 3L9PA 2OJIA 3ZFMA 2JDVA 3HECA 4DFLA 3CS9A 3KU2A 1XH5A 3ZS5A 5FTGA 1G8AA 4EBVA 4CVAA 4IVBA 4JBQA 2WTCA 4FKJA 4UMQA 4BY9E 1SNUA 4A9UA 4MCVA 1IRKA 2XJ0A 5CEKA 4IWOA 2IZTA 2OGVA 3KQ7A 4XCUA 4A4LA 4JDIA 5D10A 3BL9A 1GJOA 4FSRA 5HG8A 4BGHA 4W9XA 1E9HA 4PL3A 2JDSA 4K8AA 1ZYCA 4QMWA 4AGWA 4KKEA 4DFUA 4RSSA 2V7OA 4U3ZA 4YUQA 2JKOA 1H1PA 3LCDA 2X0GA 5DT3A 4QMQA 2R0IA 3UO5A 4EZ7A 1P5EA 3DQXA 1WZYA 4IM2A 5GJGA 5IF1A 3QA0A 4RFMA 2NNWB 3PRIA 4YHJA 3QFVA 4TWPA 3OWKA 4ZY6A 1Q24A 4GS6A 3HAMA 1H01A 1FVRA 2J50A 3R04A 4IVCA 4S30A 5CI6A 4G3EA 2C5XA 3UOLA 4GFGA 4KAOA 3NYVA 3ZDIA 3H9RA 2X8DA 2YABA 2PZPA 5AUZA 3CQWA 2I0HA 4JT3A 3RAKA 4BIEA 3RK5A 2VTSA 4QMLA 3KXNA 1YWVA 3FBVA 3W2SA 3UDSA 2O64A 3QRJA 2V55A 2VNYA 4XG2A 5GZAA 3DBQA 1OL5A 1ZRZA 2BDWA 5E8ZA 4RLLA 2XIKA 2ETKA 2ITWA 2X9EA 4FIGA 4L46A 3TIZA 3CGOA 3IOPA 4DF3A 3FZ1A 4WIHA 2YFXA 1WBTA 2F2CB 5IUIA 4FL3A 3H30A 3GQLA 4JIKA 4D4YA 1OMWA 3F5XA 3O17A 4KIKB 3SXFA 2RFSA 3E64A 2IO6A 4C59A 3BQRA 3BX5A 2ZDTA 3SW4A 1J3HA 4FKOA 1BX6A 4FKUA 4FSZA 4ZLZA 2GTNA 4F7LA 4FUYA 3RK7A 2B7AA 4C3RA 5JFSA 4I0RA 4O27B 3NVMB 1J7IA 5M06A 4U6RA 4GKIA 3GU5A 4NK9A 3NUNA 4IJ9A 4ACCA 2G15A 3SAYA 3GCVA 3NNVA 5TF9A 3TKUA 5AAGA 4X3FA 2PPQA 5K4IA 2A19B 5M53A 3W2OA 3R28A 3LKMA 4FYNA 2GQGA 1MQBA 2R2PA 3PJ8A 3IGOA 4L01A 4NIFA 4UEUA 3H9OA 3FLYA 1NVRA 4BF2A 5CASA 2ITZA 2REIA 4AAYA 1M7QA 3HRFA 3AMAA 3PA3A 3UPZA 5M4UA 3PY3A 1HCLA 1PXOA 5FBOA 1PXPA 3VF9A 3ZLWA 4GW8A 4CZUA 3ZM9A 3U6HA 4A9TA 3ZLYA 4AWIA 4EUTA 3ATSA 4IAZA 4TYHB 4LGGA 4EK3A 4NL0A 2QOLA 4WA9A 4FV6A 1K3AA 3FMMA 4RRVA 3TKIA 4DFZE 1G3NA 3I5ZA 4ACMA 4AW0A 5CQUA 2V5QA 4W8DA 3EZRA 4F1MA 5CAVA 4ZSAA 4DA5A 3CTQA 4OT5A 5HE0A 3ENMA 4W4YA 2ITXA 1YRPA 5HEZA 3QCQA 3FLSA 4G5JA 5L3AA 3LM0A 4E20A 1YXXA 5EK7A 5EW3A 4RG0A 3RNIA 2C3IB 3BGZA 3C0GA 3LW0A 2EXEA 4ITJA 4RWJA 1YWNA 4O0UA 2JAVA 4OBPA 5KE0A 4QQJA 1URCA 1IA9A 2BDFA 3I0QA 4CQEA 5HQ0A 3TEIA 3EQRA 4BJJB 3MGYA 4PF4A 1SNXA 3HA6A 2P55A 3HV3A 5CNNA 5AR7A 3PE1A 4JNWA 3ULIA 3S0OA 3VS6A 4BTKA 1J7UA 3KXGA 2Y8OA 3TNHA 4RPVA 3HV7A 4K2RA 3LFCA 3OG7A 3R7VA 4EK8A 3KKVA 4O0SA 4P7EA 4LDTA 3TIYA 3K5VA 3ZRLA 4NUSA 3E63A 2ZM1A 3UYSA 3V5TA 4CEGA 5HE3A 2BAKA 3KK8A 2ZV8A 3MA3A 3ORNA 4BHNA 2J4ZA 2NRUA 5DEYA 2JKMA 3N4UA 5EQEA 4FMQA 5LCJA 3SRVB 4EHVA 1OM1A 2WU7A 3PSBA 3UGCA 3VHKA 3P4KA 4UXQA 5J7HA 4IQ6A 4AAAA 3BV2A 4IC8A 1PRYA 3U55A 2A0CX 2VRXA 2R3OA 3AC2A 3ULZA 3R7GA 3EQPA 3MH2A 4DHFA 4FEUA 3OWJA 3T3UA 3KCFA 5JZJA 2R5TA 1W2DA 4E5WA 4CLJA 1H07A 4QP8A 5L2TA 3AXWA 2VTQA 3OXTA 3V5QA 3W1FA 2XRWA 3HP2A 4UMTA 4M7IA 4H36A 3ML1A 4APPA 2ITVA 2R3NA 5DFPA 4IE9A 2F7XE 3COMA 1UKIA 1W7HA 2BTSA 3UC4A 5JFXA 1PXNA 5L8LA 4O7YA 1H1SA 1IASA 1PXLA 1OPLA 3KF4A 4HZSA 2WMUA 3R2BA 5HCZA 4O4FA 5TT7A 2FB8A 2GS7A 5CANA 5ETIA 4RWIA 3LLAA 2VTNA 2WTJA 4JX7A 4O0TA 3UP7A 3LQ5A 5BYYA 2CNQA 3BGPA 3Q52A 1ZY4A 3QQGA 1F0QA 2PZRA 3DNEA 4LV5A 3UODA 2G1TA 4PMPA 3BQCA 4EH2A 2E9PA 3OCSA 1SM2A 4RVTA 5H8BA 1YXTA 5IA1A 3BBWA 2AC5A 2DQ7X 2GU8A 2YCQA 4J96A 3VONA 3DKGA 3RWPA 2QURA 1J1BA 2WKMA 2FSTX 1YWRA 2YIXA 4FKGA 4IBMA 4MQ1A 4MF1A 1CMKE 1PMUA 2ONLA 3VS3A 4AF3A 4YO4A 3JR1A 1Q97A 2PE1A 3QRUA 4OBOA 4EOQA 5KX8A 3D5XA 4H3QA 3ZOSA 3OTVA 4FSTA 5I9XA 4AFEA 3DNDA 4RZWA 3CQUA 5C8KA 4FNWA 2YIYA 3UOJA 4PUZA 5CY3A 5DT4A 2AYPA 3NWWA 4E93A 4KABA 5A4CA 3ODZX 5A4EA 3HV5A 3O8PA 4U80A 2PVMA 1PKGA 3TV6A 3TTJA 3L8PA 5I9UA 4K6ZA 3RZFA 4ORKA 4U8ZA 5DPVA 2C68A 3EZVA 3UIMA 3ZSGA 2CGVA 5M4IA 1WBWA 3BU6A 5EI2A 3FI4A 3MTFA 1EH4A 4ANLA 2X6DA 3O5AA 3AC4A 2WMTA 5E1SA 4TXCA 3VS5A 2X8EA 4HYHA 5EHYA 3VJNA 3A62A 4EOJA 3CIKA 3KN5A 4DBNA 3TG1A 3ZDUA 3AMYA 3KXXA 2NPQA 4O4BB 3VC4A 3L8SA 4F1OA 2X2KA 2YIQA 4D58A 3LFQA 1AD5A 4DT8A 4O7LA 2O5KA 2OH4A 3O50A 4UY9A 1FOTA 4TW9A 3QTSA 2WO6A 1H26A 4FV8A 5CSPA 1ZZ2A 2Z60A 4NFMA 3R71A 4FKIA 5B7VA 3QQHA 2CKQA 2IVSA 1H28A 4LMUA 5AR3A 2YWVA 4OTPA 3UC3A 2B55A 1OVEA 4FSQA 4MF0A 2YM3A 4EOMA 1V0OA 2X2MA 2JDOA 5CWZA 3AG9A 4LV8A 3BLAA 3VAPA 4L45A 5JGDA 2EU9A 5KMKA 2CKPA 4L9IA 2XF0A 3A7IA 3UDBA 4CKIA 4M8TA 3QCXA 3OXIA 3HUBA 4OTFA 1PXMA 4PL4A 4PQNA 3QU0A 5J1VA 4V05A 2WMXA 3KEXA 2RFDA 5LOHA 4R8QA 1H1QA 1KE9A 3FMNA 4FA2A 4QYGA 4YJTA 2HXLA 3WF7A 4D28A 1H8FA 2J2IB 5GIPE 2IVUA 1Q3WA 3PYYA 4IAYA 1VYZA 4BCGA 2AQXA 3FMJA 2PTKA 4J71A 3CY3A 2QODA 3OBGA 1JVPP 2Y4IB 3B2WA 1IR3A 3NSZA 3PJCA 4G6OA 3W2CA 2C5OA 4FKLA 4IAFA 2PUNA 5CTPA 3S00A 2YM5A 4EH9A 3QHWA 5ANIA 3JY9A 3ERKA 4YZBA 4D4SA 3FLQA 3ENHA 3UYTA 5HVKA 4FKTA 3KRLA 3N51A 4P4CA 3DB8A 4RQKA 3ZRMA 1FBNA 2C6OA 5AV0A 1GZOA 2ZAZA 3NPCA 1ZLTA 3QD0A 4QOXA 5J79A 5LMAA 3IONA 2GFSA 3VJOA 2VGOA 3PA4A 3IW5A 2YDKA 4FNYA 2QOFA 3KULB 3E92A 3NUPA 3TZ9A 2C69A 3BLRA 4BTFA 3DXQA 4DCAA 3ZEWA 2UW7A 5D11A 3KXZA 3ACJA 3AOXA 3HP5A 1UU3A 3D15A 3OHTA 5CS6A 3QGWA 4XLVA 5KKRB 5HZNA 2QQ7A 2ZMCA 3D9VA 1I09A 3GVUA 4UWCA 3S4QA 4M68A 4CFWA 1TKIA 2VWVA 2R3JA 2YLFA 2PU8A 5F4NA 5LARA 4EK5A 5CALA 5E4HA 3IS5A 3PVWA 2X8IA 5I0BA 5AP5A 2R7IA 4U43A 2HW7A 4QQTA 2WNTA 4ZSEA 3FY2A 3EL8A 4BI0A 4HGTA 4Z3VA 3QUPA 4GJ3A 4BGQA 3RWQA 4AW1A 4X0MA 4CYJA 1SYKA 5CVGA 4B6LA 3C4FA 3PFQA 4FTQA 3MPMA 4QEBA 4WSYA 5AX9A 2CGXA 4EWHA 2WQBA 5DWRA 4EYJA 4KB8A 2CPKE 3DKFA 3WE4A 4IZYA 3V8SA 3B8RA 2W4KA 4BGGA 4M3QA 4FIIA 4FF8A 5E8XA 5HOAA 5G1XA 3NUXA 3H9FA 5B0XA 4XBRA 3TNQB 5EW8A 2HCKA 2Y4PA 2OG8A 3O7LD 3DZOA 1BI8A 1KOBA 2EWAA 4EOIA 5IZFA 2HXQA 2VO6A 5HO8A 3IDPA 3NW7A 4AOIA 2W17A 5CLPA 5F1ZA 4IACA 5EKOA 4FEVA 2GQRA 2KTYA 1NVQA 4XG8A 3ZSHA 1JAMA 2O8YA 2PL0A 4O2ZA 4APCA 3LXKA 4MD8E 3Q9WA 4J99A 2JIUA 5B2KA 4LM5A 2BMCA 3A7HA 5IH6A 2XNGA 3C4ZA 4G3FA 3VNTA 2AC3A 1X8BA 5JEBA 1H1WA 3DJ5A 4R3RA 4F65A 3ORLA 3RJCA 3ZRKA 3VS4A 4R78A 3M11A 1KSWA 4FT7A 1SMHA 3G15A 3VS1A 5EQYA 3NIZA 2VN9A 5J95A 4QP2A 2F4JA 1GIHA 5CSWA 3WZKA 4M15A 5M4FA 1IAHA 4BC6A 4D2RA 5KCVA 3U6JA 3F88A 4IZ5A 3SC1A 4BCMA 3ITZA 5G6VA 3ZO4A 2WMQA 4FNXA 4W4WA 1Z5MA 4RIWA 4CKRA 1DM2A 1NW1A 3VBVA 2B53A 4M0YA 4E6DA 5BUIA 1AGWA 5C27A 5KHXA 2ZB1A 4R5YA 2ZFYA 5EQPA 4CT1A 1MRVA 3R8LA 2LGCA 5DRDA 3P08A 3W0NA 4IFCA 1Q5KA 2XKEA 3G5DA 5J1WA 1ST0A 3M42A 3MVMA 3A61A 3F2RA 4IVAA 3GUBA 4QO9A 2EXCX 2Y4IC 3Q4UA 4FT0A 1K2PA 3D7TA 4AT3A 4M97A 5EDQA 2QG5A 4DEDA 5HESA 4BWKA 4TWOA 2FH9A 2XNMA 1WVYA 1OIQA 4K1BA 5KZIA 2C6DA 4C02A 3LQ3A 3BU3A 3D2IA 3FMHA 4NCTC 3ZBXA 5K9IA 4RVKA 3W33A 2VTOA 3OF0A 2C6LA 3H0YA 1DAYA 2PVKA 4RC3A 2YM8A 4K33A 5CQWA 2VX3A 3DDPA 3I4BA 3F69A 1JKLA 4NEUA 4R1YA 5I9WA 1R0EA 4MXYA 4CRLA 3I60A 1JLUE 3ORIA 1ZWSA 4O4EA 1MRUA 3BYMA 5IMXA 3NRMA 3ZYAA 1G8SA 5EKNA 4YGAA 4Y95A 3PUFC 3LCKA 4ANBA 3KY2A 4QQ5A 4U3YA 3UE4A 4DLJA 5KKRC 3PXFA 5BYZA 3AD4A 4ZTSA 2OI4X 3S95A 3TNWA 5E7RA 4FC0A 4ANOA 4CXAA 3FXXA 4DINA 4F7JA 5KBRA 3HEGA 3Q4ZA 3KXMA 4JAJA 4PTGA 5EM8A 2W1FA 2UV2A 3TM0A 4AXFA 4X2NA 3NAXA 2JITA 5CT0A 2X6EA 1OIUA 2I40A 4EOPA 3OY1A 3QC9A 3UQCA 4NTTA 4FSWA 1OPKA 4ALWA 3WYXA 2EB2A 3DY7A 2UZWE 4DYMA 2C6MA 2FSOX 3A7GA 2ITNA 3K3IA 4MEDA 4ZOGA 1U59A 2BRBA 2OFVA 5AP7A 3RCJA 4C58A 4EKKA 2WMVA 4C3PA 5CZIA 4RWLA 4BDIA 4LL0A 4IX4A 5FEQA 1QMZA 5BNJA 3NFFB 3IG7A 3HGKA 4I3ZA 1FGKA 1PXIA 1V1KA 1GY3A 4L68A 5EM6A 3R73A 1PF8A 4WNKA 3CPBA 4YTIA 2B1PA 3NYOA 4BCJA 5LWNA 3PJ3A 3PXYA 4QP7A 3WIGA 1U46A 2C1AA 5FEEA 3A60A 1UNHA 4FZ6A 4LRJA 3C5UA 2JBOA 4HGLA 4W9WA 1WBPA 4OTHA 3WZDA 2C0OA 2YZLA 2JD5A 4DTAA 3DV3A 2OJJA 5HX8A 5C01A 1WBOA 3HX4A 4JOAA 2Z7QA 3C13A 5AIKA 4F99A 5HLPA 4FIHA 4K11A 4TN6A 5E8TA 1U54A 3RM6A 1Q8UA 3TNIA 4A9YA 4MTAA 2C3JA 5AR2A 4BDJA 2ETMA 3MS9A 4DGMA 4WUNA 3LFEA 3UVRA 4CTBA 2J0LA 4NW5A 1XH6A 2HIWA 4Y8DA 5EYKA 3R8MA 4WBBB 3B2TA 3GXLA 3C51A 4FZ7A 5IQIA 4BCNA 3EFWA 1CKPA 3EOCA 5AP0A 3GQIA 2FSLX 4RX8A 4TPTA 3SV0A 2OSCA 4EZ3A 5KMMA 2UZLA 4N70A 2Z7SA 4CYIA 4HZRA 3BYOA 2BUJA 3P79A 3DAEA 2CGUA 4EOKA 3VBTA 1KUTA 4J97A 3TTIA 2WU6A 2J51A 5TO8A 4BKZA 4O7RA 4R77A 4YC3A 1H27A 2HYYA 3ETAA 3I7CA 4GL9A 3V5WA 4EQUA 2NO3A 5E9EA 5AUTA 2IZUA 2IWIA 3MW1A 4O6LA 3Q6UA 4BFMA 1QPEA 5A54A 3SDJA 5C8MA 2ZMDA 3E7VA 4O22A 4BI2A 3LJ2A 4R5SA 2CN5A 4YHTA 4BTMA 4AXDA 3ZC5A 2YIWA 4FV4A 4JJRA 3ZUUA 2Q0NA 2HY81 2EUFB 2G9XA 2ZV7A 1ZOGA 4GT3A 5TE0A 3AT2A 3ORPA 4CQGA 5I5ZA 4O82A 3FLNC 5CI7A 5KZ0A 4AE6A 2VTAA 3BI6A 3JUHA 3R9DA 3VBQA 2PZ5A 3W55A 3KIOC 4FV7A 3VW6A 3DKOA 3RAHA 3BEGA 4Y46A 1YXVA 2WMSA 5IDNA 1PYXA 2GNLA 3Q2JA 1XKKA 2XALA 4QMMA 4XX9A 1OECA 3P23A 5B2LA 1Y6BA 1JSUA 3Q4TA 3LCOA 4ZSLA 3PUPA 4WKQA 4DFNA 3F2AA 3TJCA 1P4OA 4IH8A 1XMMA 4KINA 5ITAA 2CCIA 1PY5A 3LXNA 3Q60A 5HO7A 3R6XA 2HZIA 2UW3A 3FPMA 4IAAA 4U45A 3FLWA 2W5HA 4DC2A 1NXKA 4U7ZA 3NDMA 4CFVA 3KREA 4UX9A 1YXSA 1BUHA 4ZEGA 4QP3A 5FM2A 2XBJA 4AW5A 3DK6A 1Q99A 1YHSA 1WFCA 4NWMA 4L6QA 1YDTE 5EG3A 3LLTA 4S2ZA 3KXHA 3ZUVA 3WZJA 4YMJA 3G9NA 4G9CA 4ERWA 1OITA 1K9AA 4IFGA 3F3VA 4HPUE 3KGAA 2PMIA 3JY0A 4IX5A 4KA3A 3SOCA 3UTOA 5HGIA 4F7SA 5HTCA 4MX9A 4FZDB 1YDSE 4M12A 5K3YA 3BL7A 4I5PA 3DFAA 5HBJA 1QL6A 2W1CA 5B2MA 2ZYBA 2WB8A 4K77A 1OL7A 4LG4A 3ACKA 4FRFA 1PXKA 4IB5A 2IVTA 2R4BA 3GEQA 3EQBA 1Z9XA 1YOJA 4WG5A 5HNGA 4W4XA 4EL9A 5HHWA 3RPOA 4X2FA 4AS0A 3OOGA 4KIOA 1Y57A 4I21A 3R7YA 4AACA 3FJQE 3JYAA 2I6LA 4EBWA 4RJ3A 5HVJA 4EHGA 4JDKA 4II5A 4YO6A 3LMHA 4MXXA 2VWIA 3LFDA 2UZBA 4FVQA 2XM8A 3CD8A 4FI1A 3R21A 4QRCA 4BHZA 4CMTA 2YDIA 5EDPA 1FMOE 3Q04A 1M2RA 4AGUA 3FZRA 4O1OA 3DS6A 2NP8A 4JDJA 4DH3A 5J8IA 4ZY5A 5C26A 3SX9A 4A4OA 4ACGA 5M57A 3M1SA 2CMWA 4MWIA 2XK9A 3QA8A 5GHVA 3SD0A 2UZNA 4IWQA 3RBWA 2P0CA 3QCYA 5CU0A 2UW8A 4FV9A 4DDGA 3Q9YA 2QLQA 3R8PA 3N4VA 5IQBA 4W4VA 2NYAA 5EOLA 1XBBA 3VS2A 3DK3A 2J0KA 2XK6A 4O84A 3OMVA 4WHZA 3V04A 5EM5A 4XV9A 2C6KA 4AE9A 4BCKA 3RP9A 5M56A 3FEGA 5CEPA 2BZKB 5J5TA 4AXCA 2IF8A 3O8TA 5J9YA 1Q8WA 3G0EA 2R3IA 3CR0A 3R30A 5L8JA 4ANMA 3W0SA 2HZ4A 3F7ZA 2YERA 3FZSA 5FXSA 1M2QA 3QD4A 3E93A 1GIIA 4XLIA 3E3PA 3DDQA 3QTWA 4JXFA 3JXWA 3P1AA 2BIKB 2YCRA 5CAQA 4P5ZA 4CT2A 4K9YA 4TYEA 3KVWA 3KRJA 1JKSA 4PY1A 3SXSA 2BAJA 2YIRA 3IW7A 4YJVA 5JH6A 4MNEA 4X3JA 1OGYA 3R1NA 4CRSA 4QTDA 2SRCA 4OTDA 5CSVA 5CAOA 2PUPA 5AR8A 4A06A 4B8LA 4YTFA 5AJQA 3RPRA 2VX0A 5HTBA 1IA8A 4QTCA 2IJMA 2YM7A 2F7ZE 2VNWA 3ET7A 3GC7A 2QOQA 3MVHA 2B9FA 5CEQA 3RCDA 3SVVA 4LRMA 2CN8A 1UA2A 3E3BX 4XYFA 1VLRA 1DI9A 4IZ7A 2O0UA 5JFVA 3TNPC 2R3RA 4RIYB 3RINA 3WBLA 5CXZA 2OU7A 2DUVA 3D5WA 1W2FA 3NVKI 3PIYA 4R7IA 3F5UA 5E91A 4DGLC 5DOSA 4QNYA 5JGAA 2XNOA 2WZJA 3FL5A 3UG2A 4BIBA 4CZYB 3SG9A 1DI8A 3PJ1A 1UWHA 4MK0A 5K5XA 4TWCA 2UZEA 4U41A 4QTAA 5AP6A 1Q62A 4PWNA 4AT4A 4BBFA 1BKXA 5IQFA 4WRGA 1L8TA 5FTQA 4HW7A 3D7ZA 4PPBA 4JRNA 2GTMA 3VVHA 5E8VA 4I24A 3G2FA 4DCEA 3F5GA 2R3PA 3ZSIA 2YITA 4GG7A 2Y0AA 4DHIB 4RJ4A