2CDZA

Crystal structure of the human p21-activated kinase 4 in complex with cgp74514a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
292
structure length
289
Chain Sequence
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK 4
publication title Crystal Structures of the P21-Activated Kinases Pak4, Pak5, and Pak6 Reveal Catalytic Domain Plasticity of Active Group II Paks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 289
sequence length 292
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2cdzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cdzA01
3RGFA 4CMTA 3F3TA 3HECA 4QYFA 2WTCA 3FI3A 4QYHA 5F1ZA 2EXEA 4ASDA 4G17A 4B4LA 3PY1A 3QL8A 5EKOA 4R77A 2VU3A 4IACA 2V7AA 5FTGA 4CFVA 3CXWA 4D2SA 4V01A 1YVJA 1YOMA 2YJSA 1OUKA 3E3PA 3SQQA 4RIXB 4EOQA 4XNEA 3U4UA 5BYYA 2IG7A 4UN0C 3F5PA 4HPUE 2J0MB 1NVQA 4DA5A 2OZAB 3A2CA 3NS9A 3OHTA 5CEQA 4TXCA 4EOSA 4NM5A 3LFSA 4UXLA 5FM3A 5KHWA 2W05A 4CVAA 2PYWA 3QA8A 4S31A 5IA1A 1FPUA 2ZOQA 2GQRA 5L6OA 3O0GA 4Z7GA 2W1HA 3OFMA 3R30A 3PVGA 3FZRA 1U54B 5BVFA 2YLEA 3C4EA 2PMOX 5CX9A 3KK9A 2UZBA 2BALA 4KD1A 4D2VA 2FYSA 5DPVA 4TYIA 4E5BA 1WZYA 4AF3A 3D0EA 3ACKA 5AA8A 2JBOA 5DWRA 4NWMA 4IB5A 4AE6A 4F64A 3UG1A 2GQSA 4C62A 2XNGA 3DXPA 2QO9A 3ELJA 4M14A 2BHEA 4NIFB 3CQUA 3IW5A 2JDOA 2XK4A 4UWCA 4YBJA 4ENYA 2A19B 5AP5A 3ZM4A 5HG8A 4L67A 4N0SA 3UOKA 3ZO4A 4JRVA 3GQIA 5CASA 3HEGA 2PVKA 2QU6A 4E4LA 1G3NA 4BI0A 2R64A 4FKOA 5CQWA 3ANRA 2UZUE 2QNJA 5EKNA 2PULA 3L8PA 3WF5A 3EIDA 4CMUA 3EWHA 4D4YA 4X3FA 4ZTSA 3R7YA 5EH0A 1FGKA 3EB0A 3P5KA 4YTFA 5IH5A 5EW9A 3QUDA 3ZSHA 3OY3A 4YLJA 4AP7A 4EUUA 4I41A 4ZMFA 5IUIA 4RX8A 2UW0A 1REJA 2DS1A 1PYXA 3R28A 4QQTA 2NRYA 2WHBA 5HLPA 4CXAA 3EFKA 4AFJA 3A62A 5KNJA 4FSUA 4DAWA 3ZBXA 5EDPA 3C5IA 4NFNA 4GK3A 3I81A 2VWBA 3U6JA 4FUYA 3IW7A 5BUJA 2QHNA 3CIKA 4RSSA 5M56A 3FLZA 4EHEA 4E6AA 3HKOA 4C4IA 2PL0A 5IMEA 4FE2A 1QCFA 3AG9A 4F7NA 2YDKA 4IW0A 1XH9A 3CGOA 3N4TA 4KIOA 2PVNA 4KWPA 2VO6A 3TNIA 3VBWA 4P7EA 2W9FB 2PUNA 4IZYA 5DVRA 3LQ8A 3TG1A 4C3FA 4D55A 4F6WA 1ZY5A 2J4ZA 4RVLA 2Y0AA 3CCNA 3QBNA 3QAME 5EHYA 2V7OA 3U87A 3MB6A 3I5ZA 5AAGA 1PJKA 1ATPE 1QPEA 4B8MA 2QG5A 2VRXA 2E9PA 3UO5A 3WARA 5EYKA 5KMMA 5AFVA 1ZZLA 2AUHA 3SOCA 1PW2A 3BU3A 2QOIA 5H8BA 4BY9E 2HZ0A 2PWLA 5LVOA 3CQEA 3NMUF 2XZSA 5M55A 4D4RA 3DJ6A 4RVKA 2VWYA 4CFNA 4FKVA 4JBQA 4Y46A 4E7WA 1JAMA 4MF0A 4E3CA 4C0TA 3QD3A 1GZKA 1YXVA 2C0TA 4MXZA 3ZRLA 1OECA 2XIXA 3HMMA 4PL4A 2HXQA 3II5A 5FDXA 5HG5A 4RIYA 3FMJA 4QTEA 2E9VA 2WU6A 5AADA 3SG8A 2VNWA 2BIKB 4BHZA 2W1EA 1K2PA 5BVWA 3R73A 4W8EA 2X4FA 4CZYB 2JKOA 3COKA 5I3RA 1UKHA 4ZAUA 4XH6A 2XKEA 3BLQA 2JFLA 4XOZA 3LFNA 5E1SA 4V0GB 5LMAA 3TXOA 3ORMA 4DF3A 2FB8A 3F9NA 4BKZA 2J5FA 2QKWB 2V55A 2WU7A 3NAYA 3R6XA 4FIIA 5AR8A 2I0VA 3ZLWA 2QURA 3MESA 2QKRA 1OMWA 4L45A 5BQ0A 4KRDA 5AUUA 2XK9A 3S00A 4O7LA 3M11A 4RZVA 2ERKA 2O2UA 3ZC5A 1KE6A 4NJ3A 4YP8A 3NGAA 3Q5ZA 3FMNA 4LGDA 4FTJA 2V0DA 5K0XA 3ZCLA 4CZUA 3EHAA 4FV5A 2YFXA 3DAEA 3M2WA 3RWPA 3VRYA 4ZOGA 4DE4A 4N6ZA 4I0TA 5EYMA 2HELA 2P2HA 3NVKI 3I6WA 4I92A 3JVRA 2XYUA 1TVOA 4ITIA 4CSVA 4XP3A 3AC3A 4MVFA 4BCOA 2QD9A 4H1JA 4I0RA 2W96B 2YAAA 4HVHA 1R0EA 2UW6A 4BDCA 3BE9A 5CXHA 1QMZA 3KREA 3BGQA 2XNBA 1UKIA 4OTFA 4IIRA 4TW9A 4FV9A 4CCBA 4KAOA 3QTRA 3RBWA 4EKLA 3NR9A 5KBQA 4O7YA 3C0GA 4QP8A 3AMYA 4XOYA 3FMEA 5CF8A 3BCEA 3QX4A 2ZB1A 3T9TA 4EZ3A 4IZ5A 4I20A 4BCPA 4MQ2A 4FOCA 3V5TA 4E4XA 5CAQA 4OTPA 4J99A 2UZTA 5JFVA 4QOXA 2XCHA 5CENA 2VTIA 5AUVA 4UX9A 1VZOA 1J7LA 4U45A 4IC8A 3QYZA 3UMWA 3JUHA 2ETKA 3CY2A 5BVNA 4FTAA 3RAWA 4EKKA 2Q83A 4FV2A 4NKAA 5HHWA 3CC6A 2XNOA 4FGRA 3WZUA 4ANQA 2BTSA 2JIVA 3WZEA 3ZO2A 5BUEA 4MK0A 3ROCA 4EBWA 3HP2A 3TCPA 3UVPA 2G15A 2XVDA 3SXFA 4FT3A 1YWRA 5HD7A 4DCEA 1PXPA 4WG3A 3PY0A 3RK7A 3SXRA 2FSOX 3JPVA 4KA3A 4DGLC 2C68A 4O0WA 5L2IA 5HKMA 5EFQA 1Q8YA 4OT5A 4ERKA 2GFCA 3KN6A 3LJ1A 3TM0A 3DXNA 4RQVA 3AC2A 1OL1A 4IEBA 4C35A 4QYYA 5AR3A 4AE9A 4IB0A 2HYYA 4LUEA 4I23A 4U9AA 3Q6UA 5IEYA 3DKOA 3PJCA 4V05A 4Q2AA 4NK9A 1YI6A 2GHLA 4JQ7A 4YC3A 5E92A 3DJ7A 3E8EA 3IDCA 2XK6A 4YMJA 3DK3A 4ZTQA 3R8MA 3AT4A 5E91A 2ITXA 3SW7A 4ORKA 3KXZA 2GNHA 2OK1A 1F5QA 2DQ7X 5KMIA 2VWWA 2YCSA 4W4XA 3EQHA 3O8TA 2H6DA 4CGAA 4G6LA 4PPAA 4I5PA 2X7FA 3C1XA 2XKCA 3V8TA 2F4JA 2O8YA 2XBJA 3NUSA 3FDNA 2WPAA 1F0QA 4GL9A 1OKVA 3ORTA 4CCUA 5LQFA 3BQRA 3QFVA 4DTKA 3A8XA 3SRVB 3VBXA 3O2MA 5LMBA 4TY1A 4ZSJA 2IJMA 3ATTA 4K9YA 3NCGA 1YHVA 4O0UA 4JT3A 1YOJA 4GFMA 4U41A 5I9XA 3FSKA 4AOIA 4IADA 3WE8A 2JBPA 3ACJA 3UIBA 4W4WA 1UWHA 4ZLZA 4QMLA 2R3MA 3HV5A 5KKRB 1BYGA 4JBOA 4M8TA 4IB3A 4YJNA 5ACKA 4UXQA 4KIKB 4BHNA 1PXKA 4BL1A 4BGGA 4DTAA 4USDA 3R83A 4GT5A 4UYAA 4ANBA 2X4ZA 4CRSA 5IQEA 3ZZWA 3ETAA 3FXWA 3O7LD 4GRBA 5KMOA 3QRTA 4FIEA 3G9LX 4K8AA 1V0BA 4C4HA 3H3CA 3WZKA 5E8VA 2OJFE 2R3KA 3AD5A 5AR5A 3FAAA 3QTQA 3F61A 3G51A 4FT0A 2JDVA 1KSWA 5CI6A 2CCHA 4JRNA 1SYKA 4MWHA 4QT1A 3ZMMA 3VN9A 4RJ5A 5CU4A 4BDAA 3FLYA 3QC9A 5AAFA 4FIHA 3FKNA 4F9WA 2WEIA 3C0IA 3LCTA 3O8UA 3F2RA 3BE2A 3AGMA 3FKOA 2IVSA 4TN6A 3U9CA 4FGBA 4YU2A 3KN5A 3VUHA 4O83A 3L8VA 1YWVA 2YISA 4HVIA 1M14A 4DEDA 3UOLA 3S1HA 4S32A 4TRLA 4D58A 2XJ1A 3HUCA 2Q0BA 2VX0A 4K2RA 4NSTA 5BYZA 1FQ1B 3RI1A 4AN2A 4MXXA 4WNPA 4D28A 2HCKA 4PPBA 3UVRA 5BMMA 4M69B 1FVVA 3BZ3A 3GCPA 4J95A 5DEYA 1RE8A 1RJBA 5I9WA 2FVDA 2IZTA 1OB3A 4YTIA 3UQGA 4AX8A 3A4OX 4O91A 5I9VA 2RG6A 5AUWA 4FKPA 4ERWA 4QMUA 4ZLYA 4YSMA 3BYSA 1YXUA 3QTWA 3QZIA 5L6WL 3KRRA 3FMDA 3VC4A 4F0IA 3BBTB 2C3JA 3FI2A 4I3ZA 1WVWA 4G16A 3C51A 3ERKA 3R1QA 3DGKA 5HCXA 4TPTA 4E1ZA 2OIDA 4A4OA 2Y4PA 4OTIA 5AMNA 1YWNA 4NYEA 4EJ7A 4QO9A 5LWNA 3UIMA 3VS0A 5CF6A 3PPZA 4GYIA 1P14A 1ZYCA 3FPMA 4K6ZA 3MVHA 1E9HA 4EH4A 3ALOA 1KOAA 1Z5MA 4G3CA 3RP9A 2JFMA 3FMLA 5HLWA 3VQHA 5IQCA 4N70A 3BX5A 4QNAA 4GUEA 4UV0A 2HW7A 2ACXA 3D7TB 3ANQA 4XG4A 2HXLA 3DNDA 3GCQA 4AUAA 3AC4A 1YDTE 3ORNA 1IG1A 4D1ZA 5B2KA 3L9NA 2G2FA 2QODA 2QOLA 4BDKA 4RMZA 4NM7A 2GSFA 1UU8A 5K9IA 5LVMA 1V0PA 4D0XA 4IAFA 2HY0A 3NYXA 3OUKA 3PA4A 1E1XA 3RPSA 4DEGA 2BMCA 2NPQA 2Z7SA 5TO8A 4R3CA 3UYTA 4F6SA 3WF7A 2OXDA 4GFGA 3QZGA 3QRIA 1A06A 3NUYA 4RJ3A 4AWIA 1WMKA 3HA6A 3PPJA 3ZSGA 2HWPA 3GU4A 3V5PA 4O81A 3BHYA 1ZOGA 1JPAA 3VS4A 4TKSA 4ACCA 4P5ZA 5AV3A 2P4IA 4ACHA 3CLYA 5IMXA 4XG3A 3PDTA 1S9JA 2QG7A 2BAJA 1OUYA 2CGWA 3IW6A 3OW3A 1NXKA 3VJNA 5HU3A 3AGLA 2Z8CA 3B8QA 2PVMA 4WUAA 4RIXA 4ZSLA 3B2WA 2R3FA 2FSMX 3UE4A 4IFCA 3FI8A 5IDPA 4N6YA 3GU6A 2EXCX 2UW4A 3DU8A 1O6LA 2BDJA 3SHEA 4O7ZA 3TDVA 4QP7A 3AD4A 2WMXA 2GNLA 3MPTA 3WE4A 2WMRA 3LFAA 3H30A 5GINE 4ZJJA 4RX7A 2RIOA 5J87A 3PWDA 4YHJA 4BZNA 5CEPA 4WG5A 4B7TA 4CFWA 2OXXA 3CJGA 2CKOA 5M57A 3GP0A 4I5HA 1BUHA 2VX1A 3K2LA 3ORLA 4BZOA 5LJJA 4GKIA 2ITYA 3LXNA 3NEWA 4L68A 5J7HA 2C6LA 2ITPA 3VUGA 5M06A 5D41A 3MVJA 4OBQA 2BFXA 2YIRA 3FQEA 2WTKB 1OZ1A 3IG7A 3ZOSA 4H3QA 4YZMA 2Z02A 2WELA 1YHWA 4PWNA 4R3RA 3VF8A 4C7TA 3ZC6A 4YJUA 3MJ2A 3OY1A 2CGVA 4BBFA 4XUFA 4S2ZA 1ERKA 5LVLA 5HVYA 1Q8TA 3ZU7A 4QMTA 4RIOA 3HGKA 4YC6A 4NIFA 1WVXA 4ACMA 5CSWA 4BTMA 4CT2A 3KB7A 5FQDC 2B9FA 4J8NA 4WHZA 4M7IA 5FBNC 4FA2A 1GOLA 3LCDA 4MBIA 3GT8A 4FKLA 4CRLA 4LM5A 2UW7A 4JXFA 2ETRA 4L01A 4O0XA 2CN5A 4O1OA 4EHZA 4FF8A 3BYUA 3QQLA 3IGGA 4H1MA 4ALWA 2OJIA 4J98A 2C5YA 4BI2A 1MQBA 5LMKC 1UWJA 2I0YA 4G9CA 4BWPA 2PMIA 1PMNA 1B6CB 4CG8A 3TZ7A 3TKIA 5AP1A 4LYNA 3LHJA 3R7IA 2C5VA 4EYMA 1BX6A 2XBAA 4RA5A 4YTHA 3R01A 4FT7A 5EQEA 3GVUA 2O0UA 1NA7A 2BZJA 5ANKA 2XK3A 2VTLA 1DS5A 3NZ0A 3F88A 3Q32A 4ZJIA 5EDQA 1IA8A 3GFEA 1IASA 3VS1A 3OVVA 3GC0A 4J52A 1H1SA 4Z7HA 3QQKA 4LOQA 5IEXA 2I40A 4H3BA 5DRDA 4A9SA 4MHAA 2G2IA 2BZKB 4IWPA 4C02A 5JEBA 2CGUA 3KMMA 1L3RE 4O7SA 4RQKA 3ZM9A 4XV3A 5HOAA 5LWMA 1OITA 3IOPA 5KBRA 2JAMA 4EQMA 3PP0A 4O96A 2YERA 2ZMCA 3PE2A 3W1FA 2BILB 5DHJA 5KZIA 3R9HA 1XBCA 3IOKA 2YCRA 3BQCA 4RJ8A 3EQCA 2PPQA 2O65A 2R3IA 4DGMA 4FT9A 3UBDA 4DITA 4PY1A 3FV8A 4Z9LA 2ONLC 3C4XA 3QXPA 1IRKA 2ZDUA 2ZV2A 3ALNA 4FNWA 2C3IB 4L44A 2ITZA 3OXTA 5DRBA 3RKBA 2P55A 4GKHA 4C61A 4CG9A 2B9HA 2C6TA 2IPXA 5ANIA 2RKUA 3MB7A 1H26A 2WTDA 3DDQA 2Y6OA 2UV2A 3CPBA 3LZBA 1KV2A 1P2AA 4X6RA 4AN3A 5EK7A 3E8CA 2WD1A 4R1YA 3ORXA 5ITAA 5DGZA 3R8LA 2BDWA 3LM5A 4UY9A 5EHOA 3F3WA 3NW6A 1XKKA 4G5JA 2UVZA 3NIEA 2VTPA 4ID7A 2ESMA 4DYMA 5AIRA 2NRUA 4C37A 4EOMA 4MXOA 2BROA 5E8XA 3GGFA 4BDBA 3C5UA 2A0CX 2GHMA 1KE8A 4C2VA 5E8UA 5LCJA 5M44A 1PY5A 3G33A 4BIEA 4FBXA 2YITA 3QWJA 4OGRA 4EBVA 5C8MA 1H0WA 3COMA 4E4MA 3EQDA 3B8RA 1XQZA 3DOGA 3E3BX 1CTPE 3E8DA 1SNUA 4HNIA 5D10A 3MA3A 3U6HA 2B9JA 4CT1A 2CGXA 2Y9QA 5CNNA 5DR6A 5HD4A 3KVWA 4MX9A 4TT7A 4YJOA 5BVOA 1NT2A 4XJ0A 5HG9A 3RTPA 3NUAA 5HE0A 3TTIA 3FZ1A 2OBJA 4JG7A 5B0XA 5A6NA 1X8BA 3QTSA 4CZTA 3ORKA 1Q5KA 3MBLA 3Q04A 4O0SA 2VV9A 1CKJA 3FWQA 3KKVA 4EOJA 2PUPA 5DH3A 3PPKA 3NLBA 2J50A 3NUUA 4E20A 4FTQA 4YUQA 5AA9A 4CKJA 4XP2A 3P4KA 4KKHA 2Y8OA 3GC7A 2UZVA 3UO6A 2WMVA 4GU9A 4FSTA 4DFLA 4E5AX 3FY2A 2WEVA 3FMMA 4FT5A 2VWUA 2Y6MA 3PSDA 4HW7A 5JZJA 2BZIB 5AIKA 2UUEA 3K5VA 3QTIA 4O86A 3NNWA 3PG1A 5IKWA 1KUTA 4I4FA 3T8OA 4BCKA 3W33A 3F6XA 5AUZA 1M2QA 4WO5A 5ANJA 4RVMA 3P86A 4HVGA 2UW8A 3HLLA 4EI4A 5CAOA 4FTNA 4QTCA 4X2JA 4QMQA 1CSNA 2X2MA 3I7CA 4G34A 4MAOA 4J96A 3GCUA 2W0JA 3PZHA 4EEVA 1IAHA 3BHTA 2J9MA 2VWZA 3LFDA 5FRIA 3A7FA 2NP8A 4LMUA 1JSVA 4BI1A 3FEGA 5HBJA 4YURA 2FO0A 5IQAA 2ZM1A 1U4DA 1OBGA 3TI1A 4C4GA 4XHKB 3MH2A 4IFGA 4L00A 4RFYA 3LW0A 4C36A 2VTSA 3P7BA 4DT8A 1WBOA 3I1AA 4ITHA 4LV5A 4BWXA 3PZEA 3QQFA 4FSYA 3U8WA 4L46A 4Q9SA 2CPKE 1Y6AA 4E26A 5FEQA 3GCVA 2PVFA 4DBNA 1WBWA 2X39A 2YLFA 3PWYA 3BIZA 3VIDA 4AGDA 4RX5A 2WTWA 3GFWA 5HNGA 3RPYA 2OG8A 2R2PA 2XEYA 2OF4A 3HA8A 4O1PA 4RGJA 4Y5HA 1GIIA 3CTHA 3QTXA 4FV7A 4IX5A 5IQIA 4YZ9A 1Q3WA 3TIZA 5AAEA 3MIAA 5DMZA 3OW4A 2V22A 2VGOA 4GW8A 4O2PA 4R7IA 1DAYA 3TWJA 4KS8A 3KMWA 2XF0A 2VTRA 2PZIA 2JIIA 2X9EA 2XB7A 3C13A 3OBJA 2YM8A 3QLFA 4DH8A 3ATSA 3MFRA 1J7IA 4CV8A 4EL9A 2J90A 4J97A 1OGUA 3B2TA 1GAGA 1R1WA 4QPMA 3DAJA 3TZ8A 4L6QA 4OT6A 4C34A 4XRLA 4D4SA 1FINA 3IECA 3EN5A 3IO7A 3KA0A 5AX9A 4ZZMA 3VJOA 3RWQA 3ET7A 3G15A 1PRYA 5EDRA 5HCZA 1ZAOA 3RMFA 3I60A 5FTOA 3QTUA 3NIZA 4Y95A 3EQFA 2R3LA 3QU0A 1JLUE 4RC4A 2WMUA 4FL2A 3H9OA 2QOOA 4KIKA 3MY0A 2W7XA 4GH2A 5EYDA 4HGTA 2GCDA 4PDSA 3NW7A 5TR6A 4BCGA 2VUWA 4ZS0A 3CGFA 5DT3A 2XS0A 3QKLA 4A4XA 4EOLA 4QQ5A 5HE3A 4E5WA 5C8NA 1I44A 3JXWA 3MPAA 1DI8A 4PP9A 4QMVA 4FEUA 4BGHA 2H9VA 5KHXA 4PNKA 2BVAA 2X2KA 3LLAA 5C03A 3DT1A 2YM7A 3TTJA 4DH7A 2GPHA 1XJDA 3HV6A 4HNFA 3KULA 4PRJA 4UZDA 5BX0A 2C4GA 4ANSA 5JGDA 3EKNA 4P2KA 4L7FA 4QMYA 2AC5A 4Y8DA 3GXLA 2PU8A 4GU6A 5EM6A 2BRMA 3HX4A 1VYZA 3QRJA 2OI4X 4PTGA 4NM3A 4F1MA 3AD6A 2I0EA 3HZTA 4U7ZA 4DFZE 5J5SA 4X6QC 2W4KA 3LMGA 1OM1A 5EI8A 5M07A 3QD2B 1R3CA 4HPTE 2WMBA 3NNVA 4WSQA 3DV3A 4I93A 4ZK5A 1Y91A 3THBA 3MWUA 2C6MA 3Q9XA 4XBRA 4R8QA 4KSPA 2YABA 3R9DA 3LFEA 3VAPA 5HNIX 2XNPA 2A1AB 3GU5A 4FIJA 3W2CA 3OCSA 3ZLYA 1URWA 5C9CA 4FYNA 5CU6A 4F9YA 1H8FA 1GNGA 3DK7A 5JRQA 4KIPA 4U3YA 3LM0A 4OBPA 5K0KA 5L2WA 4UWBA 5A14A 1YQJA 5E8YA 3LFFA 4WOVA 5HVJA 5M4CA 1BKXA 1F3MC 2HAKA 4H39A 4ALVA 5B2MA 2PE2A 3U6IA 4F08A 3D14A 4QTAA 3ODZX 2V5QA 5AWMA 2CDZA 2VTOA 3NVMB 3Q6WA 3R7UA 4JJRA 1JWHA 4FX3A 3QX2A 1Q41A 2ETMA 3RPOA 5IQGA 3RHXA 4M84A 5DFPA 2QOBA 3LXLA 1KOBA 4WA9A 3D7TA 4DFYA 4ZMEA 3ZDUA 5CAVA 4ZS4A 3CTJA 2FGIA 1RDQE 2W1CA 3BHUA 4U8ZA 3O50A 4IM2A 3QQHA 3Q2JA 4FK6A 3WZDA 2OJGA 3AT2A 3N4VA 2I6LA 2QR8A 2ZV7A 1OBDA 2YEXA 2VTNA 3GEQA 3KVXA 2EWAA 3R00A 1LEWA 2C5XA 2H8HA 2RFEA 4NM0A 2QLUA 3K5UA 2BPMA 2R7IA 4I0SA 4GVAA 2JDRA 4YO6A 4II5A 5A4QA 3PXFA 5ETFA 2PVJA 1JOWB 4FG9A 5DT0A 1PXJA 3LKMA 2GU8A 3ORPA 4YC8A 4DEBA 2SRCA 5GIPE 3SG9A 1CKIA 4QP4A 4XG6A 3OEZA 3R8UA 5DT4A 4M97A 4KKEA 3ZLXA 3UNKA 5GJFA 3MPMA 4RWJA 4L52A 5C26A 1Q97A 3RCDA 5LVNA 4J1RA 2J5EA 4FKSA 3WF6A 5J9YA 4GV1A 4XG7A 4IM3A 4HZSA 3FMHA 2C1BA 3QA0A 4XP0A 4F6UA 3DJ5A 3O96A 4FV6A 2HWOA 3GUBA 3OS3A 4OTWA 5HQ0A 4FKTA 4U97A 3DNEA 5HTCA 2XK8A 5G6VA 2VNYA 3EL8A 4YHTA 4A9YA 4HGLA 4KABA 4GS6A 3ZRMA 5EYCA 4C38A 4NT4A 1ZOEA 2CKQA 4GCJA 3TKUA 3DBFA 4CFFA 1CMKE 5C1QB 2VO0A 4HGSA 4JQEA 4L53A 4ZY6A 5A4LA 1UNLA 5M51A 2UW5A 3MY5A 4LL5A 3SXSA 1XH7A 3TNPC 4DGGA 5K5NA 2J0IA 3POZA 4DG3E 3VUDA 3ZHPC 5HO7A 1MRUA 5LCKA 2OLCA 1YW2A 2E9OA 3EQRA 1Y8GA 4NH1A 3KU2A 3EN4A 3GOPA 1H01A 4PP7A 3NPCA 4FKIA 4BC6A 1YDSE 5LVPA 4D2PA 5IEVA 5IPJA 3FMKA 4TYHB 5TF9A 2R3OA 3MDYA 4JBPA 2VTQA 4N57A 4NTTA 4U40A 4I22A 3OZ6A 1ZOHA 3Q52A 5E8WA 5A54A 1QL6A 3PTGA 5CU3A 3UDBA 4G2FA 4HGEA 3ITZA 2UZNA 3BYMA 3R04A 4ZY5A 4QMMA 2HW6A 3ZO3A 4DGNA 3EQIA 1Q8ZA 3LQ5A 3R8PA 1H25A 4O7RA 4FG7A 3FJQE 3JY9A 4LG4A 4PV0A 4QMZA 5JFWA 2XH5A 2R9SA 1AGWA 5KKRC 2ZVAA 4C4EA 3NSZA 1Y6BA 4MNFA 1P5EA 4QMXA 4JVGA 4EHVA 5CY3A 5I4NA 1PKDA 1CM8A 4OUCA 5FGKA 4I6BA 4C8BA 1LEZA 3MTFA 1IR3A 3GC9A 5J1WA 5A4TA 2B53A 3DTCA 4CYJA 3ZUTA 4G3EA 1UNHA 1ZYJA 3FHIA 3HMIA 4UMPA 5E4HA 1NY3A 3ZSIA 4U44A 4Z3VA 3RNIA 2ZYBA 5DBXA 2C47A 3L1SA 3W2QA 3BV3A 3D7ZA 4BR3A 2VN9A 3G0FA 2VTAA 4NZWB 1STCE 4OBOA 5HZNA 3GB2A 4Y85A 3H9FA 1MRYA 2QOQA 3V8SA 2R4BA 3F69A 2W17A 4F9AA 3VHEA 2O3PA 3RHKA 4F7LA 3ZZEA 1J1CA 2PZPA 3E87A 2WB8A 4KSQA 3R8ZA 4AFEA 2FSTX 4CFUA 2G9XA 5E8TA 5GZ8A 4IX3A 2Z7LA 1FMOE 3SDJA 4YJTA 2PMLX 2X2LA 3QHRA 4XX9A 3K54A 3ZXZA 3F3VA 2ITOA 1MRVA 2FSLX 2OFVA 2W5BA 3VBYA 4YSJA 3ID6C 5HO8A 4QP6A 1W8CA 2HOGA 2VAGA 3QALE 4R5YA 5AV4A 5J5TA 4MWIA 5LMKA 5J95A 3ZO1A 5M09A 4GIIA 1UNGA 3GU8A 3L9PA 4MKCA 1APME 4MF1A 4O0VA 4YNOA 4F99A 3SGCA 3BGPA 3QCSA 4R7HA 4X3FB 3ZBFA 2ZM4A 5FTQA 4JIKA 4IJPA 5T3QA 5CVHA 3T3UA 2XP2A 4IDVA 1HOWA 3E64A 4NTSA 3BKBA 4FZ6A 4GIHA 3TZMA 3EFJA 3PSBA 3D5XA 5CVGA 1ZMUA 2EB2A 4GSBA 3UIXA 4D5HA 2CNVA 1IEPA 2RF9A 3EQBA 4B9DA 2YIXA 4FSNA 3HV7A 4ALUA 1P4OA 3O71A 3Q9ZA 3EKKA 4R1VA 3P23A 3HRFA 3R9OA 1H0VA 2XA4A 4AZVA 4EOIA 2A2AA 4DH3A 4TTHB 3LFCA 3VW6A 1G8SA 3DS6A 1Q8WA 1WFCA 4UZHA 3W10A 5DIAA 1G8AA 2QOCA 3LQ3A 4F4PA 3NW5A 5M53A 3JR1A 2RFSA 5JZNA 4GEOA 4MTAA 1ZYLA 4P90A 5L8KA 4ZTMA 2Z2WA 3R7OA 2CLXA 3CP9A 4AW2A 4ZJVA 4TYJA 4XYFA 2CLQA 3D5VA 5HBHA 3R2YA 5CF5A 1T45A 3KRXA 2H34A 4G9RA 3FL4A 4BZDA 2VO7A 2ONLA 2NNWB 4Q5EA 4PMTA 4IHPA 1UU7A 2W1DA 4O22A 1PKGA 3OG7A 1KE5A 2F2UA 2OIBA 1GZ8A 3OOGA 1QPCA 4KS7A 4MXYA 4DLIA 5CU0A 4KRCA 3BBWA 2IW6A 4G3GA 3BWJA 2VO3A 4L7SA 4ASZA 4HCUA 3OCTA 4FEVA 5EOLA 2QOHA 1V1KA 3DPKA 4FC0A 1Z57A 3IKAA 3QRKA 3OCGA 5D9HA 1Q61A 2X8IA 5GZAA 4I4EA 5IQFA 1B38A 5I9UA 2PMNX 3AMBA 3EOCA 1J91A 3AC8A 4RJ7A 1REKA 4CNHA 3QQUA 3RM6A 1O9UA 4RIYB 4IWDA 3IS5A 4WNMA 3WIKA 4M0YA 4NU1A 4XV1A 4ZLOA 1XH5A 3MFUA 3UZRA 4IAZA 4RIWA 2XM9A 2WTIA 3MTLA 4OW8A 3DQWA 3ZUUA 4JR3A 3S0OA 3MI9A 3A60A 3PIZA 2X7GA 4K18A 1ZXEA 2JEDA 2OWBA 3ZS5A 4F9CA 3DY7A 2QR7A 4O7TA 3NCZA 4JLCA 4D1XA 3D2KA 4I94A 3R7VA 4BN1A 1H00A 4GT4A 5L4QA 2PHKA 4WBBB 3I79A 4FODA 1WBPA 4BDDA 5A9UA 3UZTA 4X0MA 1OI9A 1JNKA 4EQUA 4I6FA 4EQCA 2VTHA 4IJ9A 5CQUA 3QZHA 5TE0A 3R7EA 3Q96A 1OPJA 2PZRA 2WMTA 3TL8A 3WYYA 4FKJA 2P0CA 3PXYA 2QQ7A 2IVVA 3QQGA 2XUUA 2YIQA 4ZZOA 4AGWA 3V8WA 5FM2A 3QD4A 4BYIA 3U54A 4J53A 1GZOA 1OPKA 2P33A 1NVSA 2QHMA 3QD0A 3GENA 4BF2A 5AP4A 4IANA 3WF9A 3VUKA 3TUCA 3G90X 5F94A 4C3PA 3FKLA 2WTKC 4E73A 5HTIA 4IZ7A 4FNXA 4WNKA 2BHHA 3NAXA 4HYIA 4YZBA 3TIYA 1U5RA 1OL6A 3V5QA 5A3XA 4S30A 3F7WA 3HUBA 1H1QA 3CEKA 3FLQA 4XG8A 4JDKA 4FZAB 1ZLTA 3RAHA 2VGPA 3UJGA 2JDSA 4KIQA 2OZAA 2E2BA 3TJCA 3G6GA 5EOBA 5L2TA 3GNIB 3KFAA 4QMPA 5BVDA 4KUJA 4EK8A 3VVHA 4GUBA 1PMUA 5TT7A 2J51A 4EK3A 3R1YA 4O6LA 3HAVA 1SVHA 1JVPP 2H96A 4AA5A 2F49A 2ITTA 2IWIA 2VTTA 3UOJA 4P4CA 2EXMA 3RVGA 3TT0A 1BL7A 4A07A 2IW8A 2BIYA 5F9EA 2OZOA 4YJSA 1U54A 4UWYA 5HESA 4S33A 5IF1A 4FKWA 2C1AA 4ASXA 2C69A 1Q99A 2B1PA 3EYGA 4JL9A 3Q4TA 4BCNA 2CHLA 1H1WA 3K3IA 4QTBA 5AM6A 5K3YA 3UC4A 4FICA 5DNRA 4MBJA 1BMKA 3CD3A 2UW3A 1ZARA 2BRNA 2PVLA 4FZ7A 4FIFA 3HYHA 1SM2A 3LFQA 3DLZA 5F4NA 4CTBA 5F95A 2X8EA 3LIJA 3COIA 5KMKA 1XH8A 4FI1A 3LOKA 4NEUA 5CLPA 3W8QA 5AUTA 3FY0A 4QPSA 5IA2A 2OF2A 2WIHA 4FKGA 5DR9A 2HY81 2WFYA 2BZHB 4IX4A 4Y72A 3MSSA 4HYSA 3FPQA 2QOKA 3D83A 2GNIA 1OKYA 2PVRA 5DE2A 4FK3A 5FEDA 4IH8A 4X21A 5HORA 3OT3A 3VQUA 4EH6A 3I0OA 3QQJA 4BDGA 1OVEA 3RCJA 2AYPA 2ITVA 4C2WA 2I0HA 4CKIA 2X6DA 4JDHA 5D1JA 4GK2A 4EK5A 4U6RA 5F20A 4XMOA 4AT3A 4PMMA 4RG0A 1Q62A 3P0MA 4LFIA 4BYJA 4EC8A 2YAKA 3F82A 3KY2A 5KMLA 3AQVA 3EQGA 5KUPA 2LGCA 1W83A 2XM8A 3JS2A 1H4LA 4FNZA 4QP9A 4AW1A 4IWOA 3FSFA 4BRXA 2ZB0A 3EQPA 4A7CA 4BTFA 2YDIA 2J0KA 4FEQA 1LP4A 4GYGA 4GMYA 3OT8A 4BICA 2JLDA 5CTPA 4FSWA 3Q4CA 3ZRKA 4TWPA 3CKWA 2WQBA 3DKFA 3LXKA 4OTQA 4F7SA 5HU9A 4YJPA 3DK6A 4BDFA 4F1TA 5GNKA 4F09A 4RLLA 3KQ7A 4MXCA 3LJ0A 4DGOA 5AP7A 1PYEA 4QPAA 1YKRA 2ITNA 2XIRA 1ZWSA 3FLWA 4EJNA 4KINA 1J3HA 3PXRA 2JKQA 4RBLA 1G5SA 1GIHA 2YM5A 3H0YA 3LMIA 1PXIA 4RC3A 3MH3A 3VHKA 2DYLA 3PSCA 5ETAA 5HBEA 2GNFA 3DLSA 1I09A 1ZMVA 5AV2A 2UVXA 4JIAA 3FUPA 3BGZA 4A4LA 5IU2A 3RALA 4FSRA 5H3QA 4KBCA 4YJQA 3VBQA 2ITUA 3U4WA 4D1SA 1FVTA 5DEWA 4IC7A 3BWFA 3IPHA 3D2IA 4TNDA 4GJ2A 3DB6A 5JGAA 5IQHA 3I4BA 2UZLA 3LLTA 4X2GA 4YZDA 1WBVA 4PUZA 3KXXA 4WRSA 2HIWA 5JSMA 4MD8E 3VS6A 5EQPA 2C6KA 2DWBA 2F7EE 2QC6A 3DZQA 3KGAA 4U42A 1ZY4A 3RPRA 3P9JA 1PHKA 3ORZA 4G31A 3IGOA 1PF8A 4AOJA 4F1OA 3PA5A 3W2SA 4V0GA 4WT6A 1PXMA 1QPDA 2RGPA 3TUDA 5IDNA 3TV6A 2XIKA 2VWVA 3EZRA 5EQYA 2C6IA 2QVSE 3QKKA 1TQMA 1J1BA 2E9NA 3DFCB 4IDTA 5C01A 4XV2A 1O6YA 4K11A 4NFMA 5LARA 4EH9A 5AUXA 2EVAA 2Y7JA 1UU3A 3RPVA 5BPYA 5FG8A 4PNIA 5J9LA 2WTVA 3DAKA 3BEGA 3L9LA 3EMGA 3QWKA 4MD7E 4LOPA 3CR0A 1U46A 3F2AA 4B0GA 2R3QA 2CJMA 4BCMA 4DG2E 3UVQA 4QNYA 2XJ0A 4E6QA 3ZUVA 4IMYA 2YM6A 4DEIA 5LXMA 4YJRA 3FZOA 3LCOA 2FA2A 3FHRA 4OTRA 2X1NA 3T9IA 3PXZA 3V04A 3F2NA 3ORIA 3P79A 3CY3A 3SX9A 1JKLA 3NUPA 4DH1A 3E92A 4L42A 3R1SA 3DBQA 5CU2A 2BAQA 1ND4A 2PVHA 5AP3A 3QZFA 3KXHA 4ZSAA 4CD0A 3A99A 2J0JA 4AA4A 1CDKA 3COHA 4LQMA 2E9UA 2IO6A 4FTIA 4XV9A 2EU9A 1T46A 5L2QA 4FTKA 2DUVA 3QUEA 2Q0NA 3MW1A 3BHVA 3VULA 4FL1A 5ANOA 2J6MA 5JRSA 4Q5HA 1NVRA 3H4JA 3TN8A 3WBLA 3CS9A 2J7TA 4AW0A 1JKTA 1XHAA 5CSHA 3MVMA 4YPDA 4EHGA 1PMVA 3G9NA 4R5SA 3OTVA 4IX6A 5H2UA 3ENMA 4ANLA 4D9TA 3SKCA 5IA3A 5EI6A 3OWKA 5CSPA 5ANDA 2YN8A 3NNXA 4FSQA 4IBMA 4X7QA 1V0OA 2OO8X 1SVGA 2BRBA 3FYJX 1KE9A 2YM4A 4HZRA 2ZV8A 5IG1A 5K4JA 3CBLA 1SMHA 3Q4ZA 5JH6A 4IAKA 2QO7A 5CF4A 1XBAA 3QHWA 5FXRA 1M2PA 2PK9A 3PVWA 2R7BA 3PJ2A 4ZEGA 3FXZA 4FSMA 4FZFB 2WIPA 4D2TA 4EH7A 5CAUA 5HGIA 1UA2A 3KF7A 4UBAA 4I24A 2XNMA 3NYVA 5EM5A 2QCSA 3O17A 4TYHA 1DM2A 3G2FA 3DKCA 4GFOA 5KMJA 3QCXA 2IVTA 2Y4IB 3KMUA 4WUNA 4F65A 2GNGA 4L3JA 4WIHA 3FZPA 3DKGA 5HX6A 3E93A 4Z16A 2WNTA 4QRCA 5CANA 1GZNA 2IZRA 5KMNA 3IQ7A 2W9ZB 5FLFA 5HG7A 5HNBA 1OPLA 5IQBA 4HOKA 5IA4A 5KO1A 3RNYA 1LUFA 2OGVA 3C4CA 4NW6A 3L8SA 4ENXA 4USFA 1L8TA 4W4YA 4JAJA 4M15A 2C6DA 1JQHA 4M66A 5FWKK 4EZ5A 5EM7A 3V3VA 2OIQA 4J8MA 3VNTA 1M17A 3GOKA 3HMNA 3PE1A 2VZ6A 3M1SA 4DTBA 4XBUA 4FMQA 2WOTA 3QGYA 3PA3A 3MH1A 4ZZNA 4LI5A 3H9RA 3PRFA 1QPJA 2KULA 4QMOA 4TWCA 4YJVA 1U59A 3R9NA 3SRVA 3VO3A 4JNWA 4EYJA 2OSCA 4TYEA 5B2LA 4U5JA 3ZEPA 5FUTA 2C0OA 1H07A 2R3NA 4H3PA 3C4ZA 2FH9A 2QO2A 3VUMA 4AN9A 5M08A 4LRMA 3W18A 3KXNA 4TWOA 3OCBA 4ZY4A 3RAIA 3KL8A 3GI3A 5K5XA 3CPCA 5I5ZA 3C0HA 4APPA 2RFNA 3OUNB 3HRCA 2XNNA 4BCIA 1MUOA 3DA6A 4FG8A 4O7WA 3IW8A 3MFSA 4I6QA 4YLLA 3VS7A 3OXIA 5L2SA 2YACA 3EL7A 2HZ4A 5HTBA 1W98A 3UOHA 4ANOA 5AP6A 3ENHA 4AZTA 4XG2A 5D7AA 2XIYA 3HMOA 5IUGA 1KWPA 2WGJA 5J8IA 3GBZA 4BFMA 4XCUA 2UZEA 4DFBA 5AJQA 1XO2B 1GIJA 4BDEA 4YLKA 2OKRA 3QKMA 4H05A 3BEAA 4MBLA 3UNJA 2IW9A 2GS2A 5DLSA 3G5DA 2ZV9A 3DBEA 4BCHA 5M4UA 3DTWA 2GMXA 2GNJA 3C50A 4UMQA 4YZCA 4ZSGA 4EH5A 3QGWA 5CEOA 2C5NA 2Z60A 4EORA 4CKRA 3O51A 3PUPA 4UB7A 4YGAA 4IAIA 4AZFA 4CQEA 3WILA 4AW5A 3KCFA 2YCFA 2EB3A 3E63A 2W5AA 4H36A 4LV8A 4FTLA 4M69A 4RJ6A 5TOZA 3PY3A 5C27A 1OL5A 3IDBA 3AMAA 3TJDA 4D4VA 4I6HA 3TZ9A 2X8DA 4AG8A 3BLHA 5CEIA 4KKGA 3Q60A 4BCFA 3BELA 2OICA 5E90A 3V5WA 2WTJA 3N9XA 2VWIA 4V04A 2C6OA 4NL0A 4BBEA 4MYGA 3VUTA 4UEUA 1H1PA 2V62A 4EH2A 4F0FA 3BU5A 1YHSA 5CNOA 3UC3A 4O84A 4GT3A 1WBTA 4K77A 3A7HA 4MNEB 4PTCA 5CZIA 4DHFA 3F5XA 4FTMA 4QMNA 3CTQA 2P3GX 4R3PA 3PYYA 2ZDTA 2ZJWA 4CFMA 2R0IA 3P08A 4JOAA 5AR7A 3RZBA 3F3ZA 4AT4A 2HZNA 4BVUA 1VEBA 5HLNA 3LPBA 3V51A 2GQGA 3T3VA 4CQGA 4Z55A 4EONA 3ULZA 3VF9A 5IUHA 2CKPA 5I9YA 4MNEA 4AGCA 3P7AA 1KE7A 4FUXA 3BYVA 3WOWA 3S4QA 4JG6A 1PXNA 2REIA 5CT7A 1Q8UA 5HIBA 1UU9A 4D5KA 4R7BA 1HCLA 2Z7QA 3CKXA 3QCQA 4L3PA 5BMSA 4BIDA 3C4FA 3VRZA 1XWSA 4BTKA 2F7XE 4DT9A 3R8VA 4R78A 1R78A 1MP8A 5EM8A 3S2PA 3F5GA 3SD0A 3OWLA 3HDNA 4I5MA 1R39A 3PJ1A 4A9TA 3EN7A 4NW5A 5I3OA 3V5LA 4BKYA 2RL5A 4BKJA 3EZVA 5M4FA 3E88A 2W1ZA 5ANEA 2BKKA 5DOSA 5JT2A 3TUBA 5C4LA 2JAVA 4EK4A 2PE0A 1E1VA 2R3HA 3FYKX 4U0IA 4FVPA 3CSVA 5AP0A 5CEMA 3DBCA 2XJ2A 3HDMA 4AT5A 4DEAA 3MN3A 3A7JA 4WBOA 4DLJA 4DN5A 5CEKA 4M3QA 4FOBA 2OH4A 4MEDA 3RJCA 3NWWA 1A48A 1W84A 3ZTXA 2F9GA 5FXQA 4ASEA 2XIZA 5JKGA 3F3UA 3PFQA 5A6OA 3FLSA 3TNHA 4YR8A 1EH4A 5D7VA 5CAPA 4J7BA 4AA0A 1Q24A 4USEA 5HICA 3G6HA 3KRJA 2W1IA 2W06A 4IAAA 1AD5A 5KZ0A 1IA9A 2WMAA 4M13A 5HIEA 5ANGA 3I6UA 4IWQA 3QUPA 4KNBA 1YRPA 2ZM3A 5J79A 3FQSA 3Q9WA 4F70A 4M67A 2XCKA 5C8KA 3QCYA 4IXPA 4E6DA 2JIUA 4ZTLA 3W2RA 3C7QA 3MFTA 4CTCA 5L8LA 3ULIA 3LXPA 4ZXTA 5HVKA 5CVFA 2BCJA 5GZ9A 2WMSA 3CJFA 4FTRA 1ZMWA 4EUTA 4DC2A 4WG4A 3ZFMA 3KC3A 4HCTA 4PMSA 1U5QA 3DCVA 2HENA 3LAUA 3FL5A 5FP5A 4O0RA 4CYIA 1JBPE 3GC8A 4DH5A 3MY1A 3NRMA 4O38A 4C59A 1OIQA 2ITWA 3O8PA 4FR4A 2WQOA 4IB1A 3I5NA 3TNQB 3FXXA 2WMQA 2IZSA 2PUIA 1OIUA 1PXLA 2BRGA 2HZIA 4ARKA 3DB8A 5IA0A 4BCJA 2X7OA 1Z9XA 4ANNA 1YXXA 5A46A 5H9BA 3UTOA 4L8MA 4F63A 4IE9A 4LUDA 5M4IA 4QP2A 2OU7A 4FV8A 2EUFB 4RPVA 3KRWA 3NYNA 5AR4A 4RJ4A 3U9NA 3EH9A 1VJYA 3E7VA 3H0ZA 4RFZA 4GG5A 3RINA 4MH7A 2X6EA 3UMXA 3MGYA 4BTJA 4ONAA 4R6VA 2CCIA 2R3JA 2OJ9A 3W8LA 1S9IA 4W8DA 3F66A 4QTDA 4M12A 4J71A 3HL7A 1XH4A 2JC6A 3RM7A 3W2PA 3P7CA 4YTCA 3O23A 2VTMA 4RZWA 3UO4A 1JSTA 4G3FA 3FQHA 3TKHA 1WAKA 4NUSA 4EC9A 4X3FC 4EWHA 2JD5A 5EI2A 3A8WA 5E9EA 4ACDA 4PDPA 4PPCA 4PX6A 3Q9YA 4LGHA 5G1XA 5E7RA 3PIXA 5IH6A 3Q53A 2BUJA 4QYGA 5FD2A 2YIWA 5CZHA 3SV0A 4IVDA 4OTHA 5ACBC 3L9MA 4E6CA 5HX8A 5BNJA 1IAJA 3PXQA 2UVYA 1H08A 4I1ZA 2GTNA 4LOOA 3KK8A 2X0GA 2IN6A 3KRLA 1W82A 5BVEA 4L3LA 1P4FA 2O63A 1UV5A 2CNQA 3SW4A 2WMWA 2YJRA 3EN9A 4Y5QA 3PLAE 2PZ5A 2BKZA 5HE2A 2HK5A 1Q3DA 3UYSA 3BV2A 3AC1A 4AQCA 1LPUA 1A9UA 3OWJA 4O7VA 4C3RA 5DYJA 2BR1A 3QXOA 4A06A 3TEIA 3R9RA 3VBTA 4Y83A 5K4IA 2NO3A 3HNGA 3WYXA 4RT7A 2R3PA 3IDPA 4NCTA 3D4QA 4WSYA 3WI6A 2YIYA 1TKIA 3QC4A 4IVAA 4X2KA 3QRUA 5IZFA 4NKSA 4ZTNA 5EG3A 5EW3A 5L3AA 2WQMA 3FE3A 4FSZA 2CNUA 4QD6A 2W1FA 3JY0A 2XKFA 4K1BA 5BUIA 3R71A 4AOTA 4DEEA 4DFNA 1K9AA 5GHVA 3PLSA 3MA6A 1AQ1A 2W99B 4FV4A 5H8GA 5IQDA 3CQWA 3HV4A 4NJDA 2WXVA 2CKEA 3V5JA 5JQ5A 3ZEWA 5L8JA 2GHGA 4FV1A 4N4SA 3ROYA 4W9XA 3FC2A 4M68A 1XH6A 4APCA 5T6KA 4CEGA 3PVBA 4F9BA 5B7VA 5JFXA 4BBMA 4EOPA 2XNEA 4YPSA 1YDRE 4XLIA 4EH3A 3D9VA 3BPRA 3KULB 5ICPA 2GDOA 4YO4A 1FVRA 3NUXA 4HJOA 3Q5IA 4PL5A 4RLKA 2GTMA 2XRWA 4P5QA 2JITA 4JI9A 2LAVA 5HE1A 2J0LA 5JN2A 5AV1A 2GS7A 3OOMA 3R1NA 2Z7RA 1B39A 3Q2MA 5D12A 4AXAA 2I7QA 4G6NA 2B55A 4QMWA 5AP2A 2KTYA 4G1WA 3KCKA 3O7LB 5HO6A 2JKMA 5DG5A 1RW8A 1BL6A 3KEXA 4L43A 5CXZA 1YI4A 1DAWA 3I0QA 4WRGA 2WOUA 4U3ZA 3DXQA 2P2IA 4OTGA 2VX3A 4O0TA 4BIBA 2OFUA 4OTDA 1ZRZA 3OXZA 2O64A 4LRKA 2YWPA 4EH8A 2W1GA 3P1AA 2RFDA 4IVCA 2XK7A 4RX9A 3OROA 4HYHA 3W16A 1CKPA 3GCSA 5FDPA 2J2IB 4O2ZA 3BHHA 2R3RA 3LCSA 4HCVA 4QYEA 3UPXA 1FBNA 5HCYA 1ZZ2A 2QOFA 3P78A 1OL2A 2XMYA 1YXTA 4WNOA 4D2RA 2FUMA 2OH0E 1M7NA 3E7OA 1XR1A 2F7ZE 2IZUA 4XEYA 1OL7A 5CSVA 5ETCA 4YHFA 1M2RA 2ZMDA 4RRVA 1SZMA 3TNWA 3BLRA 3C4WA 4A9RA 4JX7A 5DN3A 3ZFXA 4MD9E 3S3IA 3UZPA 5JGBA 1LR4A 3REPA 2X9FA 3PIYA 3SC1A 4FEWA 4QQJA 3BRBA 2ERZE 2W4OA 2WZJA 4FYOA 3EFLA 3ODYX 4AGUA 2F57A 4RFMA 1WBSA 2G01A 3K3JA 5KCVA 5I9ZA 2BTRA 1DI9A 3JVSA 4XG9A 3VW8A 3UQCA 3OBGA 5GJGA 4BDJA 5BYLA 4FVRA 2YM3A 4G3DA 4FTCA 5CSXA 3HP5A 2B7AA 3OTUA 5IISA 3QYWA 5FP6A 3OC1A 3IONA 3ZXTA 4OAVB 3EYHA 4O27B 1ZYDA 1JKKA 4X2FA 2BAKA 5EW8A 4CLIA 4E8AA 2YZAA 3DDPA 3R0TA 3AOXA 4K0YA 5IA5A 1SNXA 4CV9A 1OIRA 4RC2A 5AUYA 1W0XC 1WCCA 2CSNA 3F7ZA 5E1EA 3POOA 4U79A 4BDHA 5AR2A 4FL3A 4MXAA 5CYIA 2BDFA 3PRIA 2QI8A 2W4JA 4TZRA 1R0PA 4FIGA 4PF4A 5T68A 4D2WA 3GU7A 2PZYA 2W5HA 4W9WA 2UW9A 3AXWA 4AAAA 4GK4A 5HIDA 3R02A 1PMEA 4LRJA 3V6RA 3LFBA 2YHVA 2YA9A 4TNBA 4RWLA 4UYNA 3D5UA 4UMUA 4LMNA 3MIYA 5A4EA 1WBNA 3LVPA 4CLJA 1Q4LA 4D0WA 5IH4A 2G1TA 3D15A 1OKZA 2PUUA 3DFAA 4FZDB 1H28A 4YBKA 5CS6A 1BI7A 3KXGA 3UG2A 3WF8A 3UNZA 1M52A 3E8NA 1WVYA 2QLQA 3Q4UA 4DINA 3FC1X 2OXYA 4E93A 1YXSA 4O21A 3FZSA 2IVUA 4IVBA 3V6SA 3ZLSA 2R3GA 5DA3A 4FNYA 4ITJA 3QLGA 4U80A 4YNEA 5TKDA 2CMWA 3U51A 4G5PA 4OAUC 3OWPA 2PE1A 3MH0A 4JS8A 4XS2A 5AV0A 5AEPA 4TYGA 2JDTA 3OD6X 2VD5A 3ZFYA 4C33A 4BCQA 2B54A 4L9IA 5GIOE 2YZLA 4QP3A 3MS9A 4I21A 4C58A 5A4CA 3RAKA 5J9ZA 4ZP5A 4AZWA 2WQNA 2GFSA 5JQ8A 3CE3A 2CN8A 3VWAA 3R7GA 4UMRA 3HAMA 1K3AA 4DBXA 1YOLA 3MV5A 3S95A 3W32A 3HVCA 4A9UA 5L6PA 5JMSA 4WKQA 2UZWE 2RSVA 1BLXA 4EK6A 5KX8A 2X81A 2I1MA 4JX3A 3HMPA 4GVJA 4EWQA 3U55A 4HVDA 4ZIMA 2OW3A 3OP5A 3WIGA 4BWKA 3VBVA 2PVYA 4HVSA 4I5CA 3SA0A 4RWKA 3E62A 3Q3BA 3UODA 4FTUA 4NCTC 3FBVA 4MCVA 4ACGA 3W2OA 4BGQA 1Y8YA 4ANMA 2JGZA 2C30A 4IZAA 3NNUA 2G2HA 4Q9ZA 3SVVA 5FXSA 4F7JA 1SVEA 1NW1A 4ZSEA 4ZTHA 3BU6A 5FEEA 4OR5A 3DBDA 3MYGA 4JDJA 4RWIA 4FEXA 4W4VA 5CWZA 3VS3A 3AT3A 3E5AA 1BI8A 1GJOA 4KBAA 4AZSA 3GQLA 4IAYA 2WAJA 4JG8A 3VS5A 4CFXA 4IQ6A 2GS6A 2XYNA 3A7IA 4DG0E 1GY3A 2C6EA 3NYOA 4DFUA 3F5UA 3M42A 3ZH8A 4H58A 3UGCA 1OKWA 4AU8A 3RK9A 3UP2A 3UP7A 2UZOA 4FV0A 5AX3A 3LJ2A 4JAIA 3TV7A 2ITQA 3TACA 3R21A 3V01A 2PSQA 4GG7A 4OLIA 3RZFA 1PXOA 4QMSA 2B52A 3MVLA 3UPZA 4D9UA 3EFWA 4FKQA 3ZDIA 2XRUA 2PTKA 3WZJA 5ETIA 1OIYA 1JSUA 2WO6A 5EHLA 3MJ1A 4YZNA 4JQ8A 5GJDA 3ZONA 5DI1A 3C9WA 4RA4A 2F2CB 4C4JA 4JBVA 3SOAA 3N4UA 4JR7A 3PG3A 2B9IA 2R0UA 3BI6A 3QTZA 2C3KA 4FKRA 4JDIA 4WD5A 5LOHA 2UZDA 1H24A 4FVQA 4EOKA 2AC3A 1M7QA 1URCA 4LL0A 1YI3A 2YDJA 3NUNA 3EN6A 2QU5A 5D11A 1UVRA 1KV1A 4TWNA 3TDWA 5I0BA 3TV4A 1HCKA 4B6LA 4IM0A 3CD8A 5FBOA 1RQQA 2C5OA 2QONA 3R22A 4PDOA 5E8ZA 2VTJA 3NX8A 2XKDA 3VUIA 4Y73A 1Y57A 5CT0A 3W55A 3D5WA 2OJJA 2RG5A 3N51A 3I7BA 3ZYAA 4X2NA 5HEZA 2BFYA 2YWVA 1FMKA 3AC5A 4PL3A 5J1VA 3PJ3A 3FZTA 4S34A 4PTEA 3L8XA 1TQPA 4G6OA 3PXKA 3D94A 4KBKA 5BVKA 5JK3A 4AS0A 4EOOA 3PJ8A 4PDYA 3R2BA 2JKKA 2C0IA 2R5TA 1J7UA 2VWXA 1VR2A 5HI2A 2PY3A 4BB4A 1O6KA 2A4LA 3DZOA 4LGGA 2C3LA 1FGIA 1TQIA 3A7GA 4FTTA 4CMOA 4MQ1A 3A61A 4FKUA 3JYAA 3IK3A 3FI4A 5E8SA 5J7BA 4X3JA 4AACA 3BYOA 5JFSA 4B99A 4O6EA 2YCQA 4XRJA 4GJ3A 1JKSA 3H10A 4DCAA 3FLNC 2XEZA 4KB8A 5KE0A 1W7HA 4DEHA 5H8EA 1MQ4A 3OEFX 3VS2A 4O7NA 2WKMA 4O0YA 4EZ7A 3DQXA 4FV3A 3KF4A 3SAYA 2B4SB 3NDMA 5CI7A 4PMPA 1H1RA 1XBBA 4O82A 4UMTA 4DFXE 3G0EA 3HRBA 3HV3A 5AM7A 2O5KA 2ZAZA 3IW4A 3LCKA 4QP1A 5DR2A 4F0GA 3QF9A 4RIWB 3LMHA 4PQNA 2A27A 1ZYSA 3UIUA 3KXMA 2Y4IC 4E4NA 3PVUA 1H27A 4M0ZA 4UALA 4XLVA 3R63A 4HYUA 3RK5A 4ZTRA 3OF0A 4U43A 4TL0A 5C4KA 3LE6A 4QQCA 4K33A 3EJ1A 4RVTA 2B0QA 4B8LA 1VYWA 3SLSA 3UQFA 2BRHA 3PP1A 4U81A 3OMVA 4C57A 4FTOA 2WQEA 4AZEA 4BDIA 3A4PA 4C4FA 5CALA 1FOTA
chains in the Genus database with same CATH superfamily
3RGFA 4CMTA 3F3TA 3HECA 4QYFA 2WTCA 3FI3A 4QYHA 5F1ZA 2EXEA 4ASDA 4G17A 4B4LA 3PY1A 3QL8A 5EKOA 4R77A 2VU3A 4IACA 2V7AA 5FTGA 4CFVA 3CXWA 4D2SA 4V01A 1YVJA 1YOMA 2YJSA 1OUKA 3E3PA 3SQQA 4RIXB 4EOQA 4XNEA 3U4UA 5BYYA 2IG7A 4UN0C 3F5PA 4HPUE 2J0MB 1NVQA 2A98A 4DA5A 2OZAB 3A2CA 3NS9A 3OHTA 5CEQA 4TXCA 4EOSA 4NM5A 3LFSA 4UXLA 5FM3A 5KHWA 2W05A 4CVAA 2PYWA 3QA8A 4S31A 5IA1A 1FPUA 2ZOQA 2GQRA 5L6OA 3O0GA 4Z7GA 2W1HA 3OFMA 3R30A 3PVGA 3FZRA 1U54B 5BVFA 2YLEA 3C4EA 2PMOX 5CX9A 3KK9A 2UZBA 2BALA 4KD1A 4D2VA 2FYSA 5DPVA 4TYIA 4E5BA 1WZYA 4AF3A 3D0EA 3ACKA 5AA8A 2JBOA 1W2DA 5DWRA 4NWMA 4IB5A 4AE6A 4F64A 3UG1A 2GQSA 1XMLA 4C62A 2XNGA 3DXPA 2QO9A 3ELJA 4M14A 2BHEA 4NIFB 3CQUA 3IW5A 2JDOA 2XK4A 4UWCA 4YBJA 4ENYA 2A19B 5AP5A 3ZM4A 5HG8A 4L67A 4N0SA 3UOKA 3ZO4A 4JRVA 3GQIA 5CASA 3HEGA 2PVKA 2QU6A 4E4LA 1G3NA 4BI0A 2R64A 4FKOA 5CQWA 3ANRA 2UZUE 2QNJA 5EKNA 2PULA 3L8PA 3WF5A 3EIDA 4CMUA 3EWHA 4D4YA 4X3FA 4ZTSA 3R7YA 5EH0A 1FGKA 3EB0A 3P5KA 4YTFA 3TMOA 5IH5A 5EW9A 3QUDA 3ZSHA 3OY3A 4YLJA 4AP7A 4EUUA 4I41A 4ZMFA 5IUIA 4RX8A 2UW0A 1REJA 2DS1A 1PYXA 3R28A 4QQTA 2NRYA 2WHBA 5HLPA 4CXAA 3EFKA 4AFJA 3A62A 5KNJA 4FSUA 4DAWA 3ZBXA 5EDPA 3C5IA 4NFNA 4GK3A 3I81A 2VWBA 3U6JA 4FUYA 3IW7A 5BUJA 2QHNA 3CIKA 4RSSA 5M56A 3FLZA 4EHEA 4E6AA 3HKOA 4C4IA 2PL0A 5IMEA 4FE2A 1QCFA 3AG9A 4F7NA 2YDKA 4IW0A 1XH9A 3CGOA 3N4TA 4KIOA 2PVNA 4KWPA 2VO6A 3TNIA 3VBWA 4P7EA 2W9FB 2PUNA 4IZYA 5DVRA 2IEWA 3LQ8A 3TG1A 4C3FA 4D55A 4F6WA 1ZY5A 2J4ZA 4RVLA 2Y0AA 3CCNA 3QBNA 3QAME 5EHYA 2V7OA 3U87A 3MB6A 3I5ZA 5AAGA 1PJKA 1ATPE 1QPEA 4B8MA 2QG5A 2VRXA 2E9PA 3UO5A 3WARA 5EYKA 5KMMA 5AFVA 1ZZLA 2AUHA 3SOCA 1PW2A 3BU3A 2QOIA 5H8BA 4BY9E 2HZ0A 2PWLA 5LVOA 3CQEA 3NMUF 2XZSA 5M55A 4D4RA 3DJ6A 4RVKA 2VWYA 4CFNA 4FKVA 4JBQA 4Y46A 4E7WA 1JAMA 4MF0A 4E3CA 4C0TA 3QD3A 1GZKA 1YXVA 2C0TA 4MXZA 3ZRLA 1OECA 2XIXA 3HMMA 4PL4A 2HXQA 3II5A 5FDXA 5HG5A 4RIYA 3FMJA 4QTEA 2E9VA 2WU6A 5AADA 3SG8A 2VNWA 2BIKB 4BHZA 2W1EA 1K2PA 5BVWA 3R73A 4W8EA 2X4FA 4CZYB 2JKOA 3COKA 5I3RA 1UKHA 4ZAUA 4XH6A 2XKEA 3BLQA 2JFLA 4FJVA 4XOZA 3LFNA 5E1SA 4V0GB 5LMAA 3TXOA 3ORMA 4DF3A 2FB8A 3F9NA 4BKZA 2J5FA 2QKWB 2V55A 2WU7A 3NAYA 3R6XA 4FIIA 5AR8A 2I0VA 3ZLWA 2QURA 3MESA 2QKRA 1OMWA 4L45A 5BQ0A 4KRDA 5AUUA 2XK9A 3S00A 4O7LA 3M11A 4RZVA 2ERKA 2O2UA 3ZC5A 1KE6A 4NJ3A 4YP8A 3NGAA 3Q5ZA 3FMNA 4LGDA 4FTJA 2V0DA 5K0XA 3ZCLA 4CZUA 3EHAA 4FV5A 2YFXA 3DAEA 3M2WA 3RWPA 3VRYA 4ZOGA 3W0QA 4DE4A 4N6ZA 4I0TA 5EYMA 4O4FA 2HELA 2P2HA 3NVKI 3I6WA 4I92A 3JVRA 2XYUA 1TVOA 4ITIA 4CSVA 4XP3A 3AC3A 4MVFA 4BCOA 2QD9A 4H1JA 4I0RA 2W96B 2YAAA 4HVHA 1R0EA 2UW6A 4BDCA 3BE9A 5CXHA 1QMZA 3KREA 3BGQA 2XNBA 1UKIA 4OTFA 4IIRA 4TW9A 4FV9A 4CCBA 4KAOA 3QTRA 3RBWA 4EKLA 3NR9A 5KBQA 4O7YA 3C0GA 4QP8A 3AMYA 4XOYA 3FMEA 5CF8A 1W2FA 3BCEA 3QX4A 2ZB1A 3T9TA 4EZ3A 4IZ5A 4I20A 4BCPA 4MQ2A 4FOCA 3V5TA 4E4XA 5CAQA 4OTPA 4J99A 2UZTA 5JFVA 4QOXA 2XCHA 5CENA 2VTIA 5AUVA 4UX9A 1VZOA 1J7LA 4U45A 4IC8A 3QYZA 3UMWA 3JUHA 2ETKA 3CY2A 5BVNA 4FTAA 3RAWA 4EKKA 2Q83A 4FV2A 4NKAA 5HHWA 3CC6A 2XNOA 4FGRA 3WZUA 4ANQA 2BTSA 2JIVA 3WZEA 3ZO2A 5BUEA 4MK0A 3ROCA 4EBWA 3HP2A 3TCPA 3UVPA 2G15A 2XVDA 3SXFA 4FT3A 1YWRA 5HD7A 4DCEA 1PXPA 4WG3A 3PY0A 3RK7A 3SXRA 2FSOX 3JPVA 4KA3A 4DGLC 2C68A 4O0WA 5L2IA 5HKMA 5EFQA 1Q8YA 4OT5A 4ERKA 2GFCA 3KN6A 3LJ1A 3TM0A 3DXNA 4RQVA 3AC2A 1OL1A 4IEBA 4C35A 4QYYA 5AR3A 4AE9A 4IB0A 2HYYA 4LUEA 4I23A 4U9AA 3Q6UA 5IEYA 3DKOA 3PJCA 3W0RA 4V05A 4Q2AA 4NK9A 1YI6A 2GHLA 4JQ7A 4YC3A 5E92A 3DJ7A 3E8EA 3IDCA 2XK6A 4YMJA 3DK3A 4ZTQA 3R8MA 3AT4A 5E91A 2ITXA 3SW7A 4ORKA 3KXZA 2GNHA 2OK1A 1F5QA 2DQ7X 5KMIA 2VWWA 2YCSA 4W4XA 3EQHA 3O8TA 2H6DA 4CGAA 4G6LA 4PPAA 4I5PA 2X7FA 3C1XA 2XKCA 3V8TA 2F4JA 4QEBA 2O8YA 2XBJA 3NUSA 3FDNA 2WPAA 1F0QA 4GL9A 1OKVA 3ORTA 4CCUA 4DHZA 5LQFA 3BQRA 3QFVA 4DTKA 3A8XA 3SRVB 3VBXA 3O2MA 5LMBA 4TY1A 4ZSJA 2IJMA 3ATTA 4K9YA 3NCGA 1YHVA 4O0UA 4JT3A 1YOJA 4GFMA 4U41A 5I9XA 3FSKA 4AOIA 4IADA 3WE8A 2JBPA 3ACJA 3UIBA 4W4WA 1UWHA 4ZLZA 4QMLA 2R3MA 3HV5A 5KKRB 1BYGA 4JBOA 4M8TA 4IB3A 4YJNA 5ACKA 4UXQA 4KIKB 4BHNA 1PXKA 4BL1A 3BL9A 4BGGA 4DTAA 4USDA 3R83A 4GT5A 4UYAA 4ANBA 2X4ZA 4CRSA 5IQEA 3ZZWA 3ETAA 3FXWA 3O7LD 4GRBA 5KMOA 3QRTA 4FIEA 3G9LX 4K8AA 1V0BA 4C4HA 3H3CA 3WZKA 5E8VA 2OJFE 2R3KA 3AD5A 5AR5A 3FAAA 3QTQA 3F61A 3G51A 4FT0A 2JDVA 1KSWA 5CI6A 2CCHA 4JRNA 1SYKA 4MWHA 4QT1A 3ZMMA 3VN9A 4RJ5A 5CU4A 4BDAA 3FLYA 3QC9A 5AAFA 4FIHA 3FKNA 4F9WA 2WEIA 3C0IA 3LCTA 3O8UA 3F2RA 3BE2A 3AGMA 3FKOA 2IVSA 4TN6A 3U9CA 4FGBA 4YU2A 3KN5A 3VUHA 4O83A 3L8VA 1YWVA 2YISA 4HVIA 1M14A 4DEDA 3AKKA 3UOLA 3S1HA 4S32A 4TRLA 4D58A 2XJ1A 3HUCA 2Q0BA 2VX0A 4K2RA 4NSTA 5BYZA 1FQ1B 3RI1A 2XAOA 4AN2A 4MXXA 4WNPA 4D28A 2HCKA 4PPBA 3UVRA 5BMMA 4M69B 1FVVA 3BZ3A 3GCPA 4J95A 5DEYA 1RE8A 1RJBA 5I9WA 2FVDA 2IZTA 1OB3A 4YTIA 3UQGA 4AX8A 3A4OX 4O91A 5I9VA 2RG6A 5AUWA 4FKPA 4ERWA 4QMUA 4ZLYA 4YSMA 3BYSA 1YXUA 3QTWA 3QZIA 5L6WL 3KRRA 3FMDA 3VC4A 4F0IA 3BBTB 2C3JA 3FI2A 4I3ZA 1WVWA 4G16A 3C51A 3ERKA 3R1QA 3DGKA 5HCXA 4TPTA 4E1ZA 2OIDA 4A4OA 2Y4PA 4OTIA 5AMNA 1YWNA 4NYEA 4EJ7A 4QO9A 5LWNA 3UIMA 4JMQA 4AXFA 3VS0A 5CF6A 3PPZA 4GYIA 1P14A 1ZYCA 3FPMA 4K6ZA 3MVHA 1E9HA 4EH4A 3ALOA 1KOAA 1Z5MA 1VLRA 4G3CA 3RP9A 2JFMA 3FMLA 5HLWA 3VQHA 5IQCA 4N70A 3BX5A 4QNAA 4GUEA 4UV0A 2HW7A 2ACXA 3D7TB 3ANQA 4XG4A 2HXLA 3DNDA 3GCQA 4AUAA 3AC4A 1YDTE 3ORNA 1IG1A 4D1ZA 5B2KA 3L9NA 2G2FA 2QODA 2QOLA 4BDKA 4RMZA 4NM7A 2GSFA 1UU8A 5K9IA 5LVMA 1V0PA 4D0XA 4IAFA 2HY0A 3NYXA 3OUKA 3PA4A 1E1XA 3RPSA 4DEGA 2BMCA 2NPQA 2Z7SA 4O4EA 4R3CA 5TO8A 3UYTA 4F6SA 3WF7A 1TZDA 2OXDA 3QZGA 4GFGA 3QRIA 1A06A 3NUYA 4RJ3A 4AWIA 1WMKA 3HA6A 3PPJA 3ZSGA 2HWPA 3GU4A 3V5PA 4O81A 3BHYA 1ZOGA 1JPAA 3VS4A 4TKSA 4ACCA 4P5ZA 5AV3A 2P4IA 4ACHA 3CLYA 5IMXA 4XG3A 3PDTA 1S9JA 2QG7A 2BAJA 1OUYA 2CGWA 3IW6A 3OW3A 1NXKA 3VJNA 5HU3A 3AGLA 4AXCA 2Z8CA 3B8QA 2PVMA 4WUAA 4RIXA 4ZSLA 3B2WA 2R3FA 2FSMX 3UE4A 4IFCA 3FI8A 5IDPA 4N6YA 3GU6A 2EXCX 2UW4A 3DU8A 1O6LA 2BDJA 3SHEA 4O7ZA 3TDVA 4QP7A 3AD4A 2WMXA 2GNLA 3MPTA 3WE4A 2WMRA 3LFAA 3H30A 5GINE 4ZJJA 4RX7A 2RIOA 5J87A 4DDIA 3PWDA 4YHJA 4BZNA 5CEPA 4WG5A 4B7TA 4CFWA 2OXXA 3CJGA 3W0SA 2CKOA 5M57A 3GP0A 4I5HA 1BUHA 2VX1A 3K2LA 3ORLA 4BZOA 5LJJA 4GKIA 2ITYA 3LXNA 3NEWA 4L68A 5J7HA 2C6LA 2ITPA 3VUGA 5M06A 5D41A 3MVJA 4OBQA 2BFXA 2YIRA 3FQEA 2WTKB 1OZ1A 3IG7A 3ZOSA 4H3QA 4YZMA 2Z02A 2WELA 1YHWA 4PWNA 4R3RA 3VF8A 4C7TA 3ZC6A 4YJUA 3MJ2A 3OY1A 2CGVA 4BBFA 4XUFA 4S2ZA 1ERKA 5LVLA 5HVYA 1Q8TA 3ZU7A 4QMTA 4RIOA 3HGKA 4YC6A 4NIFA 1WVXA 4ACMA 5CSWA 4BTMA 4CT2A 3KB7A 5FQDC 2B9FA 4J8NA 4WHZA 4M7IA 5FBNC 4FA2A 1GOLA 3LCDA 4MBIA 3GT8A 4FKLA 4CRLA 4LM5A 2UW7A 4JXFA 2ETRA 4L01A 4O0XA 2CN5A 4O1OA 4EHZA 4FF8A 3BYUA 3QQLA 3IGGA 4H1MA 4ALWA 2OJIA 4J98A 2C5YA 4BI2A 1MQBA 5LMKC 1UWJA 2I0YA 4G9CA 4BWPA 2PMIA 1PMNA 1B6CB 4CG8A 3TZ7A 3TKIA 5AP1A 4LYNA 3LHJA 3R7IA 2C5VA 4EYMA 1BX6A 2XBAA 4RA5A 4YTHA 3R01A 4FT7A 5EQEA 3GVUA 2O0UA 1NA7A 2BZJA 5ANKA 2XK3A 2VTLA 1DS5A 3NZ0A 3F88A 3Q32A 4ZJIA 5EDQA 1IA8A 3GFEA 1IASA 3VS1A 3OVVA 3GC0A 4J52A 1H1SA 4Z7HA 3QQKA 4LOQA 5IEXA 2I40A 4H3BA 5DRDA 4A9SA 4MHAA 2G2IA 2BZKB 4IWPA 4C02A 5JEBA 2CGUA 3KMMA 1L3RE 4O7SA 4RQKA 3ZM9A 4XV3A 5HOAA 5LWMA 1OITA 3IOPA 5KBRA 2JAMA 4EQMA 3PP0A 4O96A 2YERA 2ZMCA 3PE2A 3W1FA 2BILB 5DHJA 5KZIA 3R9HA 1XBCA 3IOKA 2YCRA 3BQCA 4RJ8A 3EQCA 2PPQA 4AXEA 2O65A 2R3IA 4DGMA 4FT9A 3UBDA 4DITA 4PY1A 3FV8A 4Z9LA 2ONLC 3C4XA 3QXPA 1IRKA 2ZDUA 2ZV2A 3ALNA 4FNWA 2C3IB 4L44A 2ITZA 3OXTA 5DRBA 3RKBA 2P55A 4GKHA 4C61A 4CG9A 2B9HA 2C6TA 2IPXA 5ANIA 2RKUA 3MB7A 1H26A 2WTDA 3DDQA 2Y6OA 2UV2A 3CPBA 3LZBA 1KV2A 1P2AA 4X6RA 4AN3A 5EK7A 3E8CA 2WD1A 4R1YA 3ORXA 5ITAA 5DGZA 3R8LA 3W0NA 2BDWA 3LM5A 4UY9A 5EHOA 3F3WA 3NW6A 1XMMA 1XKKA 4G5JA 2UVZA 3NIEA 2VTPA 4ID7A 2XALA 2ESMA 4DYMA 5AIRA 2NRUA 2IF8A 4C37A 4EOMA 4MXOA 2BROA 5E8XA 3GGFA 4BDBA 3C5UA 2A0CX 2GHMA 1KE8A 4C2VA 5E8UA 5LCJA 5M44A 1PY5A 3G33A 3BLAA 4BIEA 4FBXA 2YITA 3QWJA 4OGRA 4EBVA 5C8MA 1H0WA 3COMA 4E4MA 3EQDA 3B8RA 1XQZA 3DOGA 3E3BX 1CTPE 3E8DA 4O4DA 1SNUA 4HNIA 5D10A 3MA3A 3U6HA 2B9JA 4CT1A 2CGXA 2Y9QA 5CNNA 5DR6A 5HD4A 3KVWA 4MX9A 4TT7A 4YJOA 5BVOA 1NT2A 4XJ0A 5HG9A 3RTPA 3NUAA 5HE0A 3TTIA 3FZ1A 2OBJA 4JG7A 5B0XA 5A6NA 1X8BA 3QTSA 4CZTA 3ORKA 1Q5KA 3MBLA 3Q04A 4O0SA 2VV9A 1CKJA 3FWQA 3KKVA 4EOJA 2PUPA 5DH3A 3PPKA 3NLBA 2J50A 3NUUA 4E20A 4FTQA 4YUQA 5AA9A 4CKJA 4XP2A 3P4KA 4KKHA 2Y8OA 3GC7A 2UZVA 3UO6A 2WMVA 4GU9A 4FSTA 4DFLA 4E5AX 3FY2A 2WEVA 3FMMA 4FT5A 2VWUA 2Y6MA 3PSDA 4HW7A 5JZJA 2BZIB 5AIKA 2UUEA 3K5VA 3QTIA 4O86A 3NNWA 3PG1A 5IKWA 1KUTA 4I4FA 3T8OA 4BCKA 3W33A 3F6XA 5AUZA 1M2QA 4WO5A 5ANJA 2NYAA 4RVMA 3P86A 4HVGA 2UW8A 3HLLA 4EI4A 5CAOA 4FTNA 4QTCA 4X2JA 4QMQA 1CSNA 2X2MA 3I7CA 4G34A 4MAOA 4J96A 3GCUA 2W0JA 3PZHA 4EEVA 1IAHA 3BHTA 2J9MA 2VWZA 3LFDA 5FRIA 3A7FA 2NP8A 4LMUA 1JSVA 4BI1A 3FEGA 5HBJA 4YURA 2FO0A 5IQAA 2ZM1A 1U4DA 1OBGA 3TI1A 4C4GA 4XHKB 3MH2A 4IFGA 4L00A 4RFYA 3LW0A 4C36A 2VTSA 3P7BA 4DT8A 1WBOA 3I1AA 4ITHA 4LV5A 4BWXA 3PZEA 3QQFA 4FSYA 3U8WA 4L46A 1W2CA 2CPKE 4Q9SA 1Y6AA 4E26A 5FEQA 3GCVA 2PVFA 4DBNA 1WBWA 2X39A 2YLFA 3PWYA 3BIZA 3VIDA 4AGDA 4RX5A 2WTWA 3GFWA 5HNGA 3RPYA 2OG8A 2R2PA 2XEYA 2OF4A 3HA8A 4O1PA 4RGJA 4Y5HA 1GIIA 3CTHA 3QTXA 4FV7A 4IX5A 5IQIA 4YZ9A 1Q3WA 3TIZA 5AAEA 3MIAA 5DMZA 3OW4A 2V22A 2VGOA 4GW8A 4O2PA 4R7IA 1DAYA 3TWJA 4KS8A 3KMWA 2XF0A 2VTRA 2PZIA 2JIIA 2X9EA 2XB7A 3C13A 3OBJA 2YM8A 3QLFA 4DH8A 3ATSA 3MFRA 1J7IA 4CV8A 4EL9A 2J90A 4J97A 1OGUA 3B2TA 1GAGA 1R1WA 4QPMA 3DAJA 3TZ8A 4L6QA 4OT6A 4C34A 4XRLA 4D4SA 1FINA 3IECA 3EN5A 3IO7A 3KA0A 5AX9A 4ZZMA 3VJOA 3RWQA 3ET7A 3G15A 1PRYA 5EDRA 5HCZA 1ZAOA 3RMFA 3I60A 5FTOA 3QTUA 3NIZA 4Y95A 3EQFA 2R3LA 3QU0A 1JLUE 4RC4A 2WMUA 4FL2A 3H9OA 2QOOA 4KIKA 3MY0A 2W7XA 4GH2A 5EYDA 4HGTA 2GCDA 4PDSA 3NW7A 5TR6A 4BCGA 2VUWA 4ZS0A 3CGFA 5DT3A 2XS0A 3QKLA 4A4XA 4EOLA 4QQ5A 5HE3A 4E5WA 5C8NA 1I44A 3JXWA 3MPAA 1DI8A 4PP9A 4QMVA 4FEUA 4BGHA 2H9VA 5KHXA 4PNKA 2BVAA 2X2KA 3LLAA 5C03A 3DT1A 2YM7A 3TTJA 4DH7A 2GPHA 1XJDA 3HV6A 4HNFA 3KULA 4PRJA 4UZDA 5BX0A 2C4GA 4ANSA 5JGDA 3EKNA 4P2KA 4L7FA 4QMYA 2AC5A 4Y8DA 3GXLA 2PU8A 4GU6A 5EM6A 2BRMA 3HX4A 1VYZA 3QRJA 2OI4X 4PTGA 4NM3A 4F1MA 3AD6A 2I0EA 3HZTA 4U7ZA 4DFZE 5J5SA 4X6QC 2W4KA 3LMGA 1OM1A 5EI8A 5M07A 3QD2B 1R3CA 4HPTE 2WMBA 3NNVA 4WSQA 3DV3A 4I93A 4ZK5A 1Y91A 3THBA 3MWUA 2C6MA 3Q9XA 4XBRA 4R8QA 4KSPA 2YABA 3R9DA 3LFEA 3VAPA 5HNIX 2XNPA 2A1AB 3GU5A 4FIJA 3W2CA 3OCSA 3ZLYA 1URWA 5C9CA 4FYNA 5CU6A 4F9YA 1H8FA 1GNGA 3DK7A 5JRQA 4KIPA 4U3YA 3LM0A 4OBPA 5K0KA 5L2WA 4UWBA 5A14A 1YQJA 5E8YA 3LFFA 4WOVA 5HVJA 5M4CA 1BKXA 1F3MC 2HAKA 4H39A 4ALVA 5B2MA 2PE2A 3U6IA 4F08A 3D14A 4QTAA 3ODZX 2V5QA 5AWMA 2CDZA 2VTOA 3NVMB 3Q6WA 3R7UA 4JJRA 1JWHA 4FX3A 3QX2A 1Q41A 2ETMA 3RPOA 5IQGA 3RHXA 4M84A 5DFPA 2QOBA 3LXLA 1KOBA 4WA9A 3D7TA 4DFYA 4ZMEA 3ZDUA 5CAVA 4ZS4A 3CTJA 2FGIA 1RDQE 2W1CA 3BHUA 4U8ZA 3O50A 4IM2A 3QQHA 3PUFC 3Q2JA 4FK6A 3WZDA 2OJGA 3AT2A 3N4VA 2I6LA 2QR8A 2ZV7A 1OBDA 2YEXA 2VTNA 3GEQA 3KVXA 2EWAA 3R00A 1LEWA 2C5XA 2H8HA 2RFEA 4NM0A 2QLUA 3K5UA 2BPMA 2R7IA 4I0SA 4GVAA 2JDRA 4YO6A 4II5A 5A4QA 3PXFA 5ETFA 2PVJA 1JOWB 4FG9A 5DT0A 1PXJA 3LKMA 2GU8A 3ORPA 4YC8A 4DEBA 2SRCA 5GIPE 3SG9A 1CKIA 4QP4A 4XG6A 3OEZA 3R8UA 5DT4A 4M97A 4KKEA 3ZLXA 3UNKA 5GJFA 3MPMA 4RWJA 4L52A 5C26A 1Q97A 3RCDA 5LVNA 4J1RA 2J5EA 4FKSA 3WF6A 5J9YA 4GV1A 4XG7A 4IM3A 4HZSA 3FMHA 2C1BA 3QA0A 4XP0A 4F6UA 3DJ5A 3O96A 4FV6A 2HWOA 3GUBA 3OS3A 4OTWA 5HQ0A 4FKTA 4U97A 3DNEA 5HTCA 2XK8A 5G6VA 2VNYA 3EL8A 4YHTA 4A9YA 4HGLA 4KABA 4GS6A 3ZRMA 5EYCA 4C38A 4NT4A 1ZOEA 2CKQA 4GCJA 3TKUA 3DBFA 4CFFA 1CMKE 5C1QB 2VO0A 4HGSA 4JQEA 4L53A 4ZY6A 5A4LA 1UNLA 5M51A 2UW5A 3MY5A 4LL5A 3SXSA 4AAYA 1XH7A 3TNPC 4DGGA 5K5NA 2J0IA 3POZA 4DG3E 3VUDA 3ZHPC 5HO7A 1MRUA 5LCKA 2OLCA 1YW2A 2E9OA 3EQRA 1Y8GA 4NH1A 3KU2A 3EN4A 2X0QA 3GOPA 1H01A 4PP7A 3NPCA 4FKIA 4BC6A 1YDSE 5LVPA 4D2PA 5IEVA 5IPJA 3FMKA 4TYHB 5TF9A 2R3OA 3MDYA 4JBPA 2VTQA 4N57A 4NTTA 4U40A 4I22A 3OZ6A 1ZOHA 3Q52A 5E8WA 5A54A 1QL6A 3PTGA 5CU3A 3UDBA 4G2FA 4HGEA 3ITZA 2UZNA 3BYMA 3R04A 4ZY5A 4QMMA 2HW6A 3ZO3A 4DGNA 3EQIA 1Q8ZA 3LQ5A 3R8PA 1H25A 4O7RA 4FG7A 3FJQE 3JY9A 4LG4A 4PV0A 4QMZA 5JFWA 2XH5A 2R9SA 1AGWA 5KKRC 2ZVAA 4C4EA 3NSZA 1Y6BA 4MNFA 1P5EA 4QMXA 4JVGA 4EHVA 5CY3A 5I4NA 1PKDA 1CM8A 4OUCA 5FGKA 4I6BA 4I6LA 4C8BA 1LEZA 3MTFA 1IR3A 3GC9A 5J1WA 5A4TA 2B53A 3DTCA 4CYJA 3ZUTA 4G3EA 1UNHA 1ZYJA 3FHIA 3HMIA 4UMPA 5E4HA 1NY3A 3ZSIA 4U44A 4Z3VA 3RNIA 2ZYBA 3NFFB 5DBXA 2C47A 3L1SA 3W2QA 3BV3A 3D7ZA 4BR3A 2VN9A 3G0FA 2VTAA 4NZWB 1STCE 4OBOA 5HZNA 3GB2A 4Y85A 3H9FA 1MRYA 2QOQA 3V8SA 2R4BA 3F69A 2W17A 4F9AA 3VHEA 2O3PA 3RHKA 4F7LA 3ZZEA 1J1CA 2PZPA 3E87A 2WB8A 4KSQA 3R8ZA 4AFEA 2FSTX 4CFUA 2G9XA 5E8TA 5GZ8A 4IX3A 2Z7LA 1FMOE 3SDJA 4YJTA 2PMLX 2X2LA 3QHRA 4XX9A 3K54A 3ZXZA 3F3VA 2ITOA 1MRVA 2FSLX 2OFVA 2W5BA 3VBYA 4YSJA 3ID6C 5HO8A 4QP6A 1W8CA 2HOGA 2VAGA 3QALE 4R5YA 5AV4A 5J5TA 4MWIA 5LMKA 5J95A 3ZO1A 5M09A 4GIIA 1UNGA 3BL7A 3GU8A 3L9PA 4MKCA 1APME 4MF1A 4O0VA 4YNOA 4F99A 3SGCA 3BGPA 3QCSA 4R7HA 4X3FB 3ZBFA 2ZM4A 5FTQA 4JIKA 4IJPA 5T3QA 5CVHA 3T3UA 2XP2A 4IDVA 1HOWA 3E64A 4NTSA 3BKBA 4FZ6A 4GIHA 3TZMA 3EFJA 3PSBA 3D5XA 5CVGA 1ZMUA 2EB2A 4GSBA 3UIXA 4D5HA 2CNVA 1IEPA 2RF9A 3EQBA 4B9DA 2YIXA 4FSNA 3HV7A 4ALUA 1P4OA 3O71A 3Q9ZA 3EKKA 4R1VA 3P23A 3HRFA 3R9OA 1H0VA 2XA4A 4AZVA 4EOIA 2A2AA 4DH3A 4TTHB 3LFCA 3VW6A 1G8SA 3DS6A 1Q8WA 1WFCA 4UZHA 3W10A 5DIAA 1G8AA 2QOCA 3LQ3A 4F4PA 3NW5A 5M53A 3JR1A 2RFSA 5JZNA 4GEOA 4MTAA 1ZYLA 4P90A 5L8KA 4ZTMA 2Z2WA 3R7OA 2CLXA 3CP9A 4AW2A 4ZJVA 4TYJA 4XYFA 2CLQA 3D5VA 5HBHA 3R2YA 5CF5A 1T45A 3KRXA 2H34A 4G9RA 2XARA 3FL4A 4BZDA 2VO7A 2ONLA 2NNWB 4Q5EA 4PMTA 4IHPA 1UU7A 2W1DA 4O22A 1PKGA 3OG7A 1KE5A 2F2UA 2OIBA 1GZ8A 3OOGA 1QPCA 4KS7A 4MXYA 4DLIA 5CU0A 4KRCA 3BBWA 2IW6A 4G3GA 3BWJA 2VO3A 4L7SA