2CDZA

Crystal structure of the human p21-activated kinase 4 in complex with cgp74514a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
292
structure length
289
Chain Sequence
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK 4
publication title Crystal Structures of the P21-Activated Kinases Pak4, Pak5, and Pak6 Reveal Catalytic Domain Plasticity of Active Group II Paks.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 289
sequence length 292
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2cdzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cdzA01
2AC5A 4WNPA 5HEZA 4C0TA 2GHGA 3RI1A 2WTKB 3GOPA 1OVEA 3QCQA 3G6GA 4AG8A 3KK9A 2W1EA 4YNEA 2YABA 4YZCA 4HZSA 3JYAA 2OU7A 4HVIA 1R0PA 4Z7GA 4F9CA 3EQHA 5JGDA 4XBUA 3OTUA 4DEEA 3G9NA 4ZAUA 4YJRA 5CEPA 4O1PA 5M51A 2ZM3A 3F5UA 4FICA 2HZ0A 3LQ5A 4RZWA 1F0QA 3MWUA 4EHVA 3MFUA 3CSVA 5HE1A 4RG0A 3UP2A 3KXNA 3KVXA 4WBOA 4JX3A 4F63A 2HW7A 3DCVA 3L1SA 4JS8A 3WZDA 2BALA 2C4GA 1H1SA 2NP8A 2PVFA 3TV6A 4Z9LA 5FRIA 1M14A 2VGOA 4DEGA 2W1IA 5GZ8A 4EK8A 3OY1A 3LCTA 4PTCA 1M2PA 4K18A 2C5YA 5DR2A 2WQOA 3LFQA 3I7CA 4TYGA 5AAEA 5KMJA 4BBMA 5ANOA 3I6WA 2W1DA 3W32A 3KULA 2GNFA 3I7BA 2CGUA 3L8VA 4UZDA 4ZTMA 3U8WA 3LJ1A 4Y95A 4CNHA 4J52A 1GAGA 4J96A 3KXMA 4R5SA 3G51A 3WIGA 1PKGA 3DZOA 3WF5A 4B6LA 4FKJA 2JKMA 4BTFA 3VBYA 1V0OA 2VWWA 3E64A 4FVRA 4PQNA 2IVUA 4KINA 4DAWA 1QPJA 5L8KA 5EI2A 2P55A 4HNIA 4BCOA 1XR1A 3MTLA 3NIEA 4QP2A 4GFOA 3H0YA 4JBPA 4MNEA 3SW4A 4IZ7A 4EH8A 3AQVA 3F9NA 3V5LA 4MD8E 3RWQA 4L68A 2OSCA 2NO3A 2OXYA 4ARKA 4DFZE 3BBTB 5F94A 3NUAA 5DMZA 3G2FA 4WSYA 4AGUA 4FEWA 5AR8A 3ZO4A 4HCUA 3ENMA 2OJFE 2F4JA 3HRBA 3Q32A 1P2AA 3BV3A 3D5VA 4FT0A 4YPDA 2BKZA 5CEQA 4FSWA 5EH0A 3MH1A 4YPSA 3WE8A 4AS0A 3DLSA 3II5A 3VS6A 1DAYA 4K2RA 5E8YA 4TTHB 5AUWA 1PMVA 4QP7A 2DQ7X 4YGAA 3FDNA 4ZS4A 3EN7A 3PSDA 3QRIA 3E8NA 3DBQA 2W1CA 3FZOA 3OCSA 1WVXA 2R9SA 4O1OA 4RVMA 3N4UA 3DXNA 3R1YA 5LXMA 5AUXA 2ETRA 3QTIA 3UG1A 4HYUA 4F6UA 4UN0C 2WU7A 3FMHA 4ZK5A 2GPHA 3KK8A 3B8QA 4UMUA 1Z9XA 3G0FA 3QZIA 5EKNA 1ND4A 1WZYA 4Q2AA 4M0YA 1OIUA 1SM2A 2JBOA 4X3FB 5GINE 2BKKA 2YM8A 5IA3A 2XKFA 3SXRA 2UW6A 2EXCX 1YXUA 4ANNA 2EXEA 3BV2A 1OIQA 4DH8A 1YWVA 3C13A 4YJNA 5K0KA 5F20A 5TOZA 4BI1A 5IUGA 3OWKA 3VS3A 2ACXA 2ZJWA 2JAMA 4GT3A 4D4SA 3TV4A 4C33A 4CZUA 4GG5A 3BYVA 2QOOA 4BCGA 4M13A 4O0WA 1FGKA 2G15A 3HLLA 3LFFA 3OEZA 4D2WA 2C3KA 2HIWA 2GDOA 3HMNA 4LV8A 3ULIA 4IZAA 1R39A 3BLRA 5HG7A 4O22A 5CEIA 1KE8A 4XOYA 4AXAA 1Q8ZA 4IB1A 2C1AA 4IVAA 1VYZA 4W4XA 4WG5A 4BICA 3LQ8A 3ORKA 4EJNA 3OROA 4C4HA 4JG8A 4CYIA 3ZU7A 5GZAA 1UWJA 3RPSA 1Q3DA 2UZVA 4DG2E 2R0IA 3AT2A 2WHBA 3C1XA 2VTHA 4TYHA 2B52A 3RNIA 4Q9ZA 3CD8A 1OL1A 4JAJA 5FP6A 2X7OA 3R02A 4UWCA 3EIDA 3FWQA 3G6HA 4C8BA 5HIDA 3A7HA 5JQ5A 3KRXA 5L4QA 2SRCA 1CKJA 2GFSA 4IZ5A 5HICA 3R8ZA 4CD0A 4XLVA 3LIJA 1PXOA 3C4ZA 3ORXA 4FG9A 3DBEA 3VS4A 4QP8A 4CKRA 4FYNA 3QL8A 3OT3A 2C5OA 3QWKA 1TKIA 3CGFA 4F9YA 2CNUA 1S9IA 1Y57A 2BZJA 5L3AA 4DT8A 3KEXA 4USFA 1U46A 4BCMA 3DXPA 4YP8A 5AR5A 1DI8A 4RMZA 2Z2WA 4FEQA 4K33A 3BRBA 1UU8A 2PSQA 4WSQA 3EHAA 4UYNA 5ITAA 3CLYA 3QLFA 3EQPA 2I0EA 1J91A 1H27A 5B7VA 1NT2A 3ETAA 5GIOE 3FC1X 4BZNA 2WU6A 2G01A 4DGOA 1YDSE 3QD0A 2OIBA 5C1QB 3FY0A 1WBSA 2GTNA 4Y72A 5L2QA 2W5HA 2YISA 3A7FA 3F5XA 3CY2A 3CC6A 1OL6A 4NKSA 4W8EA 4F9AA 3MB7A 2VWBA 3GU6A 2YCFA 3IW7A 3OOGA 5C4KA 3IGOA 1OKYA 4MHAA 3WZJA 4AA4A 2Y9QA 4LI5A 1FGIA 2XNEA 2RG5A 3AMYA 4G5PA 3C5IA 2J5EA 4ASXA 3EH9A 4EUTA 2CKOA 3PRFA 4HVSA 2OW3A 2UW4A 3GP0A 4EJ7A 3GBZA 1GIHA 3FZRA 4PDPA 3WI6A 3OWLA 3UPZA 4C4GA 1LEWA 3MS9A 4HOKA 2E9VA 4JG7A 3QQJA 4BDGA 3FMJA 2QD9A 4QP6A 5AWMA 3BQRA 1JWHA 1YWNA 4YO4A 3QQUA 5DOSA 4FTNA 4CRSA 4L9IA 5LWMA 4ZY4A 4AX8A 5D41A 3DLZA 4UZHA 4DC2A 4G6LA 3NGAA 4EZ3A 3GCSA 4JQ8A 3RBWA 3FMLA 4JRNA 2IG7A 4YMJA 2YZAA 2BZHB 4E5WA 1PY5A 1KWPA 2VV9A 4BBFA 3IG7A 4F4PA 3HV7A 1Q8TA 5C4LA 2FSOX 3OXZA 4QQJA 3ZS5A 3GXLA 4I41A 3PY1A 2XNNA 4YLLA 4WNOA 5FTOA 1SVHA 3UPXA 3G0EA 3ZEPA 5EQEA 4DG0E 4X6QC 4FKWA 2F2CB 4V04A 2FH9A 2WMXA 5JZJA 3VW8A 5IKWA 2W7XA 1Q3WA 2VAGA 4MBLA 5KMLA 1FQ1B 2QOLA 1J7UA 3TZ9A 2C5VA 3WZEA 3VBQA 3DDPA 3QF9A 4IJPA 2GFCA 5KMKA 4ALUA 3BU6A 2BRMA 3P5KA 2R5TA 4TYJA 3DPKA 3QTUA 4QTBA 3RCDA 3DAEA 3VC4A 4CFWA 2PVRA 4YZBA 2VZ6A 2YJRA 1A9UA 3ZDIA 4LYNA 4BRXA 3FQSA 2XYNA 3JXWA 3RVGA 4YU2A 4QMOA 2R7IA 1WMKA 1LEZA 4Y73A 2F9GA 4YC8A 3K3JA 3D5UA 4G31A 2E9OA 4O0YA 3ZRLA 2FSMX 1Y91A 2VO7A 3CS9A 1IRKA 3DV3A 3DBDA 3ELJA 5L6PA 1O6KA 4PTGA 4B4LA 4QMPA 3BGZA 3MVHA 1OPLA 4FUXA 3FI4A 4NIFA 2PY3A 2VTPA 4FZFB 2XKCA 2JITA 3SHEA 2OIDA 3PIYA 4DFNA 4EC9A 3V8TA 4QMQA 1LP4A 5J1WA 3DFCB 2WMUA 3L8SA 1BUHA 2OK1A 4PTEA 4DCEA 3NIZA 2IVSA 4I0TA 4IEBA 3T9IA 2Q0NA 4LG4A 2J0IA 4OBPA 2X0GA 3LLTA 2XK3A 3A7GA 5AAFA 3ZFYA 3TN8A 1HCKA 3ZLXA 2YJSA 3E92A 1H1PA 2UZLA 3PY0A 4YC3A 4GKIA 3GENA 3LFDA 3C4FA 3LHJA 2PL0A 5AEPA 4QNAA 3V01A 5KMMA 2WEVA 3FYJX 3I0OA 2PWLA 3OBGA 5D11A 3ALOA 4K6ZA 3F5PA 5B0XA 5HNGA 5KE0A 3O51A 3PJCA 2QO2A 4UX9A 4I6QA 3HX4A 4WOVA 4RX8A 2OG8A 3FC2A 3I4BA 3F3TA 5HD7A 3NNXA 4D2SA 2PZ5A 3UZPA 5EI8A 4UXLA 2OH0E 4UWBA 2J90A 2XK8A 4PY1A 4D4YA 4L01A 4HW7A 3K54A 3IW8A 2X9EA 4H36A 4AUAA 1FVRA 4MXCA 4C4IA 4MD7E 5FD2A 5FLFA 5AAGA 5C8KA 4UMRA 4YR8A 3DOGA 4WBBB 5TO8A 5CAQA 5JFSA 3R1NA 2CN5A 3FMNA 3SD0A 3ZONA 3SVVA 4RPVA 5HVJA 4E6QA 5BVDA 2W1FA 2GMXA 4QO9A 2WXVA 5IU2A 1QL6A 2XRWA 4PL4A 3TACA 2VTQA 3Q04A 4JRVA 1ZMUA 3IPHA 4GMYA 5E1EA 5LMAA 5TR6A 2CNQA 5AR7A 3HV6A 2X39A 4QOXA 5CI6A 4DITA 2J50A 4KD1A 3BGPA 3FLQA 2H9VA 3COKA 4XBRA 3KB7A 4HYIA 2FSLX 2WTVA 1IEPA 4USDA 3FBVA 1NVQA 4RIXB 1H01A 4J1RA 4NKAA 4YLKA 3A7JA 3GC8A 1BI7A 5LVNA 2IZRA 1Y6AA 5FEEA 4Z55A 2VWXA 2VD5A 1YI4A 5CSWA 4AN9A 2QKWB 4JVGA 5JK3A 3BLHA 3NRMA 4RJ3A 4TXCA 3HUCA 4I5PA 3IOKA 4PV0A 3G15A 4OTHA 4B99A 1SNUA 5K9IA 2G9XA 4K9YA 4TWCA 4IQ6A 3QCSA 4BHZA 1G8AA 4O6LA 3FQEA 2PVHA 3V6SA 1NVRA 4I4FA 4PWNA 4KS8A 3RK5A 2BPMA 5E8ZA 5DBXA 5IG1A 2VNWA 4O38A 4CCBA 4OBQA 2IVVA 5CZHA 2WTJA 4QMMA 3LLAA 3FI2A 3SOAA 2CKEA 4FL2A 4R3RA 3LM0A 4EOPA 4PNKA 4R8QA 1F3MC 3IQ7A 5CSPA 3PPJA 2PK9A 2WGJA 2OH4A 3NWWA 3UQGA 4FF8A 5J95A 2HY81 3A8XA 4YSJA 4D0WA 2OXDA 1IG1A 4M0ZA 4YLJA 2QU6A 3NVKI 3E8CA 3Q5ZA 4D2RA 2OZAB 4GJ3A 4YTHA 5CSVA 3DNEA 3PVBA 4FNXA 4ZOGA 1ERKA 1OKZA 3V5PA 2W9FB 4L8MA 3N4VA 4O0UA 5LARA 3HUBA 1JPAA 3EZVA 1FBNA 2GQRA 1V0PA 4PDSA 2XCKA 4QYEA 2X7GA 2B0QA 2BUJA 4MWIA 3AC3A 3HV5A 4ZS0A 2C0TA 2P3GX 2ONLA 3Q96A 2UW8A 4CFVA 4FTRA 4FTKA 2PVKA 4GIHA 4F0FA 5K4IA 3TKUA 4E8AA 3V04A 3W8LA 3A2CA 2B55A 3C7QA 4C36A 4IDTA 4YBKA 2PZYA 4BBEA 1OUYA 4MD9E 1ZYDA 4ZEGA 3NUSA 1R3CA 3Q4UA 3RPOA 4AGCA 3I6UA 3WYXA 4BI0A 5L2TA 2VNYA 1PF8A 4CG8A 5FDXA 3DTCA 3NAYA 2UZWE 3LMHA 1ZY4A 2X4FA 2PZIA 4O0TA 4GK3A 4AOIA 2A0CX 4BC6A 4OLIA 4C4EA 3AOXA 3P23A 2ZYBA 4I5HA 3P7CA 4I23A 4QMXA 3L9MA 4KSQA 4ZLOA 4X3JA 3RKBA 3ZZWA 4EK4A 4EORA 3GCUA 1W7HA 4GS6A 4M69A 2XK7A 4OTRA 4FZDB 4IX6A 4L52A 2XMYA 5FXQA 1PHKA 2KTYA 5BVFA 2X6EA 3PSBA 2O8YA 4BWPA 3R9RA 3QQLA 2VTAA 2UZOA 4MQ2A 1H4LA 4EH2A 2B1PA 1QCFA 2YACA 3KVWA 2UZBA 2VX3A 3Q3BA 4IAFA 4M8TA 2I0VA 3OP5A 4ZTNA 3V51A 4C57A 2W05A 3E63A 3TTIA 3UIMA 3NCGA 5D1JA 5M56A 4H1MA 5CEMA 2X7FA 3P08A 4FZ7A 5LCJA 4XG3A 4F1TA 2IPXA 3HEGA 3K5VA 3ZSIA 2BAKA 3ORPA 3E62A 2XZSA 3H9OA 1YXXA 3NYOA 4BCKA 1PXMA 3O7LB 4QMVA 4RC2A 1Q41A 1JLUE 2C3IB 3EMGA 3QTSA 5IQAA 2XK4A 2YCSA 3FLSA 5E8XA 3W55A 5F9EA 4JDKA 3D9VA 2XH5A 3D94A 3JVSA 3EYGA 4ACHA 4AT5A 1WAKA 2BMCA 3RTPA 4CMUA 4F1MA 1GY3A 3IO7A 4D2TA 4ZZOA 4C61A 1R78A 3EFKA 3EQDA 3R30A 4X7QA 4QPSA 2GQGA 3W1FA 4PP7A 1ZMVA 1KE5A 3EQGA 3LMGA 5HIBA 4PPBA 2R3IA 4WNKA 4FZ6A 4FMQA 3CIKA 2O5KA 3TNIA 4J99A 3TV7A 4GT5A 5CF6A 3GCPA 4EH3A 2QR8A 3KMMA 4ZTHA 1Q4LA 3O8TA 4UB7A 5T68A 4ZIMA 3P0MA 4XEYA 4WUAA 3MVMA 4IAYA 2IW8A 4ZLZA 1GZOA 4EOLA 3SG9A 2FO0A 4OTWA 3UNJA 5BUJA 3DXQA 4C3FA 2IZSA 4I0RA 4CYJA 4YZMA 1ZYCA 5JEBA 3W2RA 4ONAA 5JSMA 5IA1A 3KXZA 2R4BA 5M53A 4EH7A 1ZOGA 3LVPA 3IECA 3E7VA 2RKUA 4GKHA 4F9WA 5IQCA 4X2JA 4FTLA 4QMWA 4ERWA 3IDBA 3WARA 4OW8A 5IQEA 3BHTA 4LRKA 3VRZA 4IBMA 5I9XA 1XH7A 3UO6A 3ZO3A 3F5GA 4BDHA 1JKLA 4M3QA 3GCVA 5FEQA 1QPCA 5G6VA 3G33A 1ZOHA 4O7TA 5E8UA 4DFUA 3Q9ZA 5KO1A 1R0EA 3BBWA 4RJ8A 3VQHA 1W84A 4FKVA 3CJFA 4JIAA 4MNEB 4BZDA 4OTFA 4X21A 4DBNA 4XS2A 3OUKA 2C47A 4G1WA 2C0OA 5LVLA 2JKOA 2Y4IB 4FSTA 2GS2A 2X8EA 5DH3A 4D9UA 4IAZA 4D4RA 3S4QA 4IVBA 1H26A 4B0GA 3AMAA 2F7EE 1PKDA 5G1XA 5BUEA 3SX9A 5AA9A 4LFIA 4LRMA 5E8WA 3SDJA 4FNWA 3FSKA 1XBAA 4GK4A 3EQRA 5J8IA 1LR4A 3NYVA 5B2KA 3VVHA 4MVFA 5HBHA 4GUEA 2V55A 4FSRA 4UXQA 4U9AA 5A14A 2OJ9A 4DH7A 4DN5A 1Q62A 4MXAA 4ITHA 4D5KA 4HVDA 4KIPA 5CF5A 3AC1A 3EN9A 4K1BA 3R2YA 5CXHA 1ATPE 3COMA 3COIA 4G34A 3DJ7A 2PMLX 5HCZA 1KE6A 4FTAA 3V8WA 3HL7A 1ZYSA 2R3NA 3F88A 2UUEA 3DFAA 3HAVA 4AN3A 5HORA 4RC4A 3QA0A 4G5JA 4RLLA 5M4FA 2XIYA 1M2RA 3NR9A 2XM8A 3EN5A 5HE0A 4D9TA 2PYWA 4O82A 2F7ZE 3PZHA 4KKEA 1KE9A 4C62A 1V0BA 4JLCA 3TUCA 1XO2B 2XNBA 3PXZA 4MAOA 5CENA 3ZMMA 4CVAA 4DHFA 2J0MB 2RGPA 4MTAA 1PMNA 4WD5A 3FV8A 5L8LA 4R1VA 4YURA 3HMMA 3VUIA 1GIIA 3S1HA 4PX6A 5AIRA 4DGMA 2RIOA 2O2UA 4FKUA 4IVDA 4JI9A 5CVHA 1PXLA 3MYGA 3SRVA 3M2WA 4UWYA 3BKBA 3BE2A 3R7VA 5AJQA 3D0EA 5ETIA 3I60A 3MSSA 5DT4A 5DT3A 3AD4A 3BWFA 2PUNA 2BAJA 2OIQA 2VO0A 4HVHA 3E7OA 1REKA 5EQYA 4FVPA 4J97A 3V6RA 3QXOA 4TPTA 3R04A 1K3AA 4OTIA 4FK3A 3OCBA 5HE3A 1I09A 5DIAA 3LFCA 3VUKA 1JKTA 2VTOA 3MIYA 3QTWA 5CQUA 2IW9A 3PVWA 3UG2A 3RZBA 1PXNA 4IWPA 2YHVA 3VUTA 3ZDUA 4XV9A 3KC3A 2CDZA 4JBQA 5A9UA 4FV9A 3NDMA 1NW1A 4IB3A 5M57A 1H8FA 2CHLA 1UKIA 5ICPA 4E5AX 5F4NA 2XJ2A 4ZTQA 3S3IA 4I93A 5BVOA 5KMNA 2OLCA 4RVLA 3RJCA 4QQ5A 5CU4A 5HKMA 3UOJA 1YHVA 4N4SA 2YA9A 5EM5A 2RFNA 4FT7A 1YOLA 4NM3A 1Q24A 4YC6A 1P4FA 3FXZA 3H3CA 3F2NA 3BX5A 3JY9A 4JBVA 3MESA 4FTCA 5HTIA 5IQHA 1FVTA 1OMWA 3C4WA 2P2IA 3E3PA 4IH8A 5KHWA 3PP0A 5LWNA 2W5BA 3FLZA 3AT3A 3FSFA 1OKVA 2EWAA 1L3RE 3KXGA 3ZEWA 3BQCA 3REPA 4F70A 1P4OA 4FV0A 5A4EA 1JNKA 2PZRA 5AADA 4PRJA 3UZRA 4GU6A 4D1SA 4C3RA 4CTBA 4EWHA 5HZNA 2B7AA 1NXKA 4CMTA 5M07A 4ZJJA 4I21A 2UZDA 3VF9A 4KBKA 4NTSA 3CTQA 3I79A 3MPMA 5DYJA 1OL5A 4FTMA 5EW3A 5IZFA 4FIHA 4E4MA 1FOTA 3A60A 3NAXA 3CQUA 3IW6A 4CZTA 4UMPA 3EN6A 3EZRA 3NNUA 4BCJA 3RPVA 3RAHA 2ITNA 4CFNA 3P7AA 3FYKX 4DA5A 1LPUA 2J9MA 4HGLA 5EM8A 5HE2A 5C01A 4L6QA 5JFXA 2H34A 1WCCA 5C8NA 3NNWA 4JX7A 4BDDA 4PPAA 3PY3A 3TIYA 5AUTA 2I0YA 3E3BX 4BN1A 4PPCA 3GC9A 3LE6A 4XP3A 3H10A 2WO6A 5IA0A 5F95A 1IAHA 3R71A 2HY0A 4ACDA 2IN6A 3PXKA 3CQEA 4LMUA 3DK3A 4R78A 5IH4A 3JS2A 4EOJA 3Q2JA 2ZMDA 3ORMA 4J71A 4OT6A 4E93A 3W2OA 3NUNA 4EL9A 2PHKA 3ZFMA 2W96B 2O63A 3F7WA 3QC4A 4FSZA 2XJ0A 2ITOA 2VWZA 4HGTA 4IXPA 3SV0A 2YIRA 3OTVA 5EI6A 3DJ5A 4RIYB 5ETFA 4BI2A 3ATSA 3EL7A 3E5AA 2Z7SA 3P4KA 4IB0A 4IW0A 3TNWA 3EQCA 3OCGA 4KBAA 4R3PA 4YJTA 4F7JA 3PA4A 3D14A 3VS7A 5CX9A 4LRJA 3BWJA 2YZLA 4JDJA 3NCZA 2I1MA 3P1AA 5A54A 1M7QA 5C26A 2B9FA 4C7TA 1H28A 2HAKA 3N51A 2PTKA 3SOCA 1WVYA 2WOUA 4FK6A 5DA3A 4U8ZA 5AP5A 2BILB 4R1YA 5E1SA 3RALA 3U87A 4BB4A 4CV9A 4FEVA 4G3GA 1YKRA 3Q9WA 4FI1A 3R8UA 3ZUTA 1STCE 3KQ7A 3LFAA 3U55A 3MFTA 4O7VA 3AGMA 2YIYA 3ZXZA 2OGVA 4F65A 3PPZA 2PMOX 4HGSA 4MQ1A 4QD6A 2UV2A 3Q2MA 4KS7A 3HKOA 5AP3A 4DEBA 4FX3A 4EHGA 4DGGA 4IFCA 4ZJVA 3NUUA 2HK5A 3KRRA 5KBQA 4FV6A 4DBXA 2X1NA 2UZUE 3BYMA 2FB8A 3FMKA 4OUCA 4Y46A 5DRBA 3QUPA 1PW2A 5CANA 3KN5A 5IQBA 3R8MA 1U4DA 2HZIA 5AX3A 5E4HA 1ZAOA 4O7ZA 4L43A 4KA3A 1ZMWA 4HNFA 4DFLA 4V0GA 5LVPA 2WTWA 4ZLYA 5DI1A 5IQDA 4CFMA 5CY3A 4GVJA 4S30A 5L2WA 5EDPA 4NU1A 3U4UA 4U44A 3VJNA 4I6HA 2ITVA 4RWIA 2F57A 2H6DA 3VAPA 2Y7JA 4FT5A 4IJ9A 4QNYA 3EYHA 1ZZ2A 3R6XA 1KOBA 3VQUA 3NYXA 4L44A 3D2IA 5HU3A 5E7RA 3JPVA 4QMUA 4BKJA 4DH1A 3KREA 5DFPA 2R3RA 3Q9XA 2LAVA 2XB7A 4C34A 2VWVA 2C6IA 3T8OA 4QYFA 4OT5A 2C6DA 2GS7A 2V0DA 3QU0A 5KCVA 1CKIA 2WOTA 3FHIA 3P86A 4KSPA 3UOKA 4AT3A 4EBVA 3OMVA 1J1CA 2WMAA 5A4TA 1BX6A 4DFBA 3D5WA 2F49A 2I6LA 1VJYA 4EK6A 4PF4A 4FEUA 4GEOA 3DY7A 4BCNA 4E4LA 4ZTLA 3FPQA 2WTDA 2WMSA 3FL4A 2ZOQA 4LV5A 4PMMA 3G5DA 5FBNC 2HZ4A 4EOQA 1M52A 3F3WA 2ZV8A 4U80A 3A61A 3QKKA 4ANBA 3FKOA 1U5RA 2UW5A 1T45A 1VYWA 3D15A 5J7BA 2WEIA 5I9UA 2XNOA 4IC7A 4M67A 4F7LA 3O2MA 4ACMA 3OVVA 2NRUA 1YHSA 2YCQA 3QX2A 2NNWB 3PXRA 3LJ0A 3R7IA 4RWJA 5AMNA 3EFWA 1PJKA 2RG6A 4QP1A 3FZSA 4LOOA 4EHEA 5LMKA 5AV4A 2XK6A 1WBPA 2JC6A 3BEGA 3BZ3A 4YSMA 3UVRA 4XV1A 1XWSA 4AE6A 4DTBA 2ITQA 3C0IA 4MCVA 3ODYX 3FE3A 1BYGA 4K77A 4KIQA 2WQMA 3AC8A 3D2KA 3POOA 4YZNA 4NZWB 3VN9A 5FUTA 3OF0A 3Q60A 3DKGA 4AZWA 3OY3A 3TUDA 3FL5A 4QRCA 2VX1A 4L67A 2BFXA 5IQIA 3IKAA 4N57A 1B6CB 4OGRA 3V5TA 2V62A 4NYEA 4U41A 2XCHA 4FOCA 4E4XA 4OTQA 4ITIA 5I3RA 4FL1A 2IO6A 4M97A 2QOFA 5JRSA 3HV4A 4XOZA 3BHYA 5J87A 2GCDA 1GZNA 3TZ7A 4F09A 5IH5A 3LFSA 2W4JA 2VTRA 5BX0A 4G9RA 3U9CA 3CKXA 4Q5HA 4M7IA 4EH4A 3GFEA 4CSVA 2J51A 4HYSA 3PJ8A 4BCPA 4J53A 1RW8A 4AZEA 5EG3A 1KE7A 1JSTA 2BRGA 2FUMA 1PXIA 2QHMA 4YHTA 2YIWA 4QYHA 5JN2A 1UNLA 4ZMEA 3VBVA 3EFLA 2ZB0A 1YW2A 4CLJA 1QPEA 3UP7A 4W4VA 3R63A 4ENYA 4N0SA 2YWPA 4ID7A 1QMZA 4ZSJA 4AFJA 2I40A 2ONLC 4IC8A 4A9UA 1NY3A 2Q0BA 1Q99A 2JKKA 2RFDA 3AD6A 4C38A 3U6IA 2JLDA 4YJUA 3A62A 3HVCA 4X3FA 4BDEA 4CT1A 3KFAA 3CE3A 3GOKA 4I0SA 3O71A 5M4CA 2BZIB 5J9YA 2ZV7A 3KU2A 4EEVA 3AD5A 5EHLA 5HD4A 4FKQA 4P90A 3ZTXA 4FT3A 3R83A 4E1ZA 4RJ4A 4RQVA 5IMXA 5IUHA 4GFMA 1U54A 4QTAA 2VO6A 2ZMCA 2VTNA 2ERZE 2YCRA 4L53A 3ATTA 2DUVA 4EKLA 3QQKA 3NUXA 3RK9A 4L46A 4CQEA 4HZRA 1XQZA 2HWOA 2E2BA 5HLWA 4AGDA 3TM0A 2FA2A 1G8SA 3I0QA 2P33A 5IEVA 3C51A 2Y0AA 4XG4A 2J0KA 4JDHA 4FIEA 3ERKA 4TZRA 2ZV9A 3SG8A 3DU8A 5DPVA 5GJDA 4BIDA 2QU5A 2W4OA 4DFYA 1B39A 2V22A 4FGRA 3RMFA 5EK7A 2GS6A 3S2PA 3ORTA 3KGAA 4BCFA 2ITXA 2QG5A 2O0UA 2XK9A 4CFUA 4IWQA 3VWAA 4LOQA 4L42A 2QI8A 3D7ZA 4BR3A 3PPKA 4AA5A 4EH5A 3RP9A 2HCKA 4CFFA 3QRJA 4M84A 4GW8A 4NW6A 3TWJA 3VO3A 2WTIA 4O7LA 4A07A 2C5NA 3QD2B 2QOKA 3R7GA 4G17A 4YUQA 2FGIA 2W1ZA 2Z8CA 3I5ZA 5CALA 1ZXEA 1H08A 1SVEA 3FZTA 5KX8A 5M09A 2YM6A 4EQMA 2QVSE 4EK5A 4NTTA 4FKIA 4FODA 3IS5A 2X8DA 4BDBA 3QTQA 5EM7A 1YOMA 3GUBA 4I22A 4U43A 1A06A 1GNGA 4U3YA 4YJSA 3TDWA 4BHNA 4TKSA 4PDOA 3NW7A 3A8WA 4N6YA 4NUSA 2PUIA 4EONA 1OPJA 3D7TB 3O7LD 5AP4A 3UNKA 2JKQA 3FI8A 2W4KA 3PG1A 4KKGA 3UBDA 4O27B 4RZVA 3ZZEA 5I5ZA 4JR7A 5CNNA 4J95A 4XRJA 1ZARA 2A4LA 3TNPC 3QKLA 1TQPA 4FTUA 4IAKA 4RC3A 4QPAA 1KV1A 3BLQA 2YDJA 5IDNA 2C30A 3Q4ZA 4FNYA 5H8GA 4FUYA 4IADA 4XJ0A 3MJ1A 1FMKA 5DE2A 3VUHA 4R6VA 1XH5A 2BTRA 1JQHA 2YLFA 5CF8A 5BYYA 4WKQA 3NS9A 2EVAA 3FMEA 2W9ZB 4WRSA 3TXOA 5L8JA 2XUUA 3ZRMA 2VTSA 2QOIA 4C37A 2FSTX 4R5YA 4R7BA 2XA4A 4X2FA 4GV1A 3AC5A 4L00A 2HWPA 4PMPA 3MY5A 5KMOA 4N70A 3HYHA 3L9NA 3BIZA 2UVXA 4ALVA 3H4JA 4UMQA 4H39A 1J1BA 3AMBA 4EKKA 2G2HA 4F9BA 4CXAA 1XBBA 2X81A 5CSXA 3CXWA 2QCSA 3C4EA 4U45A 3QYZA 2WQBA 2QQ7A 4G6OA 4DLJA 4Y5HA 5HCYA 1YDTE 1OITA 3OS3A 3KRLA 2C5XA 2JEDA 5H8BA 2WMTA 4EOMA 5EOLA 3DQXA 2PPQA 2CGWA 3UDBA 2CPKE 4IAIA 4L3LA 4FTJA 3C0HA 4BGQA 3ZSGA 2C69A 2HYYA 2CCIA 4PMSA 3RAWA 1G5SA 1H1WA 5HESA 3LCSA 3QD4A 4KIKB 3TT0A 2YFXA 4QPMA 2XF0A 5LJJA 2B54A 3QFVA 2C0IA 4FC0A 5JGAA 3LOKA 4FGBA 4BDKA 4BYIA 3BGQA 4TY1A 4CGAA 4X2KA 4FV2A 4ORKA 3HAMA 3QXPA 4C35A 3ULZA 4EH6A 1MRVA 3CD3A 4QP9A 4FKTA 4RLKA 2R3KA 1XH9A 3HECA 1OI9A 3QUEA 4GT4A 2R3FA 4O6EA 3UMXA 4E3CA 2VRXA 1PRYA 1XKKA 4GFGA 3O96A 3VUMA 4DEDA 3MJ2A 4ZSEA 3WZUA 5LVOA 5IF1A 2RF9A 3DKCA 2AC3A 3S0OA 5K5XA 3GU7A 3F61A 3U6HA 4TYEA 1W82A 3FKLA 3QA8A 3PLSA 3PWDA 3QQGA 3IK3A 3QCXA 4JXFA 1L8TA 2CMWA 4AW1A 4JNWA 5AV2A 4D0XA 1OB3A 5BPYA 3R7EA 1J3HA 2VTTA 3UOHA 2CSNA 3F3VA 4CLIA 2JDTA 5DEYA 3LXKA 1AGWA 3F6XA 3PJ3A 5EHOA 2BIYA 2V7AA 2XKDA 3PXFA 3V5QA 3RPRA 1H00A 1U59A 4B9DA 4TNDA 1WBVA 5AUVA 4WT6A 1SYKA 4CRLA 4O91A 4RFYA 4EQCA 2J0LA 4YJVA 5CNOA 4QT1A 3PDTA 3LAUA 4OTDA 3RK7A 4D5HA 3QTRA 5CEKA 4LUEA 4OTPA 2B4SB 4ZY6A 3EL8A 2W5AA 3HRCA 5BMSA 5KHXA 1OL2A 5CSHA 4CEGA 2CLXA 1UV5A 4WRGA 4YBJA 5BVWA 5K4JA 5EHYA 1IA9A 3H9RA 2C1BA 3MH2A 4X2GA 4F99A 4XUFA 4A06A 3NW5A 2CLQA 2HXLA 3R73A 2RFEA 3R1SA 4C59A 2VUWA 1YXSA 4NCTA 3LFNA 3QKMA 4FV5A 1BL7A 3GNIB 1OZ1A 2GU8A 3MDYA 3RPYA 4AWIA 3QZGA 3R7UA 5JFWA 1NA7A 2EXMA 4RBLA 5ANEA 3FEGA 2BROA 3DTWA 2XEYA 2VTLA 3GB2A 5TKDA 5BVEA 3ZHPC 4D2VA 5I9VA 1OM1A 4AAAA 2CJMA 3WF6A 5JFVA 3OFMA 2QLUA 3HDNA 4XG6A 2ZVAA 5E8VA 4AGWA 5LQFA 1XH6A 1KSWA 3IONA 4W9WA 4L7SA 5CS6A 3PFQA 4BZOA 1SZMA 2WQNA 3HP2A 4AP7A 4XNEA 1JSUA 5CAPA 1ZY5A 2REIA 2W17A 4PMTA 3FPMA 2BVAA 4ASZA 1GZ8A 2GHMA 4G3FA 3OWJA 4BGHA 4CZYB 2ERKA 4P5ZA 4DH3A 3WF7A 2C3LA 2YIQA 5E91A 1WBOA 3IW5A 5M4IA 2QOHA 3QQFA 3MFSA 4OR5A 4RIWA 3O50A 5EDRA 4RIXA 3WE4A 2EU9A 4KRCA 4AOTA 3GU5A 1Y8GA 4I1ZA 3QHRA 4DCAA 3KULB 2B9HA 1APME 3COHA 4AFEA 4RIOA 2WD1A 3NX8A 4X6RA 2OBJA 4RVKA 5FWKK 3UOLA 3FMDA 3QBNA 3FLYA 5FM3A 4BTJA 3ACKA 4O7NA 3LZBA 2YN8A 3W2SA 4MX9A 5HOAA 3GU8A 3SW7A 4MYGA 1XH8A 3LW0A 4UALA 2VWUA 2VO3A 3HMOA 5DT0A 3R22A 5AX9A 2ETKA 5AFVA 5F1ZA 2YLEA 4JQEA 3W16A 3ANQA 3K2LA 1CM8A 5GIPE 4ZSAA 1JAMA 3BYUA 1SMHA 5J79A 3CR0A 5EYCA 3NMUF 5A4LA 5EKOA 4LM5A 2WQEA 4FZAB 1PXPA 2GNIA 4RJ6A 3R01A 3CQWA 5C9CA 5J1VA 2H96A 3GQIA 2QO9A 3PWYA 3T9TA 3KXHA 5CEOA 2I7QA 4Y85A 3AT4A 4I20A 4QMNA 5BUIA 1W8CA 3QGWA 4GRBA 2W06A 2CKQA 3PIZA 4A4LA 3ZO2A 2X4ZA 3S95A 5K5NA 3TZMA 2Q83A 4CMOA 3WIKA 5J9LA 3RM7A 4I24A 1BLXA 4O0RA 4DG3E 2B9IA 1WBNA 1GIJA 4NK9A 3SKCA 5CF4A 3FKNA 5IQFA 3DKFA 4XV3A 3R8PA 3R1QA 3MVLA 3C50A 4B7TA 4BDJA 2OZAA 4RA4A 5IA2A 3UQCA 4PL5A 3R21A 2YITA 3RINA 2V5QA 4I92A 3DAKA 5CU0A 5AIKA 2PVJA 1RE8A 5DG5A 1XH4A 4GCJA 4IMYA 2A27A 3PE2A 2BTSA 1BL6A 4FSMA 2CGXA 3R00A 5FQDC 5I9WA 4A4OA 4OAUC 5EQPA 5HU9A 1RDQE 4R7IA 2BRNA 1UU7A 5FBOA 2UZNA 3L9LA 4BKYA 4I6FA 3G9LX 4GYGA 5CASA 3ORZA 3ZCLA 5KMIA 3KA0A 3V8SA 2W1HA 2XEZA 2A1AB 2G2IA 3R2BA 4MXYA 3WOWA 3POZA 3TZ8A 5JT2A 5HBEA 4TYIA 1DAWA 1Q97A 2ZDTA 5ETCA 2JIVA 3RHKA 3OBJA 5H2UA 3HMPA 4IDVA 1YQJA 4NEUA 5AM6A 5CAVA 3ENHA 3ZM9A 3ZBXA 5JGBA 3ROYA 4XG8A 5A4CA 4PDYA 1ZYJA 2JAVA 2NPQA 5T3QA 3QLGA 3UVPA 3S00A 3RNYA 4F7NA 3W18A 4HJOA 3TI1A 4E5BA 1WBWA 2OICA 1JKKA 3KCFA 4QTEA 3VBTA 5IUIA 3A99A 2OXXA 4AZTA 4FV8A 5IISA 1V1KA 4FIIA 4DTKA 4G16A 4KB8A 4RX5A 2GNGA 5AV1A 4O7WA 5ACKA 3Q4TA 3BHUA 3THBA 1WBTA 1KUTA 2IJMA 4ZMFA 2WTKC 3M1SA 3QYWA 4DGNA 4LL0A 3DKOA 4TYHB 5A46A 3OEFX 1CKPA 3A4PA 1OIRA 4IM0A 4N6ZA 3CP9A 4V0GB 3FQHA 4ANSA 2W0JA 5ETAA 3DDQA 2W99B 3C0GA 2O64A 3LKMA 3DT1A 3TNQB 3QTXA 4XG9A 3KRJA 4MK0A 3PZEA 4BTKA 2EB3A 4EHZA 3QCYA 4LOPA 4KIOA 4APPA 3TG1A 4U79A 3FJQE 3VS0A 4CQGA 4AW0A 3OC1A 4EBWA 5EW9A 3VS2A 4YJQA 1OBGA 2C68A 4E7WA 5K3YA 4GK2A 4M14A 1B38A 1M7NA 5AR4A 4XG2A 1P5EA 3RHXA 4BFMA 4F0IA 3VBWA 3LXNA 2HXQA 4W8DA 3LFBA 4YZDA 5CWZA 4ASDA 4DYMA 4P7EA 4QP4A 4EZ7A 1FINA 3KL8A 4JDIA 3MY1A 1CMKE 2NRYA 4BCQA 1YDRE 2WZJA 4FV4A 1Q8UA 2GNLA 2R7BA 4S32A 5CI7A 2Z60A 3ZXTA 4BWXA 3B2TA 2X9FA 3EB0A 4QYGA 1YWRA 3F82A 4IHPA 3CTHA 3SLSA 4WO5A 1W83A 4MBJA 4ZTSA 3KMUA 4UY9A 5L2IA 2O65A 2OF2A 4M12A 5DNRA 5LMKC 4F6WA 1GZKA 1DM2A 4YTCA 2VGPA 3F69A 3QD3A 3PUPA 4JOAA 5HO8A 5M08A 1XBCA 4K0YA 3ZBFA 2DYLA 2VWIA 1BI8A 5CT0A 3OW4A 4QP3A 3SA0A 4S31A 1H24A 4TWNA 3PA5A 1G3NA 2XNMA 4YJPA 4FTQA 1OGUA 1BKXA 1WFCA 2JDOA 1BMKA 3Q6WA 4O2PA 4HCTA 4QMZA 5A4QA 1P14A 4O86A 1PYXA 3UC4A 4BIBA 4ANMA 3QQHA 3MPTA 2EUFB 3BCEA 4ITJA 5BQ0A 1UKHA 2B53A 5BYLA 4ENXA 2HW6A 4O84A 3DK6A 3W8QA 5E90A 4EOSA 1H0WA 3PIXA 3ET7A 3UGCA 4A7CA 1J7IA 2B9JA 4O7YA 3LXLA 5EDQA 4U0IA 4ZSLA 2PE0A 3LMIA 3ACJA 3HDMA 3PG3A 5GHVA 5GNKA 5FEDA 4FV7A 3OG7A 2HZNA 2JDVA 4IM3A 4DEIA 5HO7A 4CTCA 4BDAA 3D4QA 4U3ZA 3LCOA 4LGDA 3UYTA 4R77A 4ASEA 1OUKA 5CU6A 1JKSA 2QO7A 3EWHA 5HTCA 2XIZA 3O8UA 3TIZA 4GIIA 3NW6A 2X2KA 4S34A 4MWHA 3ZOSA 4ZSGA 2QC6A 4JJRA 3OOMA 4NM7A 3F3UA 4UBAA 4BDCA 4FIFA 1ZRZA 4X3FC 4FE2A 4CKJA 5KKRC 4LGHA 2VWYA 4XG7A 4GSBA 2JIUA 4C4JA 2R3PA 3KY2A 4BYJA 4E4NA 2J2IB 3BU5A 4AN2A 4Y8DA 1UU9A 3E8DA 1X8BA 4RWKA 1O6LA 1OECA 2RSVA 3NUYA 3UIBA 3PLAE 1E1XA 4RA5A 2ZDUA 5H9BA 3ALNA 2R3HA 4DLIA 3KMWA 3QTZA 1ZOEA 2GHLA 4E26A 2IZUA 2J7TA 3N9XA 3NUPA 1Q8YA 4JR3A 4L45A 3ANRA 2WMQA 4XLIA 5KKRB 4ERKA 2R64A 4YO6A 4K11A 2BHEA 4QMLA 2OF4A 3VUGA 1DI9A 2CNVA 1H25A 5EFQA 3TDVA 2WMBA 3EFJA 2BFYA 4KRDA 4O96A 2XNPA 3JVRA 5IA5A 5CXZA 4NIFB 1U54B 2YAAA 3OZ6A 5D7VA 3P9JA 4E73A 4BIEA 2C6TA 5HG9A 4B8LA 3MH3A 4O7RA 5AA8A 2JBPA 2QOCA 4IVCA 4RJ5A 2WIHA 4WG4A 1Y6BA 3R9NA 4RGJA 3UNZA 4V05A 3EN4A 5CVGA 2P4IA 3MIAA 1PMEA 4Q9SA 2CN8A 3LXPA 3ZUUA 4C2WA 4NW5A 4IZYA 4U42A 3Q5IA 4FKOA 2BHHA 3QRTA 4F0GA 3OXIA 2BRBA 4S33A 2R3JA 2G2FA 3GQLA 1Z57A 2G1TA 3ZH8A 2JIIA 5M44A 2C6KA 5AUZA 3F3ZA 2ZM1A 4HYHA 4HGEA 4JQ7A 3CBLA 3FHRA 2X2MA 1OL7A 1SNXA 2HELA 5HLNA 4TNBA 2A19B 3CCNA 4DGLC 5AP7A 4AZFA 2C6LA 3DB8A 4O0VA 1A48A 4E6CA 5J5SA 3HA6A 5CU2A 4XH6A 1XHAA 3EJ1A 3RGFA 4A4XA 3UO4A 2H8HA 3E87A 3PJ2A 4EOKA 4L3JA 2ETMA 2F7XE 3NVMB 3I1AA 5EW8A 3VHKA 1KOAA 2XNGA 4W4WA 3BU3A 4USEA 5T6KA 3DNDA 4FSYA 4L3PA 3NNVA 3QGYA 2XYUA 4TRLA 3VBXA 5EOBA 4NJ3A 5BMMA 4FBXA 5FG8A 4LQMA 4II5A 5EM6A 3GEQA 1HOWA 3F2AA 4E6AA 3FLNC 2PVYA 2JD5A 4UMTA 1VEBA 3GGFA 4DT9A 3C4XA 4XX9A 4UYAA 5HVYA 1YHWA 5BVNA 4APCA 3A4OX 2IWIA 4NT4A 5A3XA 1MP8A 3BYSA 5H8EA 4O81A 1UA2A 2JDSA 3PA3A 4J8NA 4H1JA 2OFVA 3OD6X 3TCPA 3OHTA 5IPJA 2GNJA 3TJDA 4IACA 4KUJA 2Y8OA 4XV2A 5JQ8A 3HMIA 4RQKA 4KABA 4CG9A 4KWPA 2XKEA 3UVQA 2YERA 4XMOA 3TKHA 2VTMA 4RWLA 4LL5A 4YHFA 3MN3A 5J5TA 3GI3A 3ZUVA 4FTIA 4G6NA 3RCJA 4QTCA 4E20A 4J7BA 1F5QA 1URCA 5HCXA 4ZXTA 1MRYA 5A6OA 3QRUA 1Q5KA 1R1WA 3MBLA 3IGGA 1ZLTA 1UVRA 4U6RA 3VW6A 5D7AA 3I81A 2Z02A 4IM2A 3Q6UA 4JBOA 3LCKA 4H58A 2XIXA 5AP0A 3ZFXA 2UZTA 4D2PA 1Q8WA 4TT7A 4QTDA 4WHZA 3DQWA 5AR3A 3DA6A 3VF8A 3R7YA 1Y8YA 3B2WA 3OCTA 4QQCA 3A7IA 4NSTA 3UC3A 4IB5A 3UQFA 2ITUA 3K3IA 1UNGA 5C27A 4QQTA 2HENA 3ITZA 5LOHA 1IA8A 2YM7A 5ANIA 4WUNA 5BNJA 2W1GA 4BGGA 3HNGA 5LCKA 5D9HA 1YXTA 3OW3A 4H3BA 4P4CA 4RT7A 3V5JA 4C2VA 4CKIA 4EOOA 5KBRA 2OWBA 1NVSA 3N4TA 1H0VA 4KAOA 4EK3A 5I4NA 4FG8A 4RIYA 3AGLA 5HGIA 4FSQA 2HOGA 5IEYA 4U7ZA 4MEDA 4F1OA 3AC2A 4I4EA 3NYNA 4A9YA 4DTAA 4ZP5A 1MQ4A 4O7SA 4YTFA 3D83A 1FVVA 4IX4A 5AP6A 3PTGA 5IH6A 4AOJA 4P5QA 3OT8A 4G9CA 3U51A 1PYEA 5CYIA 3AG9A 3ROCA 4AW5A 2CGVA 4WG3A 5ANDA 3B8RA 4IWDA 5DLSA 5EYMA 3VS1A 3U54A 2R3GA 1SVGA 3DBFA 3MGYA 3QRKA 4HPTE 5L2SA 2OI4X 4DINA 3HA8A 1PXKA 3R28A 4FTTA 3V5WA 4EZ5A 5FDPA 4KBCA 3U9NA 3U6JA 4XP2A 2PU8A 2O3PA 4IFGA 5EYKA 2QLQA 3GVUA 3RWPA 1MQBA 4ANOA 4GH2A 3P79A 5FGKA 5JMSA 4FKPA 4YTIA 3PJ1A 4D4VA 1YVJA 4MXZA 3WF8A 5FTGA 2BAQA 1UU3A 2YM4A 3EQIA 3M42A 3PE1A 4TN6A 3W2QA 3SGCA 3DBCA 4TW9A 2WMRA 3EQFA 4ZZMA 5HX8A 3BEAA 2E9UA 3MW1A 3EOCA 4MXXA 3CPBA 3DS6A 3K5UA 3PP1A 1PXJA 1M17A 4ZTRA 1AD5A 1H1RA 3VRYA 2Y6OA 1ZZLA 4FTOA 4D55A 4M69B 3FZPA 2XRUA 3I5NA 3FMMA 4NCTC 3ZLYA 2UW7A 4IAAA 3O17A 3ZO1A 3LCDA 2GNHA 2R2PA 3EKNA 1TVOA 3PSCA 3R8LA 3DAJA 5M06A 3O0GA 5IMEA 3R9OA 5DRDA 4WNMA 4E6DA 3PRIA 5E9EA 2CCHA 2ZV2A 3QZFA 3VULA 3WZKA 3UZTA 4GG7A 3E88A 4JIKA 2C6OA 4ZY5A 2UW3A 2UVZA 5CLPA 4H3QA 1VR2A 1YXVA 5ANKA 4O83A 3H30A 3PVUA 4IIRA 4ZJIA 2VTIA 1TQMA 1Q61A 4Z3VA 4JL9A 1M2QA 2QOBA 4M15A 5JZNA 3FXWA 4Z7HA 1S9JA 2YM3A 2J5FA 4MXOA 1ZWSA 1JVPP 2YEXA 1EH4A 5I0BA 5CAOA 3Q52A 3R0TA 4PUZA 3BHHA 4MF0A 4D28A 3OXTA 2P2HA 2J4ZA 4I94A 4EUUA 2QHNA 4FA2A 3FZ1A 5E92A 2PUUA 2R3LA 4M68A 2BRHA 5FXRA 2F2UA 3MA3A 4I3ZA 3ZYAA 4ANLA 3Q4CA 3UYSA 5B2LA 3R9HA 2CKPA 4BCHA 4MF1A 1PMUA 5IA4A 5J7HA 4XCUA 3AC4A 1FMOE 1Z5MA 2E9PA 2ZB1A 4NH1A 5AR2A 2ZAZA 4ANQA 4FL3A 4C58A 2DS1A 1W0XC 4FYOA 1U5QA 2UZEA 4RIWB 3QWJA 2AUHA 2V7OA 4U97A 1JBPE 4X2NA 2OJJA 4L7FA 5FXSA 5HLPA 2YIXA 4NFNA 4FIJA 5E8TA 2PMIA 3C9WA 2ZM4A 2PE1A 5DR6A 3BPRA 3GC0A 5ANJA 1YI3A 2X2LA 3P7BA 5FTQA 5DVRA 3ORLA 2UW0A 2WNTA 4FT9A 2AYPA 1MRUA 5FM2A 3PXQA 2ITYA 3NPCA 5CQWA 3LQ3A 3TTJA 4TWPA 4AT4A 4BKZA 4HVGA 3TUBA 3UTOA 2C6EA 3BI6A 3JR1A 1CDKA 3NSZA 2ITZA 3RZFA 3ZC5A 2YWVA 4D1ZA 2BCJA 3VJOA 3HGKA 3QC9A 5HQ0A 4G3EA 2RFSA 3HRFA 4EC8A 3T3UA 3CGOA 2J6MA 5D10A 4WIHA 1J7LA 5HG5A 5TT7A 3QALE 4NFMA 4F08A 1IAJA 3F2RA 4NJDA 4NM5A 2OZOA 1I44A 4O2ZA 4V01A 1OKWA 4RRVA 3UODA 4U5JA 5LMBA 4YNOA 2PULA 2R3MA 4AACA 4J8MA 4GJ2A 1E1VA 4QMYA 4D1XA 4LGGA 2EB2A 4MBIA 3V3VA 3C5UA 4FIGA 4FKRA 4JT3A 4R3CA 1W98A 4DEHA 2PE2A 4TL0A 4H05A 2QODA 2PUPA 2VN9A 3ZLWA 2P0CA 3RAKA 4BF2A 1IR3A 1O9UA 3MVJA 2JFLA 2OFUA 2QR7A 3F7ZA 3MH0A 4UV0A 3SXFA 3VS5A 3W2PA 3ORNA 4IANA 3MI9A 4QMSA 5JKGA 4OBOA 4NWMA 3EQBA 4TWOA 1KV2A 5IDPA 2RL5A 2C3JA 3TEIA 1ZYLA 2ITWA 5C03A 4FKGA 4FV1A 2KULA 4C3PA 3KN6A 3R9DA 5HX6A 3LM5A 4AE9A 2PZPA 3W10A 4HPUE 4IE9A 3GT8A 1XJDA 3OUNB 4YJOA 3C4CA 4GUBA 5AP2A 5E8SA 1DS5A 4F64A 4M66A 4G2FA 5JH6A 2PVMA 1RQQA 2PVLA 2QURA 3UIUA 4AZVA 5HHWA 1OBDA 1AQ1A 4DFXE 3QAME 2XBAA 2R3OA 2YM5A 5HIEA 5HVKA 3MB6A 3BYOA 2DWBA 5B2MA 2BIKB 4EQUA 4NM0A 5HNIX 3DB6A 2QOQA 3UE4A 3SRVB 4AQCA 3ZLSA 4FEXA 4H3PA 4WA9A 5EYDA 2GQSA 2BR1A 4RX9A 1URWA 2WB8A 2Z7RA 3E93A 4FSNA 5GJGA 5ACBC 4OAVB 3G90X 3HP5A 2OO8X 3R8VA 1YOJA 4F6SA 3MA6A 5IEXA 3Q53A 4FG7A 1E9HA 3ZM4A 3OWPA 2Y4PA 3NZ0A 4MNFA 3PVGA 3KF7A 4A9TA 4XHKB 3F66A 2QONA 2C6MA 3HZTA 3EKKA 2WELA 3LJ2A 4BWKA 3L9PA 1O6YA 3MY0A 3QUDA 4R7HA 4Y5QA 4Z16A 3WF9A 3TL8A 1VZOA 3GU4A 4AU8A 3NEWA 4GYIA 5I3OA 3RAIA 2WMWA 2BDWA 3FI3A 5DEWA 3D7TA 5CZIA 5H3QA 5KZIA 1WVWA 1JOWB 4BY9E 4W4YA 4BDIA 3JUHA 4FSUA 5DHJA 3KRWA 2X8IA 4AZSA 5DN3A 2A2AA 1K9AA 3LPBA 1T46A 2YAKA 4DF3A 4EYJA 3MPAA 4S2ZA 3JY0A 3E8EA 3KKVA 3QX4A 2ITTA 2PMNX 3QHWA 1H07A 4CV8A 5KNJA 4ACGA 2BDJA 5AUUA 4I5CA 2XP2A 1FPUA 1REJA 1YRPA 2YDKA 4LUDA 3CTJA 4OTGA 5CU3A 3BHVA 4GL9A 3H0ZA 4DEAA 4B8MA 2OKRA 5C8MA 3HV3A 4AA0A 5DWRA 4KNBA 3WILA 4IX5A 3T3VA 3ODZX 5I9YA 2Z7QA 3BELA 4CCUA 2JGZA 2J0JA 3Q9YA 4EWQA 4ZZNA 2WTCA 5JRQA 3RM6A 2YDIA 2WFYA 4FKSA 1UWHA 2XS0A 2JFMA 4D58A 4Q5EA 2FVDA 3NLBA 3DJ6A 2UVYA 4AW2A 1OIYA 4C02A 4EH9A 3R7OA 1GJOA 3DK7A 3ZC6A 3WYYA 1HCLA 3DZQA 3ZRKA 4I6BA 5M4UA 3CKWA 3O23A 4HCVA 2FYSA 2OJGA 3WBLA 4BL1A 4GU9A 5HTBA 2Y6MA 3P78A 4ACCA 3MFRA 3VNTA 2IZTA 3PXYA 5HNBA 2JDRA 2UW9A 3L8PA 4FR4A 4CT2A 4JAIA 4KKHA 1RJBA 2BZKB 5BYZA 4X0MA 4KIKA 4O21A 2VTJA 4GVAA 3VUDA 2Y4IC 5J9ZA 4NL0A 5AV3A 2VU3A 1LUFA 4BDFA 4JG6A 1CSNA 3IDPA 3TNHA 4CFXA 5HO6A 5A6NA 4DE4A 4UEUA 3KCKA 4RX7A 4FVQA 4C4FA 4A9SA 2VX0A 4QYYA 1GOLA 3FLWA 3H9FA 5HI2A 2R3QA 3FAAA 4RSSA 2LGCA 3BE9A 4AF3A 3VHEA 4BCIA 2XM9A 5KZ0A 4Y83A 3PYYA 5AUYA 4O0XA 2GTMA 3QZHA 4J98A 1UNHA 5D12A 3KF4A 4XRLA 3TKIA 3KXXA 3FXXA 4G3CA 4PL3A 4W9XA 3LFEA 3SC1A 1OPKA 3SQQA 3SXSA 4K8AA 5KUPA 3ORIA 4EYMA 2Z7LA 1MUOA 4QMTA 2BDFA 3FY2A 5GZ9A 3GCQA 5L6WL 3D5XA 4RFZA 4I5MA 4BTMA 3AXWA 5TE0A 4RJ7A 3CEKA 2IVTA 2WAJA 5GJFA 1CTPE 4PP9A 4BVUA 2E9NA 4FKLA 4MKCA 2QG7A 3UJGA 2R0UA 2WIPA 2IW6A 2ESMA 4P2KA 2QKRA 4U40A 5M55A 3GFWA 2PVNA 3MV5A 4F7SA 4DH5A 5HG8A 4U81A 3ZSHA 4IX3A 4IWOA 4PNIA 5FP5A 1H1QA 3CPCA 4YZ9A 4EOIA 3M11A 5DGZA 5AV0A 4A9RA 1K2PA 3UO5A 4O0SA 3ID6C 3VIDA 4LMNA 2WPAA 4ALWA 5LVMA 3GC7A 4RVTA 3O8PA 4RFMA 5K0XA 5CAUA 2X6DA 5L6OA 2WMVA 5TF9A 2ITPA 5CT7A 2WKMA 2XIKA 3L8XA 3TJCA 3IW4A 5HBJA 3MTFA 5I9ZA 1IASA 3U4WA 5ANGA 5AM7A 5IQGA 3W33A 2XIRA 2XVDA 4YHJA 1YI6A 3DGKA 5CTPA 3FUPA 4FV3A 5CVFA 1JSVA 3UIXA 4FOBA 5BVKA 2OJIA 2GSFA 4XYFA 3CY3A 4G3DA 2XJ1A 4XP0A 3IOPA 5AP1A 4FNZA 3W2CA 1TQIA 2XBJA 5DR9A 2QNJA 1QPDA 3UMWA 3IDCA 4MH7A 4EI4A 2I0HA 3SAYA 3CJGA
chains in the Genus database with same CATH superfamily
2AC5A 4WNPA 5HEZA 4C0TA 2GHGA 3RI1A 2WTKB 3GOPA 1OVEA 3QCQA 3G6GA 4AG8A 3KK9A 2W1EA 4YNEA 2YABA 4YZCA 4HZSA 3JYAA 2OU7A 4HVIA 1R0PA 4Z7GA 4F9CA 3EQHA 5JGDA 4XBUA 3OTUA 4DEEA 3G9NA 4ZAUA 4YJRA 5CEPA 4O1PA 5M51A 2ZM3A 3F5UA 4FICA 2HZ0A 3LQ5A 4RZWA 1F0QA 3MWUA 4EHVA 3MFUA 3CSVA 3O5AA 5HE1A 4RG0A 3W0NA 3UP2A 3KXNA 3KVXA 4WBOA 4JX3A 4F63A 2HW7A 3DCVA 3L1SA 4JS8A 3WZDA 2BALA 2C4GA 1H1SA 2NP8A 2PVFA 3TV6A 4Z9LA 5FRIA 1M14A 2VGOA 4DEGA 2W1IA 5GZ8A 4EK8A 3OY1A 3LCTA 4PTCA 1M2PA 4K18A 2C5YA 5DR2A 2WQOA 3LFQA 3I7CA 4TYGA 5AAEA 5KMJA 4BBMA 5ANOA 3I6WA 2W1DA 3W32A 3KULA 2GNFA 3I7BA 2CGUA 3L8VA 4UZDA 4ZTMA 3U8WA 3LJ1A 4Y95A 4CNHA 4J52A 1GAGA 4J96A 3KXMA 4R5SA 3G51A 3WIGA 1PKGA 3DZOA 3WF5A 4B6LA 4FKJA 2JKMA 4BTFA 3VBYA 1V0OA 2VWWA 3E64A 4FVRA 4PQNA 2IVUA 4KINA 4DAWA 1QPJA 5L8KA 5EI2A 2P55A 4HNIA 4BCOA 1XR1A 3MTLA 3NIEA 4QP2A 4GFOA 3H0YA 4JBPA 4MNEA 3SW4A 4IZ7A 4EH8A 3AQVA 3F9NA 3V5LA 4MD8E 3RWQA 4L68A 2OSCA 2NO3A 2OXYA 4ARKA 4DFZE 3BBTB 5F94A 3NUAA 5DMZA 3PFYA 3G2FA 4WSYA 4AGUA 4FEWA 5AR8A 3ZO4A 4HCUA 3ENMA 2OJFE 2F4JA 3HRBA 3Q32A 1P2AA 3BV3A 3D5VA 4FT0A 4YPDA 2BKZA 5CEQA 4FSWA 5EH0A 3MH1A 4YPSA 3WE8A 4AS0A 3DLSA 3II5A 3VS6A 1DAYA 4K2RA 5E8YA 4TTHB 5AUWA 1PMVA 4QP7A 2DQ7X 4YGAA 3FDNA 4ZS4A 3EN7A 3PSDA 3QRIA 3E8NA 3DBQA 2W1CA 3FZOA 3OCSA 1WVXA 2R9SA 4O1OA 4RVMA 3N4UA 3DXNA 3R1YA 5LXMA 5AUXA 2ETRA 3QTIA 3UG1A 4HYUA 4F6UA 4UN0C 2WU7A 3FMHA 1W2CA 4ZK5A 2GPHA 3KK8A 3B8QA 4UMUA 1Z9XA 3G0FA 3QZIA 5EKNA 1ND4A 1WZYA 4Q2AA 4M0YA 1OIUA 1SM2A 2JBOA 4X3FB 5GINE 2BKKA 2YM8A 3W0PA 5IA3A 2XKFA 3SXRA 2UW6A 2EXCX 1YXUA 4ANNA 2EXEA 3BV2A 1OIQA 4DH8A 1YWVA 3C13A 4YJNA 5K0KA 5F20A 5TOZA 4BI1A 5IUGA 3OWKA 3VS3A 2ACXA 2ZJWA 2JAMA 4GT3A 4D4SA 3TV4A 4C33A 4CZUA 4GG5A 3BYVA 2QOOA 4BCGA 4M13A 4O0WA 1FGKA 2G15A 3HLLA 3LFFA 3OEZA 4D2WA 2C3KA 2HIWA 2GDOA 3HMNA 4LV8A 3ULIA 4IZAA 1R39A 3BLRA 5HG7A 4O22A 5CEIA 1KE8A 4XOYA 4AXAA 1Q8ZA 4IB1A 2C1AA 4IVAA 1VYZA 4W4XA 4WG5A 4BICA 3LQ8A 3ORKA 4EJNA 3OROA 4C4HA 4JG8A 4CYIA 3ZU7A 5GZAA 1UWJA 3RPSA 1Q3DA 2UZVA 4DG2E 2R0IA 3AT2A 2WHBA 3C1XA 2VTHA 4QDVA 4TYHA 2B52A 3RNIA 4Q9ZA 3CD8A 1OL1A 4JAJA 5FP6A 2X7OA 3BLAA 4QDEA 3R02A 4UWCA 3EIDA 3FWQA 3G6HA 4C8BA 5HIDA 3A7HA 5JQ5A 3KRXA 5L4QA 2SRCA 1CKJA 2GFSA 4IZ5A 5HICA 3R8ZA 4CD0A 4XLVA 3LIJA 1PXOA 3C4ZA 3ORXA 4FG9A 3DBEA 3VS4A 4QP8A 4CKRA 4FYNA 3QL8A 3OT3A 2C5OA 3QWKA 1TKIA 3CGFA 4F9YA 2XALA 2CNUA 1S9IA 1Y57A 2BZJA 5L3AA 3W0SA 4DT8A 3KEXA 4USFA 1U46A 4BCMA 3DXPA 4YP8A 5AR5A 1DI8A 1OGYA 4RMZA 2Z2WA 4FEQA 4K33A 3BRBA 1UU8A 2PSQA 4WSQA 3EHAA 4UYNA 5ITAA 3CLYA 3QLFA 3EQPA 2I0EA 1J91A 1H27A 5B7VA 1NT2A 3ETAA 4LDTA 3FC1X 4BZNA 2WU6A 2G01A 4DGOA 1YDSE 3QD0A 2OIBA 5C1QB 3FY0A 1WBSA 2GTNA 4Y72A 5L2QA 2W5HA 2YISA 3A7FA 3F5XA 3CY2A 3CC6A 1OL6A 4NKSA 4W8EA 4F9AA 3MB7A 2AEGA 2VWBA 3GU6A 2X0QA 2YCFA 3IW7A 3OOGA 5C4KA 3IGOA 1OKYA 4MHAA 3WZJA 4AA4A 2Y9QA 4LI5A 1FGIA 2XNEA 2RG5A 3AMYA 4G5PA 3C5IA 2J5EA 4ASXA 3EH9A 4EUTA 2CKOA 3PRFA 4HVSA 2OW3A 2UW4A 3GP0A 4EJ7A 3GBZA 1GIHA 3FZRA 4PDPA 3WI6A 3OWLA 3UPZA 4C4GA 1LEWA 3MS9A 4HOKA 2E9VA 4JG7A 3QQJA 4BDGA 3FMJA 2QD9A 4QP6A 5AWMA 3BQRA 1JWHA 1YWNA 4YO4A 3QQUA 5DOSA 4FTNA 4CRSA 4L9IA 5LWMA 4ZY4A 4AX8A 5D41A 3DLZA 4UZHA 4DC2A 4G6LA 3NGAA 4EZ3A 3GCSA 4JQ8A 3RBWA 3FMLA 4JRNA 2IG7A 1G8JA 4YMJA 2YZAA 2BZHB 4E5WA 1PY5A 1KWPA 2VV9A 4BBFA 3IG7A 4F4PA 3HV7A 1Q8TA 5C4LA 2FSOX 3OXZA 4QQJA 3ZS5A 3GXLA 4I41A 3PY1A 2XNNA 4YLLA 4WNOA 5FTOA 1SVHA 3UPXA 4AXCA 3G0EA 3ZEPA 5EQEA 4DG0E 3NFGB 4X6QC 4FKWA 2F2CB 4V04A 2FH9A 2WMXA 5JZJA 3VW8A 5IKWA 2W7XA 1Q3WA 2VAGA 4MBLA 5KMLA 1FQ1B 2QOLA 1J7UA 3TZ9A 2C5VA 3WZEA 3VBQA 3DDPA 3QF9A 4IJPA 2GFCA 5KMKA 4ALUA 3BU6A 2BRMA 3P5KA 2R5TA 4TYJA 3DPKA 3QTUA 4QTBA 3RCDA 3DAEA 3VC4A 4CFWA 2PVRA 4YZBA 2VZ6A 2YJRA 1A9UA 3ZDIA 4LYNA 4BRXA 3FQSA 2XYNA 3JXWA 3RVGA 4YU2A 4QMOA 2R7IA 1WMKA 1LEZA 4Y73A 2F9GA 4YC8A 3K3JA 3D5UA 4G31A 2E9OA 4O0YA 3ZRLA 2FSMX 1Y91A 2VO7A 3CS9A 1IRKA 3DV3A 3DBDA 3ELJA 5L6PA 1O6KA 4PTGA 4B4LA 4QMPA 3BGZA 3MVHA 1OPLA 4FUXA 3FI4A 4NIFA 2PY3A 2VTPA 4FZFB 2XKCA 2JITA 3SHEA 2OIDA 3PIYA 4DFNA 4EC9A 3V8TA 4QMQA 1LP4A 5J1WA 3DFCB 2WMUA 3L8SA 1BUHA 2OK1A 4PTEA 4DCEA 3NIZA 2IVSA 4I0TA 4IEBA 3T9IA 2Q0NA 4LG4A 2J0IA 4OBPA 2X0GA 3LLTA 2XK3A 3A7GA 5AAFA 3ZFYA 3TN8A 1HCKA 3ZLXA 2YJSA 3E92A 1H1PA 2UZLA 3PY0A 4YC3A 4GKIA 3GENA 3LFDA 3C4FA 3LHJA 2PL0A 5AEPA 4QNAA 3V01A 5KMMA 2WEVA 3FYJX 3I0OA 2PWLA 3OBGA 5D11A 3ALOA 4K6ZA 3F5PA 5B0XA 5HNGA 5KE0A 3ML1A 3O51A 3PJCA 2QO2A 4UX9A 4I6QA 3HX4A 4WOVA 4RX8A 2OG8A 3FC2A 3I4BA 3F3TA 5HD7A 3NNXA 4D2SA 2PZ5A 3UZPA 5EI8A 4UXLA 2OH0E 4BJJA 4UWBA 2J90A 2XK8A 4PY1A 4D4YA 4L01A 4HW7A 3K54A 3IW8A 2X9EA 4H36A 4AUAA 1FVRA 4MXCA 4C4IA 4MD7E 5FD2A 5FLFA 5AAGA 5C8KA 4UMRA 4YR8A 3DOGA 4WBBB 5TO8A 5CAQA 5JFSA 3R1NA 2CN5A 3FMNA 3SD0A 3ZONA 3SVVA 4RPVA 5HVJA 4E6QA 5BVDA 2W1FA 2GMXA 4QO9A 2WXVA 5IU2A 1QL6A 2XRWA 4PL4A 4LV7A 3TACA 2VTQA 3Q04A 4JRVA 1ZMUA 3IPHA 4GMYA 5E1EA 5LMAA 5TR6A 2CNQA 5AR7A 4JMQA 3HV6A 2X39A 4QOXA 5CI6A 4DITA 2J50A 4KD1A 3BGPA 3FLQA 2H9VA 3COKA 4XBRA 3KB7A 4HYIA 2FSLX 2WTVA 1IEPA 4USDA 3FBVA 1NVQA 4RIXB 1H01A 4J1RA 4NKAA 4YLKA 3A7JA 3GC8A 1BI7A 5LVNA 2IZRA 1Y6AA 5FEEA 4Z55A 2VWXA 2VD5A 1YI4A 5CSWA 4AN9A 2QKWB 4JVGA 5JK3A 3BLHA 3NRMA 4RJ3A 4TXCA 3HUCA 4I5PA 3IOKA 4PV0A 1ST0A 3G15A 4OTHA 4B99A 1SNUA 5K9IA 2G9XA 4K9YA 4TWCA 4IQ6A 3QCSA 4BHZA 1G8AA 4O6LA 3FQEA 2PVHA 3V6SA 1NVRA 4I4FA 4PWNA 4KS8A 3RK5A 2BPMA 5E8ZA 5DBXA 5IG1A 2VNWA 4O38A 4CCBA 4OBQA 2IVVA 5CZHA 2WTJA 4QMMA 3LLAA 3FI2A 3SOAA 2CKEA 4FL2A 4R3RA 3LM0A 4EOPA 4PNKA 4R8QA 1F3MC 1W2DA 3IQ7A 5CSPA 3PPJA 2PK9A 2WGJA 4DHJA 2OH4A 3NWWA 3UQGA 4FF8A 5J95A 2HY81 3A8XA 4YSJA 4D0WA 2OXDA 1IG1A 4M0ZA 4YLJA 2QU6A 3NVKI 3E8CA 3Q5ZA 4D2RA 2OZAB 4GJ3A 4YTHA 5CSVA 3DNEA 3PVBA 4FNXA 4ZOGA 1ERKA 1OKZA 3V5PA 2W9FB 4L8MA 3N4VA 4O0UA 5LARA 3HUBA 1JPAA 3EZVA 1FBNA 2GQRA 1V0PA 4PDSA 2XCKA 4QYEA 2X7GA 2B0QA 2BUJA 4MWIA 3AC3A 3HV5A 4ZS0A 2C0TA 2P3GX 2ONLA 3Q96A 2UW8A 4CFVA 4FTRA 4FTKA 2PVKA 4GIHA 4F0FA 1TZDA 1W2FA 3TKUA 4E8AA 5K4IA 3V04A 3W8LA 3A2CA 2B55A 3C7QA 4C36A 4IDTA 4YBKA 2PZYA 4BBEA 1OUYA 4MD9E 1ZYDA 4ZEGA 3NUSA 1R3CA 3Q4UA 3RPOA 4AGCA 3I6UA 3WYXA 4BI0A 5L2TA 2VNYA 4O4EA 1PF8A 4CG8A 5FDXA 3DTCA 3NAYA 2UZWE 3LMHA 1ZY4A 2X4FA 4FRFA 2PZIA 4O0TA 4GK3A 4AOIA 2A0CX 4BC6A 4OLIA 4C4EA 3AOXA 3P23A 2ZYBA 4I5HA 3P7CA 4I23A 4QMXA 3L9MA 4KSQA 4ZLOA 4X3JA 3RKBA 3ZZWA 4EK4A 4EORA 3GCUA 1W7HA 4GS6A 4M69A 2XK7A 4OTRA 4FZDB 4IX6A 4L52A 2X0OA 2XMYA 5FXQA 1PHKA 2KTYA 5BVFA 2X6EA 3PSBA 2O8YA 4BWPA 3R9RA 3QQLA 2VTAA 2UZOA 4MQ2A 1H4LA 4EH2A 2B1PA 1QCFA 2YACA 3KVWA 2UZBA 2VX3A 3Q3BA 4IAFA 4M8TA 2I0VA 3OP5A 4ZTNA 3V51A 4C57A 2W05A 3E63A 3TTIA 3UIMA 3NCGA 5D1JA 5M56A 4H1MA 5CEMA 2X7FA 3P08A 4FZ7A 5LCJA 4XG3A 4F1TA 2IPXA 3HEGA 3K5VA 3ZSIA 2BAKA 3ORPA 3E62A 2XZSA 3H9OA 1YXXA 3NYOA 4BCKA 1PXMA 3O7LB 4QMVA 4RC2A 1Q41A 1JLUE 2C3IB 3EMGA 3QTSA 5IQAA 2XK4A 2YCSA 3FLSA 5E8XA 3W55A 5F9EA 4JDKA 3D9VA 2XH5A 3D94A 3JVSA 3EYGA 4ACHA 4AT5A 1WAKA 2BMCA 3RTPA 4CMUA 4F1MA 1GY3A 3IO7A 4D2TA 4ZZOA 4C61A 1R78A 3EFKA 3EQDA 3R30A 4X7QA 4QPSA 2GQGA 3W1FA 4PP7A 1ZMVA 1KE5A 3EQGA 3LMGA 5HIBA 4PPBA 2R3IA 4WNKA 4FZ6A 4FMQA 3CIKA 2O5KA 3TNIA 4J99A 3TV7A 4GT5A 5CF6A 3GCPA 4EH3A 2QR8A 3KMMA 4ZTHA 1Q4LA 3O8TA 4UB7A 5T68A 4ZIMA 3P0MA 4XEYA 4WUAA 3MVMA 4IAYA 2IW8A 4ZLZA 1GZOA 4EOLA 3SG9A 2FO0A 4OTWA 3UNJA 5BUJA 3DXQA 4C3FA 1ST4A 2IZSA 4I0RA 4CYJA 4YZMA 1ZYCA 5JEBA 3W2RA 4ONAA 5JSMA 5IA1A 3KXZA 2R4BA 5M53A 4EH7A 1ZOGA 3LVPA 3IECA 3E7VA 2RKUA 4GKHA 4F9WA 5IQCA 4X2JA 4FTLA 4QMWA 4ERWA 3IDBA 3WARA 4OW8A 5IQEA 3BHTA 4LRKA 3VRZA 4IBMA 5I9XA 1XH7A 3UO6A 3ZO3A 3F5GA 4BDHA 1JKLA 4M3QA 3GCVA 5FEQA 1QPCA 5G6VA 3G33A 1ZOHA 4O7TA 5E8UA 4DFUA 3Q9ZA 5KO1A 1R0EA 3BBWA 4RJ8A 3VQHA 1W84A 4FKVA 3CJFA 4JIAA 4MNEB 4BZDA 4OTFA 4X21A 4DBNA 4XS2A 3OUKA 2C47A 4G1WA 2C0OA 5LVLA 2JKOA 2Y4IB 4FSTA 2GS2A 2X8EA 5DH3A 4D9UA 4IAZA 4D4RA 3S4QA 4IVBA 1H26A 4B0GA 3AMAA 2F7EE 1PKDA 5G1XA 5BUEA 3SX9A 5AA9A 4LFIA 4LRMA 5E8WA 3SDJA 4FNWA 3FSKA 1XBAA 4GK4A 3EQRA 5J8IA 1LR4A 3NYVA 5B2KA 3VVHA 4MVFA 5HBHA 4GUEA 2V55A 4FSRA 4UXQA 4U9AA 5A14A 2OJ9A 4DH7A 4DN5A 1Q62A 4MXAA 4ITHA 4D5KA 4HVDA 4KIPA 5CF5A 3AC1A 3EN9A 4K1BA 3R2YA 5CXHA 1ATPE 3COMA 3TYKA 3COIA 4G34A 3DJ7A 2PMLX 5HCZA 1KE6A 4FTAA 3V8WA 3HL7A 1ZYSA 2R3NA 3F88A 2UUEA 3DFAA 3HAVA 4AN3A 5HORA 4RC4A 3QA0A 4G5JA 4RLLA 5M4FA 2XIYA 1M2RA 3NR9A 2XM8A 3EN5A 5HE0A 4D9TA 2PYWA 4O82A 2F7ZE 3PZHA 4KKEA 1KE9A 4C62A 1V0BA 4JLCA 3TUCA 1XO2B 2XNBA 3PXZA 4MAOA 5CENA 3ZMMA 4CVAA 4DHFA 3AKKA 2J0MB 2RGPA 4MTAA 1PMNA 4WD5A 3FV8A 5L8LA 4R1VA 4YURA 3HMMA 3VUIA 1GIIA 3S1HA 4PX6A 5AIRA 4DGMA 2RIOA 2O2UA 4FKUA 4IVDA 4JI9A 5CVHA 1PXLA 3MYGA 3SRVA 3M2WA 4UWYA 3BKBA 3BE2A 3R7VA 5AJQA 3D0EA 5ETIA 3I60A 3MSSA 5DT4A 5DT3A 3AD4A 3BWFA 2PUNA 2BAJA 2OIQA 2VO0A 3TMOA 4HVHA 3E7OA 1REKA 5EQYA 4FVPA 4J97A 3V6RA 3QXOA 4TPTA 3R04A 1K3AA 4OTIA 4FK3A 3OCBA 5HE3A 1I09A 5DIAA 3LFCA 3VUKA 1JKTA 2VTOA 3MIYA 3QTWA 5CQUA 2IW9A 3PVWA 3UG2A 3RZBA 1PXNA 4IWPA 2YHVA 3VUTA 3ZDUA 4XV9A 3KC3A 2CDZA 4JBQA 5A9UA 4FV9A 3NDMA 1NW1A 4IB3A 5M57A 1H8FA 2CHLA 1UKIA 5ICPA 4E5AX 5F4NA 2XJ2A 4ZTQA 3S3IA 4I93A 5BVOA 5KMNA 2OLCA 4RVLA 3RJCA 4QQ5A 5CU4A 5HKMA 3UOJA 4AQKA 1YHVA 4N4SA 2YA9A 5EM5A 2RFNA 4FT7A 1XMMA 1YOLA 4NM3A 1Q24A 4YC6A 1P4FA 3FXZA 3H3CA 3F2NA 3BX5A 3JY9A 4JBVA 3MESA 4FTCA 5HTIA 5IQHA 1FVTA 1OMWA 3C4WA 2P2IA 3E3PA 4IH8A 5KHWA 3PP0A 5LWNA 2W5BA 3FLZA 3AT3A 3FSFA 1OKVA 2EWAA 1L3RE 3KIOC 3KXGA 3ZEWA 3BQCA 3REPA 4F70A 1P4OA 4FV0A 5A4EA 1JNKA 2PZRA 5AADA 4PRJA 3UZRA 4GU6A 4D1SA 4C3RA 4CTBA 4EWHA 5HZNA 2B7AA 1NXKA 4CMTA 5M07A 4ZJJA 4I21A 2UZDA 3VF9A 4KBKA 4NTSA 3CTQA 3I79A 3MPMA 5DYJA 1OL5A 4FTMA 5EW3A 5IZFA 4FIHA 4E4MA 1FOTA 3A60A 3NAXA 3CQUA 3IW6A 3AKJA 4CZTA 4UMPA 3EN6A 3EZRA 3NNUA 4BCJA 3RPVA 3RAHA 2ITNA 4CFNA 3P7AA 3FYKX 4DA5A 1LPUA 2J9MA 4HGLA 5EM8A 5HE2A 5C01A 4L6QA 5JFXA 2H34A 1WCCA 5C8NA 3NNWA 4JX7A 4BDDA 4PPAA 3PY3A 3TIYA 5AUTA 2I0YA 3E3BX 4BN1A 4PPCA 3NFFB 3GC9A 3LE6A 4XP3A 3H10A 2WO6A 5IA0A 5F95A 1IAHA 3R71A 2HY0A 4ACDA 2IN6A 3PXKA 3CQEA 4LMUA 3DK3A 4R78A 5IH4A 3JS2A 4EOJA 3Q2JA 2ZMDA 3ORMA 4J71A 4OT6A 4E93A 3W2OA 3NUNA 4EL9A 3BL9A 2PHKA 3ZFMA 2W96B 2O63A 3F7WA 3QC4A 4FSZA 2XJ0A 2ITOA 2VWZA 4HGTA 4IXPA 3SV0A 2YIRA 3OTVA 5EI6A 3DJ5A 4RIYB 5ETFA 4BI2A 3ATSA 3EL7A 3E5AA 2Z7SA 3P4KA 4IB0A 4IW0A 3TNWA 3EQCA 3OCGA 4KBAA 4R3PA 4YJTA 4F7JA 3PA4A 3D14A 3VS7A 5CX9A 4LRJA 3BWJA 2YZLA 4JDJA 3NCZA 2I1MA 3P1AA 5A54A 1XMLA 1M7QA 5C26A 2B9FA 4C7TA 1H28A 2HAKA 3N51A 5GIOE 2PTKA 3SOCA 1WVYA 4F78A 2WOUA 4FK6A 5DA3A 4U8ZA 5AP5A 2BILB 4R1YA 5E1SA 3RALA 3U87A 4BB4A 4CV9A 4FEVA 4G3GA 1VLRA 1YKRA 3Q9WA 4FI1A 3R8UA 3ZUTA 1STCE 3KQ7A 3LFAA 3U55A 3MFTA 4O7VA 3AGMA 2YIYA 3ZXZA 2OGVA 4F65A 3PPZA 2PMOX 4HGSA 4MQ1A 4QD6A 2UV2A 3Q2MA 4KS7A 3HKOA 5AP3A 4DEBA 4FX3A 4EHGA 4DGGA 4IFCA 4ZJVA 3NUUA 2HK5A 3KRRA 5KBQA 4FV6A 4DBXA 2X1NA 2UZUE 3BYMA 2FB8A 3FMKA 4OUCA 4Y46A 5DRBA 3QUPA 1PW2A 5CANA 3KN5A 5IQBA 3R8MA 1U4DA 2HZIA 5AX3A 5E4HA 1ZAOA 4O7ZA 4L43A 4KA3A 1ZMWA 4HNFA 4DFLA 4V0GA 5LVPA 2WTWA 4ZLYA 5DI1A 5IQDA 4CFMA 5CY3A 4GVJA 4S30A 5L2WA 5EDPA 4NU1A 3U4UA 4U44A 3VJNA 4I6HA 2ITVA 4RWIA 2F57A 2H6DA 3VAPA 2Y7JA 4FT5A 4IJ9A 4QNYA 3EYHA 1ZZ2A 3R6XA 1KOBA 2XARA 3VQUA 3NYXA 4L44A 2XAMA 3D2IA 5HU3A 5E7RA 3JPVA 4QMUA 4BKJA 4DH1A 3KREA 5DFPA 2R3RA 3Q9XA 2LAVA 2XB7A 4C34A 2VWVA 2C6IA 3T8OA 4QYFA 4OT5A 2C6DA 2GS7A 2V0DA 3UDTA 3QU0A 5KCVA 1CKIA 2WOTA 3FHIA 3P86A 4KSPA 3UOKA 4AT3A 4EBVA 4BJJB 3OMVA 1J1CA 2WMAA 5A4TA 1BX6A 4DFBA 3D5WA 2F49A 2I6LA 1VJYA 4EK6A 4PF4A 4FEUA 4GEOA 3DY7A 4BCNA 4E4LA 4ZTLA 3FPQA 2WTDA 2WMSA 3FL4A 2ZOQA 4LV5A 4PMMA 3G5DA 5FBNC 2HZ4A 4EOQA 1M52A 3F3WA 2ZV8A 4U80A 3A61A 3QKKA 4ANBA 3FKOA 1U5RA 2UW5A 1T45A 1VYWA 3D15A 5J7BA 2WEIA 5I9UA 2XNOA 4IC7A 4M67A 4F7LA 3O2MA 4ACMA 3OVVA 2NRUA 1YHSA 2YCQA 3QX2A 2NNWB 3PXRA 3LJ0A 3R7IA 4RWJA 5AMNA 3EFWA 1PJKA 2RG6A 4QP1A 3FZSA 4LOOA 4EHEA 5LMKA 5AV4A 2XK6A 1WBPA 2JC6A 3BEGA 3BZ3A 4YSMA 3UVRA 4XV1A 1XWSA 4AE6A 4DTBA 2ITQA 3C0IA 4MCVA 3ODYX 3FE3A 1BYGA 4K77A 4KIQA 2WQMA 3AC8A 3D2KA 3POOA 4YZNA 4NZWB 3VN9A 5FUTA 3OF0A 3Q60A 3DKGA 4AZWA 3OY3A 3TUDA 3FL5A 4QRCA 2VX1A 4L67A 2BFXA 5IQIA 3IKAA 4N57A 1B6CB 4OGRA 3V5TA 2V62A 4NYEA 4U41A 2XCHA 4FOCA 4E4XA 4OTQA 4ITIA 5I3RA 4FL1A 2IO6A 4M97A 2QOFA 5JRSA 3HV4A 4XOZA 3BHYA 5J87A 2GCDA 1GZNA 3TZ7A 4F09A 5IH5A 3LFSA 2W4JA 2VTRA 5BX0A 4G9RA 3U9CA 3CKXA 4Q5HA 4M7IA 4EH4A 3GFEA 4CSVA 2J51A 4HYSA 3PJ8A 4BCPA 4J53A 1RW8A 4AZEA 5EG3A 1KE7A 1JSTA 2BRGA 2FUMA 1PXIA 2QHMA 4YHTA 2YIWA 4QYHA 5JN2A 1UNLA 4ZMEA 3VBVA 3EFLA 2ZB0A 1YW2A 4CLJA 1QPEA 3UP7A 4W4VA 3R63A 4ENYA 4N0SA 2YWPA 4ID7A 1QMZA 4ZSJA 4AFJA 2I40A 2ONLC 4IC8A 4A9UA 1NY3A 2Q0BA 1Q99A 2JKKA 2RFDA 3AD6A 4C38A 3U6IA 2NYAA 2JLDA 4YJUA 3A62A 3HVCA 4X3FA 4BDEA 4CT1A 3KFAA 3CE3A 3GOKA 4I0SA 3O71A 5M4CA 2BZIB 5J9YA 2ZV7A 3KU2A 4EEVA 3AD5A 5EHLA 5HD4A 4FKQA 4P90A 3ZTXA 4FT3A 3R83A 4E1ZA 4RJ4A 4RQVA 5IMXA 5IUHA 4GFMA 1U54A 4QTAA 2VO6A 2ZMCA 2VTNA 2ERZE 2YCRA 4L53A 3ATTA 2DUVA 4EKLA 3QQKA 3NUXA 3RK9A 4L46A 4CQEA 4HZRA 1XQZA 2HWOA 2E2BA 5HLWA 4AGDA 3TM0A 2FA2A 1G8SA 3I0QA 2P33A 5IEVA 3C51A 3UDZA 2Y0AA 4XG4A 2J0KA 4JDHA 4FIEA 3ERKA 4TZRA 2ZV9A 3SG8A 3DU8A 5DPVA 5GJDA 4BIDA 2QU5A 2W4OA 4DFYA 1B39A 2V22A 4FGRA 3RMFA 5EK7A 2GS6A 3S2PA 3ORTA 3KGAA 4BCFA 2ITXA 2QG5A 2O0UA 2XK9A 4CFUA 4IWQA 3VWAA 4LOQA 4L42A 2QI8A 3D7ZA 4BR3A 3PPKA 4AA5A 4EH5A 3RP9A 2HCKA 4CFFA 3QRJA 4M84A 4GW8A 4NW6A 3TWJA 3VO3A 2WTIA 4O7LA 4A07A 2C5NA 3QD2B 2QOKA 3R7GA 4G17A 4YUQA 2FGIA 2W1ZA 2Z8CA 3I5ZA 5CALA 1ZXEA 1H08A 1SVEA 3FZTA 5KX8A 5M09A 2YM6A 4EQMA 2QVSE 4EK5A 4NTTA 4FKIA 4FODA 4AXEA 3IS5A 2X8DA 4BDBA 4AXDA 3QTQA 5EM7A 1YOMA 3GUBA 4I22A 4U43A 1A06A 1GNGA 4U3YA 4YJSA 3TDWA 4BHNA 4TKSA 4PDOA 3NW7A 3A8WA 4N6YA 4NUSA 2PUIA 4EONA 1OPJA 3D7TB 3O7LD 5AP4A 3UNKA 2JKQA 3FI8A