2CDZA

Crystal structure of the human p21-activated kinase 4 in complex with cgp74514a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
292
structure length
289
Chain Sequence
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the P21-Activated Kinases Pak4, Pak5, and Pak6 Reveal Catalytic Domain Plasticity of Active Group II Paks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK 4
total genus 86
structure length 289
sequence length 292
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2cdzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cdzA01
2PK9A 3WF6A 4XS2A 4CFUA 4ZY5A 2R7IA 1G3NA 3MGYA 3OF0A 4MNFA 4PWNA 4XBUA 5IISA 4N4SA 3R83A 3F5UA 5DT3A 3H30A 4FV7A 5CU6A 4IACA 3D14A 3BCEA 3DDQA 2ZMCA 5EI2A 2HY0A 1IA8A 2XJ0A 3QTRA 4WNMA 5E90A 4HYHA 2XUUA 4F09A 4D2WA 2ITYA 3GNIB 5AIRA 5CAUA 4M7IA 3F5XA 3MH2A 4CXAA 3MVLA 4F9WA 1Q61A 4C0TA 4DG0E 1W83A 2WQBA 4ZOGA 1PXPA 2UZUE 2VX1A 4AW2A 4Q9SA 3O71A 3H10A 4W9XA 5ACBC 3M11A 4NKAA 3UQFA 2BR1A 2X2MA 4O0XA 3UP7A 1H08A 3PE1A 3AMBA 4G16A 4IAYA 4PNKA 4DFYA 3QHRA 5HVYA 3R01A 4MBIA 3NWWA 2G2IA 4OBQA 3R02A 4Y95A 4APPA 3U6JA 4PMMA 5JGDA 3BGZA 2UW4A 2ZMDA 3QD0A 3CPCA 5C8MA 4FGBA 2YISA 2XCKA 2F57A 4BZNA 1KE6A 3BE2A 4J53A 1UVRA 3ENHA 4F63A 3K2LA 1P4FA 4EH7A 2C5VA 3DJ7A 1GIJA 3MH1A 4JIAA 4FT9A 4CYIA 2ETKA 2VUWA 3HP2A 3OTUA 2PZ5A 3DKFA 4CTCA 1GAGA 2X8DA 3PPJA 4EZ7A 3TUDA 2X81A 5JGBA 2PVYA 1SNUA 4TYHA 4J96A 3PY0A 1YQJA 4R7BA 3GC9A 3VHKA 3Q9ZA 1OKYA 3FKNA 4X21A 2QCSA 1H0VA 4C62A 3LLAA 2IVTA 3HV6A 3UO5A 2G01A 2HWOA 1WBSA 4GUEA 2PVRA 4TNDA 2ITTA 1ZMVA 3E64A 4FVPA 4XP2A 4EQMA 3R9OA 2EWAA 4O2ZA 4GS6A 2W4KA 4L7FA 4RX9A 2E9VA 2GTNA 1PKGA 3ENMA 3P7BA 3Q32A 3FLQA 3HRCA 3QX2A 3EN7A 3EQBA 5AMNA 3ZXZA 4ZTMA 3FLNC 4YMJA 5DR9A 3O96A 2Y4PA 1XHAA 4CQEA 3Q04A 3UBDA 4HYIA 3QRIA 3DAKA 2PY3A 4DGMA 5HQ0A 4J98A 1IASA 4FTQA 4KS8A 4H3QA 2X4ZA 2WTKB 2PZIA 3AMYA 3NCZA 2W4JA 4E4MA 4ZSAA 1B6CB 5KKRB 3FMJA 4MXOA 3HA6A 4FIJA 2WTJA 3W2SA 1VYZA 5IMEA 3SA0A 2R5TA 5HHWA 3ORMA 4BHZA 5GJDA 4N70A 3MS9A 1MRVA 2QD9A 5FXQA 3LQ3A 3Q4CA 1A06A 4G3DA 3KULB 3GCSA 3LXPA 4RVTA 3R2YA 3UZPA 4F08A 4FKRA 2ERKA 4CCBA 1V1KA 3ZUTA 2OBJA 3UIUA 3PYYA 2VX3A 2F7EE 3GU5A 2DS1A 2JIVA 4FKSA 5HVJA 4CTBA 1B39A 4I5HA 4MNEA 1ZZ2A 3P0MA 4E5BA 3LLTA 3PRIA 5L2WA 1W0XC 4YJSA 3LCDA 4ERKA 4QPMA 4GIHA 4DLJA 4GW8A 5CNNA 4B99A 4I6BA 4MYGA 2IPXA 4NSTA 1QL6A 4QYHA 3DXQA 4Y8DA 4OTPA 4YPSA 2IZSA 3MTFA 2WD1A 2WU6A 4LRMA 2WPAA 3F69A 3CIKA 3IDPA 4NKSA 4WIHA 4XLVA 4LG4A 4N6YA 3E8EA 4JX7A 2C0OA 4LGGA 5BVDA 1K3AA 4FICA 4HJOA 3TV7A 3HGKA 5ETFA 4C36A 4BDAA 5ITAA 5IQAA 5IQBA 5DG5A 3KA0A 1IR3A 4IM2A 4FV6A 4ANQA 4IX3A 4E26A 3LQ8A 2C0IA 3LFAA 5E92A 2OW3A 2JITA 4RC4A 3R9DA 4KKEA 3T9IA 2G2FA 2HZIA 4EWQA 3PFQA 1UNLA 5JQ5A 1M17A 5DEWA 4ITIA 2BVAA 4JL9A 3SKCA 2QG7A 2IG7A 5D9HA 2BZJA 1AGWA 3FI3A 1LEWA 5JKGA 2JBOA 4IE9A 4NW5A 1Y57A 3NUSA 3UVRA 5FEDA 5G1XA 2B52A 1HCLA 2HELA 1PJKA 4C35A 2OXYA 4DHFA 1JKTA 3OBJA 3PJ1A 4DEDA 5IQIA 2Z60A 4XUFA 3KEXA 3COMA 3BHTA 5HIEA 3OCTA 2BZIB 4CMTA 4AGUA 4QMVA 5HX6A 2XYNA 4L67A 4EORA 3A8WA 4MKCA 4ANSA 4DTAA 2Y6OA 4C4EA 2GHMA 1XH7A 3OCSA 4FOCA 2Z7SA 4W4WA 2RL5A 5KZ0A 3UOKA 4BI0A 1XJDA 4XRLA 4ZLYA 3JY0A 4MTAA 3R7IA 3BV3A 4LOQA 4MAOA 1OL6A 3BV2A 3PG3A 4IX6A 4XHKB 4FKOA 1UA2A 3S2PA 3V01A 5KMJA 4IMYA 2X0GA 4FEQA 2C3KA 4V0GA 3RM7A 5A54A 1DI8A 4NK9A 3B8QA 2J0IA 2J0KA 3F3VA 3W2OA 3PXKA 2HYYA 4EHZA 3TKIA 4K2RA 3AC5A 5BUIA 4DFBA 4L45A 4MXZA 4RFZA 4YZMA 3ZUUA 4IB5A 2I7QA 4FK6A 3CKWA 4P90A 4GVAA 4C57A 2W06A 3DJ6A 4P7EA 5DYJA 2QLQA 4HVDA 2LGCA 2J90A 5EDPA 3D4QA 5TT7A 3NPCA 4YHFA 1M14A 3LIJA 1H07A 4FKTA 2XKEA 2NO3A 3FXZA 3D15A 1JLUE 3N4TA 2W1GA 3EIDA 1W8CA 5CSWA 1KE7A 3VHEA 2G9XA 4RJ7A 3SXSA 1TVOA 1T45A 2QR8A 4FZDB 3V04A 2I1MA 3SX9A 2A1AB 5EYDA 5DA3A 4OTHA 1NVQA 1WBNA 1S9IA 2ONLA 2R3FA 1LEZA 4EK6A 5HU9A 3FV8A 5A6OA 2GDOA 3R71A 2C47A 2YIQA 5JZJA 3GOKA 4FV0A 4MQ1A 1QPJA 3EOCA 4RIWA 1VZOA 3QQLA 2WQMA 5DWRA 2R3HA 2F49A 3ALOA 4I21A 5C4LA 3UNKA 3EQPA 4FE2A 4M67A 1YHWA 5L6PA 2CLQA 2JD5A 4OTGA 1XBBA 3IECA 5HZNA 1MUOA 2JDVA 2Y0AA 3RINA 2YM6A 3R1SA 5I3OA 2XJ1A 1ATPE 3WZJA 1Q8ZA 3PXYA 4BL1A 4CMUA 3GENA 2J9MA 4G5PA 4WRSA 5JEBA 2BALA 4J52A 4I6QA 3LMHA 1FVVA 4EYMA 4FKJA 4KIKA 4W4YA 3CTQA 3KRRA 4GYGA 4CNHA 5CEOA 2JDTA 5IQCA 1YXXA 4X0MA 4O7TA 1BI8A 2IVUA 2BUJA 4I24A 3P5KA 4QMTA 3ZM9A 4H58A 4BCOA 4ANBA 5HO7A 4NJDA 2XM8A 2YCSA 4YR8A 1ZMWA 4RT7A 1PYEA 4ANNA 2QO9A 2OJGA 5M53A 4Z16A 3QRUA 2FSTX 2QO2A 2GFSA 3UTOA 4DE4A 1R39A 4YLKA 3ODYX 5CAPA 4Q2AA 4U79A 4DFLA 5L8LA 2BAKA 3SXRA 4U7ZA 4GK4A 2X39A 2IWIA 2ZYBA 3PSDA 4FV5A 4WD5A 4RJ4A 5AM7A 4YC6A 4BICA 3KF4A 4BZOA 3HNGA 3ZO2A 3UMXA 4EUUA 3RTPA 2OJJA 4CGAA 4A9SA 2UV2A 3JXWA 3DNEA 4FV2A 3F66A 4IM3A 1M2RA 2VTMA 4NM7A 4EC8A 4DGNA 2W1CA 3B2TA 5CANA 3P86A 2PMIA 4XOYA 4U6RA 3UC3A 3P7AA 4C58A 1OZ1A 4GT4A 4LYNA 2XKCA 3OZ6A 3NSZA 4AN9A 2VGOA 2X6EA 4FSRA 4YLLA 2XIXA 4JIKA 4FTIA 4XG9A 2VWIA 5AM6A 4L44A 3TCPA 2BDFA 3O23A 3UQGA 3FQSA 3BHYA 3AC3A 4FV1A 3GFEA 5K3YA 1HCKA 2YLEA 1J7UA 4IJPA 4S32A 3C4ZA 3UJGA 3FY0A 2VRXA 5FGKA 3DZOA 4IFGA 4FEWA 3BHVA 4KIKB 3OC1A 4XEYA 3W2QA 4KAOA 4UYAA 2BIKB 1H1RA 3F5GA 4QP6A 3S00A 3F2AA 5C4KA 4AW0A 4AE6A 4YHJA 5H2UA 4MBJA 5AAGA 3LFDA 3R73A 4CMOA 4UN0C 4PTEA 3GQIA 3RAHA 2ITOA 3JYAA 3V51A 2ZJWA 4EH2A 5KO1A 4X2KA 4WSQA 5C01A 3E8DA 2HY81 4M0ZA 1KV2A 3EQHA 4BCJA 5IDNA 2E9NA 3M2WA 3MJ1A 5LWMA 1SNXA 1WFCA 3LXNA 3EHAA 4IZAA 5AR4A 2PUPA 4KIQA 5J87A 4EYJA 3PIYA 3BHHA 3IW4A 3DAEA 4F6UA 1PXJA 3U6IA 4L53A 1YRPA 2YAAA 4G3GA 3GC7A 1M2PA 3MY0A 3KXMA 4QMPA 3PVGA 4U0IA 4UWBA 3WF9A 2FO0A 1YI3A 2CDZA 4JT3A 2IW6A 1U4DA 4UXQA 3C50A 2BKKA 3PVBA 4TXCA 3VS4A 3RPVA 4JX3A 4D2RA 1YXTA 1ZYJA 3CD3A 3U4WA 5B2LA 3NW6A 5J7HA 2ITNA 2OO8X 2HW6A 3I0OA 3NYVA 1WVWA 2JKQA 2EVAA 3HV4A 3NYNA 4DC2A 3JUHA 3Q96A 4HZSA 4AW1A 3UNZA 4JDKA 4ZIMA 4NFNA 4XV9A 1OL1A 1JQHA 4ZS4A 2ITZA 3ETAA 4W8DA 4A4XA 5CVFA 4MWIA 4EOMA 4FSZA 3BEAA 3QZHA 5HCYA 3NRMA 2W5HA 5CQUA 3W2CA 1PYXA 2PE0A 3ULIA 5AUTA 5J9YA 4CQGA 2YEXA 5HESA 3U4UA 5L8KA 3CSVA 3DBDA 4AZEA 1OIRA 4HZRA 3WZKA 1JKSA 2QOOA 4IFCA 5ANOA 3D5UA 4L9IA 5DR2A 3C5IA 4O27B 4NEUA 3CGFA 1XH5A 4EWHA 3O8PA 4PV0A 1ERKA 4AF3A 2BRGA 4LM5A 3PTGA 4M66A 4LRJA 3EYHA 4CLIA 2Q0BA 3F7ZA 4I4EA 4RBLA 2C5YA 2OXDA 2B54A 2XVDA 5B2MA 3Q6WA 4A7CA 1M7NA 2RFDA 3PZEA 2JLDA 5FDXA 3QUDA 3VJOA 5EK7A 5EKNA 4YNOA 4I94A 4GG5A 4ASXA 1ND4A 1XR1A 4MXCA 4DBNA 2JIUA 3MPAA 4BKZA 4ACGA 3U8WA 5M56A 4F9YA 4R5YA 4LMNA 4X6RA 3BELA 2OICA 5FEQA 3KXZA 2W7XA 2C4GA 3BU3A 4H3PA 2BAQA 3BBWA 4OUCA 3OOMA 2QQ7A 1FGIA 4H36A 4JVGA 3GC8A 3WE8A 4X7QA 3KREA 2XM9A 2Z02A 4FTUA 2GMXA 1Q8UA 3QD2B 5TE0A 1TKIA 2W4OA 3UC4A 3BZ3A 2PULA 4O7WA 2PU8A 5AP2A 5HTIA 1ZOHA 4H39A 1BYGA 4GCJA 3AD6A 4JXFA 2C5OA 2B53A 4XG8A 5HI2A 5BVEA 2C6KA 3VJNA 4YGAA 4QMZA 3WYXA 1Q3WA 1XBCA 2CSNA 5HBJA 3CQEA 4CKIA 2CKPA 3GBZA 4FYOA 3GCPA 1URCA 1H24A 2A4LA 2PVJA 3OG7A 3QCSA 4D1ZA 5HLWA 4GUBA 1Y8YA 4U8ZA 3DOGA 2OF2A 3QUEA 2BTRA 4IB3A 5CSVA 4QT1A 2ITXA 5LCJA 4PY1A 4JAIA 1H25A 1P4OA 4OTFA 5HTBA 4F7LA 4GL9A 4KBCA 5DH3A 4EUTA 3FAAA 2YM8A 3GC0A 4JQ8A 1CKJA 3MY1A 4I6FA 5GZ8A 4AT5A 3ZRKA 3RCJA 2W1IA 5D11A 2YJRA 1QMZA 1P5EA 3OCBA 4ZSJA 2OWBA 4ERWA 3GP0A 3O0GA 4K33A 2JKKA 3I0QA 5HNBA 3EN9A 1UU7A 4WO5A 1OL5A 4F1OA 3MPMA 4XYFA 5AR7A 5CF6A 3FQEA 3FC2A 2V0DA 3ET7A 4M69B 4QYGA 4RSSA 4E6CA 5K0XA 3CEKA 3H4JA 4I0RA 2DYLA 4KUJA 5F9EA 4EKKA 3EQIA 2GQRA 5FUTA 3G90X 5K4JA 4O83A 3LMIA 3VUDA 3HMMA 4FTMA 1PXOA 3L9NA 3AOXA 1JAMA 3NLBA 2QG5A 5AUVA 4AZFA 5CNOA 4B6LA 2WMWA 3P4KA 4JNWA 3RKBA 2HENA 2ITWA 2YIXA 4NW6A 2YWVA 4EH8A 3IW7A 4RLLA 2P4IA 5E8UA 4I5PA 2BHEA 1KV1A 4NU1A 3ZMMA 1U54B 5HX8A 1PMVA 4RFYA 4RZVA 3PY3A 3GUBA 4QO9A 4TYIA 2QHNA 2ZV7A 3O7LD 3R8LA 3FLSA 4DH5A 4EL9A 2GCDA 2ACXA 3UVQA 3RJCA 4EH4A 1JOWB 3CKXA 4XG4A 3SV0A 4EK3A 5L2IA 4E5AX 4BFMA 4J95A 2WTWA 4G6LA 4O91A 2OIDA 2F4JA 3H9RA 3TG1A 5AFVA 5FBNC 3QLFA 2YCRA 4RZWA 4E4LA 1GZ8A 4L8MA 4RX5A 5LVNA 2GFCA 3DKCA 4V01A 3KB7A 2QOQA 3Q2JA 4FSTA 2OF4A 4YLJA 5IZFA 4HGSA 2Z8CA 5E9EA 4EJ7A 2VTJA 3UG1A 3EYGA 4TYEA 3V8TA 4ZLZA 4CVAA 2V55A 2J50A 5HG9A 4PMPA 3PLSA 5ETIA 3VS1A 3NVMB 4QNAA 4O38A 4R78A 4QMQA 2FVDA 2JAVA 4HPTE 3NNWA 1V0OA 4Q5HA 2JDSA 5CASA 4WNKA 3CXWA 5FM3A 2J5EA 3FMKA 3DAJA 4FMQA 5F94A 3UMWA 2XH5A 5TKDA 4DF3A 3ANRA 2ITPA 4K9YA 2WIPA 4RIYB 4UX9A 3GOPA 4FNWA 2IVVA 4X3FA 3QKKA 4QMOA 3NDMA 2VD5A 4ORKA 3EB0A 3NIZA 1GZKA 3O51A 4FL1A 4RRVA 4EOSA 1VR2A 2J2IB 1Q62A 2PUUA 2W9ZB 4L6QA 4UV0A 4P5ZA 4IJ9A 4FSYA 2J6MA 4Y85A 2WU7A 4ZZOA 5L6WL 1WVYA 2JGZA 1O9UA 4RVKA 4C34A 1Q4LA 4BGHA 4I41A 3OXIA 3VS0A 1TQPA 5AV4A 3FJQE 3R22A 2GNLA 2X7OA 4FODA 4HCVA 4IZ7A 1CSNA 4WRGA 3EL7A 4FEUA 3TTJA 3NUUA 4KWPA 4BYIA 4E6DA 2Y7JA 1OPKA 4FSMA 5CY3A 5EOBA 1DAWA 2FSMX 3QZFA 5M4CA 1FINA 4KSQA 2C5XA 3VULA 3DK7A 4FT5A 3RPSA 3TKHA 3ZSHA 3WIGA 3AT4A 4AFEA 4AAAA 1YHVA 3D2IA 3VC4A 2GTMA 5AEPA 4IDTA 5DI1A 3PJ2A 3MN3A 4LQMA 3DQXA 1WZYA 5EDQA 4FVRA 4AZTA 1KE8A 4TNBA 1U5QA 1O6YA 2FUMA 4JBPA 4JJRA 3R7EA 4HPUE 2A19B 2XIZA 5AR8A 4MD7E 3HDNA 3T3VA 1ZAOA 3QUPA 3ZLYA 1AD5A 1M52A 5EM8A 1OPLA 3GT8A 3FXXA 2OU7A 2NNWB 4BDKA 3IW8A 3QQGA 3I1AA 3E5AA 3NYOA 2JBPA 2PMLX 5C27A 4X2GA 5ICPA 3T8OA 3QRKA 4C3FA 3LCKA 4I1ZA 3FQHA 4UBAA 5AUZA 2H8HA 4FTJA 5HBHA 3RCDA 4FEVA 3H9FA 5BNJA 4GKHA 2LAVA 2Z7RA 3SD0A 4EOPA 4ZSGA 4D5HA 2W5AA 3QC4A 2I0HA 3A4OX 4AOTA 3QZGA 4O7VA 4N0SA 1ZMUA 2Z2WA 4IZ5A 4IW0A 1JPAA 4B7TA 4O7SA 1W7HA 4Z9LA 5B2KA 3VQHA 2QO7A 3ZBXA 3NUNA 2W96B 4QYYA 5C26A 5CVGA 4WOVA 1ZY4A 3TACA 2ZV9A 4O0VA 4HYUA 3WE4A 2E9PA 2VTQA 3QQFA 4FZ6A 3DBQA 1OGUA 3FPMA 4GT3A 3SG9A 1S9JA 3DPKA 1WBOA 4GV1A 3L8VA 5J9LA 4QP3A 4ZP5A 1LPUA 5EH0A 3FYJX 4RGJA 3KFAA 1REJA 5EW8A 3PLAE 4IHPA 3TN8A 2WTKC 5CF4A 3Q4ZA 3W2RA 2V62A 4FZFB 3QCXA 4RWIA 3U9NA 4RJ8A 4HVHA 3MFRA 1OIUA 3RVGA 5BVOA 2GQSA 5CYIA 3OCGA 5HLNA 4GVJA 1U46A 4IDVA 3HMIA 3KN6A 1WBTA 3P1AA 4J71A 3VIDA 3L1SA 5A4EA 3NUAA 5IH4A 2RFSA 2XB7A 5ANDA 2I40A 3PPKA 3ZEPA 3F9NA 3MVHA 4N57A 1PKDA 4K77A 3NR9A 3OBGA 1YOLA 3EFJA 3BE9A 4LUEA 4NJ3A 1H27A 2FA2A 3NNVA 3MH0A 3SGCA 3AD5A 1ZOGA 2CN8A 4H1MA 3RK9A 2BILB 4BDHA 5EHLA 4D4YA 3PXZA 3HAVA 4L43A 4PTCA 3KK9A 1YWNA 2XA4A 4AA5A 2BPMA 4G1WA 4V0GB 2UVXA 5FD2A 3BPRA 2QI8A 3WF5A 1JNKA 4NM5A 4O0SA 4YZ9A 5I9VA 4ASDA 3DTWA 3JVSA 5HICA 2OH4A 4S33A 3UQCA 3KKVA 5IF1A 5AX9A 3ZH8A 3COIA 3NW5A 3G0FA 1UU9A 3NGAA 3JR1A 2Y6MA 3EL8A 4KINA 3RNIA 5CI7A 1H28A 2EU9A 4N6ZA 4V04A 3SW4A 3U9CA 4RIYA 3UP2A 3QTUA 3R7VA 5IUGA 3HAMA 2EUFB 2F2UA 2ZDUA 4KKHA 3SW7A 4G3CA 2J5FA 1XH8A 5CXHA 3NAYA 2P33A 5AR5A 1G5SA 2RG6A 4D1XA 2PZPA 3ORPA 5FXSA 5I9XA 2XYUA 2VTTA 3OY3A 3PP0A 4QQCA 1J7LA 5AJQA 3ZFMA 2OJIA 4JRVA 4M97A 5H8EA 5I5ZA 5EI6A 3AC2A 4TY1A 3UIMA 5HO6A 2X9FA 5GNKA 3DFAA 4IVBA 4IVCA 3VBQA 4AW5A 4D2SA 5HD4A 2PHKA 3HV7A 3UOLA 1Q99A 1OL7A 2OZOA 5DGZA 4WG3A 1WBVA 1CKPA 4ZSEA 5BYZA 4DINA 4AS0A 4YU2A 2QHMA 3KXNA 4GH2A 2XKFA 3FSKA 3HVCA 4LV8A 4DFUA 5JRSA 3V5QA 4GFMA 3TL8A 3DCVA 4CEGA 4FF8A 2XK7A 2PZYA 4HNIA 2BRHA 2WXVA 3CTJA 4AWIA 4E73A 3FSFA 3G5DA 4TYJA 1JBPE 1GY3A 3BX5A 4W9WA 4O7LA 4MXYA 2W05A 4BY9E 2XNNA 3BYSA 5EKOA 2YAKA 2YDJA 4QMWA 2EXMA 5HOAA 4ACDA 5BYYA 3BIZA 2C3JA 5A3XA 3FMLA 3O8UA 4FTNA 4ZZMA 2P55A 2QOCA 2HIWA 4F6SA 4LGHA 4DFXE 2ZM3A 2ZM1A 4JS8A 5HORA 5JK3A 3LW0A 4DFNA 3FHIA 2CPKE 4TTHB 3VUIA 4R1YA 2I6LA 3H9OA 5HIBA 4DTKA 4R6VA 2IJMA 3NUXA 3GFWA 4C3RA 4UMRA 3EMGA 3G9LX 4M69A 2DQ7X 5EG3A 2YIYA 4H3BA 2VNYA 3C51A 3OROA 4QQ5A 4C4HA 4D2PA 2VTIA 4CFVA 5M51A 3KGAA 3H0YA 3V5TA 1YXVA 5HNIX 5A14A 4TYGA 4JR7A 4QOXA 4YTHA 5JFXA 5M44A 4RIOA 3RPRA 2XZSA 3TJDA 4QMNA 4USEA 5DR6A 3C0GA 4NZWB 2OSCA 2YM5A 5F1ZA 5IA0A 4F7SA 4EHEA 2BIYA 4ZJIA 4I0SA 3C4CA 4RVLA 3RPYA 3R1NA 3C7QA 3SHEA 2ZB1A 1YHSA 4JDJA 3ZS5A 3EFKA 4LV5A 5IDPA 3ZO1A 5AAEA 3AD4A 3C4EA 4QP1A 4YZBA 3NUPA 5BMMA 4E20A 1Q8YA 3BWJA 2XBJA 3IQ7A 4PPCA 1R0PA 4RJ3A 4LOOA 5IA3A 3MH3A 5EDRA 1YI6A 5HE2A 4L00A 4TN6A 5A46A 3DXPA 4RWLA 5AV1A 2VV9A 3M1SA 3BQCA 2R9SA 2VTHA 3PE2A 4F0GA 2X8EA 4FA2A 2YACA 2ZAZA 5IG1A 2HZNA 2XJ2A 4O7YA 3HRBA 3FMNA 2I0VA 4J8NA 4O1OA 5KE0A 3ROYA 3DS6A 4M15A 3VS3A 3VUHA 4JOAA 4C59A 4XG2A 5A4LA 4OAUC 4OBOA 3RAIA 4FUYA 5CEIA 3UYSA 2Z7QA 3A60A 5I9UA 2UVYA 2F9GA 2PMNX 1Q5KA 4O2PA 4GU9A 1YW2A 5CT0A 4UMQA 4WNOA 4EI4A 3F88A 3HECA 1ZARA 2BCJA 4ZTSA 3UOHA 4DGGA 4WNPA 4IANA 2PSQA 4XLIA 2UZTA 3I5ZA 3Q4UA 4WBOA 4S30A 3FKLA 3W55A 2BHHA 4D1SA 1GJOA 3V5WA 4YBKA 5JMSA 1OB3A 2NP8A 4H05A 2UZDA 4KS7A 1PXLA 2HXQA 4DYMA 4L3JA 3DJ5A 4L52A 2X9EA 4PTGA 1TQIA 1ZYSA 2YIWA 3PRFA 2CGWA 4RWKA 3LXKA 5L3AA 4D4VA 4A9RA 4I20A 3SVVA 3BHUA 1ZYCA 5CZIA 1H01A 3CPBA 4FZ7A 3KVWA 4PDOA 1XBAA 4XCUA 2B0QA 3QRTA 5HG8A 4E8AA 3TDWA 5EW3A 3UGCA 1BL6A 4YPDA 4WG5A 4Y5HA 4BCGA 3RK5A 1X8BA 4MVFA 4IWQA 4BCIA 3N4VA 2GPHA 2B7AA 4ENXA 4NTSA 1SMHA 2FH9A 4E6AA 3HMNA 1JKKA 3WZDA 5HO8A 3LFFA 4O0UA 3L9MA 2XK4A 3AT2A 3QL8A 4TYHB 2IO6A 4G9RA 4BGGA 3EQDA 1JKLA 1EH4A 2KULA 2VZ6A 2XNBA 4AE9A 3ZOSA 2P3GX 4BCMA 2C30A 3IGOA 1GIIA 1P14A 2WTDA 4CZUA 2PVFA 3EWHA 3G6HA 3RP9A 1Q3DA 3VUTA 2J0JA 3QKMA 4HVGA 1PY5A 2HZ0A 2XK9A 3GQLA 2PVMA 3MY5A 3PG1A 3Q9XA 2IVSA 3OFMA 4BDGA 2YDIA 3SQQA 3MFTA 4UMPA 3FWQA 4DH1A 4EHGA 1Q8TA 3MFSA 2BRMA 2VTPA 3EFWA 3PSBA 2P2IA 4YO6A 5EHOA 3K5VA 3VAPA 5I9YA 3OOGA 5E8WA 3DB6A 5M55A 4L3PA 5IA5A 3RI1A 3ZZEA 4BDCA 4ZTNA 3QWKA 5CLPA 5IA1A 4O86A 5J5TA 4HW7A 2C1BA 5AV3A 4A07A 4XP3A 3V5PA 2VO3A 3HV3A 5CF5A 3II5A 3LXLA 4IXPA 4DTBA 3QALE 4BIDA 3R9HA 1UWHA 5E1EA 4FYNA 4I4FA 4HOKA 3E87A 4D0XA 2R3GA 4B4LA 4EOKA 5IA2A 5IMXA 3QYWA 3CE3A 2UW6A 1HOWA 4LL0A 3H0ZA 4BRXA 2ETMA 3S3IA 4JAJA 2W1DA 4OTWA 4PDYA 1VJYA 4XP0A 2CKOA 3WIKA 3LAUA 1J3HA 1ZZLA 3BI6A 1ZXEA 3DDPA 2C68A 5B0XA 2WMBA 2F7ZE 2BAJA 2E9OA 1CM8A 1XH4A 3HV5A 4JDHA 1FBNA 5EQEA 3V8SA 4CSVA 2E9UA 3AXWA 2QVSE 3N9XA 2RSVA 3ITZA 2PYWA 3TZ7A 2J51A 4FBXA 5CVHA 3NS9A 4Z3VA 5ANEA 3T9TA 1FMOE 4C4FA 5IEVA 3BYOA 4DT9A 3SOAA 2GNHA 4PL5A 4RX8A 4C33A 3C0IA 2XP2A 4CFNA 3PWYA 3AC8A 4EEVA 3R8PA 3THBA 4RVMA 4USFA 5CEKA 2BFXA 3A8XA 3OWPA 4AGDA 2OGVA 4F1TA 4HGEA 1YDRE 1CDKA 2P2HA 5IUIA 4UMTA 4GSBA 5T6KA 2QC6A 2OG8A 5LMKC 1QPCA 3LZBA 2UZBA 4RA4A 4CG9A 1OECA 1PF8A 1NXKA 3DFCB 4YJOA 3TM0A 2UW9A 3S4QA 2CKEA 5GINE 4FIEA 1QPDA 3KL8A 3BKBA 3DU8A 5AR2A 3KU2A 4DEHA 4U41A 3AGMA 4BWPA 5LQFA 4OTIA 3QTZA 2BZHB 4QYEA 2W1EA 3G51A 4QTEA 1KSWA 3Q5ZA 3LFEA 5DLSA 3VW8A 3CD8A 2ZV8A 3WF7A 5BUEA 3IONA 3I6UA 4PL3A 3QZIA 4O7ZA 5HLPA 3F6XA 2AUHA 2HK5A 4ARKA 4AP7A 1I44A 5F20A 1GOLA 2JFLA 3OP5A 2PPQA 4Y73A 4X2NA 4XX9A 4XOZA 3PUPA 2HWPA 2CHLA 2ETRA 3MPTA 2BKZA 2H9VA 3LCTA 4ZTQA 4ALWA 4JBQA 3UZRA 2BRBA 4LUDA 3P08A 3GCQA 4CKRA 3QFVA 1Q97A 3LFQA 4ZSLA 5DFPA 2PMOX 2VWVA 2IW9A 2OLCA 5D12A 3D83A 4HVSA 3E93A 2VU3A 3E8CA 5M57A 3ODZX 2V22A 2YJSA 3CY2A 4Y83A 1IG1A 3H3CA 3G0EA 5AA8A 1YI4A 4R7IA 2CGXA 3F2NA 3O8TA 4MD8E 3V5LA 4MEDA 4ACCA 5KUPA 3MDYA 1L3RE 5HVKA 2OIQA 2O64A 2CGUA 2EXEA 2W99B 3AT3A 3GU6A 3PJCA 4G31A 4UB7A 5JRQA 3DXNA 3PWDA 3ZTXA 5LMBA 3QBNA 3OTVA 4IAZA 5KMNA 5AA9A 1ZYLA 3NUYA 4OT6A 4RC2A 3ZLXA 2QONA 4JBOA 3TJCA 4CZYB 3K5UA 4RX7A 5CEMA 3EN5A 3WBLA 4AOIA 3SG8A 1AQ1A 4FV4A 4RQVA 2ZVAA 4F9BA 2AC3A 4YTIA 4IH8A 3KXGA 4U97A 3QWJA 4FT3A 5FEEA 2JAMA 2ERZE 4AZSA 2G2HA 4A9YA 3PDTA 4CFXA 3R9RA 4R5SA 4X3FB 2OZAB 1OUKA 2W9FB 3BRBA 4GG7A 5E7RA 5AAFA 3R7GA 4FNZA 1R78A 5IQGA 1Z5MA 3QGWA 5HG7A 4U3ZA 1G8AA 3QTWA 3B8RA 3HDMA 3UVPA 3VS7A 2VX0A 3REPA 2B1PA 2HOGA 3ORIA 4XJ0A 5D7AA 2B9HA 2YN8A 5M4UA 5AUUA 1FPUA 1B38A 3F5PA 4KRCA 3TUCA 2ITQA 5L2SA 2XS0A 3PJ3A 3PXFA 4FSUA 5AP1A 5LVLA 1YXSA 4YP8A 3DK3A 2O5KA 4BHNA 3OWJA 4A9UA 3IKAA 3D7TB 3I4BA 4P2KA 2X1NA 5EM7A 3CQWA 3VF9A 3ZCLA 4O6EA 2R64A 4QQJA 4CCUA 5EI8A 4WKQA 3FZ1A 5AP7A 3BBTB 4HCUA 3EQGA 1R0EA 4FSNA 4K11A 4M14A 4BCKA 5KBQA 2WQEA 3KMUA 1OKZA 2XIYA 2XIRA 4XMOA 3QGYA 4OR5A 4BR3A 2B4SB 2GQGA 3FXWA 3NX8A 1OL2A 1FVTA 4G3EA 3CBLA 4E4NA 1YXUA 1E1VA 2WTVA 3MESA 5EQPA 3NNXA 1PW2A 5BVNA 5IPJA 3VWAA 3D7ZA 4QRCA 4M0YA 4FOBA 4RMZA 5ANIA 3U6HA 3A61A 5EOLA 3P9JA 1H4LA 4MH7A 2C0TA 4EOOA 4D9UA 1H1PA 3OT8A 3TNWA 3MV5A 5FWKK 5IQHA 3OXZA 5FG8A 5AADA 3A4PA 4YHTA 2VTAA 1SVEA 1YOJA 1RJBA 2VTSA 3IPHA 4IADA 5TOZA 2HXLA 5AV0A 3CJGA 4MX9A 5GZ9A 2PVNA 3OXTA 5LXMA 2W1HA 1ZOEA 4ALUA 3ZZWA 4FTOA 2GNGA 4FG8A 3VUMA 1XH6A 3KRLA 4KBAA 4U9AA 5H8GA 3DNDA 3TKUA 4BIBA 3UG2A 1PRYA 3UO4A 1OI9A 3FMDA 1ZWSA 5I4NA 2YLFA 3HEGA 4BIEA 2OKRA 2H96A 3EZRA 3FI8A 3P7CA 2UW8A 4QMLA 4IQ6A 5AWMA 3KXXA 3CC6A 1CMKE 3MI9A 4U5JA 4DH8A 3SC1A 4FIGA 4YZNA 1TQMA 3ZC5A 1G8SA 4EH5A 2O65A 2R3RA 4UZHA 4EK8A 2C6EA 5ANGA 1PXIA 2IN6A 4BCPA 1NW1A 4FIHA 2XK8A 4HYSA 3NNUA 2UUEA 3LFNA 4GMYA 4CZTA 2WFYA 4TZRA 4X2FA 3COKA 3IGGA 4PMTA 2R3QA 2WEVA 4GKIA 2VTRA 3EKNA 3B2WA 1KOBA 5KHWA 4BZDA 4YO4A 5KKRC 2G1TA 1J1BA 5EHYA 3T3UA 2X7FA 3GB2A 4OBPA 4YJTA 4A4LA 2WMSA 5AP6A 3V6SA 2R3MA 3E62A 3ZEWA 3FZPA 3OWLA 4GEOA 5ANJA 2V5QA 1H8FA 2C1AA 4FL3A 4MXAA 4U45A 4F9AA 4NH1A 3WOWA 3QLGA 1OIYA 2ZOQA 2VTNA 3EQFA 3ACKA 1T46A 4OLIA 3W16A 5EYCA 4AN2A 1K2PA 3EQRA 2BFYA 1YWRA 3E63A 4J1RA 2ZM4A 1BLXA 5HNGA 3MIYA 2RIOA 4KA3A 3RBWA 2C5NA 3IG7A 3SRVA 3CY3A 2OXXA 2QNJA 3FZSA 4MQ2A 3RM6A 5L4QA 4OTDA 4MK0A 2NPQA 1SYKA 3FHRA 4IWOA 5HIDA 3DBFA 3RMFA 3W10A 5CU3A 2J4ZA 3R7OA 4KIPA 4W4VA 4AT3A 4JG7A 5TF9A 3LJ0A 1UNGA 4GT5A 3S1HA 4GRBA 3W8LA 5AP5A 4A06A 4AOJA 3A62A 4YC8A 3RZBA 2WZJA 2UZLA 4II5A 2WMXA 2HW7A 2ITUA 3C4FA 5JT2A 5GIPE 2VWZA 3JVRA 2O3PA 4AN3A 4LOPA 4FSWA 4ZTLA 4C02A 3OEFX 1IRKA 2PZRA 3C4WA 5LOHA 2QKWB 1O6KA 3O50A 3DQWA 3COHA 4O22A 4OTQA 4M12A 2JKMA 2C6TA 3Q4TA 3P79A 2P0CA 2B9JA 2C6DA 2QOBA 4WUNA 1M7QA 4CKJA 3OMVA 1WBPA 4DT8A 3PIZA 4B8MA 3QTSA 2FB8A 4QP2A 5CU2A 2PTKA 5AX3A 2G15A 3GU7A 4TRLA 5T68A 5L6OA 1IAHA 2BROA 1ZLTA 3GXLA 4FC0A 1Z9XA 2UW5A 4AXAA 2YA9A 4ZY4A 1KUTA 5DOSA 4F65A 4G3FA 5BUJA 3QCQA 4V05A 1H0WA 3TV4A 4DG3E 4O96A 3QXPA 4EOQA 4BTKA 5DN3A 5AP3A 5LCKA 2GS7A 1YWVA 3HLLA 3OUKA 4IVAA 5J7BA 4TT7A 5EYMA 2VO0A 2WOTA 3DGKA 2R3JA 3BGQA 4RIXB 5HEZA 4AGWA 2CCIA 3RWQA 2Z7LA 2F7XE 1MRUA 1JWHA 2GU8A 5DRDA 1DAYA 5KX8A 2GNFA 4S2ZA 4C8BA 1QCFA 3L8XA 4FR4A 4PL4A 3RHXA 4LI5A 4BI1A 2QU6A 3DKGA 4IIRA 4QMUA 2RGPA 3TZ9A 5HU3A 2GS2A 2YM3A 3D5WA 4F70A 5JSMA 1W98A 1LUFA 3GGFA 3FEGA 4ID7A 5IH6A 2KTYA 2OJ9A 1J7IA 3AG9A 4I3ZA 1V0PA 1YKRA 3ZONA 1DM2A 2CCHA 5DBXA 4FTCA 2JKOA 1YOMA 3MJ2A 4LMUA 1SVGA 2W1FA 3KCKA 2XIKA 3PZHA 4ZEGA 1WCCA 4BCNA 1U59A 4QTDA 4CT1A 4HCTA 3IOKA 4NTTA 2QOKA 2YWPA 4PDPA 3Q6UA 2PUNA 3OW4A 3V5JA 5J5SA 4RFMA 3QC9A 4FG7A 2EB3A 1OBGA 5KMOA 1VYWA 3V8WA 3LCSA 4X3FC 4W4XA 4ZTRA 4AA4A 3BYMA 1UNHA 3HUCA 4DCAA 3FLYA 5FRIA 3SDJA 1E1XA 4BTJA 3U51A 5CSHA 5H9BA 5LMAA 2UW7A 5M09A 3QQUA 1W84A 3MB6A 3PVUA 4C3PA 4KNBA 4PNIA 1A9UA 3FDNA 3VS2A 2VO7A 4QTCA 1SZMA 2Y8OA 4K1BA 1JVPP 4MF1A 4XG3A 5HCZA 3VVHA 3WF8A 4BDIA 2WMAA 4DEIA 3E3BX 3TT0A 4FKVA 3MBLA 3R8VA 4QTAA 5FLFA 1YDSE 2WNTA 4TWPA 1M2QA 3ID6C 2X2KA 4D58A 4YTCA 4XV3A 3UZTA 3KXHA 2UW3A 3P23A 3QTXA 5I3RA 4FTAA 3AMAA 3F3WA 2H6DA 2X7GA 4YC3A 3N4UA 3GU4A 2X8IA 1I09A 3QXOA 3MB7A 3CTHA 3TXOA 1WMKA 4XV2A 3NW7A 4CFMA 5E4HA 1XO2B 2B9FA 2ITVA 2IZRA 2VGPA 3Q60A 4GJ3A 2B55A 1A48A 4C7TA 1STCE 3AQVA 4IX5A 1J91A 4WT6A 4MXXA 2CNQA 4D28A 4K18A 4BWKA 1RE8A 3FLWA 5DVRA 2XNGA 2YCQA 3FE3A 1BX6A 3G9NA 4FTRA 4E93A 3LE6A 3ORTA 4GK2A 5FBOA 5JH6A 3MSSA 3A7JA 1OUYA 3NIEA 4LL5A 1IAJA 2RF9A 3KMMA 4FVQA 4XG7A 2AC5A 2XNMA 4XNEA 1FQ1B 3ULZA 4KKGA 4AA0A 5K4IA 4M68A 3C13A 3MA3A 3BLRA 4BN1A 2YDKA 3GCVA 3SLSA 4DCEA 4FT0A 3R04A 3EN6A 4WHZA 4YJQA 2CN5A 2R3KA 4PP9A 4L7SA 3RNYA 4JG6A 5ETAA 4GYIA 4E4XA 2SRCA 3PA3A 2GHGA 3C5UA 3OY1A 4MCVA 4G17A 4RJ6A 5CAVA 4IM0A 2PVHA 3UE4A 4FKWA 3K3JA 4FTKA 3O2MA 1KWPA 4QMXA 2BRNA 5FXRA 5BVFA 4YJRA 4I92A 5M08A 3TEIA 4IWDA 3W32A 1MQ4A 3ORLA 4FKIA 2WGJA 3QQJA 4USDA 3OVVA 3R28A 1R1WA 4LFIA 3ZO4A 4PMSA 1REKA 3L9PA 3LJ1A 1XKKA 3VBVA 4ENYA 4EONA 1OITA 1WVXA 4MHAA 4ONAA 3D94A 3CCNA 1FVRA 3L9LA 4PUZA 4XBRA 3TI1A 4HVIA 1V0BA 3FL4A 5HG5A 4ALVA 5JFSA 3UYTA 4BBMA 3UIBA 3FBVA 5JQ8A 2GNJA 5J8IA 4WA9A 3R00A 5E1SA 5CT7A 4FV9A 4FV8A 4KB8A 4YBJA 2CNVA 1OVEA 2OK1A 4HNFA 2WMTA 3KQ7A 3QF9A 3ZDIA 4EOLA 2ESMA 3GVUA 3ZYAA 3EFLA 1VEBA 3F7WA 3LKMA 2UZWE 5HKMA 2ZDTA 4E5WA 1L8TA 4FKPA 4YJUA 2B9IA 3D7TA 3JS2A 4G34A 4RIWB 4UZDA 5AP4A 5CENA 3ZLSA 3NVKI 1APME 2A27A 4OAVB 2GSFA 5JN2A 5EW9A 4U42A 4IC8A 4YZCA 4GU6A 3RWPA 4Z55A 4BVUA 3HL7A 3MIAA 1P2AA 4TWOA 4O0YA 3V6RA 4AGCA 4F0FA 1PXMA 2R0IA 3R6XA 5J95A 4BBFA 1PHKA 4BF2A 1IEPA 2OI4X 4ANOA 4C37A 3FZOA 4KD1A 3RALA 5CU4A 4R77A 4E7WA 5DT4A 4IVDA 1GNGA 5G6VA 3UIXA 5JZNA 2UZOA 2XNPA 3I5NA 1RQQA 2WOUA 4A4OA 3ZU7A 4G9CA 5AUYA 4O81A 2O8YA 2QURA 2IZUA 4ACMA 4C2VA 4YUQA 3UNJA 1OMWA 2GHLA 1NA7A 3D9VA 3FZRA 4GFGA 3MA6A 2X4FA 3POZA 4ASEA 1UKIA 3W33A 5K9IA 1IA9A 3LM0A 3QQHA 3FZTA 1FGKA 4FSQA 4O21A 1OBDA 2OH0E 4I5CA 1U54A 3FMHA 2Y4IC 3A7HA 3LCOA 4TKSA 5FTOA 5BVWA 2QR7A 4QP4A 3ZLWA 2QOFA 4DBXA 5L8JA 3BLHA 2VWXA 2QODA 3IK3A 4J97A 5LARA 4UYNA 4C38A 3A7FA 5FP6A 4C4GA 4JR3A 5KMLA 4FV3A 4D2TA 3GCUA 3ORNA 4S34A 4NL0A 4AACA 3KCFA 2A0CX 2Q0NA 2YZAA 3WI6A 2YFXA 2VTLA 4ZLOA 3FMEA 2YM4A 3DV3A 4MNEB 5DIAA 3W2PA 5LVOA 4TWNA 5LMKA 2DUVA 4FNXA 4U40A 4K6ZA 3UOJA 2CLXA 5A9UA 4CFFA 4JQ7A 1FMKA 3E92A 3KULA 4QP7A 2C6LA 4FT7A 4P5QA 3KF7A 4D55A 2WB8A 4NFMA 4U80A 3UPXA 3SOCA 1F5QA 3NYXA 3WARA 1PMEA 3DKOA 4E1ZA 3BGPA 3LOKA 2Y4IB 1URWA 4RA5A 4UXLA 1ZRZA 2DWBA 3CP9A 4WSYA 2BDWA 4F64A 4UY9A 4ITHA 3I7BA 1UU3A 4EC9A 3KY2A 1DI9A 2HZ4A 3ERKA 3R1QA 2CKQA 5M4IA 4DLIA 3NCGA 1KOAA 3I81A 3PJ8A 2Y9QA 4ZS0A 4QNYA 3UO6A 2RFEA 3ROCA 3MFUA 4L68A 3SXFA 3E8NA 4FKLA 2QKRA 4BDBA 3CLYA 2R4BA 5FDPA 5CZHA 4CLJA 2WHBA 4D5KA 4PRJA 3U87A 3PXRA 2JC6A 2EB2A 4H1JA 3ZFXA 3OS3A 3TNPC 5D7VA 4BCHA 4F1MA 1CKIA 3QYZA 4ZK5A 3I79A 3BWFA 1Y6AA 3QD3A 4PPBA 4TL0A 1BL7A 3AC1A 4EZ3A 5B7VA 2VWBA 5GJGA 4B9DA 5IU2A 5HE0A 5K5NA 4JDIA 2X6DA 3Q53A 2FSOX 4IWPA 3MTLA 2RFNA 4FK3A 3M42A 4HGLA 4UWYA 3G6GA 3BYUA 4M8TA 4I23A 4OW8A 3OD6X 2UZVA 5E8YA 3VW6A 4GJ2A 3A7GA 3ZSGA 4EH6A 4AUAA 5C03A 4KBKA 2NRYA 3D5XA 3ORKA 3LMGA 4O0TA 3A2CA 3HRFA 4PPAA 4RIXA 2WMVA 3HUBA 4OGRA 5CAOA 2J0MB 3QCYA 2W17A 3QRJA 3OT3A 3VS6A 3FLZA 4FG9A 4DEGA 5CEQA 4EH3A 4YNEA 3RZFA 5E8SA 1Y91A 4BYJA 1RW8A 2RKUA 3FKOA 3RAWA 2YZLA 2CMWA 4JQEA 5BX0A 3O7LB 3EH9A 5I0BA 4CT2A 4IAKA 4FUXA 3P78A 5EM6A 2NRUA 2HAKA 4Q9ZA 5F4NA 4M3QA 3TIYA 4D2VA 2AYPA 5H8BA 4CD0A 3S0OA 2XRWA 5ACKA 3I7CA 3W18A 2O63A 2YITA 4NUSA 3FPQA 4F0IA 4YJNA 3FYKX 5IKWA 2YM7A 2QOLA 4O84A 1UU8A 2VWWA 5ANKA 4U44A 2V7OA 4FZAB 2YCFA 2R3LA 3E88A 2W1ZA 3R2BA 4K0YA 2J0LA 4PDSA 2WTCA 5LVPA 4CFWA 3DBCA 3Q5IA 1XWSA 5L2QA 3Q9WA 4ZMEA 3QD4A 2XEYA 3NEWA 4AFJA 4RWJA 3LFCA 4EHVA 4PP7A 4CRSA 5JGAA 4APCA 3TV6A 3FUPA 5FTGA 1SM2A 1MQBA 5CSXA 3KVXA 4UEUA 3TWJA 4D0WA 4EK5A 3QA0A 4R8QA 3TNHA 3EKKA 4IZYA 4DA5A 5AV2A 3C9WA 5I9WA 2A2AA 2XK6A 4O7RA 5IEXA 4K8AA 1WBWA 3BLQA 4NCTA 2O2UA 4J99A 3A99A 4L3LA 4EQCA 4EQUA 4BWXA 4G6NA 4Y5QA 1YVJA 4DH3A 5KMKA 4I22A 5IQFA 3SRVB 3QQKA 3R1YA 4EBWA 1RDQE 3DB8A 4Y46A 4Y72A 1GIHA 4FTLA 3V3VA 5AIKA 3KRXA 1W82A 3UPZA 5TR6A 4NT4A 4PQNA 2OIBA 4LGDA 4YTFA 3D0EA 2PWLA 4ZAUA 5TO8A 3TZ8A 3TNQB 1O6LA 1OPJA 3GEQA 4I0TA 5IA4A 3U54A 3RGFA 1KE5A 3HZTA 4MD9E 4XRJA 3VNTA 5HGIA 3O17A 4AU8A 4F9CA 3DTCA 3MVMA 5E8VA 5EFQA 2R3OA 3VBTA 3ZUVA 3ZC6A 4Z7GA 4FEXA 5CWZA 4I6HA 3I60A 2VWYA 3ORXA 3G33A 3IDCA 3F82A 4DITA 2BZKB 3HA8A 2XEZA 3R30A 4WBBB 2XBAA 2QOHA 3PP1A 2VN9A 2JIIA 1SVHA 4MBLA 3HX4A 4UALA 5DPVA 2I0EA 4JI9A 4ASZA 2BTSA 5A6NA 3LQ5A 3C1XA 4U43A 4PF4A 4YSMA 4C4JA 4RC3A 4FKGA 5BVKA 3ATTA 2JFMA 2WQNA 3ALNA 4U3YA 4I5MA 2PL0A 3QA8A 3KN5A 4J7BA 3ACJA 3LPBA 3K54A 3Q2MA 1F3MC 2C6OA 2WTIA 3IW5A 4BGQA 3S95A 4KABA 1Q24A 1H00A 3R7UA 3TIZA 5LVMA 4TW9A 4E3CA 1NVRA 5IH5A 4O0WA 3BU6A 4QYFA 5KMIA 4BTFA 4EOJA 5HTCA 4NM3A 2PUIA 5IEYA 1Q41A 5CS6A 2I0YA 5D41A 5DE2A 5EYKA 1QPEA 3ZHPC 5CALA 3DLZA 5HD7A 4QD6A 2V7AA 5D10A 3Q9YA 5AR3A 2R3NA 4RG0A 3C0HA 3ZRLA 4L46A 4JLCA 4EK4A 3KMWA 2XK3A 4BCQA 3QAME 2W0JA 4R3RA 3LFBA 3FMMA 3PSCA 5EM5A 5C1QB 3D5VA 3OUNB 4QP9A 5BYLA 4QPSA 4L42A 1ZY5A 3Q52A 3CQUA 4D4SA 2PVKA 3OW3A 4EBVA 4G2FA 5LJJA 4DEEA 4IBMA 5AP0A 2ZV2A 5DNRA 1BUHA 2YHVA 4RPVA 5E91A 3SAYA 4BDEA 3LVPA 2ONLC 3CR0A 3E7VA 3CJFA 2JDRA 4KSPA 4NIFA 4NYEA 3DZQA 4AQCA 1Z57A 4YJVA 2W5BA 3ZSIA 5I9ZA 4EOIA 5KHXA 1KE9A 1OM1A 4L01A 3NMUF 3NAXA 3OEZA 4DH7A 5F95A 5CI6A 2FYSA 5A4TA 4ZTHA 5L2TA 3R8MA 4C2WA 4O6LA 5CAQA 1U5RA 4Q5EA 1NVSA 4R7HA 2CGVA 3PVWA 2IZTA 3PIXA 4O1PA 5E8ZA 1ZYDA 3VRZA 3QKLA 5CX9A 4R3PA 2PE1A 2J7TA 3DLSA 3OHTA 4XG6A 3R63A 5DEYA 3TTIA 2QU5A 4R1VA 5IQEA 2UW0A 3QHWA 3LFSA 5BMSA 3DA6A 4CV8A 5ETCA 1K9AA 4X6QC 5GJFA 2WO6A 3WZEA 5E8XA 4RQKA 3MW1A 5FM2A 3TDVA 4IC7A 3QX4A 1UKHA 4NCTC 4OT5A 5DMZA 2WQOA 3RK7A 3GI3A 4IAAA 3CS9A 2OZAA 4FKUA 4IAFA 5KMMA 2GNIA 3R0TA 5D1JA 4ZJJA 4X3JA 3HMOA 1MRYA 3JPVA 2CJMA 3GU8A 5KNJA 5GZAA 4GFOA 4IB1A 5BPYA 4I93A 1OIQA 1UWJA 2VO6A 3PA5A 4IX4A 4M84A 4AX8A 3BU5A 4QMMA 4MWHA 5HBEA 4QQTA 3F2RA 4FL2A 2VNWA 3RHKA 5CSPA 3F3TA 4QTBA 3N51A 3VQUA 4AT4A 4BKJA 2VWUA 5M06A 3MYGA 2OJFE 1J1CA 4FIIA 4NWMA 4DEBA 1NY3A 4E6QA 4EH9A 4F7NA 2JEDA 4TWCA 1CTPE 5CTPA 2QLUA 3KRWA 3UDBA 3IW6A 5EQYA 3E7OA 3D2KA 4ANMA 2E2BA 3ZFYA 4WUAA 5DHJA 2HCKA 2OFVA 4DGOA 4A9TA 5J79A 3F61A 1BMKA 4F6WA 2H34A 3MVJA 2YABA 3WILA 1JSUA 1Q8WA 3VN9A 5DT0A 3IS5A 4C61A 3KRJA 5K5XA 4KIOA 2UZEA 3G2FA 1LP4A 5JFWA 5CU0A 1JSTA 3KK8A 4QMSA 2FSLX 3HP5A 4IEBA 2IW8A 3WYYA 3WZUA 1LR4A 4JG8A 3G15A 4F99A 1PMUA 3FY2A 1BKXA 4GIIA 3TNIA 1OKVA 2C6IA 3TZMA 1PXKA 2UZNA 4HGTA 3K3IA 2XF0A 4O82A 2XRUA 4ZXTA 5AUWA 3QTQA 5FTQA 4G5JA 4ANLA 4QP8A 2QOIA 4AZWA 1XQZA 1XH9A 2R3PA 2WMUA 3EQCA 3F3UA 4LRKA 4S31A 3A7IA 4YSJA 4YURA 4ZZNA 5CEPA 5E8TA 3JY9A 3FL5A 4BB4A 5A4CA 1GZOA 2XKDA 4FX3A 2RG5A 3IOPA 4FI1A 4O0RA 1NT2A 2X2LA 5KCVA 2WIHA 2JDOA 4ZY6A 1H26A 4AG8A 2PE2A 3Q3BA 3AC4A 4JBVA 4MF0A 4CV9A 1YDTE 2C69A 4NM0A 2GS6A 3DBEA 4RLKA 3TUBA 1H1QA 4BTMA 4BDDA 2XNEA 3L8PA 3KC3A 5J1WA 4QPAA 4WG4A 4YJPA 3W8QA 4AZVA 3VUGA 4DEAA 3FI4A 4B8LA 3PA4A 3EJ1A 4RJ5A 5M07A 4IB0A 4TPTA 3PPZA 4CYJA 4DG2E 2FGIA 2YERA 5KBRA 2OFUA 4CRLA 1MP8A 4M13A 3W1FA 2WAJA 5IUHA 2VAGA 4YZDA 4R3CA 4EJNA 3VS5A 1F0QA 3ANQA 3R9NA 4FNYA 3VBYA 2WKMA 3VUKA 4BDJA 4DN5A 4D9TA 4EZ5A 5DRBA 5CF8A 3EZVA 2EXCX 3HYHA 5J9ZA 3HKOA 5FQDC 4DGLC 3DK6A 1FOTA 3ZRMA 3UODA 2XMYA 3RAKA 3E3PA 1UV5A 3FC1X 3DT1A 3IDBA 1PXNA 1Y6BA 3R8ZA 3R21A 5HE1A 5J1VA 4FTTA 4BI2A 3FI2A 3LHJA 3DY7A 5C8KA 3VO3A 3L8SA 5AUXA 5H3QA 3BEGA 1GZNA 5C9CA 3PXQA 5JFVA 4ZJVA 5CXZA 3AGLA 4F7JA 4FGRA 4P4CA 1WAKA 4KRDA 3VBWA 2F2CB 3OWKA 4OTRA 2BDJA 2C3IB 4BDFA 4O7NA 3VRYA 3ZO3A 4UMUA 3POOA 4CG8A 2ZB0A 4G6OA 1Y8GA 4IAIA 4C4IA 4FIFA 1DS5A 3IO7A 1R3CA 2BMCA 5FP5A 5GIOE 4UWCA 4X2JA 1BI7A 2YIRA 2WMRA 5IQDA 4DFZE 1E9HA 4NIFB 4XH6A 4DAWA 3ORZA 5K0KA 3EN4A 5A4QA 3R8UA 4ZMFA 4BBEA 4ITJA 3LJ2A 4J8MA 4W8EA 2CNUA 4BC6A 4BKYA 3ELJA 4F4PA 1H1SA 1JSVA 2C3LA 2WMQA 4PX6A 4GK3A 2REIA 3U55A 5HE3A 4EKLA 1H1WA 3BQRA 3HMPA 1PMNA 2UVZA 3I6WA 4D4RA 4FKQA 3F3ZA 3C4XA 2WELA 3QU0A 2O0UA 4B0GA 3QTIA 4ACHA 3R7YA 2C6MA 2R0UA 2XNOA 5CQWA 5KZIA 4JRNA 3ZM4A 5BQ0A 3ATSA 2WEIA 4QMYA 3MWUA 2PVLA 3LM5A 5HCXA 3VBXA 3VF8A 5T3QA 3ZDUA 3BYVA 5C8NA 5LWNA 4XV1A 3RPOA 2R7BA 2R2PA 3CGOA 3PY1A 3ZXTA 4Z7HA 4U81A 5GHVA 5M4FA 2VTOA 3NZ0A 2Q83A 2R3IA 4BCFA 1OKWA 3ZBFA 2XCHA
chains in the Genus database with same CATH superfamily
2PK9A 3WF6A 4XS2A 4CFUA 4ZY5A 2R7IA 1G3NA 3MGYA 3OF0A 4MNFA 4PWNA 4XBUA 5IISA 4N4SA 3R83A 3F5UA 5DT3A 3H30A 4FV7A 5CU6A 4IACA 3D14A 3BCEA 3DDQA 2ZMCA 5EI2A 2HY0A 1IA8A 2XJ0A 3QTRA 4WNMA 5E90A 4HYHA 2XUUA 4F09A 4D2WA 2ITYA 3GNIB 5AIRA 5CAUA 4M7IA 3F5XA 3MH2A 4CXAA 3MVLA 4F9WA 1Q61A 4C0TA 4DG0E 1W83A 2WQBA 4ZOGA 1PXPA 2UZUE 2VX1A 4AW2A 4Q9SA 3O71A 3H10A 4W9XA 5ACBC 3M11A 4NKAA 3UQFA 2BR1A 2X2MA 4O0XA 3UP7A 1H08A 3PE1A 3AMBA 4G16A 4IAYA 4PNKA 4DFYA 3QHRA 5HVYA 3R01A 4MBIA 3NWWA 2G2IA 4OBQA 3R02A 4Y95A 4APPA 3U6JA 4PMMA 5JGDA 3BGZA 2UW4A 2ZMDA 3QD0A 3CPCA 5C8MA 4FGBA 2YISA 2XCKA 2F57A 4BZNA 1KE6A 3BE2A 4J53A 1UVRA 3ENHA 4F63A 3K2LA 1P4FA 4EH7A 2C5VA 3DJ7A 1GIJA 3MH1A 4JIAA 4FT9A 4CYIA 2ETKA 2VUWA 3HP2A 3OTUA 2PZ5A 3DKFA 4CTCA 1GAGA 2X8DA 3PPJA 4EZ7A 3TUDA 2X81A 5JGBA 2PVYA 1SNUA 4TYHA 4J96A 3PY0A 1YQJA 4R7BA 3GC9A 3VHKA 3Q9ZA 1OKYA 3FKNA 4X21A 2QCSA 1H0VA 4C62A 3LLAA 2IVTA 3HV6A 3UO5A 2G01A 2HWOA 1WBSA 4GUEA 2PVRA 4TNDA 2ITTA 1ZMVA 3E64A 4FVPA 4XP2A 4EQMA 3R9OA 2EWAA 4O2ZA 4GS6A 2W4KA 4L7FA 4RX9A 2E9VA 2GTNA 1PKGA 3ENMA 3P7BA 3Q32A 3FLQA 3HRCA 3QX2A 3EN7A 1G8KA 3EQBA 5AMNA 3ZXZA 4ZTMA 3FLNC 4YMJA 5DR9A 3O96A 2Y4PA 1XHAA 4CQEA 3Q04A 3UBDA 4HYIA 3QRIA 3DAKA 2PY3A 4DGMA 5HQ0A 4J98A 1IASA 4FTQA 4KS8A 4H3QA 2X4ZA 2WTKB 2PZIA 3AMYA 3NCZA 2W4JA 4E4MA 4ZSAA 1B6CB 5KKRB 3FMJA 4MXOA 3HA6A 4FIJA 2WTJA 3W2SA 1VYZA 5IMEA 3SA0A 2R5TA 5HHWA 3ORMA 4BHZA 5GJDA 4N70A 3MS9A 1MRVA 2QD9A 5FXQA 3LQ3A 3Q4CA 1A06A 4G3DA 3KULB 3GCSA 3LXPA 4RVTA 3R2YA 3UZPA 4F08A 4FKRA 2ERKA 4CCBA 1V1KA 3ZUTA 2OBJA 3UIUA 3PYYA 2VX3A 2F7EE 3GU5A 2DS1A 2JIVA 4FKSA 4O4EA 5HVJA 4CTBA 1B39A 4I5HA 4MNEA 1ZZ2A 3P0MA 4E5BA 3LLTA 3PRIA 5L2WA 1W0XC 4YJSA 3LCDA 4ERKA 4QPMA 4GIHA 4DLJA 4GW8A 5CNNA 4B99A 4I6BA 4MYGA 2IPXA 4NSTA 1QL6A 4QYHA 3DXQA 4Y8DA 4OTPA 4YPSA 2IZSA 3MTFA 2WD1A 2WU6A 4LRMA 2WPAA 3F69A 3CIKA 3IDPA 4NKSA 4WIHA 4XLVA 4LG4A 2XAMA 4N6YA 3E8EA 4JX7A 2C0OA 4LGGA 5BVDA 1K3AA 4FICA 4HJOA 3TV7A 3HGKA 5ETFA 4C36A 4BDAA 5ITAA 5IQAA 5IQBA 5DG5A 3KA0A 1IR3A 4IM2A 4FV6A 4ANQA 4IX3A 4E26A 3LQ8A 2C0IA 3LFAA 5E92A 2OW3A 2JITA 4RC4A 3R9DA 4KKEA 3T9IA 2G2FA 2HZIA 4EWQA 3PFQA 1UNLA 5JQ5A 1M17A 5DEWA 4ITIA 2BVAA 4JL9A 3SKCA 2QG7A 2IG7A 5D9HA 2BZJA 1AGWA 3FI3A 1LEWA 5JKGA 2JBOA 4IE9A 4NW5A 1Y57A 3NUSA 3UVRA 5FEDA 5G1XA 2B52A 1HCLA 2HELA 1PJKA 4C35A 2OXYA 4DHFA 1JKTA 3OBJA 3PJ1A 4DEDA 5IQIA 2Z60A 4XUFA 3KEXA 3COMA 1OGYA 3BHTA 3UDZA 5HIEA 3OCTA 2BZIB 4CMTA 4AGUA 4QMVA 5HX6A 2XYNA 4L67A 4EORA 3A8WA 4MKCA 4ANSA 4DTAA 2Y6OA 4C4EA 2GHMA 1XH7A 3OCSA 4FOCA 2Z7SA 4W4WA 2RL5A 5KZ0A 3UOKA 4BI0A 3BL9A 1XJDA 4XRLA 4ZLYA 3JY0A 4MTAA 3R7IA 3BV3A 4LOQA 4MAOA 1OL6A 3BV2A 3PG3A 4IX6A 4XHKB 4FKOA 1UA2A 3S2PA 3V01A 5KMJA 4IMYA 2X0GA 4FEQA 2C3KA 4V0GA 3RM7A 5A54A 1DI8A 4NK9A 3B8QA 2J0IA 2J0KA 3F3VA 3W2OA 3PXKA 2HYYA 4EHZA 3TKIA 4K2RA 3AC5A 5BUIA 4DFBA 4L45A 4MXZA 4RFZA 4YZMA 3ZUUA 4IB5A 2I7QA 4FK6A 3CKWA 4P90A 4GVAA 4C57A 2W06A 3DJ6A 4P7EA 5DYJA 2QLQA 4HVDA 2LGCA 2J90A 5EDPA 3D4QA 5TT7A 3NPCA 4YHFA 1M14A 3LIJA 1H07A 4FKTA 2XKEA 2NO3A 3FXZA 3D15A 1JLUE 3N4TA 2W1GA 3EIDA 1W8CA 5CSWA 1KE7A 3VHEA 2G9XA 4RJ7A 3SXSA 1TVOA 1T45A 2QR8A 4FZDB 3V04A 2I1MA 3SX9A 2A1AB 5EYDA 5DA3A 4OTHA 1NVQA 1WBNA 1S9IA 2ONLA 2R3FA 1LEZA 4EK6A 5HU9A 3FV8A 5A6OA 2GDOA 3R71A 2C47A 2YIQA 5JZJA 3GOKA 4FV0A 4MQ1A 1QPJA 3EOCA 4RIWA 1VZOA 3QQLA 2WQMA 5DWRA 2R3HA 2F49A 3ALOA 4I21A 5C4LA 3UNKA 3EQPA 4FE2A 4M67A 1YHWA 5L6PA 2CLQA 2JD5A 4OTGA 1XBBA 3IECA 5HZNA 1MUOA 2JDVA 2Y0AA 3RINA 2YM6A 3R1SA 5I3OA 2XJ1A 1ATPE 3WZJA 1Q8ZA 3PXYA 4BL1A 4CMUA 3GENA 2J9MA 4G5PA 4WRSA 5JEBA 2BALA 4J52A 4I6QA 3LMHA 1FVVA 4EYMA 4FKJA 4KIKA 4W4YA 3CTQA 3KRRA 4GYGA 4CNHA 5CEOA 2JDTA 5IQCA 1YXXA 4X0MA 4O7TA 1BI8A 2IVUA 2BUJA 4I24A 3P5KA 4QMTA 3ZM9A 4H58A 4BCOA 4ANBA 5HO7A 4NJDA 2XM8A 2YCSA 4YR8A 1ZMWA 4RT7A 1PYEA 4ANNA 2QO9A 2OJGA 5M53A 4DHIB 4Z16A 3QRUA 2FSTX 2QO2A 2GFSA 3UTOA 4DE4A 1R39A 4YLKA 3ODYX 5CAPA 4Q2AA 4U79A 4DFLA 5L8LA 2BAKA 3SXRA 4BJJA 4U7ZA 4GK4A 2X39A 2IWIA 2ZYBA 3PSDA 4FV5A 4WD5A 4RJ4A 5AM7A 4YC6A 4BICA 3KF4A 4BZOA 3HNGA 3ZO2A 3UMXA 4EUUA 3RTPA 2OJJA 4CGAA 4A9SA 2UV2A 3JXWA 3DNEA 4FV2A 3F66A 4IM3A 1M2RA 2VTMA 4NM7A 4EC8A 4DGNA 2W1CA 3B2TA 5CANA 3P86A 4F78A 2PMIA 4XOYA 4U6RA 3UC3A 3P7AA 4C58A 1OZ1A 4GT4A 4LYNA 2XKCA 3OZ6A 3NSZA 4AN9A 2VGOA 2X6EA 4FSRA 4YLLA 2XIXA 4JIKA 4FTIA 4XG9A 2VWIA 5AM6A 4L44A 3TCPA 2BDFA 3O23A 3UQGA 3FQSA 3BHYA 3AC3A 4FV1A 3GFEA 5K3YA 1HCKA 2YLEA 1J7UA 4IJPA 4S32A 3C4ZA 3UJGA 3FY0A 2VRXA 5FGKA 3DZOA 4IFGA 1XMMA 3BHVA 4FEWA 4KIKB 3OC1A 4XEYA 3W2QA 4KAOA 4UYAA 2BIKB 1H1RA 3F5GA 4QP6A 3S00A 3F2AA 5C4KA 4AW0A 4AE6A 4YHJA 5H2UA 4MBJA 5AAGA 3LFDA 3R73A 4CMOA 4UN0C 4PTEA 3GQIA 3RAHA 2ITOA 3JYAA 3V51A 2ZJWA 4EH2A 5KO1A 4X2KA 4WSQA 5C01A 3E8DA 2HY81 4M0ZA 1KV2A 3EQHA 4BCJA 5IDNA 2E9NA 3M2WA 3MJ1A 5LWMA 1SNXA 1WFCA 3LXNA 3EHAA 4IZAA 5AR4A 2PUPA 4KIQA 5J87A 4EYJA 3PIYA 3BHHA 3IW4A 3DAEA 4F6UA 1PXJA 3U6IA 4L53A 1YRPA 2YAAA 4G3GA 3GC7A 1M2PA 3MY0A 3KXMA 4QMPA 3PVGA 4U0IA 4UWBA 3WF9A 1W2FA 2FO0A 1YI3A 2CDZA 4JT3A 2IW6A 1U4DA 4UXQA 3C50A 2BKKA 3PVBA 4TXCA 3VS4A 3RPVA 4JX3A 4D2RA 1YXTA 1ZYJA 3CD3A 3U4WA 5B2LA 3NW6A 5J7HA 2ITNA 2OO8X 2HW6A 3I0OA 3NYVA 1WVWA 2JKQA 2EVAA 3KIOC 3HV4A 3NYNA 4DC2A 3JUHA 3Q96A 4HZSA 4AW1A 3UNZA 4JDKA 4ZIMA 4NFNA 4XV9A 1OL1A 1JQHA 4ZS4A 2ITZA 3ETAA 4W8DA 4A4XA 5CVFA 4MWIA 4EOMA 4FSZA 3BEAA 3QZHA 5HCYA 3NRMA 2W5HA 5CQUA 3W2CA 1PYXA 2PE0A 3ULIA 5AUTA 5J9YA 4CQGA 2YEXA 5HESA 3U4UA 5L8KA 3CSVA 3DBDA 3UDTA 4AZEA 1OIRA 4HZRA 3WZKA 1JKSA 2QOOA 4IFCA 5ANOA 3D5UA 4L9IA 5DR2A 3C5IA 4O27B 4NEUA 3CGFA 1XH5A 4EWHA 3O8PA 4PV0A 1ERKA 4AF3A 2BRGA 4LM5A 3PTGA 4M66A 4LRJA 3EYHA 4CLIA 2Q0BA 3F7ZA 4I4EA 4RBLA 2C5YA 2OXDA 2B54A 2XVDA 5B2MA 3Q6WA 4A7CA 1M7NA 2RFDA 3PZEA 2JLDA 5FDXA 3QUDA 3VJOA 5EK7A 5EKNA 4YNOA 4I94A 4GG5A 4ASXA 1ND4A 1XR1A 4MXCA 4DBNA 2JIUA 3MPAA 4BKZA 4ACGA 3U8WA 5M56A 4F9YA 4R5YA 4LMNA 4X6RA 3BELA 2OICA 5FEQA 3KXZA 2W7XA 2C4GA 3BU3A 4H3PA 2BAQA 3BBWA 4OUCA 3OOMA 2QQ7A 1FGIA 4H36A 4JVGA 3GC8A 3WE8A 4X7QA 3KREA 2XM9A 2Z02A 4FTUA 2GMXA 1Q8UA 3QD2B 5TE0A 1TKIA 2W4OA 3UC4A 3BZ3A 2PULA 4O7WA 2PU8A 5AP2A 5HTIA 1ZOHA 4H39A 1BYGA 4GCJA 3AD6A 4JXFA 2C5OA 2B53A 4XG8A 5HI2A 5BVEA 2C6KA 3VJNA 4YGAA 4QMZA 3WYXA 1Q3WA 1XBCA 2CSNA 5HBJA 3CQEA 4CKIA 2CKPA 3GBZA 4FYOA 3GCPA 1URCA 1H24A 2A4LA 2PVJA 3OG7A 3QCSA 4D1ZA 5HLWA 4GUBA 1Y8YA 4U8ZA 3DOGA 2OF2A 3QUEA 2BTRA 4IB3A 5CSVA 4QT1A 2ITXA 5LCJA 4PY1A 4JAIA 1H25A 1P4OA 4OTFA 5HTBA 4F7LA 4GL9A 4KBCA 5DH3A 4EUTA 3FAAA 2YM8A 3GC0A 4JQ8A 1CKJA 3MY1A 4I6FA 5GZ8A 4AT5A 3ZRKA 3RCJA 2W1IA 3W0NA 5D11A 2YJRA 1QMZA 1P5EA 3OCBA 4ZSJA 2OWBA 4ERWA 3GP0A 3O0GA 4K33A 2JKKA 3I0QA 5HNBA 3EN9A 1UU7A 4WO5A 1OL5A 4F1OA 3MPMA 4XYFA 5AR7A 5CF6A 3FQEA 3FC2A 2V0DA 3ET7A 4M69B 4QYGA 4RSSA 4E6CA 5K0XA 3CEKA 3H4JA 4I0RA 2DYLA 4KUJA 5F9EA 4EKKA 3EQIA 2GQRA 5FUTA 3G90X 5K4JA 4O83A 3LMIA 3VUDA 3HMMA 4FTMA 1PXOA 3L9NA 3AOXA 1JAMA 3NLBA 2QG5A 5AUVA 4AZFA 5CNOA 4B6LA 2WMWA 3P4KA 4JNWA 3RKBA 2HENA 2ITWA 2YIXA 4NW6A 2YWVA 4EH8A 3IW7A 4RLLA 2P4IA 5E8UA 4I5PA 2BHEA 1KV1A 4NU1A 3ZMMA 1U54B 5HX8A 1PMVA 4RFYA 4RZVA 3PY3A 3GUBA 4QO9A 4TYIA 2QHNA 2ZV7A 3O7LD 3R8LA 3FLSA 4DH5A 4EL9A 2GCDA 2ACXA 3UVQA 3RJCA 4EH4A 1JOWB 3CKXA 4XG4A 3SV0A 4EK3A 5L2IA 4E5AX 4BFMA 4J95A 2WTWA 4G6LA 4O91A 2OIDA 2F4JA 3H9RA 3TG1A 5AFVA 5FBNC 3QLFA 2YCRA 4RZWA 4E4LA 1GZ8A 4L8MA 4RX5A 5LVNA 2GFCA 3DKCA 4V01A 3KB7A 2QOQA 3Q2JA 4FSTA 2OF4A 4YLJA 5IZFA 4HGSA 2Z8CA 5E9EA 4EJ7A 2VTJA 3UG1A 3EYGA 4TYEA 3V8TA 4ZLZA 4CVAA 2V55A 2J50A 5HG9A 4PMPA 3PLSA 5ETIA 3VS1A 3NVMB 4QNAA 4O38A 4R78A 4QMQA 2FVDA 2JAVA 4HPTE 3NNWA 1V0OA 4Q5HA 2JDSA 5CASA 4WNKA 3CXWA 5FM3A 2J5EA 3FMKA 3DAJA 4FMQA 5F94A 3UMWA 2XH5A 5TKDA 4DF3A 3ANRA 2ITPA 4K9YA 2WIPA 4RIYB 4UX9A 3GOPA 4FNWA 2IVVA 4X3FA 3QKKA 4QMOA 3NDMA 2VD5A 4ORKA 3EB0A 3NIZA 1GZKA 3O51A 4FL1A 4RRVA 4EOSA 4O4FA 1VR2A 2J2IB 1Q62A 2PUUA 2W9ZB 4L6QA 4UV0A 4P5ZA 4IJ9A 4FSYA 2J6MA 4Y85A 2WU7A 4ZZOA 5L6WL 1WVYA 2JGZA 1O9UA 4RVKA 4C34A 3NFGB 1Q4LA 4BGHA 4I41A 3OXIA 3VS0A 1TQPA 5AV4A 3FJQE 3R22A 2GNLA 2X7OA 4FODA 4HCVA 4IZ7A 1CSNA 4WRGA 3EL7A 4FEUA 3TTJA 3NUUA 4KWPA 5BV3A 4BYIA 4E6DA 2Y7JA 1OPKA 4FSMA 5CY3A 5EOBA 1DAWA 2FSMX 3QZFA 5M4CA 1FINA 4KSQA 2C5XA 3VULA 3DK7A 4FT5A 3RPSA 3TKHA 3ZSHA 3WIGA 3AT4A 4AFEA 4AAAA 1YHVA 3D2IA 3VC4A 2GTMA 5AEPA 4IDTA 5DI1A 1XMLA 3PJ2A 3MN3A 4LQMA 3DQXA 1WZYA 3AKJA 5EDQA 4FVRA 2X0PA 4AZTA 1KE8A 4TNBA 1U5QA 1O6YA 2FUMA 4JBPA 4JJRA 3R7EA 4HPUE 2A19B 2XIZA 5AR8A 4MD7E 3HDNA 3T3VA 1ZAOA 3QUPA 3ZLYA 1AD5A 1M52A 5EM8A 1OPLA 3GT8A 3FXXA 2OU7A 2NNWB 4BDKA 3IW8A 3QQGA 3I1AA 3E5AA 3NYOA 2JBPA 2PMLX 5C27A 4X2GA 5ICPA 3T8OA 3QRKA 4C3FA 3LCKA 4I1ZA 3FQHA 4UBAA 5AUZA 3O5AA 2H8HA 4FTJA 5HBHA 3RCDA 4FEVA 3H9FA 5BNJA 4GKHA 2LAVA 2Z7RA 3SD0A 4EOPA 4ZSGA 4D5HA 2W5AA 3QC4A 2I0HA 3A4OX 4AOTA 3QZGA 4O7VA 4N0SA 1ZMUA 2Z2WA 4IZ5A 4IW0A 1JPAA 4B7TA 4O7SA 1W7HA 4Z9LA 5B2KA 3VQHA 2QO7A 3ZBXA 3NUNA 2W96B 4QYYA 5C26A 5CVGA 4WOVA 1ZY4A 3TACA 4QDVA 2ZV9A 4O0VA 4HYUA 3WE4A 2E9PA 2VTQA 3QQFA 4FZ6A 3DBQA 1OGUA 3FPMA 4GT3A 3SG9A 1S9JA 3DPKA 1WBOA 4GV1A 3L8VA 5J9LA 4QP3A 4ZP5A 1LPUA 1G8JA 5EH0A 3FYJX 4RGJA 3KFAA 1REJA 4FRFA 5EW8A 3PLAE 4IHPA 3TN8A 2WTKC 5CF4A 3Q4ZA 3W2RA 2V62A 4FZFB 3QCXA 4RWIA 3U9NA 4RJ8A 4HVHA 3MFRA 1OIUA 3RVGA 5BVOA 2GQSA 5CYIA 3OCGA 5HLNA 4GVJA 1U46A 4AXEA 4IDVA 3HMIA 3KN6A 1WBTA 3P1AA 4J71A 3VIDA 3L1SA 5A4EA 3NUAA 5IH4A 2RFSA 2XB7A 5ANDA 2I40A 3PPKA 3ZEPA 3F9NA 2XARA 3MVHA 4N57A 1PKDA 4K77A 3NR9A 3OBGA 1YOLA 3EFJA 3BE9A 4LUEA 4NJ3A 1H27A 2FA2A 3NNVA 3MH0A 3SGCA 3W0PA 3W0RA 3AD5A 1ZOGA 2CN8A 4H1MA 3RK9A 2BILB 4BDHA 5EHLA 4D4YA 3PXZA 3HAVA 4L43A 4PTCA 3KK9A 1YWNA 2XA4A 4AA5A 2BPMA 4G1WA 4V0GB 2UVXA 5FD2A 3BPRA 2QI8A 3WF5A 1JNKA 4NM5A 4O0SA 4YZ9A 5I9VA 4ASDA 3DTWA 3JVSA 5HICA 2OH4A 4S33A 3UQCA 3KKVA 5IF1A 5AX9A 3ZH8A 3COIA 3NW5A 3G0FA 1UU9A 3NGAA 3JR1A 2Y6MA 3EL8A 4KINA 3RNIA 5CI7A 1H28A 2EU9A 4N6ZA 4V04A 3SW4A 3U9CA 4RIYA 3UP2A 3QTUA 3R7VA 5IUGA 3HAMA 2EUFB 2F2UA 2ZDUA 4KKHA 3SW7A 4G3CA 2J5FA 1XH8A 5CXHA 3NAYA 2P33A 5AR5A 1G5SA 2RG6A 4D1XA 2PZPA 3ORPA 5FXSA 5I9XA 2XYUA 2VTTA 3OY3A 3PP0A 4QQCA 1J7LA 5AJQA 3ZFMA 2OJIA 4JRVA 4M97A 5H8EA 5I5ZA 5EI6A 3AC2A 4TY1A 3UIMA 5HO6A 2X9FA 5GNKA 3DFAA 4IVBA 4IVCA 3VBQA 4AW5A 4D2SA 5HD4A 2PHKA 3HV7A 3UOLA 1Q99A 1OL7A 2OZOA 5DGZA 4WG3A 1WBVA 1CKPA 4ZSEA 5BYZA 4DINA 4AS0A 4YU2A 2QHMA 3KXNA 4GH2A 2XKFA 3FSKA 3HVCA 4LV8A 4DFUA 5JRSA 3V5QA 4GFMA 3TL8A 3DCVA 4CEGA 4FF8A 2XK7A 2PZYA 4HNIA 2BRHA 2WXVA 3CTJA 4AWIA 4E73A 3FSFA 3G5DA 4TYJA 1JBPE 1GY3A 3BX5A 4W9WA 4O7LA 4MXYA 2W05A 4BY9E 2XNNA 3BYSA 5EKOA 2YAKA 2YDJA 4QMWA 2EXMA 5HOAA 4ACDA 5BYYA 3BIZA 2C3JA 5A3XA 3FMLA 3O8UA 4FTNA 4ZZMA 2P55A 2QOCA 2HIWA 4F6SA 4LGHA 4DFXE 2ZM3A 2ZM1A 4JS8A 5HORA 5JK3A 3LW0A 4DFNA 3FHIA 2CPKE 4TTHB 3VUIA 4R1YA 2I6LA 3H9OA 5HIBA 4DTKA 4R6VA 2IJMA 3NUXA 3GFWA 4C3RA 4UMRA 3EMGA 3G9LX 4M69A 2DQ7X 5EG3A 2YIYA 4H3BA 2VNYA 3C51A 3OROA 4QQ5A 4C4HA 4D2PA 2VTIA 4CFVA 5M51A 3KGAA 3H0YA 3V5TA 1YXVA 5HNIX 5A14A 4DDIA 4TYGA 4JR7A 4QOXA 4YTHA 5JFXA 5M44A 4RIOA 3RPRA 2XZSA 3TJDA 4QMNA 4USEA 5DR6A 3C0GA 4NZWB 2OSCA 2YM5A 3PUFC 5F1ZA 5IA0A 4F7SA 4EHEA 2BIYA 4ZJIA 4I0SA 3C4CA 4RVLA 3RPYA 3R1NA 3C7QA 3SHEA 2ZB1A 1YHSA 4JDJA 3ZS5A 3EFKA 4LV5A 5IDPA 3ZO1A 5AAEA 3AD4A 3C4EA 4QP1A 4YZBA 3NUPA 5BMMA 4E20A 1Q8YA 3BWJA 2XBJA 3IQ7A 4PPCA 1R0PA 4RJ3A 4LOOA 5IA3A 3MH3A 4O4CA 5EDRA 1YI6A 5HE2A 4L00A 4TN6A 5A46A 2X0OA 3DXPA 4RWLA 5AV1A 2VV9A 3M1SA 3BQCA 2R9SA 2VTHA 3PE2A 4F0GA 2X8EA 4FA2A 2YACA 2ZAZA 5IG1A 2HZNA 2XJ2A 4O7YA 3HRBA 3FMNA 2I0VA 4J8NA 4O1OA 5KE0A 3ROYA 3DS6A 4M15A 3VS3A 3VUHA 4JOAA 4C59A 4XG2A 5A4LA 4OAUC 4OBOA 3RAIA 4FUYA 5CEIA 3UYSA 2Z7QA 3A60A 4AXDA 5I9UA 2UVYA 2F9GA 2PMNX 1Q5KA 4O2PA 4GU9A 1YW2A 5CT0A 4UMQA 4WNOA 4EI4A 3F88A 3HECA 1ZARA 2BCJA 4ZTSA 3UOHA 4DGGA 4WNPA 4IANA 2PSQA 4XLIA 2UZTA 3I5ZA 3Q4UA 4WBOA 4S30A 3FKLA 2XANA 3W55A 2BHHA 4D1SA 1GJOA 3V5WA 4YBKA 5JMSA 1OB3A 2NP8A 4H05A 2UZDA 4KS7A 1W2DA 1PXLA 2HXQA 4DYMA 4L3JA 3DJ5A 4L52A 2X9EA 4PTGA 1TQIA 1ZYSA 2YIWA 3PRFA 2CGWA 4RWKA 3LXKA 5L3AA 2AEGA 4D4VA 4A9RA 4I20A 3SVVA 3BHUA 1ZYCA 5CZIA 1H01A 3CPBA 4FZ7A 3KVWA 4PDOA 1XBAA 4XCUA 2B0QA 3QRTA 5HG8A 4E8AA 3TDWA 5EW3A 3UGCA 1BL6A 4YPDA 4WG5A 4Y5HA 4BCGA 3RK5A 1X8BA 4MVFA 4IWQA 4BCIA 3N4VA 2GPHA 2B7AA 4ENXA 4NTSA 1SMHA 2FH9A 4E6AA 3HMNA 1JKKA 3WZDA 5HO8A 3LFFA 4O0UA 3L9MA 2XK4A 3AT2A 3QL8A 4TYHB 2IO6A 4G9RA 4BGGA 3EQDA 1JKLA 1EH4A 2KULA 2VZ6A 2XNBA 4AE9A 3ZOSA 2P3GX 4BCMA 2C30A 3IGOA 1GIIA 1P14A 2WTDA 4CZUA 2PVFA 3EWHA 3G6HA 3RP9A 1Q3DA 3VUTA 2J0JA 3QKMA 1VLRA 4HVGA 1PY5A 2HZ0A 2XK9A 3GQLA 2PVMA 3MY5A 3PG1A 3Q9XA 2IVSA 3OFMA 4BDGA 2YDIA 3SQQA 3MFTA 4UMPA 3FWQA 4DH1A 4EHGA 1Q8TA 3MFSA 2BRMA 2VTPA 3EFWA 3PSBA 2P2IA 4YO6A 5EHOA 3K5VA 3VAPA 5I9YA 3OOGA 5E8WA 3DB6A 5M55A 4L3PA 5IA5A 3RI1A 3ZZEA 4BDCA 4ZTNA 3QWKA 5CLPA 5IA1A 4O86A 4DHZA 5J5TA 4HW7A 2C1BA 5AV3A 4A07A 4XP3A 3V5PA 2VO3A 3HV3A 5CF5A 3II5A 3LXLA 4IXPA 4DTBA 3QALE 4BIDA 3R9HA 1UWHA 5E1EA 4FYNA 4I4FA 4HOKA 3E87A 4D0XA 2R3GA 4B4LA 4EOKA 5IA2A 5IMXA 3QYWA 3CE3A 2UW6A 1HOWA 4LL0A 3H0ZA 4BRXA 2ETMA 3S3IA 4JAJA 2W1DA 4OTWA 4PDYA 1VJYA 4XP0A 2CKOA 3WIKA 3LAUA 1J3HA 1ZZLA 3BI6A 1ZXEA 3DDPA 2C68A 5B0XA 2WMBA 2F7ZE 2BAJA 2E9OA 1CM8A 1XH4A 3HV5A 4JDHA 1FBNA 5EQEA 3V8SA 4CSVA 2E9UA 3AXWA 2QVSE 3N9XA 2RSVA 3ITZA 2PYWA 3TZ7A 4AAYA 2J51A 4FBXA 5CVHA 3NS9A 4Z3VA 5ANEA 3T9TA 1FMOE 4C4FA 5IEVA 3BYOA 4DT9A 3SOAA 2GNHA 4PL5A 4RX8A 4C33A 4QEBA 3C0IA 2XP2A 4CFNA 3PWYA 3AC8A 4EEVA 3R8PA 3THBA 4RVMA 4USFA 5CEKA 4FJVA 2BFXA 3A8XA 3OWPA 4AGDA 2OGVA 4F1TA 4HGEA 1YDRE 1CDKA 2P2HA 5IUIA 4UMTA 4GSBA 5T6KA 2QC6A 2OG8A 5LMKC 1QPCA 3LZBA 2UZBA 4RA4A 4CG9A 1OECA 1PF8A 1NXKA 3DFCB 4YJOA 3TM0A 2UW9A 3S4QA 2CKEA 5GINE 4FIEA 1QPDA 3KL8A 3BKBA 3DU8A 5AR2A 3BLAA 3KU2A 4DEHA 4U41A 3AGMA