5HESA

Human leucine zipper- and sterile alpha motif-containing kinase (zak, mlt, hccs-4, mrk, azk, mltk) in complex with vemurafenib
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
294
structure length
287
Chain Sequence
ASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase MLT
publication title Structure of the Human Protein Kinase ZAK in Complex with Vemurafenib.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 287
sequence length 294
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hesA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hesA01
2WXVA 1CM8A 2NP8A 4FIGA 4U81A 3KL8A 4C34A 2V5QA 3FXWA 2CKQA 3HMPA 1LPUA 5A4LA 4EONA 4WNOA 5IEYA 2R3QA 4ASZA 3DDQA 1LEWA 1PF8A 4FVQA 4QP6A 4PP9A 5CXZA 4CV9A 5I9VA 4OAVB 3CY3A 4F65A 4KIQA 2YM6A 3REPA 3GQIA 1REJA 3A7GA 2JC6A 3QQGA 4QMLA 4UV0A 3UP7A 3UYSA 3GENA 4CLJA 3IPHA 5AWMA 5CEOA 4R8QA 1JKLA 4F7NA 3KK9A 3L1SA 4NTSA 1IAHA 3NVKI 3QGWA 4CYIA 4G6NA 3G15A 3G33A 3OWJA 4BR3A 4YJQA 5FUTA 3EFWA 5F95A 3VUGA 5EYKA 4BF2A 4CFWA 4D0WA 2VWYA 2X2LA 3IS5A 3O23A 3NGAA 3EZRA 4E4MA 3HV4A 4K6ZA 4TNBA 5HNBA 2QCSA 3UDBA 4CRSA 4FTRA 3HRFA 4ASEA 2OSCA 2BKKA 5B0XA 2J51A 4YC8A 3ZBFA 3PVBA 1Y6AA 3KFAA 2ONLC 3LLAA 4I6QA 4C0TA 2PMOX 2Q83A 3R04A 3U87A 4M3QA 2ERKA 2CN8A 5CALA 4MAOA 4MBLA 4UXQA 4FEXA 5LOHA 1URCA 2ERZE 3Q96A 4PF4A 3U9CA 2GNIA 5CTPA 4R1VA 4BRXA 4RJ3A 4MXZA 4CKIA 1WMKA 2Z7QA 2ZV9A 3U51A 5A14A 3QTWA 4QP7A 4ZEGA 2NRUA 5KMNA 3MV5A 4RMZA 2YZLA 5FP6A 4EWQA 1OIRA 2UVYA 3NYVA 1WBNA 5HD4A 1MRYA 5EKOA 5M09A 5DEWA 4NM3A 3MA3A 3FPMA 3P7BA 5FXRA 3NMUF 1APME 5CSVA 4E7WA 3VULA 3TZ8A 5E91A 4LUEA 4LL5A 1DM2A 5CI6A 1UWJA 4BIBA 4J1RA 4JNWA 4YJNA 5HCYA 4WG5A 3COIA 5IQEA 5M55A 3MY1A 3SVVA 4R77A 3OHTA 3R73A 4LGDA 2HZIA 4RX9A 3ZZWA 2P55A 3DOGA 3RPRA 3DK6A 4ANOA 4NT4A 4BTMA 5HTCA 2JD5A 3U9NA 4AOTA 4C4FA 4XEYA 2ITPA 4UMTA 5DNRA 4AW0A 1LUFA 4MK0A 5DFPA 1XH7A 4BDAA 3U6JA 3QWJA 5HX8A 3OCSA 5J87A 4F9CA 4ONAA 2ZM1A 4QYYA 4BN1A 2B7AA 2C6LA 2JBPA 3L8PA 4PTCA 4XJ0A 4WSQA 2ITNA 2WMSA 2WO6A 2BTRA 4JDKA 2R3FA 2Y7JA 4N0SA 4RSSA 5CSXA 4F1OA 4KBAA 5M4FA 3NVMB 5J9LA 2J6MA 1OMWA 5CSPA 4FKOA 4F7LA 2O5KA 4MCVA 4RZVA 4V05A 5HG9A 3WF6A 2OJGA 4MHAA 2B9JA 3H4JA 1JWHA 2PZPA 2P4IA 2XJ2A 3OW3A 4J95A 4XRLA 3HDMA 4LGGA 4DHFA 3O8TA 4RGJA 3KULA 2Z8CA 4MKCA 4IDVA 3ZSHA 5EYMA 1BKXA 4FI1A 3A7FA 4NL0A 3F3WA 3H0ZA 3QQFA 3EQRA 3RAHA 3KMMA 2HZ0A 4MXOA 2BRNA 3KF7A 2YAKA 4BDKA 3PE2A 4RIWB 4WRSA 4IZ5A 5IA5A 4GUEA 1REKA 4XNEA 2PUNA 1MRVA 4GFOA 5AM7A 1PYEA 2G9XA 2X7GA 4ZTHA 4ZIMA 2X9EA 4ZZNA 4DEAA 3R7UA 4E6CA 1H08A 3HL7A 4IWDA 5ICPA 4QP9A 4E5AX 3FMNA 3TJDA 3QCXA 4Y95A 1GIIA 1H25A 3AD6A 4AA0A 3D5UA 5BMSA 4OTHA 4PPBA 3ENHA 4OW8A 4WNPA 4AGCA 2PULA 4JDJA 2H96A 3F5GA 3I0OA 3NNXA 4FG9A 4R6VA 1Z9XA 4X3JA 4UMUA 4AZVA 2QG7A 4TN6A 1HOWA 5LVLA 3TV6A 2V7OA 3W8LA 4AUAA 4MYGA 3UBDA 4IAYA 2WU6A 4YBJA 5J1WA 3Q2JA 1CDKA 2JDTA 4FSWA 3O7LD 4PNIA 4QMMA 2BDFA 3NUXA 3HMNA 4Y72A 4AF3A 2XKCA 4O21A 3DFAA 4YTIA 2OG8A 3EQBA 3CP9A 3AD4A 3FZSA 3KXZA 2OH0E 3PG1A 2EB2A 4RJ7A 3VF9A 2JIUA 2OU7A 4QT1A 1R1WA 3BBWA 2YFXA 4NZWB 3SAYA 5T3QA 3VUTA 3MJ1A 2VWBA 3QX2A 3CD8A 4O0SA 4KKEA 4W4VA 3G90X 4F99A 2BVAA 3QX4A 3FLZA 3FMEA 5IH6A 5LWNA 3GP0A 4NM5A 4XS2A 4IWQA 5A4EA 4C2VA 3K5VA 2V0DA 3F5UA 3NRMA 4YURA 4O1OA 4FC0A 1YXTA 3TZ7A 4O86A 3BHYA 1ZOEA 5CYIA 2C4GA 1KE9A 2C6EA 3EN7A 4JR3A 2R3LA 1OITA 4G6LA 4RQVA 4UY9A 4YC3A 2ETKA 4NW6A 5AA8A 4P4CA 3Q5IA 4ANNA 4L00A 5IQHA 2FO0A 4FK3A 2QKWB 2XNNA 2YDIA 5CU6A 5M53A 3KK8A 3WZDA 4IX3A 3FI3A 5CY3A 2X81A 2X7FA 5JGAA 2H9VA 4BDEA 2HW6A 4DLIA 1OKWA 3H9OA 3RP9A 5EQPA 2GNJA 3KU2A 4E93A 3PDTA 2GFCA 2CHLA 4X7QA 3OOGA 1CKIA 2IZSA 3W8QA 3HV7A 4CFXA 4DTAA 4FVPA 2GHLA 4LGHA 3ZDIA 3FPQA 4PPAA 4DG0E 2W06A 3CD3A 3OCGA 5IKWA 3OF0A 4C3PA 4ZS0A 5KO1A 4O7ZA 2R3KA 3KVWA 3KA0A 2QODA 2OW3A 4IBMA 3WF8A 5BVEA 4RA5A 2HZNA 2HY81 4L7FA 2B52A 4FGBA 5CF8A 3E64A 2VNYA 4K33A 3F7ZA 4CZYB 5M44A 2PZIA 4EH6A 2XRWA 3OG7A 3QCYA 2BDJA 3EYHA 4YTFA 2QC6A 3RPVA 2W1IA 5K4IA 3KULB 2VRXA 3FLQA 2J0MB 3Q32A 4IB3A 1MQBA 3DFCB 2A27A 4XV1A 4HW7A 3VW8A 1QCFA 1Q5KA 4H3BA 2A4LA 2OBJA 2YLEA 3R7OA 2J90A 3TEIA 2BAJA 2OICA 2VWXA 2FYSA 2R9SA 2YIYA 4K8AA 5AP0A 3RAIA 2QR7A 4FIJA 3F82A 4LL0A 3R9HA 1SNXA 3I7BA 4CMTA 4CQGA 3JYAA 3GXLA 4J97A 5EFQA 4DEHA 3R9RA 1Q41A 4RPVA 3G5DA 1RW8A 4QP2A 4CLIA 3LFNA 1KV2A 3B2TA 4AXAA 4L43A 1AGWA 2EWAA 1YXVA 4KABA 2EXEA 5GJDA 5CEIA 4FTIA 4C58A 4EK3A 1RQQA 2PVJA 4O0XA 3NPCA 3JUHA 3A7HA 5HKMA 4AQCA 4N57A 1FMKA 4V0GA 4DFUA 3QUDA 5KMMA 5AFVA 4AZWA 4ZTQA 4FNZA 4PMTA 2FGIA 4I6BA 3MESA 2O64A 4EK6A 3ZM4A 2R64A 3VBYA 2G15A 3GCPA 5JZJA 3DA6A 3AGMA 4HYUA 3IW5A 3W10A 4DG3E 1QPJA 2YLFA 2XK4A 4R3CA 5BUIA 4EOJA 4QMQA 4CKRA 4R7IA 2CNQA 4YBKA 3BGZA 3QKLA 3Q52A 5IQBA 3O96A 3EQCA 5EDQA 5IMEA 4JG6A 3KRLA 3L9LA 4PUZA 4KS8A 4R3RA 4J7BA 2FVDA 4DF3A 3ZRMA 3FYJX 4S33A 2VD5A 4HNIA 3GNIB 3PJ1A 4BI0A 2ZDUA 3SQQA 3P5KA 4GG7A 5GZ8A 1H0VA 3I81A 1JSTA 2BTSA 4A9YA 3ZEPA 2WQOA 3FHRA 5IUIA 4ENXA 3E8DA 1Z5MA 3BV2A 3LW0A 4J52A 4FTUA 4BY9E 4XLIA 2CGXA 5C03A 3IGOA 4MEDA 5JFSA 5KMIA 4YU2A 2V7AA 4FV7A 4YR8A 3KXMA 1CSNA 1KE8A 2C1AA 4BKZA 2OJJA 4LRMA 3K5UA 3U54A 3PIXA 5IZFA 1Q8YA 5CAQA 4EHVA 3TXOA 3H10A 3PIZA 2R3NA 4ZTRA 4CCBA 3ORNA 2WU7A 3D4QA 4ZTNA 4BIEA 3ORKA 5D41A 3CC6A 3FV8A 3OWPA 4WUAA 2H6DA 1GIHA 5E1EA 2F4JA 2BALA 3R8ZA 5CT7A 4O91A 1NXKA 5JMSA 5EW9A 4BCQA 4D2SA 2I0YA 4M67A 4FEWA 4KKHA 3V5TA 2YN8A 2QO9A 4O27B 4PL5A 4DH1A 4K2RA 4EH7A 1Q24A 4Q9ZA 4BCKA 5IH5A 3RZBA 5EQEA 2CMWA 3C5UA 4KSQA 3THBA 5IG1A 3UODA 4PDYA 5E92A 4L46A 4Q9SA 3DCVA 3PP1A 4ZSEA 1IA9A 4FKVA 5IQFA 4TKSA 5CZIA 4DH3A 2YISA 3LFCA 3RINA 3PYYA 1CKJA 3DT1A 3I60A 3QZFA 3DV3A 4RQKA 5A4TA 3ZONA 2YWVA 5BYLA 4XBUA 2ITWA 4NTTA 4BCGA 3P86A 4XMOA 2QI8A 3AMAA 3VS4A 2XM8A 3NCZA 2IZUA 4NH1A 2XK6A 3RM7A 4D9TA 4IVBA 3LQ5A 5AAEA 5IA3A 5IUGA 3TUCA 1OL2A 2OIQA 4IMYA 4YNEA 3ZFXA 4X3FA 5EM8A 3RM6A 3LM0A 3R8VA 2WQEA 3OTUA 2I0VA 3ZYAA 3P1AA 3PTGA 4AA5A 2WELA 2WHBA 3HMMA 3NUUA 3ZFMA 5JRQA 1O6KA 4W4YA 5DEYA 5BVNA 2G01A 4HVSA 1WVWA 3FLWA 3D15A 4Z3VA 4WO5A 4YHJA 4BGGA 2OXDA 5CF5A 2WFYA 4FTNA 5IEVA 3TWJA 5CEMA 1YWNA 3BGPA 5F20A 4ZJVA 4ZLYA 5EQYA 2HAKA 2BZKB 3KN6A 4DITA 5C4KA 3H9FA 3VAPA 3VJNA 5KBQA 2XKFA 5KHXA 4LMUA 3OEFX 4OUCA 3LMIA 3UMWA 1JKKA 3VF8A 3CKWA 5J1VA 5E8VA 2HYYA 3F2RA 4ZJJA 1XJDA 1NVRA 2ACXA 5ETFA 2GMXA 3PSDA 5EYDA 2C6OA 2PVMA 2J0JA 2YJRA 3QCQA 4FT7A 4GCJA 3TI1A 4EK8A 5JN2A 3LE6A 4C35A 2CLXA 4G31A 4V0GB 3RNYA 3CJGA 3MB6A 3IW8A 2XH5A 3U8WA 3R2YA 4TT7A 4U44A 3NIEA 3QRIA 4U9AA 3F9NA 2Y0AA 1XWSA 5IQIA 2XA4A 4IAKA 3ZU7A 3TIYA 3SG9A 5EM5A 4C02A 3HUCA 3TJCA 1IRKA 3D0EA 5TOZA 2B53A 4X6QC 4M14A 3DXNA 3IECA 1KE6A 5JK3A 3VHEA 2CNUA 4DEGA 3C1XA 1FOTA 2R3GA 3NWWA 1PKDA 4FKRA 3ZLWA 4C57A 5HZNA 3AD5A 4M69A 3WZKA 4GL9A 5KUPA 3BEGA 2KTYA 2R3OA 4QMYA 2VTJA 2W99B 4BDIA 3W1FA 5LMBA 2BIYA 1W7HA 5H9BA 4YJTA 4CT1A 4DFLA 3S00A 2WOUA 3ZLXA 4X0MA 2IN6A 3WE4A 3FL4A 4F9WA 4UMPA 3PZEA 3D7TA 1ZZLA 4RIXA 4ITIA 4AW2A 3POZA 3QRJA 3IW6A 3KCFA 2YCQA 5AP7A 4OLIA 3QU0A 2X8IA 3EQIA 4N6YA 3U6HA 2QKRA 5AR4A 4R5SA 3UYTA 3VC4A 3NDMA 3L9PA 2FB8A 3LZBA 2ITYA 4FV4A 1H01A 4G3CA 5AJQA 2IW8A 4EUUA 2GQSA 3CQWA 4QMNA 4YZBA 5HCZA 2I6LA 2WQNA 3LCTA 4I6HA 1STCE 4QTBA 5D7VA 3E87A 3NCGA 1F0QA 1L3RE 3BU3A 4F7JA 3HMIA 3BE2A 5HE0A 1YHWA 3A4PA 1JBPE 4G5PA 4MWHA 3ZO4A 2QHNA 2X4ZA 2YERA 1S9JA 4FZFB 5HBJA 1AQ1A 2XVDA 3QYWA 4O6LA 3D2KA 2C47A 4Q2AA 4QYFA 4JDHA 3TV4A 3UOJA 4FZ7A 4EC8A 3WI6A 1JQHA 1URWA 1YOJA 1WBVA 3DJ6A 5FEQA 2I1MA 3R8MA 4FL3A 3JXWA 4O2PA 3VHKA 4E8AA 5L6PA 4HVHA 4IFGA 1H1WA 4F63A 4YJUA 5E7RA 5HVYA 4IADA 4XHKB 3ZRKA 5BUJA 1OPLA 3SHEA 4QNYA 2GFSA 4EHEA 1W82A 4Q5HA 3II5A 3PLSA 2GPHA 3COHA 3NW6A 4OTGA 4IXPA 4BGHA 2OJFE 3FQSA 3DKFA 3KN5A 4IVAA 3OW4A 1U5QA 3FSKA 4YJRA 5AV1A 4D4RA 2PZRA 4YJOA 4FT3A 4U79A 1FPUA 1TQMA 5CI7A 5LXMA 5EHLA 4BCNA 2JITA 3RALA 5E8YA 3QQLA 4FUYA 4FX3A 1SMHA 1YHVA 3MFTA 2A0CX 4FKIA 3RHXA 3V5WA 3VRZA 1R3CA 1MP8A 4BCOA 5DH3A 1OB3A 3P9JA 4CKJA 3RK7A 4QP1A 4U45A 4EHGA 4O2ZA 4X3FB 5HCXA 5HTBA 4E1ZA 1V0BA 4YNOA 4I4FA 2VTTA 2AC3A 2YIRA 3LVPA 4WSYA 3ZEWA 4WKQA 2R3IA 4FEVA 4RVLA 1O6YA 4II5A 5CWZA 4BYJA 3BQRA 3IDPA 4CNHA 2XF0A 3DS6A 4QQTA 4NYEA 1EH4A 3VW6A 4UYAA 3RGFA 3D7ZA 1OZ1A 1H07A 3G51A 4A4OA 4BBFA 3E3BX 3QYZA 3ELJA 3W55A 4TYIA 3LXPA 4MF1A 4YSMA 1H1QA 4FT0A 4HGTA 4DEIA 4GSBA 3RVGA 2CGWA 5E8WA 3R83A 4CTBA 4OTWA 2XCHA 3GEQA 4AE9A 5FEEA 4BTKA 5K0KA 4F7SA 4K9YA 4IB1A 2AUHA 2ITQA 2WEIA 3ZCLA 5AUTA 1OGUA 5CNNA 4D58A 1BYGA 4F08A 3L8VA 4WT6A 4IAIA 2W05A 4IQ6A 4RJ4A 5DBXA 4OBQA 1YWRA 3COKA 1DAWA 4I5CA 1S9IA 4BDJA 4ZP5A 1Q8TA 1ZMUA 4OTIA 3V8SA 2EVAA 3HV5A 5KCVA 2BRHA 2WMAA 1TQPA 4NKSA 4WBOA 1G8SA 3HNGA 4FKTA 3PA3A 4EZ3A 5EKNA 4P2KA 3Q4UA 4V04A 3PY1A 3OBJA 4XG3A 4JS8A 1OKZA 5GZAA 2P2IA 3LCKA 3D14A 3BHUA 4M69B 3DKOA 3C4XA 4ERWA 3PP0A 4FZAB 5I0BA 1JAMA 2W17A 3I6WA 3PSCA 4O7SA 2PVKA 2WMXA 4LOPA 3RHKA 5HX6A 4IACA 5JKGA 3LMHA 4ANMA 3HGKA 3W2PA 1SYKA 3DBQA 1ZOGA 1OL5A 3UG1A 1BUHA 4ASDA 3F2AA 1G8AA 3D7TB 4G6OA 4RIXB 5DHJA 3NUAA 2F2CB 4GUBA 2QNJA 4DBNA 3G2FA 4H39A 1UA2A 3MPTA 3LPBA 2IW9A 1Q62A 3OOMA 5AR2A 2QU5A 4HCTA 2W1CA 4YO4A 4JL9A 3AQVA 4QYGA 1O6LA 3PVUA 1PY5A 3M2WA 4JBVA 4BTFA 5CEKA 3VBWA 2BILB 4O6EA 3O0GA 4FTCA 4LM5A 3RZFA 4KUJA 4EJ7A 3OXZA 2UW8A 5DT0A 4RC4A 4YZMA 2JKQA 4DFZE 4M68A 5JFVA 3TKUA 5IQDA 4CSVA 3OUKA 4PP7A 2W0JA 4ARKA 5LVMA 4QMZA 2NRYA 4TYEA 4E5WA 4Z7GA 3F3ZA 4EORA 4EYMA 5AAGA 4X6RA 2JAVA 4BDCA 2X6EA 4B4LA 4H05A 3D5VA 4LOOA 3EN9A 3ZC6A 4EYJA 1IR3A 3GB2A 4U41A 3QBNA 3OFMA 5DOSA 4YMJA 4NW5A 2GNGA 4IAZA 4LMNA 4NEUA 4WD5A 2Y4IB 3KC3A 3GC8A 2X4FA 3QTXA 5FQDC 4AW5A 2V62A 2ZB0A 5AP1A 3KKVA 3KXNA 2JGZA 3RPYA 4IWOA 4MWIA 3MVHA 4HPUE 4TYJA 4AE6A 4H1JA 4YTCA 4ZY6A 3CBLA 2F9GA 4USEA 4H36A 5IA4A 4WG4A 3GU7A 4FG7A 3LKMA 3LFAA 2IVUA 2XNPA 4QPMA 4HVIA 2XK7A 3R01A 1NVQA 1B39A 4IJ9A 3T3VA 2VTLA 3C9WA 4DE4A 4JIKA 3SLSA 4IAFA 1QL6A 3AC2A 4B0GA 5AP4A 4P5ZA 3D5XA 2VWVA 2C6KA 4OBOA 3VS0A 5TT7A 3H0YA 5M4IA 3ZSGA 5C8NA 5HE2A 1XO2B 4GVJA 1SVHA 3FZPA 3MH0A 4TYHA 3GC9A 4I5MA 1A48A 3V5JA 2OI4X 5EM6A 4D0XA 5IDNA 1IASA 3UMXA 5FP5A 3IONA 3TUDA 4DINA 4G3GA 1U5RA 4EH8A 1M52A 2YM8A 2PSQA 2QG5A 4K0YA 4B7TA 4W8EA 5BVKA 5HO7A 2B0QA 2ZVAA 1NVSA 1XBCA 3UNKA 3Q04A 4UBAA 4CFFA 1BL7A 4XUFA 2YABA 3O50A 4FVRA 3IW4A 3MBLA 3Q9WA 5EYCA 3FZ1A 2RIOA 4PMPA 1IAJA 2BUJA 3TKIA 3MPMA 2EXMA 3DY7A 4S31A 4MQ1A 5DVRA 5JT2A 3DU8A 4RC3A 4IX5A 1AD5A 3D2IA 5IMXA 4Y8DA 1E1XA 3BCEA 4U8ZA 3UNZA 5BYZA 3UQFA 2BZHB 4Y46A 4BC6A 2V55A 3WYXA 3PY3A 4GK4A 4D2TA 3QHWA 4GJ2A 4HGEA 3IOKA 2ITZA 5HO8A 5L8LA 3ULZA 3C4ZA 1UV5A 3R9OA 3GUBA 2XK9A 3FYKX 2UZLA 4RJ8A 2E2BA 5T68A 2FUMA 2C6DA 1OIUA 3GGFA 4QMSA 4UZHA 4LV8A 2HW7A 2I0EA 2H8HA 1E9HA 1HCLA 1QPCA 3QTQA 3RPSA 2HY0A 5LVPA 3F3VA 2B55A 3FUPA 4ZSLA 5L6WL 2BRMA 4IB5A 3CR0A 3QA0A 4PL3A 2XYUA 5J7BA 5DR2A 2UZDA 1YDSE 2VUWA 5AP3A 3BGQA 2BROA 2RKUA 3Q9ZA 3EKNA 1FQ1B 3TACA 3WF5A 3EOCA 3A8WA 4FTAA 5AX3A 3E5AA 2QOQA 3IOPA 5CNOA 4QQ5A 4XG2A 4EUTA 5FXSA 1M2PA 4NU1A 4ZSJA 3ZUVA 1BI8A 1HCKA 2HCKA 4U42A 4XOYA 1VYWA 1VJYA 4XV9A 5DG5A 3MWUA 5I9ZA 1OUYA 3EWHA 4C61A 5L8KA 3WOWA 4ZTMA 3AG9A 4FTMA 2P0CA 4L68A 5FRIA 3NNUA 3MFUA 2GS2A 3EL7A 1PMVA 2ITTA 3OVVA 4PL4A 4IANA 2I7QA 4EBVA 5DI1A 2XNEA 5C9CA 2CCIA 3F69A 3VNTA 4BTJA 3HA6A 5A3XA 1BI7A 3CTHA 4O0WA 4G9RA 4AFJA 5AV3A 3V04A 4M66A 3RBWA 3WF9A 4KS7A 3KVXA 4O7LA 1XH5A 1YRPA 4B8LA 3KREA 2XNBA 4FYOA 4XG6A 3NW7A 4TWOA 4XOZA 3PIYA 3NUNA 4I4EA 4FV3A 4FEUA 3COMA 4MD8E 2YDJA 1OL1A 4CMUA 5DYJA 4AX8A 1ZYSA 2ESMA 3SXSA 3C5IA 2W1FA 1FINA 3VQUA 3TCPA 2Q0BA 2JIVA 4F9AA 4C59A 5L4QA 4C4GA 3HDNA 4W9WA 4O83A 4M12A 2B4SB 1M2QA 1BX6A 2QURA 3LXLA 4YHTA 2OWBA 4DFYA 2YCFA 3G6GA 3MGYA 3QD3A 2XNMA 4ZSGA 3WARA 4C38A 1WBWA 4EH3A 5I3RA 4ACMA 3RAKA 5AM6A 3UQGA 5L6OA 4O7YA 4U5JA 4GU6A 5BNJA 4H1MA 3GU6A 4I22A 4EOSA 2JAMA 3OWKA 4D28A 1YI6A 4HNFA 3R7IA 3AXWA 5J5TA 2E9OA 3GU8A 3LCSA 5DR9A 2NPQA 5LARA 2OF4A 3ZBXA 3MA6A 4NM7A 4TYHB 4FKGA 4XH6A 2WIPA 3UPXA 2R0UA 4BBEA 4U3ZA 5HD7A 4BI2A 1OBDA 4FODA 4KNBA 4H58A 2CDZA 3ET7A 4YJPA 3CJFA 4DEBA 5FTGA 4ASXA 4MBJA 4UWCA 3EYGA 1GZ8A 2ZV8A 4UXLA 4RWIA 1NY3A 1PXMA 3I79A 5C8MA 3RJCA 5J95A 2DS1A 4X2KA 4QTAA 4IWPA 3BV3A 3ZO2A 3JR1A 2O8YA 3H3CA 4I5PA 5AUYA 4M15A 3NR9A 4O96A 1B6CB 1TVOA 2EUFB 3TNHA 3C4FA 5CF4A 3HX4A 3UVQA 4O7RA 2PE0A 4GT4A 4RVKA 5AEPA 3OZ6A 2OGVA 5FEDA 3D83A 2Z02A 3L9NA 5AUXA 3UOLA 4BYIA 5KKRC 4RVTA 4WIHA 3AGLA 3IDCA 4DT8A 1UKHA 3OCBA 3PXQA 4YLJA 3PVGA 4HYIA 3ENMA 3QXPA 4I20A 3HUBA 1UU3A 2JBOA 4WBBB 2DYLA 3BHVA 3PPKA 4MXAA 2PYWA 1JLUE 2W5HA 2CPKE 5HIBA 2QD9A 2QR8A 4RLLA 4M13A 4ZAUA 4JX7A 1PJKA 2XIXA 4GFMA 3FDNA 4QPSA 3DBDA 2RG5A 4EH4A 4JRVA 4PDPA 5AP6A 3JPVA 1ZXEA 5L2WA 4GV1A 1SVGA 2C5VA 2I0HA 5E8ZA 3BWFA 2UW9A 5M51A 2VX3A 2RF9A 1OBGA 4IZYA 1OKYA 2B1PA 3R1QA 2UW6A 1LR4A 2ZB1A 2W1ZA 2A2AA 3JS2A 4FKJA 4RX7A 3UZRA 2X2KA 3C51A 1XKKA 4JBQA 4IW0A 4MH7A 4QOXA 3LLTA 4BDDA 1F5QA 4HCVA 5K0XA 3VVHA 3FLYA 1JPAA 4LOQA 3KXHA 4C4EA 4EQCA 4AZFA 3VS1A 2BFYA 3FL5A 4RIYA 4F9BA 3R7EA 3D94A 1M2RA 1JOWB 5HG5A 2ZV7A 2P3GX 4KIKA 4FZ6A 5JQ5A 3DBCA 3QFVA 4GK2A 3FSFA 4QO9A 2YCSA 5JGDA 3PG3A 3QC4A 2VTNA 3CKXA 4IM0A 4FKSA 2XKDA 3TNIA 3CPBA 3NIZA 4K77A 2R3HA 4HGLA 2BFXA 2RL5A 2X1NA 5CZHA 5HBHA 4E20A 4LRJA 3TUBA 2J7TA 3PXFA 3C4CA 4GKHA 1R78A 3MVMA 3C0IA 2PZ5A 4Q5EA 2G2IA 4BCIA 2WTKC 3VN9A 4A4XA 2ZMCA 3KRXA 3MIAA 3V6RA 4RJ5A 5LCKA 3NUYA 4G3DA 5LJJA 3HV3A 3EQPA 3FMLA 4UZDA 4YZ9A 3TNWA 2YM5A 4APCA 5B2MA 4EOLA 4F1MA 3U55A 4L45A 4DCAA 3OT3A 4DG2E 3MTFA 3SA0A 4E4LA 2QOFA 2PL0A 3FMKA 2X7OA 3BYUA 2ITVA 3R9NA 4CTCA 5L3AA 3A99A 3F3UA 4J98A 3VBQA 2BHEA 3AC1A 4UALA 5HIDA 4YC6A 4CRLA 3W16A 1OI9A 3FI4A 3AOXA 3FJQE 1H1SA 2C5OA 3ZZEA 3QD2B 4YJVA 4A9SA 4FA2A 3IGGA 4BHZA 5JQ8A 5GJFA 4BICA 2YHVA 5BMMA 4AN9A 3OXTA 3EKKA 3V8WA 3DZQA 3CSVA 2IWIA 1UU8A 3RCJA 3ZLSA 3HRBA 4X2FA 3SV0A 4DH8A 2G1TA 2X6DA 3VIDA 5BVFA 4JQ7A 4O84A 4LUDA 3SG8A 5I5ZA 2XBJA 3EJ1A 3I6UA 3UIUA 4FL1A 1GZKA 4J99A 2QOOA 4JR7A 4GKIA 4UWBA 2XCKA 5EM7A 2BCJA 1YQJA 4DTKA 5CXHA 2OK1A 3QALE 1U54A 2A19B 2G2HA 3WZUA 4DEEA 2WNTA 1NT2A 1IG1A 3HV6A 3EIDA 2OFVA 4G34A 5ANKA 4IDTA 3A60A 2C69A 3EFJA 5KNJA 1XH4A 4CFMA 2QLUA 3IQ7A 3QRTA 4JT3A 1OVEA 2XS0A 4K18A 1L8TA 2ZYBA 5FD2A 2OJ9A 4I23A 3EN4A 3ZM9A 1RE8A 2DQ7X 3DB6A 1RJBA 3IK3A 1R0EA 4FIEA 4BWKA 5CENA 3SOCA 3OT8A 1IA8A 3R2BA 3OBGA 5D12A 1OL7A 1Q8ZA 5IPJA 4C7TA 2XIYA 4AS0A 2IVSA 5BYYA 4FTQA 2ZMDA 4BIDA 5KX8A 2QOBA 2VO0A 4XG4A 2WD1A 4ZS4A 4RT7A 2XNOA 4FK6A 5IQAA 2R7BA 2R3PA 4JI9A 4F6UA 3PXZA 2WZJA 3PSBA 4RWLA 3QA8A 5BX0A 3R1NA 5EG3A 1YVJA 2VTSA 4EK4A 5BVDA 3EFKA 5LQFA 2Y4PA 4TYGA 4XG7A 3HKOA 4FTTA 3WF7A 4OGRA 4PTGA 2Z7SA 4O1PA 4CEGA 4IZ7A 4BBMA 4F1TA 3F3TA 2PY3A 3M11A 1YDTE 4XP0A 3WZJA 4XX9A 4L3LA 3C13A 4U43A 4DLJA 4FV1A 3UIMA 4BCFA 5ITAA 5H8GA 4CG9A 4QTEA 3FC1X 3QD0A 4EOPA 2G2FA 4F09A 2J5EA 4OAUC 3R28A 1ZYJA 3L9MA 4J71A 4QMTA 3ID6C 2YM4A 1ZZ2A 3N4VA 4AAAA 3DAKA 3LM5A 4AOIA 3G0EA 2C68A 4IAAA 4RIYB 4DGMA 4F0FA 4A9UA 3LJ0A 4YHFA 5EI6A 4JQEA 4S2ZA 1FBNA 1WZYA 1VYZA 2RFNA 4JAJA 1J7LA 3BYVA 1G5SA 4S30A 4YPSA 3DXQA 4KIKB 2J9MA 1V0PA 2VTIA 3QTSA 5CU0A 4G3EA 4E26A 4BGQA 4WG3A 4BFMA 5LMKC 2P33A 2VGPA 2W4OA 3ZSIA 3T9TA 4E6AA 4BDBA 4IHPA 4O0VA 3TZ9A 2EXCX 2WAJA 4HZRA 1VEBA 2BMCA 2FSTX 4MF0A 5B2KA 4DT9A 3FBVA 4O22A 5FDXA 2C3LA 3OY3A 3ZLYA 3N51A 2BAKA 1XH6A 2W1HA 2GHMA 2JKMA 3E7VA 5AUVA 4BI1A 3NUSA 4EQUA 4J8NA 4M97A 4GW8A 1F3MC 4U80A 4JDIA 2J50A 2DWBA 4JG8A 1XHAA 4FF8A 1Y57A 4FE2A 3NYOA 4KINA 3LQ8A 2VN9A 3WYYA 3S0OA 1M14A 3DTWA 4FV9A 2IJMA 4HPTE 2VTRA 4XG9A 3V51A 2W9ZB 4FIFA 3EMGA 3E7OA 2HZ4A 3CTQA 4HGSA 2B9IA 2HXLA 4F0IA 4XYFA 3CIKA 3QGYA 3BHTA 4DCEA 5DPVA 5G6VA 5JRSA 4BKJA 4D4VA 3OY1A 4FNYA 1WFCA 3Q5ZA 5EI2A 2IPXA 2E9NA 2QU6A 2F7ZE 5CU2A 3E88A 3UOHA 3ZXZA 5AR5A 4RX5A 4EH9A 2YJSA 5E9EA 4HVDA 1GJOA 3FI2A 2W9FB 1H26A 4N70A 4DFBA 5CVHA 3EFLA 3CY2A 4NCTA 3QWKA 2OIDA 4I5HA 1W0XC 2EB3A 2VTPA 5HICA 2VWUA 1U54B 3MFRA 5EH0A 3D9VA 3G9LX 3IW7A 2VO6A 1ATPE 3JY0A 4FYNA 3NZ0A 4J8MA 3TV7A 4W8DA 2PVLA 2C6MA 4AFEA 1ZMWA 4PRJA 2O3PA 4DGGA 2VTMA 2W96B 3QQUA 1U46A 4Y5HA 4V01A 3UE4A 3VS5A 5AA9A 5HVKA 1V0OA 3NEWA 4ANBA 3ORIA 3RAWA 3UO6A 2YEXA 4Z7HA 4CZUA 2QOCA 4FOCA 2JFLA 3R0TA 1W8CA 2CGVA 4BKYA 2PE2A 2RSVA 4FKPA 4EOOA 4F70A 4ZTSA 3VUHA 2A1AB 3PA4A 5JFWA 5HNIX 3Q6WA 4GJ3A 5AV2A 2UW5A 3LQ3A 4FSTA 1FVRA 3HECA 3MH2A 5C27A 3ALOA 4I93A 4BCHA 4C3FA 3C0HA 5L8JA 4BCMA 3DZOA 3GU4A 4OR5A 1UVRA 3OROA 2BAQA 5ETAA 4ZSAA 3K2LA 5DIAA 5GINE 4DH5A 1H27A 2IVVA 3TZMA 4K1BA 3MY0A 4YZCA 4KIPA 4D5HA 3OP5A 3AT3A 5E1SA 2VWIA 2OXYA 4C4IA 4EHZA 3HAMA 5D7AA 1J91A 3GOPA 3NW5A 1WCCA 4EJNA 2OLCA 3CQUA 4I21A 3FMHA 3I4BA 4TRLA 3W2SA 3F61A 2F2UA 4JRNA 2BDWA 3PWYA 5HOAA 2PUPA 2CKPA 3FZOA 3SXRA 2JEDA 3VUDA 4CFVA 1XH9A 4E5BA 4EH5A 2QLQA 3K3IA 3MSSA 4LRKA 2PVNA 4RA4A 5HE3A 4ANQA 3OUNB 5CAPA 2WTVA 3FKLA 4W4XA 3VUIA 3ZS5A 4ACHA 4BWXA 5LVOA 4ZK5A 5TE0A 5D10A 5CAUA 5H8EA 5EDPA 1PXLA 1T45A 3BELA 4NKAA 5M4UA 3W33A 5KMKA 1E1VA 2ZV2A 2X2MA 4IC8A 4ITJA 4L7SA 3TNPC 3UC4A 2VZ6A 2GCDA 1UNGA 2REIA 2F7EE 2YZAA 3PFQA 5FTOA 2QOKA 3T8OA 4UX9A 2WMBA 3F7WA 4TZRA 5AP5A 2NNWB 1H28A 3PRFA 5KZ0A 3OS3A 1YKRA 4NSTA 3BQCA 3BBTB 4PY1A 4JJRA 1UKIA 4TNDA 4MXXA 1XR1A 4KRDA 5HESA 1PXNA 2HWPA 4F9YA 4OT6A 3VBTA 2GS6A 4N6ZA 2WTCA 4C36A 2WTDA 2XIRA 5CQWA 2YIXA 2PK9A 4LYNA 4AN3A 4BB4A 1OL6A 1Z57A 2ONLA 4MBIA 4DGNA 2OF2A 1PXJA 4D2PA 3VRYA 3ZMMA 3DAEA 4FBXA 4EL9A 4EOMA 5F94A 2PMIA 1FGKA 2WEVA 3FE3A 3S95A 1QPEA 4O0UA 1Y8YA 5AMNA 5DE2A 3GFWA 4C3RA 4R3PA 4KAOA 4XV3A 3QHRA 4I3ZA 4YUQA 3O71A 5IQGA 3R7YA 4DH7A 2JKOA 5DMZA 5HLNA 4UMRA 4S32A 5JEBA 2VAGA 3VQHA 4CYJA 5HO6A 4ALWA 4D4YA 4YZNA 5AAFA 1T46A 3CEKA 4RFYA 2PUIA 4P90A 1Q3DA 4ERKA 1KUTA 1GZOA 1UWHA 2EU9A 5I9UA 4FUXA 4OTDA 3BX5A 1H24A 4IVCA 1W84A 5DN3A 2HIWA 2C5XA 2VTHA 5EW3A 3BKBA 4EBWA 2C30A 5JH6A 4IVDA 4ENYA 4F64A 3Q4TA 4QYEA 2QOHA 4QP8A 2W5AA 3MYGA 3Q60A 4QMUA 5CT0A 4R7BA 4L44A 3O7LB 4EQMA 1ZOHA 4FKLA 2YAAA 4E4XA 5GIOE 4FKWA 3EQFA 4ANLA 3Q3BA 4DFXE 4GVAA 2BRBA 2JKKA 2VWZA 3MS9A 4I0SA 2GQGA 3EH9A 4TWNA 2X8DA 4O81A 2C0OA 2OKRA 3QL8A 3E3PA 4B9DA 1R0PA 2HOGA 2XJ1A 3DNEA 4FSYA 3VUKA 4O7VA 2CGUA 2UW0A 4FSQA 1YOMA 2LAVA 4AT5A 3WIGA 2J0LA 3LFEA 2W4KA 4DAWA 4FNWA 5FM2A 4FV8A 1KWPA 2HELA 3BYOA 1PRYA 2H34A 2VTQA 4LV5A 4CCUA 3KRJA 2VGOA 5AUWA 5HU9A 5E4HA 2WTJA 5TR6A 4G1WA 3VBXA 5HNGA 5M06A 3FZRA 2Z7LA 5M4CA 4EEVA 1YWVA 4ITHA 1K9AA 1WVXA 3S3IA 4B8MA 4HCUA 3TN8A 4QP4A 5FBNC 4FTKA 2XUUA 4D2VA 2O0UA 3MI9A 4FTJA 1CMKE 3ETAA 2WTIA 3GBZA 2ITXA 1KE7A 3QQJA 3VBVA 4FV5A 2AYPA 4LFIA 4NIFA 2O65A 2W4JA 5TO8A 1OECA 1SVEA 4GIIA 2FA2A 2ZDTA 4WHZA 5IA0A 3C7QA 4KWPA 3C50A 5DRBA 3GQLA 3OWLA 4CQEA 5GIPE 3NAYA 3E63A 3AT4A 3KY2A 3MN3A 3P7CA 4MX9A 4PMSA 5LVNA 3P08A 3V6SA 3FMJA 2OO8X 3NSZA 4MTAA 2VX1A 4X2GA 3ORMA 5AADA 2WMVA 2GDOA 5L2TA 2WOTA 3CLYA 4FV6A 4GIHA 3LHJA 5A54A 3GC0A 4XV2A 4GEOA 3F66A 3EN6A 3FMMA 3PPJA 3BU6A 3GI3A 3QTIA 3R22A 3ZFYA 4BCPA 4D4SA 3VS7A 4PQNA 4C4HA 2IG7A 2GTNA 3BEAA 3E93A 3FKNA 5ANGA 2UZWE 3ATSA 4O7TA 3BE9A 3CQEA 2F57A 4ZXTA 5F1ZA 4BZNA 4RWKA 4L8MA 5K9IA 2W1EA 2KULA 2ZAZA 2X39A 2YWPA 4RFZA 5E90A 3Q4ZA 4H3QA 3E8NA 3DDPA 3PWDA 3W2OA 2LGCA 4U40A 4AW1A 4IM2A 3FWQA 2UZVA 4KIOA 4APPA 3R02A 3DXPA 2WB8A 1UNHA 1H0WA 3AC8A 5AR3A 1PKGA 3P4KA 4U7ZA 5FBOA 3CGFA 1FMOE 5A6NA 2B9FA 2HK5A 4M7IA 3V3VA 3WILA 4LI5A 4QP3A 3SX9A 1FVVA 3IO7A 1LP4A 2J0KA 2GS7A 2UW3A 1GIJA 4JBPA 4XP2A 2Z2WA 4L67A 3ULIA 5AR7A 5TKDA 3JVRA 3I1AA 3UC3A 4ZZOA 4Y5QA 4D1SA 2YDKA 2VNWA 3EQGA 4BCJA 2GNHA 1DS5A 2OXXA 5DA3A 4FSUA 3KMUA 3QRKA 3D5WA 4NWMA 5AX9A 2PUUA 4AWIA 4BVUA 3BWJA 3P23A 4GFGA 3KGAA 3BI6A 3SKCA 4AP7A 4DTBA 2X9FA 5FWKK 3C4WA 2WIHA 1U59A 3FLNC 5CU3A 3DBEA 3ZH8A 4JVGA 5HBEA 4EI4A 4FT5A 5CLPA 3ZO1A 5IU2A 1NA7A 2PVYA 3LFBA 4CMOA 5JZNA 5A4QA 3S2PA 3BLQA 5M08A 4GH2A 3QZIA 2C6IA 2E9PA 1JNKA 5JGBA 4C62A 3VWAA 3BLRA 1ND4A 4I94A 4B6LA 2CSNA 5HTIA 2CCHA 4IB0A 4EOIA 4RFMA 3C0GA 3ALNA 4YLLA 5I9XA 4OBPA 1A06A 4RZWA 4JLCA 4CGAA 4R5YA 2QVSE 3B8RA 5HEZA 3KRRA 3UPZA 3DK3A 2UZEA 3DJ5A 3P7AA 4FZDB 5DGZA 4EZ5A 3ZTXA 3N4TA 3HP2A 4EWHA 4XRJA 3UVRA 5H8BA 1XH8A 4EKKA 2OFUA 3SDJA 1RDQE 3KRWA 3GCQA 2UW7A 4FKUA 5FLFA 5I9YA 3ORLA 1XBAA 4FG8A 3S1HA 1CTPE 1IEPA 5FGKA 3U4WA 3CTJA 1FGIA 5KBRA 4PX6A 3UJGA 3ZC5A 4TTHB 5K5XA 4M0ZA 4DYMA 4J53A 3ACKA 3TIZA 4NIFB 3VJOA 3PUPA 4E3CA 5CASA 2OH4A 4IC7A 4ID7A 4QRCA 4O0TA 1YXSA 3DLSA 3NAXA 3WZEA 4FSRA 3RNIA 1ZLTA 3MVJA 3RCDA 4CFNA 3CCNA 5EI8A 1BLXA 4ZMFA 3W2RA 1K2PA 1OPJA 3UO5A 1R39A 3R30A 4RIOA 4U97A 2ZJWA 3DPKA 5A46A 3ANQA 2BR1A 5HGIA 3TKHA 4E6QA 3R71A 3TNQB 4KA3A 4FTOA 4CVAA 3LIJA 4GMYA 3VS6A 2BHHA 3BZ3A 4G9CA 4A9RA 3MVLA 3W18A 2VTAA 2UVXA 4FICA 4L53A 3R63A 3KXGA 3PZHA 4HYHA 3FY0A 4PDOA 4QNAA 3CS9A 2ITUA 3RI1A 4BDFA 2E9VA 4EK5A 5EW8A 1XQZA 2PE1A 3PXRA 1UU9A 3UZTA 1Y91A 3JY9A 1J1CA 2W7XA 4GYIA 4Y85A 5AIRA 4QPAA 2QO2A 4QQCA 3DKCA 3HZTA 3SC1A 3F88A 4AGUA 2VWWA 3QKKA 5LCJA 2QQ7A 3A7JA 3HMOA 4ACGA 4AZEA 2Y6MA 3QQHA 2UVZA 3NYXA 4C8BA 3R7GA 3Q6UA 4USDA 4TW9A 4UWYA 3LOKA 3AC4A 5CVGA 5HIEA 1M7QA 3UOKA 2VV9A 3O8UA 3QLFA 3MTLA 3GU5A 4UMQA 2PU8A 3RKBA 1I09A 3MB7A 2J2IB 4WNKA 1WBSA 4UYNA 4AN2A 3B8QA 3PXYA 2UW4A 3TTIA 4CV8A 4FMQA 1V1KA 3DNDA 4IX4A 5CANA 2YM7A 2PVHA 3T3UA 4A9TA 3QD4A 2WMUA 4FIHA 1YOLA 4W9XA 5BVWA 2Y8OA 3TTJA 3SXFA 4KB8A 3PY0A 4OTFA 2J0IA 2E9UA 1JSUA 4RBLA 2UZUE 2QOLA 2V22A 4O0RA 3UVPA 2X8EA 3MY5A 4YSJA 3MH1A 1YHSA 4NM0A 2XRUA 5AIKA 2UZNA 4LG4A 3UO4A 5BVOA 4TXCA 3FXXA 1PMNA 3CXWA 4GT5A 3TG1A 4ZY4A 5FDPA 4L3PA 3ZUTA 2ITOA 3HRCA 4DA5A 5J9ZA 4IEBA 5ACKA 4AACA 2XIKA 3MW1A 2BZJA 3FY2A 4YP8A 2OZOA 4DBXA 3FZTA 4R7HA 4TL0A 4CFUA 4ORKA 4YGAA 2IZTA 4M84A 1G3NA 2W1DA 2WMTA 4L6QA 4AZTA 1ZRZA 5IDPA 4C2WA 2SRCA 3M42A 4ZY5A 1PXKA 3SOAA 5GNKA 4NK9A 5FM3A 3U6IA 5AV4A 2Q0NA 3ZRLA 2BRGA 2BZIB 5KKRB 4GU9A 1Q4LA 3DAJA 3RPOA 3ZXTA 3VS3A 2R3MA 3I0QA 3MDYA 3QRUA 4ALVA 4HVGA 4F6SA 2IZRA 2B54A 4IZAA 4O82A 2W5BA 2C3JA 2JDVA 3KQ7A 5L2QA 5J7HA 2CN5A 2ETRA 3QF9A 5A4CA 5CS6A 3F2NA 4L42A 4A7CA 5M07A 3I5NA 4QYHA 4A4LA 1YW2A 1Q61A 3QTUA 3ORTA 5KMLA 3BU5A 1BMKA 3QAME 4PDSA 4D1ZA 3FMDA 2F49A 4DFNA 3KEXA 5CSHA 5DT4A 3VS2A 3BRBA 3P78A 5FG8A 5EHOA 4AU8A 4ZMEA 3W2CA 3A62A 2YCRA 4G3FA 1PMUA 4PV0A 4X2JA 3EHAA 3ORXA 4I1ZA 2RFSA 4PMMA 3HP5A 3I5ZA 2OIBA 5FXQA 4EOKA 2FSLX 4FSNA 2PTKA 2YM3A 5E8SA 2JDSA 4OTPA 2GNLA 2XZSA 4GK3A 3ROYA 3UZPA 3PRIA 4FNXA 3PJ3A 3EQDA 5KZIA 4ALUA 1JVPP 5BQ0A 5GHVA 5CF6A 5EHYA 3V5LA 2WPAA 5KMJA 2RFEA 5IQCA 3GT8A 3UQCA 3QKMA 2PVRA 3B2WA 4I24A 3BPRA 5CU4A 4BDHA 4F6WA 1FVTA 3A61A 2VU3A 5EDRA 3JVSA 5J5SA 2C5YA 1DI9A 1KSWA 3RMFA 3NUPA 1TQIA 3NNVA 3R9DA 2JIIA 1J7IA 3EB0A 5I9WA 3C4EA 3GC7A 1SM2A 5ANJA 3SD0A 3R8LA 2C3KA 4OTQA 4QTDA 2B9HA 2PMNX 1BL6A 2PMLX 3LFDA 5LMKA 3TDVA 1CKPA 2QOIA 3NLBA 4ZLZA 3QQKA 1ZYLA 2PHKA 3PJCA 3WBLA 2XIZA 2RGPA 2XP2A 4YPDA 4AOJA 2ETMA 2GU8A 1OM1A 2XJ0A 4FV0A 5L2SA 5ANOA 5C01A 3BLHA 2WMWA 2WTKB 3SRVA 4BZOA 2RG6A 1KOAA 3DLZA 4O38A 3FI8A 4ACCA 2WMQA 4KSPA 4RLKA 1YXXA 2XKEA 5CSWA 3PPZA 4AZSA 3KF4A 3QCSA 4NFNA 3QUEA 4QMOA 5D11A 5F4NA 2VX0A 4BL1A 5K5NA 5HE1A 1GZNA 4X2NA 5AP2A 3V5PA 2XBAA 4UEUA 2UZBA 3O2MA 1J3HA 2CKOA 3G6HA 5A6OA 4H3PA 3F5XA 2IW6A 2UZTA 5CEQA 1YXUA 2VTOA 3AT2A 3ODZX 3R1SA 4CD0A 3H9RA 4MNFA 3UTOA 5DRDA 3DGKA 2IO6A 5J9YA 3K3JA 4U6RA 4RX8A 5CQUA 5J8IA 4IIRA 3A7IA 1M7NA 3FXZA 4XBRA 4ACDA 4FSMA 4CZTA 3LCOA 5D9HA 3A8XA 3DBFA 4QMVA 1Q8WA 1OPKA 3F6XA 1M17A 4NJDA 4Z16A 3HEGA 1SZMA 3UP2A 5HLPA 3PA5A 3Q9YA 4S34A 4I0TA 4WRGA 2WTWA 2R3RA 3DJ7A 4D2RA 3GCSA 5KMOA 3I7CA 4WOVA 3LXKA 4AGWA 1ZYDA 1UU7A 3O17A 3S4QA 4EOQA 1ZAOA 4KBKA 2W1GA 3CE3A 4FSZA 3R8UA 3TT0A 4RVMA 5HG7A 1W98A 3BIZA 3ZUUA 4A07A 1H1PA 1JKTA 3O51A 3Q53A 1B38A 5LMAA 1MRUA 3AC5A 5ANEA 4ZLOA 3ZOSA 3QZHA 5KHWA 4L01A 2QO7A 1P5EA 3GVUA 3LXNA 4EH2A 4G2FA 4MNEA 2XMYA 3UIXA 1DI8A 3E8CA 3FQHA 3DQWA 1UNLA 3MIYA 4BWPA 3IG7A 2QONA 3HYHA 4Y83A 1H00A 2XK8A 1PW2A 3OXIA 4F0GA 5T6KA 5DLSA 1PHKA 2FSOX 3E62A 1MQ4A 3HLLA 3QZGA 3TDWA 4QTCA 3TM0A 5AV0A 1YI4A 3E92A 1X8BA 1KV1A 3ERKA 2OZAA 4FOBA 4YO6A 2Y6OA 5ACBC 4L9IA 5EOLA 3Q4CA 3FC2A 5IISA 4X21A 3ORPA 4QMWA 3V8TA 4YTHA 3DKGA 4G16A 1WVYA 2C1BA 4NJ3A 4YZDA 5IF1A 2GQRA 3PJ2A 4TWCA 5L2IA 4K11A 4G17A 3LAUA 4GS6A 3LJ1A 4G5JA 4CG8A 2JDOA 2QHMA 3MFSA 3OEZA 3IKAA 3N9XA 3R1YA 2XM9A 5GJGA 3EZVA 1P4FA 3E8EA 4ZTLA 1ERKA 1KOBA 2P2HA 5FTQA 5HI2A 1QPDA 2UUEA 4AGDA 3ACJA 5E8TA 3G9NA 4MVFA 3F5PA 2HWOA 1ZYCA 5B2LA 2YITA 3O8PA 3QC9A 4CXAA 3TL8A 5KE0A 5TF9A 2J4ZA 3KB7A 4WNMA 2UZOA 3ANRA 4JX3A 3PLAE 3V01A 3K54A 3P0MA 1Q99A 5CX9A 1PXOA 3ZHPC 2WGJA 3L8XA 3P79A 4D5KA 2XEZA 4JXFA 3R00A 3GCVA 3VO3A 5J79A 5AUZA 1OIYA 1YDRE 4MQ2A 4MXYA 1GAGA 4IJPA 3PVWA 4FV2A 4QMPA 1ZY5A 4Y73A 1SNUA 4PNKA 4FGRA 1VZOA 3BYMA 4D1XA 5C8KA 4TPTA 2X0GA 1J7UA 5BUEA 4KKGA 3ATTA 4HJOA 4RG0A 4TY1A 2WKMA 3LFFA 2YIQA 4IM3A 3NYNA 1ZARA 4TWPA 4I6FA 3A2CA 5IA2A 2BIKB 4Z9LA 4FEQA 1ZMVA 4FT9A 4EC9A 4EZ7A 1TKIA 2Y9QA 4FIIA 3SRVB 4USFA 5F9EA 3T9IA 4XG8A 2JDRA 3MJ2A 1YI3A 2AC5A 2XEYA 3R8PA 3V5QA 4DC2A 1ZY4A 4GRBA 4AG8A 1A9UA 3KXXA 5AR8A 3SW7A 4DEDA 3KCKA 2ZOQA 3DK7A 4KD1A 4O0YA 4X3FC 2PVFA 5G1XA 4PWNA 1PXIA 3EL8A 2JFMA 2YA9A 3KMWA 5CAVA 2O63A 3LFQA 3ODYX 3QTRA 1ZWSA 3LJ2A 3CPCA 2R2PA 4BZDA 3VUMA 5DWRA 3U4UA 2R7IA 4AA4A 4UB7A 4E6DA 4PTEA 5H3QA 2YIWA 2C0TA 3W32A 4YJSA 1JSVA 3OD6X 4OT5A 5CEPA 2CKEA 5HHWA 5HU3A 1Q3WA 5ETCA 4R1YA 4Z55A 4A06A 5HORA 5E8XA 4QD6A 4XLVA 4UN0C 3MPAA 2FH9A 3DTCA 1P2AA 1P4OA 3PXKA 4M0YA 4RWJA 4JOAA 3NS9A 5EK7A 3W2QA 1OIQA 3FQEA 3MH3A 5ETIA 4DGOA 5IH4A 5C1QB 2HENA 3OTVA 5I3OA 5I4NA 3HAVA 3DQXA 4I92A 3NNWA 4HZSA 5CAOA 3POOA 4FKQA 3QTZA 4IX6A 5M57A 2GSFA 4AT3A 2XYNA 1K3AA 3H30A 3G0FA 5AUUA 3AMBA 3PE1A 1U4DA 2YACA 3SGCA 1VR2A 2VO7A 4MNEB 3UIBA 1Y8GA 4C33A 3L8SA 3LCDA 5H2UA 4XP3A 3AMYA 4B99A 1Q8UA 1WBOA 4JIAA 5EOBA 2OJIA 3UG2A 4E4NA 4O7NA 5IEXA 4U0IA 2CJMA 4QQJA 3UNJA 4IH8A 2WMRA 2GTMA 5CVFA 2GHGA 2OZAB 2R5TA 1J1BA 4GG5A 2HXQA 4L52A 5E8UA 1GNGA 4ZJIA 5IA1A 4F4PA 2CLQA 3RTPA 3OC1A 2F7XE 4ZOGA 5HQ0A 1OUKA 3NX8A 3N4UA 3FAAA 3LFSA 3AC3A 2GNFA 5K3YA 4NUSA 4JBOA 4D9UA 3HA8A 2PWLA 3R7VA 3IDBA 2PPQA 3HVCA 1GOLA 3EN5A 1JKSA 2WQBA 5C26A 3BHHA 3ORZA 4YLKA 2RFDA 5D1JA 2C0IA 4U3YA 4RRVA 4EKLA 3ITZA 2R3JA 4HYSA 5HLWA 5M56A 1WBPA 2C5NA 4BDGA 1W83A 1QMZA 4FL2A 4ANSA 5K4JA 4MD7E 1H4LA 2XNGA 4D55A 4D2WA 1NW1A 2DUVA 2CNVA 2J5FA 3PJ8A 2O2UA 4WUNA 2BPMA 4AT4A 4R78A 3Q2MA 4JG7A 4KBCA 4M8TA 3RK5A 4L3JA 2UV2A 2FSMX 3RWPA 4O7WA 3R6XA 4E73A 5C4LA 1DAYA 4GT3A 4I0RA 3FLSA 2Z7RA 3SW4A 2I40A 2R4BA 3GCUA 4NCTC 4NFMA 4FTLA 4OTRA 4QMXA 1PMEA 3BYSA 1OKVA 5GZ9A 5JSMA 4WA9A 3ZO3A 3LMGA 2XB7A 3QLGA 4DN5A 3R21A 2PZYA 2Z60A 2WQMA 2IVTA 2R0IA 3WE8A 2Y4IC 4IFCA 2XK3A 3M1SA 1Y6BA 4GYGA 4IE9A 4XCUA 5JFXA 1KE5A 4J96A 5DT3A 3FEGA 1GY3A 4P5QA 2BKZA 3Q9XA 1XBBA 3UGCA 3GFEA 2VO3A 3DB8A 3RK9A 3OMVA 2ZM4A 1Q97A 4KRCA 4CT2A 5BPYA 4BHNA 5DR6A 2NO3A 3GOKA 5A9UA 4RC2A 4DGLC 3RWQA 2C3IB 4MXCA 4LQMA 3QUPA 4I41A 4P7EA 1MUOA 1H8FA 4JQ8A 4PPCA 4ZZMA 5HG8A 1WAKA 4RIWA 1LEZA 4JAIA 5B7VA 1O9UA 2C6TA 3A4OX 4MD9E 3ZDUA 1WBTA 3QXOA 4C37A 5LWMA 5ANDA 3EQHA 4C4JA 5HVJA 3ROCA 2ZM3A 4N4SA 1I44A 1PXPA 3FKOA 4RJ6A 1PYXA 2JLDA 3FHIA 1H1RA 5IUHA 3CGOA 5ANIA 3WIKA 4HOKA 4W4WA 4FR4A 3OCTA 1P14A
chains in the Genus database with same CATH superfamily
2WXVA 1CM8A 2NP8A 4FIGA 4U81A 3KL8A 4C34A 2V5QA 3FXWA 1OGYA 2CKQA 3HMPA 1LPUA 5A4LA 4EONA 4WNOA 5IEYA 2R3QA 4ASZA 3DDQA 1LEWA 1PF8A 4FVQA 4QP6A 4PP9A 5CXZA 4CV9A 5I9VA 4OAVB 3CY3A 4F65A 4KIQA 2YM6A 3REPA 3GQIA 1REJA 3A7GA 2JC6A 3QQGA 4QMLA 4UV0A 3UP7A 3UYSA 3GENA 4CLJA 3IPHA 5AWMA 5CEOA 4R8QA 1JKLA 4F7NA 3KK9A 3L1SA 4NTSA 1IAHA 3NVKI 3QGWA 4CYIA 4G6NA 3G15A 3G33A 3OWJA 4BR3A 4YJQA 5FUTA 3EFWA 5F95A 3VUGA 5EYKA 4BF2A 4CFWA 4D0WA 2VWYA 2X2LA 3IS5A 3O23A 3NGAA 4AQKA 3EZRA 4E4MA 3HV4A 4K6ZA 4TNBA 5HNBA 2QCSA 3UDBA 4CRSA 4FTRA 3HRFA 4ASEA 2OSCA 2BKKA 5B0XA 2J51A 4YC8A 3ZBFA 3PVBA 1Y6AA 3KFAA 2ONLC 3LLAA 4I6QA 4C0TA 2PMOX 2Q83A 3R04A 3U87A 4M3QA 2ERKA 2CN8A 5CALA 4MAOA 4MBLA 4UXQA 4FEXA 5LOHA 1URCA 2ERZE 3Q96A 4PF4A 3U9CA 2GNIA 5CTPA 4R1VA 4BRXA 4RJ3A 4MXZA 4CKIA 1WMKA 2Z7QA 2ZV9A 3U51A 5A14A 3QTWA 4QP7A 4ZEGA 2NRUA 5KMNA 3MV5A 4RMZA 2YZLA 5FP6A 4EWQA 1OIRA 2UVYA 3NYVA 1WBNA 5HD4A 1MRYA 5EKOA 5M09A 5DEWA 4NM3A 3MA3A 3FPMA 3P7BA 5FXRA 3NMUF 1APME 5CSVA 4E7WA 3VULA 3TZ8A 5E91A 4LUEA 4LL5A 1DM2A 5CI6A 1UWJA 4BIBA 4J1RA 4JNWA 4YJNA 5HCYA 4WG5A 3COIA 5IQEA 5M55A 3MY1A 3SVVA 4R77A 3OHTA 3R73A 4LGDA 2HZIA 4RX9A 3ZZWA 2XAMA 2P55A 3DOGA 3RPRA 3DK6A 4ANOA 4NT4A 4BTMA 5HTCA 2JD5A 3U9NA 4AOTA 4C4FA 4XEYA 2ITPA 4UMTA 5DNRA 4AW0A 1LUFA 4MK0A 5DFPA 1XH7A 4BDAA 3U6JA 3QWJA 5HX8A 3OCSA 5J87A 4F9CA 4ONAA 2ZM1A 4QYYA 4BN1A 2B7AA 2C6LA 2JBPA 3L8PA 4PTCA 4XJ0A 4WSQA 2ITNA 2WMSA 2WO6A 2BTRA 4JDKA 2R3FA 2Y7JA 4N0SA 4RSSA 5CSXA 4F1OA 4KBAA 5M4FA 3NVMB 5J9LA 2J6MA 1OMWA 5CSPA 4FKOA 4F7LA 2O5KA 4MCVA 4RZVA 4V05A 5HG9A 3WF6A 2OJGA 4MHAA 2B9JA 3W0SA 3H4JA 1JWHA 2PZPA 2P4IA 2XJ2A 3OW3A 4J95A 4XRLA 3HDMA 4LGGA 4DHFA 3O8TA 4RGJA 3KULA 2Z8CA 4MKCA 4IDVA 3ZSHA 5EYMA 1BKXA 4FI1A 3A7FA 4NL0A 3F3WA 3H0ZA 3QQFA 3EQRA 3RAHA 3KMMA 2HZ0A 4MXOA 2BRNA 3KF7A 2YAKA 4BDKA 3PE2A 4RIWB 4WRSA 4IZ5A 5IA5A 4GUEA 1REKA 4XNEA 2PUNA 1MRVA 4GFOA 5AM7A 1PYEA 2G9XA 1ST4A 2X7GA 4ZTHA 4ZIMA 2X9EA 4ZZNA 4DEAA 3R7UA 4E6CA 1H08A 3HL7A 4IWDA 5ICPA 4QP9A 4E5AX 3FMNA 3TJDA 3QCXA 4Y95A 1GIIA 1H25A 3AD6A 4AA0A 3D5UA 5BMSA 4OTHA 4PPBA 3ENHA 4OW8A 4WNPA 4AGCA 2PULA 4JDJA 2H96A 3F5GA 3I0OA 3NNXA 4FG9A 4R6VA 1Z9XA 4X3JA 4UMUA 4AZVA 2QG7A 4TN6A 1HOWA 5LVLA 3TV6A 2V7OA 3W8LA 4AUAA 4MYGA 3UBDA 4IAYA 2WU6A 4YBJA 5J1WA 3Q2JA 1CDKA 2JDTA 4FSWA 3O7LD 4PNIA 4QMMA 2BDFA 3NUXA 3HMNA 4Y72A 4AF3A 2XKCA 4O21A 3DFAA 4YTIA 2OG8A 3EQBA 3CP9A 4F78A 3AD4A 3FZSA 3KXZA 2OH0E 3PG1A 3BL9A 2EB2A 4RJ7A 3VF9A 2JIUA 2OU7A 4QT1A 1R1WA 3BBWA 2YFXA 4NZWB 3SAYA 5T3QA 3VUTA 3MJ1A 2VWBA 3QX2A 3CD8A 4O0SA 4KKEA 4W4VA 3G90X 4F99A 2BVAA 3QX4A 3FLZA 3FMEA 5IH6A 5LWNA 3GP0A 4NM5A 4XS2A 4IWQA 5A4EA 4C2VA 3K5VA 2V0DA 3F5UA 3NRMA 4YURA 4O1OA 4FC0A 1YXTA 3TZ7A 4O86A 3BHYA 1ZOEA 5CYIA 2C4GA 1KE9A 2C6EA 3EN7A 4JR3A 2R3LA 1OITA 4G6LA 4RQVA 4UY9A 4YC3A 2ETKA 4NW6A 5AA8A 4P4CA 3Q5IA 4ANNA 4L00A 5IQHA 2FO0A 4FK3A 2QKWB 2XNNA 2YDIA 5CU6A 5M53A 3KK8A 3WZDA 4IX3A 3FI3A 5CY3A 2X81A 2X7FA 4AXDA 5JGAA 2H9VA 4BDEA 2HW6A 4DLIA 1OKWA 4I6LA 3H9OA 3RP9A 5EQPA 2GNJA 3KU2A 4E93A 3PDTA 3P5JC 2GFCA 2CHLA 4X7QA 3OOGA 1CKIA 2IZSA 3W8QA 3HV7A 4CFXA 4DTAA 4FVPA 2GHLA 4LGHA 3ZDIA 3FPQA 4PPAA 4DG0E 2W06A 3CD3A 3OCGA 5IKWA 3OF0A 4C3PA 4ZS0A 5KO1A 4O7ZA 2R3KA 3KVWA 3KA0A 2QODA 2OW3A 4IBMA 4MUQA 3WF8A 5BVEA 4RA5A 2HZNA 2HY81 4L7FA 2B52A 4FGBA 5CF8A 3E64A 2VNYA 4K33A 3F7ZA 4CZYB 5M44A 2PZIA 4EH6A 4DDIA 2XRWA 3OG7A 3QCYA 2BDJA 3EYHA 4YTFA 2QC6A 3RPVA 2W1IA 5K4IA 3KULB 2VRXA 3FLQA 2J0MB 3Q32A 4IB3A 1MQBA 3DFCB 2A27A 4XV1A 4HW7A 3VW8A 1QCFA 1Q5KA 4H3BA 2A4LA 2OBJA 2YLEA 3R7OA 2J90A 3TEIA 2BAJA 2OICA 2VWXA 2FYSA 2R9SA 2YIYA 4K8AA 5AP0A 3RAIA 2QR7A 4FIJA 3F82A 4LL0A 3R9HA 1SNXA 3I7BA 4CMTA 4CQGA 3JYAA 3GXLA 4J97A 5EFQA 4DEHA 3R9RA 1Q41A 4RPVA 3G5DA 1RW8A 4QP2A 4CLIA 3LFNA 1KV2A 3B2TA 4AXAA 4L43A 1AGWA 2EWAA 1YXVA 4KABA 2EXEA 5GJDA 5CEIA 4FTIA 4C58A 4EK3A 1RQQA 2PVJA 4O0XA 3NPCA 3JUHA 3A7HA 5HKMA 4AQCA 4N57A 1FMKA 4V0GA 4DFUA 3QUDA 5KMMA 5AFVA 4AZWA 4ZTQA 4FNZA 4PMTA 3AKKA 2FGIA 4I6BA 3MESA 2O64A 4EK6A 3ZM4A 2R64A 3VBYA 2G15A 3GCPA 5JZJA 3DA6A 3AGMA 4HYUA 3IW5A 3W10A 4DG3E 1QPJA 2YLFA 2XK4A 4R3CA 5BUIA 4EOJA 4QMQA 4CKRA 4R7IA 2CNQA 4YBKA 3BGZA 3QKLA 3Q52A 5IQBA 3O96A 2A98A 3EQCA 5EDQA 5IMEA 4JG6A 3KRLA 3L9LA 4PUZA 4KS8A 4R3RA 4J7BA 2FVDA 4DF3A 3ZRMA 3FYJX 4S33A 2VD5A 4HNIA 3GNIB 3PJ1A 4BI0A 2ZDUA 3SQQA 3P5KA 4GG7A 5GZ8A 1H0VA 3I81A 1JSTA 2BTSA 4A9YA 3ZEPA 2WQOA 3FHRA 5IUIA 4ENXA 3W0OA 3E8DA 1Z5MA 3BV2A 3LW0A 4J52A 4FTUA 4BY9E 4XLIA 2CGXA 5C03A 3IGOA 4MEDA 5JFSA 5KMIA 4YU2A 2V7AA 4FV7A 4YR8A 3KXMA 4AAYA 1CSNA 1KE8A 2C1AA 4BKZA 2OJJA 4LRMA 3K5UA 3U54A 3PIXA 5IZFA 1Q8YA 5CAQA 4EHVA 3TXOA 3H10A 3PIZA 2R3NA 4ZTRA 4CCBA 3ORNA 2WU7A 3D4QA 4ZTNA 4BIEA 3ORKA 5D41A 2NNWB 3CC6A 3FV8A 3OWPA 2XAOA 4WUAA 2H6DA 1GIHA 5E1EA 2F4JA 2BALA 3R8ZA 5CT7A 4O91A 1NXKA 5JMSA 5EW9A 4BCQA 4D2SA 2I0YA 4M67A 4FEWA 4KKHA 3V5TA 2YN8A 2QO9A 4O27B 4PL5A 4DH1A 4K2RA 4EH7A 1Q24A 4Q9ZA 4BCKA 5IH5A 3RZBA 5EQEA 2CMWA 3C5UA 4KSQA 3THBA 5IG1A 3UODA 4PDYA 5E92A 4L46A 4Q9SA 3DCVA 3PP1A 4ZSEA 1IA9A 4FKVA 5IQFA 4TKSA 5CZIA 4DH3A 2YISA 3LFCA 3RINA 3PYYA 1CKJA 3DT1A 3I60A 3QZFA 3DV3A 4RQKA 5A4TA 3ZONA 2YWVA 5BYLA 4XBUA 2ITWA 4NTTA 4BCGA 3P86A 4XMOA 2QI8A 3AMAA 3VS4A 2XM8A 3NCZA 2IZUA 4NH1A 2XK6A 3RM7A 4D9TA 4IVBA 3LQ5A 5AAEA 5IA3A 5IUGA 3TUCA 1OL2A 2OIQA 4IMYA 4YNEA 3ZFXA 4X3FA 5EM8A 3RM6A 3LM0A 3R8VA 2WQEA 3OTUA 2I0VA 3ZYAA 3P1AA 3PTGA 4AA5A 2WELA 2WHBA 3HMMA 3NUUA 3ZFMA 5JRQA 1O6KA 4W4YA 5DEYA 5BVNA 2G01A 4HVSA 1WVWA 3FLWA 3D15A 4Z3VA 4WO5A 4YHJA 4BGGA 2OXDA 5CF5A 2WFYA 4FTNA 5IEVA 3TWJA 5CEMA 1YWNA 3BGPA 5F20A 4ZJVA 4ZLYA 5EQYA 2HAKA 2BZKB 3KN6A 4DITA 5C4KA 3H9FA 3VAPA 3VJNA 5KBQA 2XKFA 5KHXA 4LMUA 3OEFX 4OUCA 3LMIA 3UMWA 1JKKA 3VF8A 3CKWA 5J1VA 5E8VA 2HYYA 3F2RA 4ZJJA 1XJDA 1NVRA 2ACXA 5ETFA 2GMXA 3PSDA 5EYDA 2C6OA 2PVMA 2J0JA 2YJRA 3QCQA 4FT7A 4GCJA 3TI1A 4EK8A 5JN2A 3LE6A 4C35A 3TYKA 2CLXA 4G31A 4V0GB 3RNYA 3CJGA 3MB6A 3IW8A 2XH5A 3U8WA 3R2YA 4TT7A 4U44A 3NIEA 3QRIA 4U9AA 3F9NA 2Y0AA 1XWSA 5IQIA 2XA4A 4IAKA 3ZU7A 3TIYA 3SG9A 5EM5A 4C02A 3HUCA 3TJCA 1IRKA 3ML1A 3D0EA 5TOZA 2B53A 4X6QC 4M14A 3DXNA 3IECA 1KE6A 5JK3A 3VHEA 2CNUA 4DEGA 3C1XA 1FOTA 2R3GA 3NWWA 1PKDA 4FKRA 3ZLWA 4C57A 5HZNA 4AXCA 3AD5A 4M69A 3WZKA 4GL9A 5KUPA 3BEGA 2KTYA 2R3OA 4QMYA 2VTJA 2W99B 4BDIA 3W1FA 5LMBA 2BIYA 1W7HA 5H9BA 4YJTA 4CT1A 4DFLA 3S00A 2WOUA 3ZLXA 4X0MA 2IN6A 3WE4A 3FL4A 4F9WA 4UMPA 3PZEA 3D7TA 1ZZLA 4RIXA 4ITIA 4AW2A 3POZA 3QRJA 3IW6A 3KCFA 2YCQA 5AP7A 4OLIA 3QU0A 2X8IA 3EQIA 4N6YA 3U6HA 2QKRA 5AR4A 4R5SA 3UYTA 3VC4A 3NDMA 3L9PA 2FB8A 3LZBA 2ITYA 4FV4A 1H01A 4G3CA 5AJQA 2IW8A 4EUUA 2GQSA 3CQWA 4QMNA 4YZBA 5HCZA 2I6LA 2WQNA 3LCTA 4I6HA 1STCE 4QTBA 5D7VA 3E87A 3NCGA 1F0QA 1L3RE 3BU3A 4F7JA 3HMIA 3BE2A 5HE0A 1YHWA 3A4PA 1JBPE 4G5PA 4MWHA 3ZO4A 2QHNA 2X4ZA 2YERA 1S9JA 4FZFB 5HBJA 1AQ1A 2XVDA 3QYWA 4O6LA 3D2KA 2C47A 4Q2AA 4QYFA 4JDHA 3TV4A 3UOJA 4FZ7A 4EC8A 3WI6A 1JQHA 1URWA 1YOJA 1WBVA 3DJ6A 5FEQA 2I1MA 3R8MA 4FL3A 3JXWA 4O2PA 3VHKA 4E8AA 5L6PA 4HVHA 4IFGA 1H1WA 4F63A 4YJUA 5E7RA 5HVYA 4IADA 4XHKB 3ZRKA 5BUJA 1OPLA 3SHEA 4QNYA 2GFSA 4EHEA 1W82A 4Q5HA 3II5A 3PLSA 2GPHA 3COHA 3NW6A 4OTGA 4IXPA 4BGHA 2OJFE 3FQSA 3DKFA 3KN5A 4IVAA 3OW4A 1U5QA 3FSKA 4YJRA 5AV1A 4D4RA 2PZRA 4YJOA 4FT3A 4U79A 1FPUA 1TQMA 5CI7A 5LXMA 5EHLA 4BCNA 2JITA 3RALA 5E8YA 3QQLA 4FUYA 4FX3A 1SMHA 1YHVA 3MFTA 2A0CX 4FKIA 3RHXA 3V5WA 3VRZA 1R3CA 1MP8A 4BCOA 5DH3A 1OB3A 3P9JA 4CKJA 3RK7A 4QP1A 4U45A 3KIOC 4EHGA 4O2ZA 4X3FB 5HCXA 5HTBA 4E1ZA 1V0BA 4YNOA 4I4FA 2VTTA 2AC3A 2YIRA 3LVPA 4WSYA 3ZEWA 4WKQA 4FRFA 2R3IA 4FEVA 4RVLA 1O6YA 4II5A 5CWZA 4BYJA 1G8KA 3BQRA 3IDPA 4CNHA 2XF0A 3DS6A 4QQTA 4NYEA 1EH4A 3VW6A 4UYAA 3RGFA 3D7ZA 1OZ1A 1H07A 3G51A 4A4OA 4BBFA 3E3BX 3QYZA 3ELJA 3O5AA 4FJVA 3W55A 4TYIA 3LXPA 4MF1A 4YSMA 1H1QA 4FT0A 4HGTA 4DEIA 4GSBA 3RVGA 2CGWA 5E8WA 3R83A 4CTBA 4OTWA 2XCHA 3GEQA 4AE9A 5FEEA 4BTKA 5K0KA 4F7SA 4K9YA 4IB1A 2AUHA 2ITQA 2WEIA 3ZCLA 5AUTA 1OGUA 5CNNA 4D58A 1BYGA 5BV3A 4F08A 3L8VA 4WT6A 4IAIA 2W05A 4IQ6A 4RJ4A 5DBXA 4OBQA 1YWRA 3COKA 1DAWA 4I5CA 1S9IA 4BDJA 4ZP5A 1Q8TA 1ZMUA 4OTIA 3V8SA 2EVAA 3HV5A 5KCVA 2BRHA 2WMAA 1TQPA 4NKSA 4WBOA 1G8SA 3HNGA 4FKTA 3PA3A 4EZ3A 5EKNA 4P2KA 3Q4UA 4V04A 3PY1A 3OBJA 4XG3A 4JS8A 1OKZA 5GZAA 2P2IA 3LCKA 3D14A 3BHUA 4M69B 3DKOA 3C4XA 4ERWA 3PP0A 4FZAB 5I0BA 1JAMA 2W17A 3I6WA 3PSCA 4O7SA 2PVKA 2WMXA 4LOPA 3RHKA 5HX6A 4IACA 5JKGA 3LMHA 4ANMA 3HGKA 3W2PA 1SYKA 3DBQA 1ZOGA 1OL5A 3UG1A 1BUHA 4ASDA 3F2AA 1G8AA 3D7TB 4G6OA 4RIXB 5DHJA 3NUAA 2F2CB 4GUBA 2QNJA 4DBNA 3G2FA 4H39A 1UA2A 3MPTA 3LPBA 2IW9A 1Q62A 3OOMA 5AR2A 2QU5A 4HCTA 2W1CA 4YO4A 4JL9A 3AQVA 4QYGA 1O6LA 3PVUA 1PY5A 3M2WA 4JBVA 4BTFA 5CEKA 3VBWA 2BILB 4O6EA 3O0GA 4FTCA 4LM5A 3RZFA 4KUJA 4EJ7A 3OXZA 2UW8A 5DT0A 4RC4A 4YZMA 2JKQA 4DFZE 4M68A 5JFVA 3TKUA 5IQDA 4CSVA 3OUKA 4PP7A 2W0JA 4ARKA 5LVMA 4QMZA 2NRYA 4TYEA 4E5WA 4Z7GA 3F3ZA 4EORA 4EYMA 5AAGA 4X6RA 2JAVA 4BDCA 2X6EA 4B4LA 4H05A 3D5VA 4LOOA 3EN9A 3ZC6A 4EYJA 1IR3A 3GB2A 4U41A 2AEGA 3W0QA 3QBNA 3OFMA 5DOSA 4YMJA 4NW5A 2GNGA 4IAZA 4LMNA 4NEUA 4WD5A 2Y4IB 3KC3A 3GC8A 2X4FA 3QTXA 5FQDC 4AW5A 2V62A 2ZB0A 5AP1A 3KKVA 3KXNA 2JGZA 3RPYA 4IWOA 4MWIA 3MVHA 4HPUE 4TYJA 4AE6A 4H1JA 4YTCA 4ZY6A 3CBLA 2F9GA 4USEA 4H36A 5IA4A 4O4EA 4WG4A 3GU7A 4FG7A 3LKMA 3LFAA 2IVUA 2XNPA 4QPMA 4HVIA 2XARA 2XK7A 3R01A 1NVQA 1B39A 4IJ9A 3T3VA 3W0RA 2VTLA 3C9WA 4DE4A 4JIKA 3SLSA 4IAFA 1QL6A 3AC2A 4B0GA 5AP4A 4P5ZA 3D5XA 2VWVA 2C6KA 4OBOA 3VS0A 5TT7A 3H0YA 5M4IA 3ZSGA 5C8NA 5HE2A 1XO2B 4GVJA 1SVHA 3FZPA 3MH0A 4TYHA 3GC9A 4I5MA 1A48A 3V5JA 2OI4X 5EM6A 4D0XA 5IDNA 1IASA 3UMXA 5FP5A 3IONA 3TUDA 4DINA 4G3GA 1U5RA 4EH8A 1M52A 2YM8A 2PSQA 2QG5A 4K0YA 4B7TA 4W8EA 5BVKA 5HO7A 2B0QA 2ZVAA 1NVSA 1XBCA 3UNKA 3Q04A 4UBAA 4CFFA 1BL7A 4XUFA 2YABA 3O50A 4FVRA 4DHJA 3IW4A 3MBLA 3Q9WA 5EYCA 3FZ1A 2RIOA 4PMPA 1IAJA 2BUJA 3TKIA 3MPMA 2EXMA 3DY7A 4S31A 4MQ1A 5DVRA 5JT2A 3DU8A 4RC3A 4IX5A 1AD5A 3D2IA 5IMXA 4Y8DA 1E1XA 3BCEA 4U8ZA 3UNZA 5BYZA 3UQFA 2BZHB 4Y46A 4BC6A 2V55A 3WYXA 3PY3A 4GK4A 4D2TA 3QHWA 4GJ2A 4HGEA 3IOKA 2ITZA 5HO8A 5L8LA 3ULZA 3C4ZA 1UV5A 3R9OA 3GUBA 2XK9A 3FYKX 2UZLA 4RJ8A 2E2BA 5T68A 2FUMA 2C6DA 1OIUA 3GGFA 4QMSA 4UZHA 4LV8A 2HW7A 2I0EA 2H8HA 1E9HA 1HCLA 1QPCA 3QTQA 3RPSA 2HY0A 5LVPA 3F3VA 2B55A 3FUPA 4ZSLA 5L6WL 2BRMA 4IB5A 3CR0A 3QA0A 4PL3A 2XYUA 5J7BA 5DR2A 2UZDA 1YDSE 2VUWA 5AP3A 3BGQA 2BROA 2RKUA 3Q9ZA 3EKNA 1FQ1B 3TACA 3WF5A 3EOCA 3A8WA 4FTAA 5AX3A 3E5AA 2QOQA 3IOPA 5CNOA 4QQ5A 4XG2A 4EUTA 3BLAA 5FXSA 1M2PA 4NU1A 4O4CA 4ZSJA 1BI8A 3ZUVA 1HCKA 1W2DA 2HCKA 4U42A 1VYWA 1VJYA 4XOYA 4XV9A 3MWUA 5DG5A 1OUYA 3EWHA 4C61A 5I9ZA 5L8KA 3WOWA 4ZTMA 3AG9A 4FTMA 2P0CA 4L68A 5FRIA 3NNUA 3MFUA 2GS2A 3EL7A 1PMVA 2ITTA 3OVVA 4PL4A 4IANA 2I7QA 4EBVA 5DI1A 2XNEA 5C9CA 2CCIA 3F69A 3VNTA 4BTJA 3HA6A 5A3XA 1BI7A 3CTHA 4O0WA 4G9RA 4AFJA 5AV3A 3V04A 4M66A 3RBWA 3WF9A 4KS7A 3KVXA 4O7LA 1XH5A 1YRPA 4B8LA 3KREA 2XNBA 4FYOA 4XG6A 3NW7A 4TWOA 4XOZA 3PIYA 3NUNA 4I4EA 4FV3A 4FEUA 3COMA 4MD8E 4JMQA 2YDJA 1OL1A 4CMUA 5DYJA 4AX8A 1ZYSA 2ESMA 3SXSA 3C5IA 2W1FA 1FINA 3VQUA 3TCPA 2Q0BA 4LDTA 2JIVA 4AXEA 4F9AA 4C59A 5L4QA 4C4GA 3HDNA 4W9WA 4O83A 4M12A 2B4SB 1M2QA 1BX6A 2QURA 3LXLA 4YHTA 2OWBA 4DFYA 2YCFA 3G6GA 3MGYA 3QD3A 2XNMA 4ZSGA 3WARA 4C38A 1WBWA 4EH3A 5I3RA 4ACMA 3RAKA 5AM6A 3UQGA 5L6OA 4O7YA 4U5JA 4GU6A 5BNJA 4H1MA 3GU6A 4I22A 4EOSA 2JAMA 3OWKA 4D28A 1YI6A 4HNFA 3R7IA 3AXWA 5J5TA 2E9OA 3GU8A 3LCSA 5DR9A 2NPQA 5LARA 2OF4A 3ZBXA 3MA6A 4NM7A 4TYHB 4FKGA 4XH6A 2WIPA 3UPXA 2R0UA 4BBEA 4U3ZA 5HD7A 4BI2A 1OBDA 4FODA 4KNBA 4H58A 2CDZA 3ET7A 4YJPA 3CJFA 4DEBA 5FTGA 4ASXA 4MBJA 4UWCA 3EYGA 1GZ8A 2ZV8A 4UXLA 4RWIA 1NY3A 1PXMA 3I79A 5C8MA 3RJCA 5J95A 2DS1A 4X2KA 4QTAA 4IWPA 3BV3A 3ZO2A 3JR1A 2O8YA 3H3CA 4I5PA 5AUYA 4M15A 3NR9A 4O96A 1B6CB 1TVOA 2EUFB 3TNHA 3C4FA 5CF4A 3HX4A 3UVQA 4O7RA 2PE0A 4GT4A 4RVKA 5AEPA 3OZ6A 2OGVA 5FEDA 3D83A 2Z02A 3L9NA 5AUXA 3UOLA 4BYIA 5KKRC 4RVTA 4WIHA 4O4BB 3AGLA 3IDCA 4DT8A 1UKHA 3OCBA 3PXQA 4YLJA 3PVGA 4HYIA 3ENMA 3QXPA 4I20A 3HUBA 1UU3A 2JBOA 4WBBB 4QEBA 2DYLA 3BHVA 3PPKA 4MXAA 2PYWA 1JLUE 2W5HA 2CPKE 5HIBA 1XMLA 2QD9A 2QR8A 4RLLA 4M13A 4ZAUA 4JX7A 1PJKA 2XIXA 4GFMA 3FDNA 4QPSA 3DBDA 2RG5A 4EH4A 4JRVA 4PDPA 5AP6A 4DHIB 3JPVA 1ZXEA 5L2WA 4GV1A 1SVGA 2C5VA 2I0HA 5E8ZA 3BWFA 1ST0A 2UW9A 5M51A 2VX3A 2RF9A 1OBGA 4IZYA 1OKYA 2B1PA 3R1QA 2UW6A 1LR4A 2ZB1A 2W1ZA 2A2AA 3JS2A 4FKJA 4RX7A 3UZRA 2X2KA 3C51A 1XKKA 4JBQA 4IW0A 4MH7A 4QOXA 3LLTA 4BDDA 1VLRA 1F5QA 4HCVA 5K0XA 3VVHA 3FLYA 1JPAA 4LOQA 3KXHA 4C4EA 4EQCA 4AZFA 3VS1A 2BFYA 3FL5A 4RIYA 4F9BA 3R7EA 3D94A 1M2RA 1JOWB 2IEWA 5HG5A 2ZV7A 2P3GX 4KIKA 4FZ6A 5JQ5A 3DBCA 3QFVA 4GK2A 3FSFA 4QO9A 2YCSA 5JGDA 3PG3A 3QC4A 2VTNA 3CKXA 4IM0A 4FKSA 2XKDA 3TNIA 2XANA 3CPBA 3NIZA 4K77A 2R3HA 4HGLA 2BFXA 2RL5A 2X1NA 5CZHA 5HBHA 4E20A 1TZDA 4LRJA 2J7TA 3PXFA 3C4CA 3TUBA 4GKHA 1R78A 3MVMA 3C0IA 2PZ5A 4Q5EA 2G2IA 4BCIA 2WTKC 3VN9A 4A4XA 2ZMCA 3KRXA 3MIAA 3V6RA 4RJ5A 5LCKA 3NUYA 4G3DA 5LJJA 3HV3A 3EQPA 3FMLA 4UZDA 4YZ9A 3TNWA 2YM5A 4APCA 5B2MA 4EOLA 4F1MA 3U55A 4L45A 4DCAA 3OT3A 4DG2E 3MTFA 3SA0A 4E4LA 2QOFA 2IF8A 2PL0A 3FMKA 2X7OA 3BYUA 2ITVA 3R9NA 4CTCA 5L3AA 3A99A 3F3UA 4J98A 2XALA 3VBQA 2BHEA 3AC1A 4UALA 5HIDA 4YC6A 4CRLA 3W16A 1OI9A 3FI4A 3AOXA 3FJQE 1H1SA 2C5OA 3ZZEA 3QD2B 4YJVA 4A9SA 4FA2A 3IGGA 4BHZA 5JQ8A 3UDZA 5GJFA 4BICA 2YHVA 5BMMA 4AN9A 3OXTA 3EKKA 3V8WA 3DZQA 3CSVA 2IWIA 1UU8A 3RCJA 3ZLSA 1W2CA 3HRBA 3W0NA 4X2FA 3SV0A 4DH8A 2G1TA 2X6DA 3VIDA 5BVFA 4JQ7A 4O84A 4LUDA 3SG8A 5I5ZA 2XBJA 3EJ1A 3I6UA 3UIUA 4FL1A 1GZKA 4J99A 2QOOA 4JR7A 4GKIA 4UWBA 2XCKA 5EM7A 2BCJA 1YQJA 4DTKA 5CXHA 2OK1A 3QALE 1U54A