1OUYA

The structure of p38 alpha in complex with a dihydropyrido-pyrimidine inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 107
structure length 350
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ouyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ouyA01
4HGSA 3F5GA 5HBHA 4XUFA 4BZOA 5C8NA 1ATPE 3R8UA 2QOHA 4EH5A 3PSCA 3C0HA 4BDKA 3QA0A 4J8NA 5ETAA 5HICA 5CU6A 4PL5A 4GG5A 2J90A 1H07A 4RQKA 1OPJA 1UU7A 3Q52A 4ZZMA 2Q83A 1JBPE 3Q4UA 3R8LA 4KINA 4AGDA 2V22A 3TV6A 2YWVA 2G15A 2BFXA 4RRVA 1KSWA 2YIYA 5KO1A 3PG1A 3H0YA 4KRDA 4K33A 4JOAA 3RTPA 3FI4A 3O23A 4EUTA 5J5TA 3SVVA 1JSVA 1PKGA 4M69B 3GCVA 4BWXA 4PDYA 4D2RA 3TM0A 2ZV7A 4RZWA 2OJGA 4P7EA 4ACCA 4FYNA 3CKWA 5IEXA 4O7ZA 2ZOQA 5HI2A 3REPA 2R4BA 3LCSA 4HYUA 4F1MA 3A61A 3NYNA 2WTKB 4DLJA 1G8SA 1J1BA 2F7ZE 4RVKA 1ZMUA 4UY9A 2IZSA 2WMWA 4QMOA 5DT3A 4EWQA 4U42A 4RC2A 1ZYCA 4APPA 4EYMA 4EZ7A 5ANGA 2B7AA 3C5UA 2X0GA 3C13A 3GU8A 4WUAA 5J1WA 4FG7A 3PRIA 3FZTA 3UOHA 3AC4A 4FNZA 1URCA 2PUPA 3B2WA 4JL9A 4GCJA 4QP6A 3WOWA 3BQRA 3HV4A 4QMMA 3OUNB 4ZTSA 4E4NA 3UO5A 5HE0A 4WIHA 4Y85A 4L9IA 4MVFA 1ZYSA 5HIBA 4G31A 5D9HA 3V5TA 3BBWA 5IQHA 2YJSA 4IWDA 2R0UA 4UMTA 4YJSA 4EBWA 2LAVA 5HG9A 4FZDB 4KIOA 4E1ZA 5DH3A 2VO0A 4JAJA 3GBZA 4I0SA 2WO6A 4EORA 3SG8A 3CQEA 4I22A 4X6RA 4M12A 3LFBA 1XBBA 2QKRA 3OXTA 1WBTA 1EH4A 2XIRA 3MPAA 3D5XA 4BIEA 4ENXA 4AN2A 4O22A 3PA3A 4XG7A 4NEUA 3ZC5A 1K2PA 4FBXA 3O0GA 3V5JA 4BCOA 1OKZA 3HUBA 4O6LA 5BVWA 4OAVB 2QHMA 3CD3A 3MESA 3P4KA 3HA6A 3ZONA 4MD9E 3SC1A 4G3FA 2YCFA 3V3VA 3VQUA 4GU9A 2ITOA 3DBEA 4B8MA 4E6DA 5AUUA 4FKLA 5JFSA 3IGGA 1ZARA 2GHLA 5G1XA 4Q9ZA 2ZM3A 4FEVA 4BDEA 4FTIA 5I9ZA 5HLNA 2YM3A 3FLYA 3R9RA 3NNWA 4FE2A 2WOTA 3LMIA 4X3FC 1GOLA 3K5UA 1H1PA 3MH3A 3C4ZA 2YA9A 3NSZA 4FTQA 4EKKA 4IMYA 3HDNA 4AZSA 4BF2A 2WNTA 2BKKA 2FH9A 1H25A 1GZOA 3IW8A 3VUMA 3CQWA 2ONLA 3B8QA 3E7VA 2BCJA 3ZZWA 3BV3A 2BRGA 4TYJA 2VWIA 3R1QA 2PU8A 4R77A 2GNFA 5K0XA 3JPVA 5FDPA 1MQ4A 4QMNA 2DS1A 4TWCA 5A4TA 4QNYA 3D83A 3ANQA 5EDRA 5BVKA 2XM8A 2O3PA 3EZRA 4FICA 2Y0AA 4C4IA 3R00A 4F9BA 3BEGA 5LVMA 4FG9A 4YC8A 3QTIA 3COIA 3EN6A 5KCVA 3UO4A 4W4VA 4AUAA 3ORXA 3MFTA 2YCSA 3NIZA 3KKVA 2I0HA 1U46A 3HMOA 3CPBA 3O71A 3PP0A 1LR4A 5DHJA 5HTCA 3VW8A 4OAUC 3DBQA 4QT1A 5CVFA 1XWSA 4QP4A 3RM7A 4AW1A 2HY0A 4FSNA 4PDPA 3CIKA 2F7XE 2OI4X 4R5SA 2VTSA 5KKRB 2X4FA 4EJ7A 1UV5A 1OI9A 2FVDA 3KY2A 4FG8A 3RWPA 5LQFA 3C4EA 2OFUA 3P08A 5CSWA 3LM5A 3F5PA 4H3PA 2XIYA 4EOMA 2GNJA 2EXCX 4PPAA 4Y8DA 5EW9A 3VULA 4O82A 4EK3A 4JRNA 3HV5A 3QQJA 3RCDA 3TIZA 2CPKE 4FT3A 4L44A 2R3HA 4JBQA 1NT2A 3ZUVA 1PY5A 4X7QA 4J71A 5JZNA 3KK9A 3ZRLA 4EH4A 1P4FA 4JLCA 3QRKA 4YJTA 4C58A 2WU7A 2BVAA 2EUFB 4I6HA 4S34A 3VN9A 4D2VA 3DQWA 2PUUA 5HKMA 2WMSA 4BHZA 2VGOA 4EKLA 3EQFA 4D0XA 5E9EA 4YNEA 4ZK5A 1SZMA 3R1YA 3OCBA 2VX1A 4IC8A 1HCKA 2VTMA 2WIPA 3HMIA 2QOLA 4HCTA 4YJNA 4ZXTA 2Y6OA 4FIJA 2YHVA 2CDZA 4BBEA 2WEIA 1YRPA 4NJDA 3RNIA 3UZRA 1T45A 3TZ8A 4NM3A 4JI9A 3W18A 2YM4A 3OC1A 5T6KA 4GT5A 3LFQA 3MWUA 5LXMA 4O7RA 3ZFMA 4D9UA 3MFRA 3BE9A 1Y8GA 1JOWB 3R21A 2UZUE 4E6AA 4DF3A 3BWFA 3R9NA 3KVWA 2IW8A 1QCFA 2R3RA 3T9TA 1OL5A 3DTWA 3F6XA 2IW9A 4FKOA 4IADA 5D7AA 4C4HA 1MRUA 2WKMA 3OUKA 4JXFA 3SQQA 1K3AA 1ERKA 4XP0A 4BTJA 4GVJA 4CZYB 4D58A 5L2SA 4FT0A 1H4LA 1R0PA 3A2CA 4JNWA 4NKAA 4AP7A 4Z7HA 4GIHA 4ZTNA 1BUHA 1ZAOA 4JQEA 3AD5A 2XZSA 3F69A 4QYFA 1GY3A 2GTNA 2HAKA 3BIZA 2BRNA 5CY3A 3G5DA 3DJ5A 1Z57A 2UZTA 1R1WA 4O7SA 1H08A 1M7NA 1YXSA 3TJDA 3IONA 3OD6X 5CEPA 2GNGA 5A6NA 3OG7A 3KN6A 3PIZA 5J95A 4C0TA 3UQCA 1FMKA 3V51A 5E8XA 3QD2B 1YWRA 4JBPA 4ZSLA 3DNEA 4QMYA 3SRVA 5LCJA 4LV8A 3DZOA 3WYYA 1VZOA 4EOIA 5IPJA 3A8XA 3ZHPC 3U9NA 4GH2A 2W9FB 3FHIA 4EH8A 4D4YA 3GCQA 3FDNA 4MD7E 2BALA 1XH8A 2R2PA 4CRLA 5D41A 3C4FA 5K4JA 3HV7A 4RWJA 4MWHA 3RHKA 5KZIA 4M14A 5KZ0A 1BL7A 2IZRA 2YDKA 2FSMX 4YZCA 3F66A 1XQZA 3QHRA 3PVGA 2P4IA 3QUPA 3GUBA 3C50A 3G15A 3DK6A 4BWPA 2XK3A 2J0LA 3R7VA 2OSCA 3A8WA 4CMTA 1FQ1B 2R3PA 3OW4A 4U41A 2RFNA 4LGGA 3UZPA 4EYJA 5A4QA 1PXKA 1Q3DA 4IVBA 3M11A 3RHXA 4A06A 4N6ZA 4QMTA 1IG1A 3VS2A 1E9HA 4CTCA 3QHWA 3ORMA 4HZSA 4BTKA 5KBRA 2OH4A 4QPSA 2F2UA 4I1ZA 2BDWA 1PXLA 1YHWA 3POZA 4JT3A 3WBLA 4A4XA 2PY3A 3R30A 4CT1A 4UX9A 2QO7A 3BX5A 5IUGA 3PZHA 1OM1A 4I4FA 3ZS5A 5IQEA 4YJOA 3LFCA 3UNJA 5HO7A 3A4OX 3M1SA 3FMEA 2GDOA 4G3EA 3GU5A 5CTPA 4XJ0A 3LQ8A 2HZ0A 2V55A 4RLLA 4QQCA 1CTPE 5F4NA 2VTPA 3TJCA 3UG1A 2VTTA 3QD3A 3UTOA 4LUEA 2E9VA 3ZO3A 4GK3A 3JXWA 4WOVA 5CU2A 4ZSJA 2XK7A 3CGFA 4USFA 2YDJA 5M57A 3F2RA 5CAQA 1J3HA 5M4IA 1PKDA 4JBOA 5DR9A 2WTCA 5CVGA 1FVTA 4P90A 4I5PA 4DCEA 1JWHA 3FYKX 3FLQA 4FKVA 3ZZEA 4FKGA 4ORKA 2I0EA 4UZHA 3U6IA 3AC3A 4DH3A 2VTQA 3WYXA 4F09A 4XHKB 4DTKA 1YHVA 2I0VA 2OZOA 5IH6A 2JGZA 2E9UA 4ZY4A 4NCTA 1U5RA 4Q5EA 4A07A 2OZAB 4XOYA 3VUKA 3V8SA 2JAMA 3ET7A 4XG6A 2C5NA 1ZMWA 4EQMA 4QTCA 2C5YA 2I40A 1ZY5A 1JLUE 5IA5A 4O0TA 3VS7A 5I3OA 3ZSIA 2QURA 3ORIA 5HGIA 4NFNA 2YJRA 3PVBA 4ASDA 2C5XA 1MQBA 4X0MA 3WE4A 3SXFA 3COMA 3NEWA 4RIOA 4EOQA 2IG7A 4O7WA 3ZMMA 3CP9A 4BDFA 1IAJA 2XM9A 3CTHA 4XV9A 3BYSA 1Y6BA 4FKQA 4IXPA 3EB0A 2QONA 3V6SA 3KF7A 3ORTA 3AXWA 5EM7A 3QGYA 3FHRA 5EQPA 3BRBA 5IH5A 3WIGA 4YO6A 1DS5A 3N9XA 4BCNA 5LWNA 3I60A 2UZEA 4QP7A 1Q8ZA 2R3FA 3BBTB 5FEEA 5K5NA 5T3QA 2PHKA 4H58A 3BHHA 3LCOA 3H0ZA 3LE6A 2WIHA 5BYLA 3SW7A 4A9UA 3M2WA 1Z9XA 3MGYA 4NW6A 5CT0A 4D0WA 3R8VA 4PTCA 5C01A 3QTQA 1YOMA 3V5WA 4BHNA 3UOLA 4F7NA 3FMKA 3ORLA 3C4XA 3FKLA 5ETFA 4FK3A 5M51A 2WU6A 1Q99A 4O1OA 5AUYA 4DFBA 4X2GA 3W8QA 2ONLC 1PHKA 3ALNA 2H96A 4AACA 4BCKA 1WCCA 3TZ9A 4IAIA 5L8KA 2XJ1A 5E90A 2GSFA 2Z8CA 1U54A 2XRWA 4MBIA 5GZ8A 3NVMB 2G9XA 3BEAA 5LMKC 4RVLA 3I7CA 3IW4A 4P5QA 3QQLA 1PF8A 4AOJA 4WO5A 5HVYA 4CFXA 4GYGA 1SYKA 5IA0A 4M3QA 3TNHA 5AUWA 4GFOA 4XEYA 3IDPA 4G5JA 3CPCA 2PVMA 4PPBA 1H0WA 4L42A 3MH0A 5EDQA 4BTFA 4ZOGA 2IVVA 4WNKA 3PPKA 4C37A 3R9HA 2VZ6A 4AT5A 4M67A 3OOMA 3RJCA 4E7WA 2O2UA 1YDRE 2W1HA 4YSJA 2HW7A 3MPMA 4QTEA 1G5SA 5KKRC 2PULA 1B6CB 5LOHA 3LCTA 1WVXA 4AW0A 3D5UA 4FEWA 3ENMA 3FPMA 5CX9A 3S95A 5AA8A 5BVOA 2BFYA 2JDVA 3KXGA 5IKWA 2B55A 4YTCA 5IA4A 4FOCA 3DK3A 3OZ6A 1ZOHA 3ROYA 3NUSA 2CGWA 4ZS0A 4AW5A 2QOQA 4XMOA 3PA5A 4U44A 5J7BA 5AP4A 2C6DA 4RWKA 4Y73A 5A54A 4ZS4A 5CLPA 4ENYA 2DUVA 4FUXA 1WBNA 2QKWB 1H1WA 3LOKA 3O2MA 3IKAA 4JX3A 3G0FA 2WAJA 4QOXA 4YR8A 4APCA 3ULZA 2CNVA 3MDYA 3TKIA 1HCLA 1LPUA 4EK4A 3GXLA 4OTQA 4G2FA 4AA4A 1VYWA 4C4FA 2XK9A 4IM3A 5FTGA 4BIDA 4DEHA 5M53A 3CY2A 4O0RA 5K0KA 5DR6A 4RX7A 3DGKA 2YIXA 1OIRA 3PIYA 1Q8YA 3Q9WA 5LVNA 3EKKA 2ITXA 3UQFA 2YM6A 3DLSA 3EYHA 4QTAA 4U0IA 4F6WA 4ASXA 4IDVA 3IOPA 5H8GA 3ORKA 4TWOA 4W8EA 2XYUA 5KE0A 3AT3A 1YOLA 4CD0A 1H0VA 2RG5A 4A9YA 4HYHA 3UNKA 2R3JA 2WMXA 2C6IA 2JKOA 4GT4A 4MQ2A 4YNOA 4FV3A 1H1QA 5B0XA 3UC3A 5J7HA 2GS7A 1J7IA 1O6KA 5EKOA 4AA5A 4JVGA 3NGAA 3PE1A 3OBJA 5EI2A 4LOOA 4FV2A 4I41A 4BICA 4GKHA 3EN5A 2GS6A 3ENHA 5CVHA 5DIAA 4ASZA 4NFMA 1OIQA 5CQUA 4RPVA 4ZMFA 2JITA 2WTKC 3G2FA 4K2RA 4IJPA 1GNGA 1W0XC 4RIXB 3CGOA 4BCHA 2WTDA 3JUHA 3MBLA 5EK7A 5BYZA 3KCFA 3IDCA 2BDFA 4DGGA 4I94A 4CLIA 3K5VA 3WF6A 3EL8A 3KRXA 4PMSA 3VBYA 3LFDA 3QRTA 3KEXA 3QRUA 4K1BA 4L00A 4AN3A 2NNWB 3LM0A 3BU3A 3NAYA 4QMPA 4RBLA 2X7OA 1P14A 2ETMA 2W06A 3PY3A 5HG8A 5HHWA 3LCKA 4Y95A 3QX4A 3TNPC 2GQSA 5HOAA 4J96A 5EFQA 3TL8A 4AZTA 4LI5A 4QP1A 4QMUA 5FTOA 4BDGA 4L3PA 5CWZA 1Y57A 3AG9A 4M66A 1R0EA 4IVDA 4KBKA 4QRCA 4MF0A 3RBWA 2XNOA 3UVPA 4ZLYA 4WT6A 5EDPA 3TACA 2XNPA 3NX8A 3MV5A 3RNYA 3VNTA 4MD8E 4JDJA 2GCDA 3BGZA 4KUJA 5L4QA 2VTAA 2JLDA 3O7LB 5GHVA 1KOAA 5TE0A 3C51A 2UW9A 2H34A 3DNDA 5AJQA 3CR0A 3F5UA 3FI3A 3KB7A 4MK0A 5K9IA 3ZC6A 4UMPA 4O0SA 4B8LA 1Q5KA 4HOKA 4DCAA 4MNEA 2C6LA 1KE9A 4BKZA 5IISA 5FTQA 2YIQA 5KX8A 3CCNA 4NUSA 1OB3A 3A7IA 3QL8A 5DE2A 1L8TA 4L01A 2W05A 5L6WL 1JKKA 1JQHA 2VU3A 4HGLA 5BVNA 4ZTQA 2F9GA 3F82A 4YLKA 4RX8A 5AR4A 4W4WA 2GPHA 2WQMA 5H3QA 5AEPA 3IW5A 2GQRA 4USEA 3TXOA 3NYXA 4CFNA 4F6UA 3BKBA 2VV9A 3ZBXA 2VTLA 4IAAA 4RFZA 3EQPA 4V05A 4ZSAA 4O0YA 3FBVA 4RLKA 3KFAA 4NIFB 1GZNA 5DOSA 3EQHA 3FL4A 4O7LA 3Q53A 4XCUA 5CQWA 5EQEA 2VO6A 3EYGA 3VVHA 4GW8A 3FMNA 5CSPA 4U3YA 5E92A 3PSDA 3TNIA 4AT3A 1WBWA 2BILB 2EB3A 2QOKA 3FQSA 3RPVA 4A9SA 4EC8A 2QD9A 3QKKA 1FGKA 2C3KA 3MY5A 3PVUA 2V5QA 3HVCA 1X8BA 3LXPA 3VS1A 2IZTA 3WZJA 4AU8A 1P5EA 4HCUA 3ZM9A 4G6OA 4B7TA 4GSBA 4FKUA 4PP9A 3RK5A 2J50A 4KD1A 2ETKA 3MA6A 3W2CA 5AV2A 5ANEA 4O1PA 4XP3A 4X6QC 3SHEA 3BQCA 3FUPA 3ZBFA 3TNWA 4ZTHA 3FL5A 4EOPA 4BR3A 4JR3A 3ZLYA 4BGHA 4AZWA 4C3RA 4ZP5A 3BHUA 4HJOA 4D28A 2DWBA 5B2KA 4L43A 3ZSHA 5CEMA 2PE2A 4NCTC 1IA8A 3ORPA 4FKJA 3D9VA 3V5PA 4IBMA 3D4QA 3EFJA 3W32A 3VBVA 2JDRA 1E1XA 4IIRA 1XH5A 2X9FA 3PFQA 3ZEPA 2BIYA 1YXUA 3KMWA 4KKGA 4PWNA 3WF5A 3Q96A 1WVYA 3FZRA 4L67A 5E7RA 2VWUA 4FL1A 2CGXA 3UVRA 1YHSA 4N6YA 1BI7A 4IQ6A 3KVXA 2ITPA 4XRJA 2OLCA 1PXOA 3PIXA 2QLQA 5CEIA 5IZFA 2GS2A 2ITYA 4XH6A 5KMNA 1PMNA 2WMVA 5KBQA 4QNAA 3C4CA 4EH6A 3BYVA 4XNEA 4I5HA 2UW8A 4U79A 2QVSE 2PVHA 4GT3A 3D15A 5ETCA 4CKIA 5CYIA 3H30A 2AYPA 3E62A 3MIYA 4RGJA 4F7SA 3HAMA 3GB2A 1QL6A 3C9WA 3EIDA 2BAJA 2BROA 3A7JA 3HRFA 3MPTA 3PPZA 3RK9A 3VUHA 3PDTA 2BZIB 5TOZA 4GYIA 3DFCB 2F57A 4UMQA 1ZZ2A 4RIXA 2PZRA 1SVHA 2VWWA 4TT7A 5AFVA 2QC6A 1Q62A 4V01A 2JEDA 4MKCA 5GIOE 4E73A 5AA9A 3RAHA 4GU6A 5ITAA 3TV4A 3O17A 3OEZA 1YI4A 4WG4A 1PXJA 3TN8A 4D1SA 5L3AA 4BFMA 4HVIA 4I20A 4O91A 2CLQA 3GCPA 2PVYA 3IW6A 4DT8A 2B1PA 1UVRA 3MTFA 4CMOA 5IQGA 2VO3A 4PY1A 2NPQA 5CEKA 2A1AB 4CQEA 3NWWA 2E9OA 3C7QA 1CKPA 4EUUA 3UJGA 5AM7A 1T46A 5IF1A 4WSQA 2BAQA 4NM0A 4AXAA 5LMKA 5IMXA 3NRMA 2YM8A 5TO8A 1JKSA 2VWXA 3EFLA 4YHJA 3VC4A 3W10A 4N57A 1AGWA 2ZYBA 4L3JA 4AN9A 3GI3A 1FINA 4RJ3A 3KF4A 3MB7A 3QALE 4WA9A 3VS6A 3ZO2A 2XIZA 3U4UA 2R9SA 4IVAA 3UO6A 3RP9A 3PVWA 3R0TA 4FGBA 4RC3A 2WMAA 3EN9A 4YLLA 3DXQA 1LEZA 5M4UA 1UNGA 2QCSA 4CLJA 3ATSA 3DA6A 4N0SA 5FD2A 4ERWA 2R5TA 3VUGA 2B53A 4ZY6A 5BNJA 3PG3A 4IEBA 2G2HA 4EONA 3G6GA 4QMWA 4TYHA 2HYYA 4FTCA 4U40A 4MXAA 3PXQA 3QUDA 2C0OA 3AC5A 3OW3A 4OBOA 1Q97A 1ZLTA 4YGAA 3FZ1A 1M14A 3R7OA 4NIFA 3RGFA 4E5WA 3ATTA 5FEDA 3MJ1A 2UZDA 2R3GA 3M42A 4NSTA 3UIUA 5IA3A 1GZ8A 3PXFA 5AV3A 4UN0C 4USDA 5LVOA 1R3CA 4OW8A 3AMBA 1A9UA 4F1OA 3H9OA 1REKA 2WMBA 2RFEA 3LIJA 4KKHA 4MHAA 1QPDA 4BI0A 1H1SA 3FZPA 4RFYA 4RJ5A 5ANDA 4FIHA 4UMRA 5BPYA 3S1HA 4EEVA 4FC0A 3T3VA 3NAXA 1WVWA 4A7CA 3PY1A 5AX3A 1Q8TA 4IZ5A 2OJIA 4O86A 3C4WA 3QBNA 4S30A 4GV1A 1FMOE 4WRGA 3F3TA 3SW4A 5C8KA 1UKHA 4CT2A 3P86A 4ONAA 4IAFA 3KULA 5A46A 2R64A 4KBAA 5HESA 3CJGA 3HLLA 4XG4A 4ALVA 3QRIA 4DGLC 3HV3A 3NUXA 4FNXA 4M15A 4Z55A 4CG8A 5IUIA 3E8NA 4FI1A 4G1WA 3R9OA 2PE1A 2C6EA 2OJFE 2C6TA 3OY1A 3QGWA 3TTIA 2X2KA 5BVDA 2WTJA 4I6FA 4AWIA 4J99A 2X8IA 3OCSA 4JQ8A 3QA8A 3TEIA 3ETAA 1KV2A 1PXPA 3FSKA 3AD6A 2BR1A 3PWDA 4M7IA 3N51A 5GJFA 2R3MA 3UZTA 4HW7A 3L8PA 1BMKA 2YITA 3RZBA 2JKQA 2YACA 4FIGA 4IB3A 2OH0E 4K0YA 1GIJA 5FXQA 3DS6A 2C5OA 4BI2A 2Z02A 5IDPA 4AX8A 4DEEA 3A7FA 5HX6A 3C0GA 3H9FA 1KV1A 4ZAUA 4H1MA 1KE8A 5M08A 2W17A 3CS9A 4F0FA 3HA8A 3ZDIA 3ZRKA 5J5SA 2VNYA 3AC8A 4U3ZA 2B9IA 2PZIA 4JDHA 4LRMA 4TWNA 4YHFA 3WARA 1H28A 2C3LA 2IW6A 5DFPA 3FKOA 2I1MA 3SD0A 1RW8A 2ESMA 1AD5A 4PMTA 2HXLA 4Z9LA 4X21A 3VRYA 3OWPA 2XK6A 2WFYA 3GOPA 4I24A 4NTTA 3JS2A 2WQEA 4Y46A 4B0GA 4BZNA 5JFXA 2HZIA 4U6RA 1UA2A 5DNRA 1F3MC 1CKIA 3I6UA 3KRWA 3GFEA 4I23A 1S9JA 5FLFA 2QOFA 3F61A 3GP0A 5EYKA 4G3CA 2W4KA 2CMWA 2FGIA 4FX3A 3WF8A 3QKLA 3DU8A 3DXNA 3ORZA 4L52A 3ERKA 3UIBA 4EK6A 5CU4A 3NW6A 4DHFA 3QZGA 2O65A 4QQTA 4BGGA 4C57A 2AC3A 4RA4A 4EI4A 2FUMA 2FA2A 3JVRA 2BIKB 3DBCA 5DT4A 2Z7RA 5FM2A 3KULB 3K3IA 3U6JA 5BUIA 4KWPA 2YZAA 1ZOGA 4FV4A 4W4XA 3EFKA 4KIPA 2RIOA 4EH7A 4DEGA 2RFSA 2WD1A 2UZOA 4FR4A 2XKCA 3KK8A 4OBPA 2WELA 4C2WA 4WUNA 3NIEA 5FQDC 3CC6A 5M06A 3BV2A 3ZLXA 3G6HA 4CKRA 3RPSA 2F7EE 5IA2A 4EOKA 3DT1A 1YWVA 2P0CA 2BPMA 3H9RA 2JBPA 5CAUA 3NW7A 4S2ZA 5ETIA 1RJBA 4DGMA 5F95A 4G9CA 4MTAA 3KL8A 2XNBA 3DQXA 4CGAA 2UZLA 3QZIA 2I6LA 2XK8A 3EWHA 4YJRA 3PE2A 5AP0A 4QQ5A 2RG6A 3MTLA 1O6LA 3IG7A 4LRJA 3R9DA 3DK7A 4I92A 4DFNA 3OY3A 4FSQA 3LAUA 4WG3A 4XG9A 5JFVA 4D1ZA 4XV3A 3WZKA 5AP7A 1XBAA 4A9TA 2PMLX 2JFLA 4F6SA 4GVAA 1XBCA 5KHWA 4MXZA 4AGWA 4HYIA 1VJYA 3HAVA 4K6ZA 3RAWA 4DFLA 5KMLA 4FTTA 3CE3A 2H8HA 4FIIA 4UWBA 1MUOA 5HCXA 4BGQA 1QMZA 4PDOA 3LXNA 4HNFA 5CI6A 1KUTA 3SOAA 1DAYA 1OBDA 2JC6A 1GIHA 3F3ZA 2WPAA 4IAZA 3HMMA 2B9FA 3MH1A 5JH6A 5EI8A 3OWJA 2QR8A 2YAKA 2OKRA 4EOLA 4NYEA 5EKNA 2F49A 5KUPA 5BUEA 3WILA 3BLRA 4C62A 1J7UA 2WMUA 4FTKA 4HNIA 4O96A 2ITTA 4TRLA 2JKMA 2GMXA 2ZAZA 4L46A 4EK8A 4FTOA 3PXYA 5HG7A 2W0JA 4PL3A 1WMKA 1MRYA 2BDJA 3I4BA 3EL7A 1PMVA 4BDBA 1ZWSA 4OT5A 2XEZA 2RFDA 2VTIA 5L2TA 4U81A 1JAMA 4C35A 4DGNA 3U4WA 4FYOA 4TYEA 4OR5A 4RC4A 4FK6A 4H1JA 1NVQA 3OOGA 4FV9A 4E3CA 1YKRA 2BHHA 1APME 5JZJA 2VNWA 3GC9A 3NUYA 3OEFX 4LGHA 5LJJA 3RZFA 5CEQA 2PL0A 1H01A 5HORA 3QXOA 4FZ7A 4DBXA 5AV4A 4GK2A 4YJQA 4YC6A 4ALUA 2XF0A 4JAIA 4IW0A 2I7QA 5E4HA 4HYSA 4XYFA 1CM8A 3F7ZA 2JIIA 2HW6A 2VX0A 2Y8OA 3LZBA 5DWRA 2CN5A 2IO6A 4FVPA 3UOJA 2W1FA 4CKJA 2C68A 4CG9A 3FI2A 3CBLA 3F3WA 3JVSA 3MS9A 2V7AA 3TDWA 4LFIA 2YFXA 4PX6A 2X6DA 3LFSA 3S4QA 1VEBA 3KRLA 2XBAA 3MFUA 4TKSA 2W1EA 4I5MA 4BC6A 2AUHA 2XKDA 4HGEA 4L68A 3KMUA 1XH9A 4BBFA 3LLAA 2C30A 2XNEA 3CKXA 1U5QA 1UNHA 2Q0BA 2ERZE 4ZJIA 4FEUA 3RWQA 4EH9A 2PSQA 2YERA 4KIKA 3OWKA 3F9NA 3PZEA 4KKEA 3TG1A 2GU8A 2BZKB 4FSRA 2YIRA 1W84A 4TYHB 5C4KA 2EXMA 3PUPA 3Q5IA 3MH2A 2YCQA 4F9YA 5CF6A 2BUJA 1BLXA 4L6QA 3QTUA 1U4DA 3FE3A 4GUEA 1CDKA 4CFWA 3E92A 3RPYA 3W55A 3EQRA 3R28A 1SVEA 3UODA 5M56A 4E6QA 1ZZLA 3FLSA 5EW3A 3HRCA 4QP9A 3OCTA 3UMXA 4JBVA 1ZXEA 5HLPA 4IFGA 2O8YA 4RJ7A 4I6QA 3U51A 4JRVA 1NW1A 1NY3A 3R73A 3NS9A 4YLJA 1UNLA 5JGDA 2HK5A 4D2TA 4ZJVA 3EQBA 2PUNA 1OMWA 5IU2A 4TPTA 3VS0A 2NRUA 2YIWA 4EOJA 3Q32A 4OBQA 3EJ1A 2XH5A 2WTVA 4QMXA 5DRDA 4DEBA 1FVRA 3RAKA 3GNIB 2R3QA 1SNUA 2ZM1A 5E8UA 1WBVA 2XMYA 5HNIX 1YXXA 4O84A 2ZB0A 4CMUA 1DM2A 2PE0A 4FSYA 1OECA 3FLNC 4FF8A 4O81A 4JIKA 2YWPA 3COKA 3MIAA 5EG3A 3DFAA 5KMOA 4QMQA 5CF8A 2ETRA 2XVDA 3JYAA 2AC5A 3IK3A 5GZ9A 3HGKA 3EQIA 2UVXA 1RE8A 4C3FA 5CSVA 1E1VA 2X81A 1GJOA 3BLQA 3KRRA 2IVUA 3A7HA 3MVLA 5HCYA 2R3OA 5CZHA 4ACGA 2XYNA 4ARKA 4AF3A 4DH5A 3P7AA 4WG5A 3DKCA 2VX3A 4CZTA 3S00A 3FWQA 3Q6UA 1F5QA 2JDSA 5C4LA 3FXZA 3Q9XA 3R04A 2YLEA 4RSSA 3OBGA 1TQMA 4K11A 4I4EA 5TR6A 2PK9A 4HPUE 5KNJA 4FTJA 3VQHA 3MYGA 5BMMA 1OIUA 2OXYA 3FMLA 3QCXA 4ANNA 5FWKK 4FKPA 3W2SA 4RQVA 4YO4A 3FC1X 3E93A 3QD0A 3ZXZA 4AG8A 2G01A 2G2FA 3ORNA 4IWOA 4NU1A 4XG2A 3BYMA 4ANLA 1Q41A 3S2PA 2Z2WA 3I5NA 4GS6A 1G3NA 4OTHA 4IC7A 3TT0A 1M7QA 3PRFA 4MEDA 2WQOA 3U55A 4OTRA 2O5KA 3D94A 1JSUA 3QYZA 4WHZA 5DI1A 5EM6A 4EJNA 4TN6A 5DLSA 4ANMA 3V6RA 2XNNA 4CXAA 5IUHA 4RVMA 3MVHA 1B38A 2QOIA 2B9HA 5M4FA 1WBPA 4LQMA 1PRYA 4M69A 3AC2A 3K2LA 3MW1A 3S0OA 4JS8A 3LXLA 3UP2A 3H4JA 4EOSA 5FEQA 4AGCA 4QQJA 5CU0A 5H8BA 4AE9A 3DBDA 2CKOA 5CAPA 2W1DA 2WTWA 4S33A 1UU3A 1JVPP 3FSFA 3O96A 2HIWA 5C26A 4DITA 2Z7SA 2Z7QA 3KXZA 1XH4A 4CCBA 5ACKA 1OPKA 1O9UA 3ZUUA 3OCGA 5CNOA 4IACA 4K18A 2PVNA 4ITHA 3LXKA 4WSYA 3TKUA 3VF8A 4FKSA 3OF0A 3U87A 4DT9A 3QQUA 4BDIA 4DC2A 4OTGA 1Y8YA 3R1NA 5AIKA 5HVKA 5A4CA 2XBJA 3ROCA 3BLHA 4A4OA 3RINA 4ITIA 4UYNA 1OIYA 3I6WA 5DRBA 2NO3A 1M2PA 2QODA 4FKTA 2W5HA 4IZAA 4RJ4A 4XRLA 3TZ7A 3ULIA 5A4LA 3VJOA 4GG7A 1IASA 3CLYA 1KWPA 4LOPA 2WOUA 3ZOSA 3KCKA 2RGPA 3GFWA 3BU5A 4ZEGA 2JDTA 1H00A 2ZV9A 1Q8UA 3VHKA 1TVOA 4R78A 1H24A 2VWBA 3TUBA 4JG7A 3U54A 5IQDA 3TV7A 2G1TA 3RI1A 3QU0A 1UU8A 2YEXA 1MRVA 3E3PA 3ZSGA 3EZVA 1SMHA 5LARA 2O64A 2CCIA 4FSWA 3VUDA 2F4JA 2OICA 3QWKA 5D7VA 4BIBA 4ACMA 3FZSA 5LVPA 4IDTA 2IWIA 2X8DA 3HP2A 4C59A 1L3RE 3Q04A 4G17A 5C03A 2Q0NA 2JDOA 5LMBA 2OJJA 2F2CB 4EL9A 1P2AA 4RJ8A 2R3IA 5HEZA 3D7TA 4FUYA 5EYCA 4P4CA 3TWJA 3FYJX 1ZOEA 1UWHA 2BMCA 1Q4LA 1O6YA 2OG8A 2PVJA 4YZ9A 3E8DA 5AMNA 2A4LA 5AIRA 5HZNA 4AFEA 4BCMA 4BCJA 3KXXA 2VTRA 4FVQA 3QWJA 4V0GA 3LVPA 2C6KA 3MB6A 4IWPA 4V0GB 4BYJA 4IX3A 5AUTA 3G51A 3AQVA 2UW7A 4ZSGA 5AR3A 4JIAA 1OGUA 4DGOA 5AM6A 3II5A 4D5HA 3PA4A 2YM7A 3BHYA 3IS5A 2J9MA 4XBUA 3CTQA 3F88A 2OIQA 5A4EA 2Y4PA 3GU4A 1KE5A 1YOJA 3ZYAA 3L8VA 5I9YA 4YJPA 2XB7A 1H1RA 4S32A 3DY7A 5AAEA 3E88A 3Q9YA 4J97A 1M17A 1M52A 3FKNA 3OMVA 2DQ7X 5ANOA 4ZIMA 2E2BA 3ACJA 2VGPA 4RIWB 2XCKA 5JRSA 3LMHA 4QMZA 4DH7A 3FAAA 2YN8A 4DN5A 1OBGA 4UYAA 4AZEA 2BKZA 3LFFA 5IQAA 3T9IA 3ZLSA 4FODA 5JRQA 4U7ZA 3PTGA 3LJ2A 1PXMA 1OKWA 3BHTA 3PJ8A 5EHYA 2C5VA 4DAWA 4RZVA 1OL7A 4EHEA 1QPCA 2QOOA 3KC3A 4BKYA 2C47A 4YJUA 3VS5A 4ZJJA 3HMNA 3A99A 3LFEA 3UIXA 5BMSA 4CVAA 5BX0A 4XG8A 2B0QA 3GQIA 4GJ2A 4D4RA 4HVSA 3SKCA 3SGCA 1PXIA 4HCVA 3ZFXA 3W8LA 3R63A 3JY9A 4U5JA 2W96B 3WZDA 1YDSE 3ALOA 3P79A 3GC0A 3R22A 4EHGA 5I3RA 1OKYA 4YZNA 4E20A 5T68A 1I44A 1PYEA 4BCIA 1W8CA 3VHEA 3VUTA 4CQGA 4EBVA 3VWAA 1ZRZA 3I5ZA 2CCHA 3NUAA 5L6PA 2CNQA 4OTIA 4FZFB 4DINA 3R1SA 2PMIA 5AUXA 4EH3A 3KQ7A 4DA5A 1IA9A 4E4XA 5I9UA 5EOLA 4PP7A 1WZYA 4F1TA 4YPSA 1PJKA 3NNVA 4C4EA 5CXHA 4AE6A 2WQBA 2WEVA 3WZEA 2X9EA 1KE6A 3GOKA 5AP5A 4CCUA 3RMFA 2PVFA 3PYYA 4YU2A 4DE4A 4GJ3A 3NCZA 3KN5A 3NYVA 3SXSA 4JG6A 3OS3A 5IQFA 4BBMA 2J0IA 2NRYA 4M13A 4E8AA 5JFWA 4KIKB 4F08A 2XP2A 2XKEA 3WI6A 1R39A 4CFMA 3OP5A 3SAYA 2W1IA 2EVAA 3WE8A 4XP2A 2XEYA 4LM5A 3KXMA 3L8SA 1XHAA 4JDKA 5F94A 3QTZA 4O0WA 2C0TA 3HKOA 5F20A 3VS4A 4FV7A 4MH7A 4U9AA 4Y5QA 5L6OA 4ANBA 5HD7A 4FTMA 3NUPA 1UU9A 1UWJA 1XJDA 4IANA 1M2RA 4TNDA 4QMLA 3AOXA 2HZ4A 3TTJA 4DBNA 1YQJA 4J8MA 3P1AA 4R3CA 3P5KA 3A7GA 3UYTA 4I0TA 3VW6A 4RA5A 4BCPA 5J9ZA 2HELA 5ANJA 5F1ZA 2J5FA 3A62A 4KAOA 4BN1A 4YP8A 5B7VA 1REJA 5FUTA 4N4SA 2XK4A 1V0PA 4ANSA 5CZIA 1STCE 3GCUA 3KGAA 3NR9A 5DN3A 4CV9A 5K5XA 2P55A 1NXKA 2ZV8A 1J91A 2HXQA 2YZLA 2C4GA 4D2PA 3O51A 4IX6A 4B99A 3E7OA 5IH4A 5IMEA 3PLAE 2FSLX 2ZM4A 3BGQA 3DZQA 4C8BA 2VTNA 5L2QA 2XS0A 4FL2A 3RAIA 4K8AA 1OKVA 2ZJWA 3JY0A 4I6BA 4FTNA 2FSTX 4CSVA 3RKBA 2QU5A 4KRCA 4IX5A 1PW2A 2JAVA 3E3BX 2QO2A 3E64A 3HYHA 5CALA 4L7SA 1W98A 4Y72A 4Y83A 4O6EA 5JSMA 3RVGA 4PMPA 3ID6C 3MVJA 4DFZE 1I09A 1QPJA 4QPMA 2OWBA 3FXWA 3HP5A 1DI8A 3UNZA 2FSOX 4FOBA 3HZTA 5EOBA 4CV8A 4LRKA 3IDBA 3IO7A 4NH1A 5B2MA 3L9NA 2J0JA 2HWOA 4G34A 5CF5A 3LW0A 4O21A 3R02A 4TXCA 5DEYA 2QQ7A 5CXZA 1H27A 3KXNA 2QG7A 5HLWA 3U8WA 4D9TA 5JEBA 3FJQE 3CY3A 2ACXA 5D12A 1WBOA 4M0YA 1Q3WA 5AUZA 4FA2A 4HVDA 3TZMA 4CEGA 5HIEA 5JQ5A 2XA4A 3TUCA 5HTBA 3RALA 5I0BA 3HX4A 4DEIA 4BI1A 4J52A 3BYUA 5E8TA 2IZUA 5FBOA 4MAOA 3UPXA 2OXDA 4IZ7A 1KOBA 2IVSA 3DAJA 4LGDA 5M55A 4O0VA 2X7GA 2VWYA 5AP1A 3WF7A 2W99B 2FO0A 2VO7A 4TL0A 3CXWA 4OT6A 5HE1A 4DFXE 3FC2A 4O7YA 4C7TA 4FNYA 1LP4A 2J4ZA 3TIYA 3C0IA 3PXZA 2BRMA 4Q9SA 5CSXA 4FSUA 3CQUA 3CTJA 5HBEA 3TKHA 3R7YA 4DLIA 5M44A 4GEOA 3O8TA 4PDSA 1OUYA 1ZYLA 4YPDA 3PXKA 2VAGA 4KA3A 2R7IA 3DDPA 4O27B 4R6VA 2G2IA 4I21A 2Y4IC 3DB8A 1IEPA 4RWIA 2X1NA 3Q9ZA 3QRJA 4ACDA 5JKGA 4YUQA 3DDQA 5DG5A 5DGZA 3EQCA 4KS7A 2OO8X 3GGFA 4IX4A 3TUDA 4MNFA 2C1AA 2PVKA 3H3CA 5KMMA 2RL5A 4AOTA 4D5KA 2C1BA 4RT7A 5JGAA 3ZRMA 4I0RA 4LMUA 3ZDUA 4BDCA 3R2YA 3DTCA 5L2WA 2XKFA 4Q5HA 3F3UA 4ZTLA 3GC8A 4XLVA 5JK3A 4FZAB 3HV6A 3R2BA 4UXQA 4E26A 4A4LA 4PRJA 5CI7A 2R7BA 3DXPA 4EH2A 2W1GA 3QCYA 4RMZA 3DKGA 2CSNA 2ITNA 2J5EA 2OF4A 4BTMA 1XR1A 1ZY4A 1J1CA 3QQKA 4IH8A 3FY2A 1URWA 4FZ6A 4M8TA 4FTAA 3R71A 1NA7A 3Q6WA 4O7NA 2ERKA 2W4JA 4DG2E 3I0OA 1FGIA 4IB0A 3FMDA 4F7JA 4ITJA 3MVMA 5L8JA 2UVYA 2OF2A 3NW5A 4YZDA 4G6NA 2E9NA 1PMEA 3W1FA 5FRIA 1HOWA 4YTIA 4Z16A 3Q2JA 4ZY5A 3OVVA 5KMIA 3E5AA 3GQLA 4O7VA 4YTHA 5TT7A 2OBJA 4X2FA 5M07A 4LV5A 2J51A 4IVCA 1GAGA 3QTWA 5E8ZA 5L8LA 3AMAA 3KXHA 4NTSA 4BWKA 2VTJA 3NMUF 4IJ9A 2PVRA 3OT3A 3W2RA 4Z7GA 2A2AA 3FY0A 2GHMA 4UEUA 4H36A 2XCHA 5AR5A 4MX9A 4G3GA 2WTIA 1FVVA 2X39A 3VS3A 2HZNA 1V1KA 1WFCA 3RPOA 2OU7A 4ZZOA 3QUEA 4HVGA 5HO8A 1YXVA 3L1SA 4BDJA 3GU6A 3H10A 2WGJA 4HGTA 1TQIA 3Q4CA 5LMAA 3NVKI 1XKKA 4AFJA 3MJ2A 4IE9A 5C8MA 3QC9A 4JDIA 4XLIA 1Y91A 5IG1A 2HWPA 1PXNA 4GIIA 2PZYA 3V8TA 4ZMEA 2JIVA 3PJ2A 2BHEA 1OITA 3E87A 4BCGA 1H26A 5JMSA 2HOGA 2Y7JA 4ZSEA 4H05A 5AP3A 3G9LX 2QLUA 3HECA 4II5A 2UVZA 3QLGA 4BL1A 4GKIA 3ODYX 5FP6A 2H9VA 3IGOA 4U43A 3ZO1A 3LQ3A 4O7TA 2KULA 3GENA 2QO9A 3GC7A 3QCQA 4OUCA 4NM5A 4TY1A 1R78A 2BRHA 3R7IA 3BU6A 5CASA 3SV0A 2GNIA 2HCKA 1Q61A 3C1XA 5HQ0A 2P3GX 4C33A 4YBJA 3SG9A 5HX8A 1VR2A 4PL4A 3FLZA 3L9PA 2CLXA 1FBNA 1RDQE 3D7TB 1OPLA 3EOCA 3P7BA 5E8SA 2B52A 2DYLA 4LOQA 3FMJA 4G5PA 4FTRA 3V5LA 3DAEA 5EYDA 3AC1A 5IEVA 4OTWA 2WMRA 4PNKA 5JT2A 4DYMA 2EWAA 4KBCA 4KIQA 4XS2A 2UV2A 2BTRA 3D2IA 4D4SA 4F65A 3R7EA 5E8VA 4FGRA 3OROA 4CYIA 2UW5A 1Q8WA 2J6MA 2W5AA 4FMQA 3LFAA 2GTMA 2Y9QA 4OTFA 3WZUA 4BDHA 4BYIA 3P78A 2V7OA 1WAKA 2YM5A 4DH1A 1ND4A 4G9RA 1GZKA 4YZBA 4OLIA 4D55A 2JBOA 5HNGA 3IOKA 1W83A 4FIFA 3D0EA 5ANKA 4MYGA 4MBLA 3DOGA 3ZM4A 2IVTA 2ITUA 4PMMA 4MXCA 3FMMA 5AP6A 5HU3A 3AT4A 4N70A 4E6CA 4L45A 5HD4A 3NUNA 5D1JA 5E1SA 4MXYA 4MXOA 3E63A 3CJFA 3MSSA 4FEXA 1TQPA 1Q24A 2LGCA 4TZRA 4M97A 5AV0A 4G3DA 5CENA 4F63A 2PZPA 1BL6A 2OJ9A 2B9JA 4KSQA 2JFMA 2WQNA 1UKIA 5D11A 3FQEA 3D2KA 5LVLA 5AAGA 3UPZA 2R3KA 5FM3A 5GIPE 3G9NA 2E9PA 2JD5A 3EKNA 4D4VA 4E5BA 4DEAA 5FBNC 3HMPA 4MQ1A 3BI6A 5I9XA 5BYYA 3BGPA 5AR7A 3SOCA 5A6OA 3FPQA 5ANIA 2P33A 4AZFA 2J7TA 2WHBA 4K77A 4CRSA 3R8PA 4NT4A 3TI1A 3QKMA 4ALWA 2OIDA 4BB4A 4YJVA 5C27A 5CF4A 4FKWA 4R3RA 3T8OA 5K3YA 3WF9A 3SX9A 1YI3A 2Y4IB 4GRBA 4H3BA 4DFYA 3OTUA 5LWMA 4D1XA 1CMKE 3IW7A 4EC9A 4R3PA 1WBSA 3LLTA 3VBQA 4DH8A 2OZAA 4QP2A 1P4OA 3QAME 2KTYA 3EFWA 2UZBA 2CJMA 2Y6MA 3HDMA 3AD4A 3R01A 4QYGA 3V8WA 4AOIA 3IQ7A 2YDIA 2YCRA 3S3IA 4FIEA 4J7BA 3BZ3A 1YI6A 2UZVA 2V0DA 2W1CA 4FT9A 4D2WA 4A9RA 5HBJA 5J87A 4G6LA 4X2NA 5I5ZA 4I93A 4FKIA 3UOKA 5M4CA 2W5BA 3UP7A 3P0MA 1YW2A 5L2IA 3RM6A 3UG2A 1FPUA 2FB8A 4YZMA 3I7BA 4PTEA 4DTAA 5TF9A 5B2LA 5C9CA 5K4IA 5IA1A 5FGKA 3EN7A 3PY0A 4JR7A 4JX7A 4LL5A 3MA3A 5BVEA 3DJ7A 3ZFYA 1BX6A 1V0BA 3PWYA 4R5YA 5CS6A 3ZTXA 1YXTA 2VTHA 1K9AA 4Y5HA 3TNQB 4F70A 4IM0A 2UZNA 3MI9A 5GNKA 2CGVA 3DPKA 2XRUA 4U80A 4RIYA 4M68A 2X7FA 3Q5ZA 4ANOA 2PYWA 5AR2A 2PWLA 5E8WA 4RVTA 4KNBA 2B4SB 3ACKA 3E8CA 3QZFA 3KA0A 4EOOA 1LUFA 3RPRA 2R3NA 5AX9A 1OUKA 4YMJA 3LMGA 1YWNA 4MBJA 4CTBA 4DTBA 1Y6AA 3VBXA 5E1EA 2JIUA 4DG0E 3A60A 3AT2A 2GNHA 2VD5A 2EXEA 1S9IA 3EHAA 1CSNA 1LEWA 3D5VA 4F7LA 2PMOX 4QTBA 4FSZA 3QQFA 3OTVA 3PJ1A 4QO9A 3SRVB 3VJNA 4FEQA 5AUVA 2GQGA 4LMNA 3BELA 3OWLA 2PPQA 4J53A 2QOCA 3QTSA 4IHPA 4FSMA 2PZ5A 4AGUA 4NK9A 3MY0A 3OHTA 3VF9A 3F5XA 4FKRA 5DMZA 4IAKA 4IB1A 2OGVA 2SRCA 1U54B 3N4UA 2ZDTA 3HL7A 3UIMA 4W9XA 3I79A 4TWPA 4ANQA 2BZHB 5DA3A 5DPVA 3FZOA 4B9DA 5CANA 4QYYA 3GCSA 2O63A 2XIKA 2OIBA 3COHA 3NUUA 3PJCA 5GZAA 5KMKA 2Z60A 3MFSA 3NNXA 4JG8A 1OVEA 5J8IA 3VAPA 3O50A 3NLBA 4E4LA 3B8RA 4IWQA 3POOA 4NJ3A 4QP3A 4R8QA 1IR3A 3O8PA 3R6XA 4X2JA 5CSHA 1VYZA 3V04A 4AAAA 3KRJA 4ZTMA 4I3ZA 4R7BA 4RG0A 1PYXA 2OK1A 1JKTA 3BE2A 4TW9A 5HIDA 2UW4A 3HRBA 3UQGA 4RX5A 3Q60A 4MWIA 3D5WA 2GFSA 4WD5A 1YVJA 4E5AX 2IPXA 4W9WA 3R8ZA 3V01A 2VN9A 4LUDA 3LFNA 5A14A 5DYJA 4NM7A 1ZYDA 4NKSA 3LKMA 4O38A 2BAKA 3BPRA 2CN8A 2QU6A 4X2KA 4U97A 5ACBC 4W8DA 5GINE 2YABA 4GMYA 5FP5A 5DBXA 4AZVA 3G33A 3O8UA 5E8YA 4YTFA 4PQNA 3ZU7A 5EYMA 5A3XA 3F3VA 3OFMA 3CSVA 4U8ZA 3AGLA 4FNWA 2PUIA 3AGMA 4LL0A 5J1VA 2ZB1A 4QMVA 1GIIA 5JGBA 2YLFA 2X6EA 4L3LA 4ZTRA 3RCJA 3RK7A 3NCGA 2XUUA 3LCDA 3Q4ZA 4PNIA 1BYGA 2WB8A 4KS8A 5AAFA 2W7XA 1OL1A 3VBWA 3QTXA 4F0IA 4F4PA 5HE2A 3IECA 4UZDA 5HNBA 1DAWA 2VTOA 4NWMA 4OTDA 3C5IA 2W1ZA 4O0UA 3VUIA 4HPTE 2ITZA 4JQ7A 3SXRA 4L7FA 3WIKA 3P23A 4RIWA 4IM2A 1SNXA 4BY9E 4AQCA 3I0QA 3LJ1A 2IN6A 2A19B 3GEQA 3NYOA 2BTSA 4G16A 4C38A 2A27A 3F2NA 3PXRA 4ID7A 4O0XA 4B6LA 4FT7A 3UBDA 3D7ZA 2RF9A 3DB6A 5EI6A 4BCFA 2NP8A 3R8MA 3VRZA 3QCSA 1XH7A 4FV6A 4WRSA 5LCKA 3W33A 1A48A 2P2IA 4D2SA 3F2AA 1Z5MA 3W2PA 3QZHA 4UV0A 2B54A 4FV8A 2CKEA 5EM5A 5EW8A 3HNGA 4AW2A 3HEGA 5FXSA 2QI8A 2R3LA 4IAYA 5KMJA 2CNUA 1BI8A 1SVGA 5J9YA 4XV2A 4GL9A 4WBOA 4EHZA 4LYNA 5DEWA 5HU9A 5IDNA 2JKKA 3SLSA 4IB5A 1NVRA 1B39A 2J0MB 3LHJA 5KHXA 5E91A 3ZH8A 4M84A 5H8EA 2PVLA 5HCZA 1XH6A 3QYWA 4FT5A 3DKFA 2J2IB 4PUZA 3DV3A 1JKLA 4TYGA 4C36A 1IRKA 1V0OA 4X3FA 5C1QB 4C4GA 2C69A 3UE4A 3MY1A 2UW6A 3DBFA 4R1YA 5EHOA 4P5ZA 3DJ6A 3P9JA 3FEGA 3VO3A 4F9AA 5F9EA 2HY81 5CT7A 2C3IB 3W2OA 2Z7LA 3PPJA 2FYSA 5FXRA 3L9MA 3KU2A 4GUBA 4HZRA 4YBKA 4XOZA 4ZLZA 1W82A 3UDBA 4O83A 2IJMA 4MF1A 3QQHA 4S31A 4UWYA 3G0EA 1MP8A 4CFVA 3JR1A 3ELJA 3IPHA 1CKJA 4WKQA 1ZMVA 1G8AA 3KMMA 4DFUA 4HVHA 4X3JA 5CNNA 4RIYB 3ODZX 1J7LA 3Q4TA 3MN3A 4XG3A 3ZXTA 1KE7A 1DI9A 5BUJA 5ICPA 3EMGA 4TTHB 2C0IA 2RSVA 4FV1A 3ZO4A 4BDDA 2XIXA 1U59A 4AT4A 4FSTA 2UZWE 2YAAA 2R0IA 3Q3BA 4I5CA 2XJ2A 4MNEB 4WNOA 3SDJA 5IQBA 2XJ0A 1RQQA 4NW5A 3ZCLA 4BVUA 4E93A 1OL2A 5I4NA 2W9ZB 2ZMDA 4O2ZA 3QTRA 5AR8A 3PP1A 4UXLA 2BZJA 3U6HA 2WMTA 3TCPA 4BKJA 2PMNX 2J0KA 4CFUA 5HG5A 3N4TA 3PSBA 5H2UA 4C61A 1JNKA 4J95A 4GK4A 5AV1A 3EQDA 2GHGA 3NDMA 5DR2A 1SM2A 2O0UA 2OW3A 3QQGA 3FLWA 1FOTA 2QNJA 2ZMCA 2CGUA 1JSTA 3EN4A 4QPAA 3N4VA 4ASEA 3LQ5A 3K3JA 3U9CA 4RX9A 4EHVA 3A4PA 2WXVA 1XO2B 3OXIA 5CAVA 4TNBA 4RFMA 2ITWA 5HVJA 3QLFA 3CEKA 3KREA 3THBA 1A06A 3CD8A 4B4LA 4FV0A 5I9VA 1OL6A 4OTPA 4CNHA 5M09A 3L9LA 3NPCA 4U45A 3UYSA 4UMUA 3NZ0A 5HTIA 3K54A 3E8EA 2VWZA 4ZLOA 2X2MA 1OZ1A 4XX9A 2BRBA 4R7IA 4ACHA 4AS0A 3BCEA 5DVRA 2UW3A 3ANRA 3FXXA 4BDAA 4BRXA 2CKPA 3DCVA 3QC4A 2GFCA 5HE3A 5FDXA 5AP2A 5EHLA 3PJ3A 5BVFA 4PTGA 2C3JA 2HENA 3PLSA 4KB8A 4UB7A 1NVSA 4H39A 3QF9A 3T3UA 3FQHA 1BKXA 5AADA 1QPEA 5J9LA 4GFMA 4XV1A 4F0GA 1YDTE 2YISA 2GNLA 3P7CA 3FI8A 4Q2AA 5EQYA 4FTLA 2UW0A 3UVQA 5CEOA 2C6OA 1M2QA 3F7WA 3NNUA 2WMQA 4PV0A 4E4MA 3LJ0A 5CAOA 4MXXA 4DG3E 4EWHA 1H8FA 3GU7A 3EH9A 3I81A 4FTUA 4RJ6A 5CU3A 2X2LA 3VIDA 4EQUA 4WNMA 4F64A 4R7HA 2CKQA 4M0ZA 5IQIA 3FV8A 4J1RA 4L8MA 4EZ3A 3V5QA 3UC4A 4UBAA 2OFVA 3HUCA 4MCVA 3OT8A 2RKUA 4V04A 4W4YA 3ZLWA 4H3QA 2QR7A 2V62A 4GFGA 4NZWB 3DKOA 4CYJA 3GT8A 3R83A 5TKDA 4KSPA 2XNGA 2I0YA 4UWCA 5EM8A 4NL0A 1TKIA 2X8EA 2H6DA 1AQ1A 4AA0A 4QYEA 3SA0A 4PF4A 4EK5A 3QD4A 4RWLA 3ZEWA 3W16A 4EQCA 2EU9A 4QMSA 4F9CA 2ZVAA 4UALA 4FL3A 4QTDA 2EB2A 3DAKA 4WNPA 5GJDA 3D14A 4JJRA 2A0CX 5FG8A 3L8XA 5J79A 4O2PA 4Z3VA 2ZDUA 2C6MA 2UUEA 4K9YA 4ERKA 3G90X 1F0QA 4L53A 4KABA 5GJGA 3R7UA 5IQCA 2CHLA 3AMYA 3DLZA 5EH0A 3TDVA 4FVRA 2REIA 4IFCA 4YSMA 1ZYJA 2VUWA 4FV5A 4TYIA 4YC3A 4YHTA 5DT0A 3BHVA 5JQ8A 2OXXA 2X4ZA 4IZYA 1IAHA 3OXZA 4R1VA 3VBTA 4C02A 3ZUTA 4DEDA 5I9WA 5A9UA 2WZJA 3UMWA 3BYOA 3B2TA 3Q2MA 2VRXA 5IEYA 5D10A 4CFFA 3ITZA 2W4OA 2P2HA 3QXPA 2QHNA 4CZUA 4J98A 4F9WA 2ITQA 3FMHA 3O7LD 4QD6A 4BCQA 5H9BA 1W7HA 4EZ5A 1PMUA 1JPAA 2ITVA 5JN2A 2XNMA 4WBBB 3QFVA 5HO6A 4C3PA 5BQ0A 2PTKA 2QOBA 3QX2A 2VWVA 2ZV2A 4OGRA 4ZZNA 4QYHA 3UGCA 4PPCA 4BZDA 4C34A 4C2VA 3EQGA 2QG5A 3I1AA 5AWMA 3R7GA 3LPBA 3GVUA 4X3FB 4XBRA 4F99A 4QP8A 4YURA 4LG4A 5G6VA 3W2QA 3BWJA 4P2KA 4C4JA
chains in the Genus database with same CATH superfamily
4HGSA 3F5GA 5HBHA 4XUFA 4BZOA 5C8NA 1ATPE 3R8UA 2QOHA 4EH5A 3PSCA 3C0HA 4BDKA 3QA0A 4J8NA 5ETAA 5HICA 5CU6A 4PL5A 4GG5A 2J90A 1H07A 4RQKA 1OPJA 1UU7A 3Q52A 4ZZMA 2Q83A 1JBPE 3Q4UA 3R8LA 4KINA 4AGDA 2V22A 3TV6A 2YWVA 2G15A 2BFXA 4RRVA 1KSWA 2YIYA 5KO1A 3PG1A 3H0YA 4KRDA 4K33A 4JOAA 3RTPA 3FI4A 3O23A 4EUTA 5J5TA 3SVVA 1JSVA 1PKGA 4M69B 3GCVA 4BWXA 4PDYA 4D2RA 3TM0A 2ZV7A 4RZWA 2OJGA 4P7EA 4ACCA 4FYNA 3CKWA 5IEXA 4O7ZA 4DDGA 2ZOQA 5HI2A 3REPA 2R4BA 3LCSA 4HYUA 4F1MA 3A61A 3NYNA 2WTKB 4DLJA 1G8SA 1J1BA 2F7ZE 4RVKA 1ZMUA 3VONA 4UY9A 2IZSA 3P5JC 2WMWA 4QMOA 5DT3A 4EWQA 4U42A 4RC2A 1ZYCA 4APPA 4EYMA 4EZ7A 5ANGA 2B7AA 3C5UA 2X0GA 3C13A 3GU8A 4WUAA 5J1WA 4FG7A 3PRIA 3FZTA 3UOHA 3AC4A 4FNZA 1URCA 2PUPA 3B2WA 4JL9A 4GCJA 4QP6A 3WOWA 3BQRA 3HV4A 4QMMA 3OUNB 4ZTSA 4E4NA 5BV3A 3UO5A 5HE0A 4WIHA 4Y85A 4L9IA 4MVFA 1ZYSA 5HIBA 4G31A 5D9HA 3V5TA 3BBWA 5IQHA 2YJSA 4IWDA 2R0UA 4UMTA 4YJSA 4EBWA 2LAVA 5HG9A 4FZDB 4KIOA 4E1ZA 5DH3A 2VO0A 4JAJA 3GBZA 4I0SA 2WO6A 4EORA 3SG8A 3CQEA 4I22A 4X6RA 4M12A 3LFBA 1XBBA 2QKRA 3OXTA 1WBTA 1EH4A 2XIRA 3MPAA 3D5XA 4BIEA 4ENXA 4AN2A 4O22A 3PA3A 4XG7A 4NEUA 3ZC5A 1K2PA 4FBXA 3O0GA 3V5JA 4BCOA 1OKZA 3HUBA 4O6LA 5BVWA 4OAVB 2QHMA 3CD3A 3MESA 3P4KA 3HA6A 3ZONA 4MD9E 3SC1A 4G3FA 2YCFA 3V3VA 3VQUA 4GU9A 2ITOA 3DBEA 4B8MA 4E6DA 5AUUA 4FKLA 5JFSA 3IGGA 1ZARA 2GHLA 5G1XA 4Q9ZA 2ZM3A 4FEVA 4BDEA 4FTIA 5I9ZA 5HLNA 2YM3A 3FLYA 3R9RA 3NNWA 4FE2A 2WOTA 3LMIA 4X3FC 1GOLA 3K5UA 1H1PA 3MH3A 3C4ZA 2YA9A 3NSZA 4FTQA 4EKKA 4IMYA 3HDNA 4AZSA 4BF2A 2WNTA 2BKKA 4LDTA 2FH9A 1H25A 1GZOA 3IW8A 3VUMA 3CQWA 2ONLA 3B8QA 3E7VA 2BCJA 3ZZWA 3BV3A 2BRGA 4TYJA 2VWIA 3R1QA 2PU8A 4R77A 2GNFA 5K0XA 3JPVA 5FDPA 1MQ4A 4QMNA 2DS1A 4TWCA 5A4TA 4QNYA 3D83A 3ANQA 5EDRA 5BVKA 2XM8A 2O3PA 3EZRA 4FICA 2Y0AA 4C4IA 3R00A 4F9BA 3BEGA 5LVMA 2X0OA 4FG9A 4YC8A 3QTIA 3COIA 3EN6A 5KCVA 3UO4A 4W4VA 4AUAA 3ORXA 2XAMA 4AQKA 3MFTA 2YCSA 3NIZA 3KKVA 2I0HA 1U46A 3HMOA 3CPBA 3O71A 3PP0A 1LR4A 5DHJA 5HTCA 3VW8A 4OAUC 3DBQA 4QT1A 5CVFA 1XWSA 4QP4A 2ZFYA 3RM7A 4AW1A 2HY0A 4FSNA 4PDPA 3CIKA 2F7XE 2OI4X 4R5SA 2VTSA 5KKRB 2X4FA 4EJ7A 1UV5A 1OI9A 2FVDA 3KY2A 4FG8A 3RWPA 5LQFA 3C4EA 2OFUA 3P08A 5CSWA 3LM5A 3F5PA 4H3PA 2XIYA 4EOMA 2GNJA 2EXCX 4PPAA 4Y8DA 5EW9A 3VULA 4O82A 4EK3A 4JRNA 3HV5A 3QQJA 3RCDA 3TIZA 2CPKE 4FT3A 4L44A 2R3HA 4JBQA 1NT2A 3ZUVA 1PY5A 4X7QA 4J71A 5JZNA 3KK9A 3ZRLA 4EH4A 1P4FA 4JLCA 3QRKA 4YJTA 4C58A 2WU7A 2BVAA 2EUFB 4I6HA 4S34A 3VN9A 4D2VA 3DQWA 2PUUA 5HKMA 2WMSA 4BHZA 2VGOA 4EKLA 3EQFA 4D0XA 5E9EA 4YNEA 4ZK5A 1SZMA 3R1YA 3OCBA 2VX1A 4IC8A 1HCKA 2VTMA 2WIPA 3HMIA 2QOLA 4HCTA 4YJNA 4ZXTA 2Y6OA 4FIJA 2YHVA 2CDZA 4BBEA 2WEIA 1YRPA 4NJDA 3RNIA 3UZRA 1T45A 3TZ8A 4NM3A 2AEGA 4JI9A 3W18A 4QDVA 2YM4A 3OC1A 5T6KA 4GT5A 3LFQA 3MWUA 5LXMA 4O7RA 3ZFMA 4D9UA 3MFRA 3BE9A 1Y8GA 1JOWB 3R21A 2UZUE 4E6AA 4DF3A 3BWFA 3R9NA 3KVWA 2IW8A 1QCFA 2R3RA 3T9TA 1OL5A 3DTWA 3F6XA 2IW9A 4FKOA 4IADA 5D7AA 4C4HA 1MRUA 2WKMA 3OUKA 4JXFA 3SQQA 1K3AA 1ERKA 4XP0A 4BTJA 4GVJA 4CZYB 4D58A 5L2SA 4FT0A 1H4LA 1R0PA 3A2CA 4JNWA 4NKAA 4AP7A 4Z7HA 4GIHA 4ZTNA 1BUHA 1ZAOA 4JQEA 3NFGB 3AD5A 2XZSA 3F69A 4QYFA 1GY3A 2GTNA 2HAKA 3BIZA 2BRNA 5CY3A 3G5DA 3DJ5A 1Z57A 2UZTA 1R1WA 4O7SA 1H08A 1M7NA 1YXSA 3TJDA 3IONA 3OD6X 5CEPA 2GNGA 5A6NA 3OG7A 3KN6A 3PIZA 5J95A 4C0TA 3UQCA 1FMKA 3V51A 5E8XA 3QD2B 1YWRA 4JBPA 4ZSLA 3DNEA 4QMYA 3SRVA 5LCJA 4LV8A 1W2CA 3DZOA 1VZOA 3WYYA 4EOIA 5IPJA 3A8XA 3ZHPC 3U9NA 4GH2A 2W9FB 3FHIA 4EH8A 4D4YA 3GCQA 3FDNA 4MD7E 2BALA 1XH8A 2R2PA 4CRLA 5D41A 3C4FA 5K4JA 3HV7A 4RWJA 4MWHA 3RHKA 5KZIA 4M14A 5KZ0A 1BL7A 2IZRA 2YDKA 2FSMX 4YZCA 3F66A 1XQZA 3QHRA 3PVGA 2P4IA 3QUPA 3GUBA 3C50A 3G15A 3DK6A 4BWPA 2XK3A 2J0LA 3R7VA 2OSCA 3A8WA 4CMTA 1FQ1B 2R3PA 3OW4A 4U41A 2RFNA 4LGGA 3UZPA 4EYJA 5A4QA 1PXKA 1Q3DA 4IVBA 3M11A 3RHXA 4A06A 4N6ZA 4QMTA 1IG1A 3VS2A 1E9HA 4CTCA 3QHWA 3ORMA 4HZSA 4BTKA 5KBRA 2OH4A 4QPSA 2F2UA 4I1ZA 2BDWA 1PXLA 1YHWA 3POZA 4JT3A 3WBLA 4A4XA 2PY3A 3R30A 4CT1A 4UX9A 2QO7A 3BX5A 5IUGA 3PZHA 1OM1A 4I4FA 3ZS5A 5IQEA 4YJOA 3LFCA 3UNJA 5HO7A 3A4OX 3M1SA 3FMEA 4QDEA 2GDOA 4G3EA 3GU5A 5CTPA 4XJ0A 3LQ8A 2HZ0A 2V55A 4RLLA 4QQCA 1CTPE 5F4NA 2VTPA 3TJCA 3UG1A 2VTTA 3QD3A 3UTOA 4LUEA 2E9VA 3ZO3A 4GK3A 3JXWA 4WOVA 5CU2A 4ZSJA 2XK7A 3CGFA 4USFA 2YDJA 5M57A 3F2RA 5CAQA 1J3HA 5M4IA 1PKDA 4JBOA 5DR9A 2WTCA 5CVGA 1FVTA 4P90A 4I5PA 4DCEA 1JWHA 3FYKX 3FLQA 4FKVA 3ZZEA 4FKGA 4ORKA 2I0EA 4UZHA 3U6IA 3AC3A 4DH3A 2VTQA 3WYXA 4F09A 4XHKB 4DTKA 1YHVA 2I0VA 2OZOA 5IH6A 2JGZA 2E9UA 4ZY4A 4NCTA 1U5RA 4Q5EA 4A07A 2OZAB 4XOYA 3VUKA 3V8SA 2JAMA 3ET7A 4O4DA 4XG6A 2C5NA 1ZMWA 4EQMA 4QTCA 2C5YA 2I40A 1ZY5A 1JLUE 5IA5A 4O0TA 3VS7A 5I3OA 3O5AA 3ZSIA 2QURA 3ORIA 5HGIA 4NFNA 2YJRA 3PVBA 4ASDA 2C5XA 1MQBA 4X0MA 3WE4A 3SXFA 3COMA 3NEWA 4RIOA 4EOQA 2IG7A 4O7WA 3ZMMA 3CP9A 4BDFA 1IAJA 2XM9A 4FRFA 3CTHA 4XV9A 3BYSA 1Y6BA 4FKQA 4IXPA 3EB0A 3W0OA 2QONA 3V6SA 3KF7A 3ORTA 3UDTA 3AXWA 5EM7A 3QGYA 3FHRA 5EQPA 3BRBA 5IH5A 3WIGA 4YO6A 1DS5A 3N9XA 4BCNA 5LWNA 3I60A 2UZEA 4QP7A 1Q8ZA 2R3FA 3BBTB 5FEEA 5K5NA 5T3QA 2PHKA 4H58A 3BHHA 3LCOA 3H0ZA 3LE6A 1OGYA 3TMOA 2WIHA 5BYLA 3SW7A 4A9UA 3M2WA 1Z9XA 3MGYA 4NW6A 5CT0A 4D0WA 3R8VA 4PTCA 3KIOC 5C01A 3QTQA 1YOMA 3V5WA 4BHNA 3UOLA 4F7NA 3FMKA 3ORLA 3C4XA 3FKLA 5ETFA 4FK3A 5M51A 2WU6A 1Q99A 4O1OA 5AUYA 4DFBA 4X2GA 3W8QA 2ONLC 1PHKA 3ALNA 2H96A 4AACA 4BCKA 1WCCA 3TZ9A 4IAIA 5L8KA 2XJ1A 5E90A 2GSFA 2Z8CA 1U54A 2XRWA 4MBIA 5GZ8A 3NVMB 2G9XA 3BEAA 5LMKC 4RVLA 3I7CA 3IW4A 4P5QA 3QQLA 1PF8A 4AOJA 4WO5A 5HVYA 4CFXA 4GYGA 1SYKA 5IA0A 4M3QA 3TNHA 5AUWA 4AXDA 4GFOA 4XEYA 3IDPA 4G5JA 3CPCA 2PVMA 4PPBA 1H0WA 4L42A 3MH0A 5EDQA 4BTFA 4ZOGA 2IVVA 4WNKA 3PPKA 4C37A 3R9HA 2VZ6A 4AT5A 4M67A 3OOMA 3RJCA 4E7WA 2O2UA 1YDRE 2W1HA 4YSJA 2HW7A 3MPMA 4BJJA 4QTEA 1G5SA 5KKRC 2PULA 3W0SA 1B6CB 5LOHA 3LCTA 1WVXA 4AW0A 3D5UA 4FEWA 3ENMA 3FPMA 5CX9A 3S95A 5AA8A 5BVOA 2BFYA 2JDVA 3KXGA 5IKWA 2B55A 4YTCA 5IA4A 4FOCA 3DK3A 3OZ6A 1ZOHA 3ROYA 3NUSA 2CGWA 4ZS0A 4AW5A 2QOQA 4O4CA 4XMOA 3PA5A 4U44A 5J7BA 5AP4A 2C6DA 4RWKA 4Y73A 5A54A 4ZS4A 5CLPA 4ENYA 2DUVA 4FUXA 1WBNA 2QKWB 1H1WA 3LOKA 3O2MA 3IKAA 4JX3A 3G0FA 2WAJA 4QOXA 4YR8A 4APCA 3ULZA 2CNVA 3MDYA 3TKIA 1HCLA 1LPUA 4EK4A 3GXLA 4OTQA 4G2FA 4AA4A 1VYWA 4C4FA 2XK9A 4IM3A 5FTGA 4BIDA 4DEHA 5M53A 3CY2A 4O0RA 5K0KA 5DR6A 4RX7A 3DGKA 2YIXA 1OIRA 3PIYA 1Q8YA 3Q9WA 5LVNA 3EKKA 2ITXA 3UQFA 2YM6A 3DLSA 3EYHA 4QTAA 4U0IA 4F6WA 4ASXA 4IDVA 3IOPA 2AQXA 5H8GA 1W2FA 3ORKA 4TWOA 4W8EA 2XYUA 5KE0A 3AT3A 1YOLA 4CD0A 1H0VA 2RG5A 4A9YA 4HYHA 3UNKA 2R3JA 2WMXA 2C6IA 2JKOA 4GT4A 4MQ2A 4YNOA 4FV3A 1H1QA 5B0XA 3UC3A 5J7HA 2GS7A 1J7IA 1O6KA 5EKOA 4AA5A 4JVGA 3NGAA 3PE1A 1G8KA 3OBJA 5EI2A 4LOOA 4FV2A 4I41A 4BICA 4GKHA 3EN5A 2GS6A 3ENHA 5CVHA 5DIAA 4ASZA 4NFMA 1OIQA 5CQUA 4RPVA 4ZMFA 2JITA 2WTKC 3G2FA 2NYAA 4K2RA 4IJPA 1GNGA 1W0XC 4RIXB 3CGOA 4BCHA 2WTDA 3JUHA 3MBLA 5EK7A 5BYZA 3KCFA 3IDCA 2BDFA 4DGGA 4I94A 4CLIA 3K5VA 3WF6A 3EL8A 3KRXA 4PMSA 3VBYA 3LFDA 3QRTA 3KEXA 3QRUA 4K1BA 4L00A 4AN3A 2NNWB 3LM0A 3BU3A 3NAYA 4QMPA 4RBLA 2X7OA 1P14A 2ETMA 2W06A 3PY3A 5HG8A 5HHWA 3LCKA 4Y95A 3QX4A 3TNPC 2GQSA 5HOAA 4J96A 5EFQA 3TL8A 4AZTA 4LI5A 4QP1A 4QMUA 5FTOA 4BDGA 4L3PA 5CWZA 1Y57A 3AG9A 4M66A 1R0EA 4IVDA 4KBKA 4QRCA 4MF0A 3RBWA 2XNOA 3UVPA 4ZLYA 4WT6A 5EDPA 3TACA 2XNPA 3NX8A 3MV5A 3RNYA 3VNTA 4MD8E 4JDJA 2GCDA 3BGZA 4KUJA 5L4QA 2VTAA 2JLDA 3O7LB 5GHVA 1KOAA 5TE0A 3C51A 2UW9A 2H34A 3DNDA 5AJQA 3CR0A 3F5UA 3FI3A 3KB7A 4MK0A 5K9IA 3ZC6A 4UMPA 4O0SA 4B8LA 1Q5KA 4HOKA 4DCAA 4MNEA 2C6LA 1KE9A 4BKZA 5IISA 5FTQA 2YIQA 5KX8A 3CCNA 4NUSA 1OB3A 3A7IA 3QL8A 5DE2A 1L8TA 4L01A 2W05A 5L6WL 1JKKA 1JQHA 2VU3A 4HGLA 5BVNA 4ZTQA 2F9GA 3F82A 4YLKA 4RX8A 5AR4A 4W4WA 2GPHA 2WQMA 5H3QA 5AEPA 3IW5A 2GQRA 1TZDA 4AXFA 4USEA 3TXOA 3NYXA 4CFNA 4F6UA 3BKBA 2VV9A 3ZBXA 2VTLA 4IAAA 4RFZA 3EQPA 4V05A 4ZSAA 4O0YA 3FBVA 4RLKA 3KFAA 4NIFB 1GZNA 5DOSA 3EQHA 3FL4A 4O7LA 3Q53A 4XCUA 5CQWA 5EQEA 2VO6A 3EYGA 3VVHA 4GW8A 3FMNA 5CSPA 4U3YA 5E92A 3PSDA 3TNIA 4AT3A 1WBWA 2BILB 2EB3A 2QOKA 3FQSA 4O4EA 3RPVA 4A9SA 4EC8A 4DHIB 2QD9A 3QKKA 1FGKA 2C3KA 3MY5A 3PVUA 2V5QA 3HVCA 1X8BA 3LXPA 3VS1A 2IZTA 3WZJA 4AU8A 1P5EA 4HCUA 3ZM9A 4G6OA 4B7TA 4GSBA 4FKUA 4PP9A 3RK5A 2J50A 4KD1A 2ETKA 3MA6A 3W2CA 5AV2A 5ANEA 4O1PA 4XP3A 4X6QC 3SHEA 3BQCA 3FUPA 3ZBFA 3TNWA 4ZTHA 3FL5A 4EOPA 4BR3A 4JR3A 3ZLYA 4BGHA 4AZWA 4C3RA 4ZP5A 3BHUA 4HJOA 4D28A 2DWBA 5B2KA 4L43A 3ZSHA 5CEMA 2PE2A 4NCTC 1IA8A 3ORPA 4FKJA 3D9VA 3V5PA 4BJJB 4IBMA 3D4QA 3EFJA 3W32A 3VBVA 2JDRA 1E1XA 4IIRA 1XH5A 2X9FA 3PFQA 3ZEPA 2BIYA 1YXUA 3KMWA 4KKGA 4PWNA 3WF5A 3Q96A 1WVYA 3FZRA 4L67A 5E7RA 2VWUA 4FL1A 2CGXA 3UVRA 1YHSA 4N6YA 1BI7A 4IQ6A 3KVXA 2ITPA 4XRJA 2OLCA 1PXOA 3PIXA 2QLQA 5CEIA 5IZFA 2GS2A 2IF8A 2ITYA 4XH6A 5KMNA 1PMNA 2WMVA 5KBQA 4QNAA 3C4CA 4EH6A 3BYVA 4XNEA 4I5HA 2UW8A 4U79A 2QVSE 2PVHA 4GT3A 3D15A 5ETCA 4CKIA 5CYIA 3H30A 2AYPA 3E62A 3MIYA 4RGJA 4F7SA 3HAMA 3GB2A 1QL6A 2XARA 3C9WA 3EIDA 2BAJA 2BROA 3A7JA 3HRFA 3MPTA 3PPZA 3RK9A 3VUHA 3PDTA 2BZIB 5TOZA 4GYIA 3DFCB 2F57A 4UMQA 1ZZ2A 4RIXA 2PZRA 1SVHA 2VWWA 4TT7A 5AFVA 2QC6A 1Q62A 4V01A 2JEDA 4MKCA 5GIOE 4E73A 5AA9A 3RAHA 4GU6A 5ITAA 3TV4A 3O17A 3OEZA 1YI4A 4WG4A 1PXJA 3TN8A 4D1SA 5L3AA 4BFMA 4HVIA 4I20A 4O91A 2CLQA 3GCPA 2PVYA 3IW6A 4DT8A 2B1PA 1UVRA 3MTFA 4CMOA 5IQGA 2VO3A 4PY1A 2NPQA 5CEKA 2A1AB 4CQEA 3NWWA 2E9OA 3C7QA 1CKPA 4EUUA 3UJGA 5AM7A 1T46A 5IF1A 4WSQA 2BAQA 4NM0A 4AXAA 5LMKA 5IMXA 3NRMA 2YM8A 5TO8A 1JKSA 2VWXA 3EFLA 4YHJA 3VC4A 3W10A 4N57A 1AGWA 2ZYBA 4L3JA 4AN9A 3GI3A 1FINA 4RJ3A 3KF4A 3MB7A 3QALE 4WA9A 3VS6A 3ZO2A 2XIZA 3U4UA 2R9SA 4IVAA 3UO6A 3RP9A 3PVWA 3R0TA 4FGBA 4RC3A 2WMAA 3EN9A 4YLLA 3DXQA 1LEZA 5M4UA 1UNGA 2QCSA 4CLJA 3ATSA 3DA6A 4N0SA 5FD2A 4ERWA 2R5TA 3VUGA 2B53A 4ZY6A 5BNJA 3PG3A 4IEBA 2G2HA 4EONA 3G6GA 4QMWA 4TYHA 2HYYA 4FTCA 4U40A 4MXAA 3BL7A 3PXQA 3QUDA 2C0OA 3AC5A 3OW3A 4OBOA 1Q97A 1ZLTA 4YGAA 3FZ1A 1M14A 3R7OA 4NIFA 3RGFA 4E5WA 3ATTA 5FEDA 3MJ1A 2UZDA 2R3GA 3M42A 4NSTA 3UIUA 5IA3A 1GZ8A 3PXFA 5AV3A 4UN0C 4USDA 5LVOA 1R3CA 4OW8A 3AMBA 1A9UA 4F1OA 3H9OA 1REKA 2WMBA 2RFEA 3LIJA 4KKHA 4MHAA 1QPDA 4BI0A 1H1SA 3FZPA 4RFYA 4RJ5A 5ANDA 4FIHA 4UMRA 5BPYA 3S1HA 4EEVA 4FC0A 3T3VA 3NAXA 1WVWA 4A7CA 3PY1A 5AX3A 1Q8TA 4IZ5A 2OJIA 4O86A 3C4WA 3QBNA 4S30A 4GV1A 1FMOE 4WRGA 3F3TA 3SW4A 5C8KA 1UKHA 4CT2A 3P86A 4ONAA 4IAFA 3KULA 5A46A 2R64A 4KBAA 5HESA 3CJGA 3HLLA 4XG4A 4ALVA 3QRIA 4DGLC 3HV3A 3NUXA 4FNXA 4M15A 4Z55A 4CG8A 5IUIA 3E8NA 4FI1A 4G1WA 3R9OA 2PE1A 2C6EA 2OJFE 2C6TA 3OY1A 3QGWA 3TTIA 2X2KA 5BVDA 2WTJA 4I6FA 4AWIA 4J99A 2X8IA 3OCSA 4JQ8A 3QA8A 3TEIA 3ETAA 1KV2A 1PXPA 3FSKA 3AD6A 2BR1A 3PWDA 4M7IA 3N51A 5GJFA 2R3MA 3UZTA 4HW7A 3L8PA 1BMKA 2YITA 3RZBA 2JKQA 2YACA 4FIGA 4IB3A 3AKKA 2OH0E 4K0YA 1GIJA 5FXQA 3DS6A 2C5OA 4BI2A 2Z02A 5IDPA 4AX8A 4DEEA 3A7FA 5HX6A 3C0GA 3H9FA 1KV1A 4ZAUA 4H1MA 1KE8A 5M08A 2W17A 3CS9A 4F0FA 3HA8A 3ZDIA 3ZRKA 5J5SA 2VNYA 3AC8A 4U3ZA 3W0NA 2B9IA 2PZIA 4JDHA 4LRMA 4TWNA 4YHFA 3WARA 1H28A 2C3LA 2IW6A 5DFPA 3FKOA 2I1MA 3SD0A 1RW8A 2ESMA 1AD5A 4PMTA 2HXLA 4Z9LA 4X21A 3VRYA 3OWPA 2XK6A 2WFYA 3GOPA 4I24A 4NTTA 3JS2A 2WQEA 4Y46A 4B0GA 4BZNA 5JFXA 2HZIA 4U6RA 1UA2A 5DNRA 1F3MC 1CKIA 3I6UA 3KRWA 3GFEA 4I23A 1S9JA 5FLFA 2QOFA 3F61A 3GP0A 5EYKA 4G3CA 2W4KA 2CMWA 2FGIA 4FX3A 3WF8A 4DDIA 3QKLA 3DU8A 3DXNA 3ORZA 4L52A 3ERKA 3UIBA 4EK6A 5CU4A 3NW6A 4DHFA 3QZGA 2O65A 4QQTA 4BGGA 4C57A 2AC3A 4RA4A 4EI4A 2FUMA 2FA2A 3JVRA 2BIKB 3DBCA 5DT4A 2Z7RA 5FM2A 1W2DA 3KULB 3K3IA 3U6JA 5BUIA 4KWPA 2YZAA 1ZOGA 4FV4A 4W4XA 3EFKA 4KIPA 2RIOA 4EH7A 4DEGA 2RFSA 2WD1A 2UZOA 4FR4A 2XKCA 3KK8A 4OBPA 2WELA 4C2WA 4WUNA 3NIEA 5FQDC 3CC6A 5M06A 3BV2A 3ZLXA 3G6HA 4CKRA 3RPSA 2F7EE 5IA2A 4EOKA 3DT1A 1YWVA 2P0CA 2BPMA 3H9RA 2JBPA 5CAUA 3NW7A 4S2ZA 5ETIA 1RJBA 4DGMA 5F95A 4G9CA 4MTAA 3KL8A 2XNBA 3DQXA 4CGAA 2UZLA 3QZIA 2I6LA 2XK8A 3EWHA 4YJRA 3PE2A 5AP0A 4QQ5A 2RG6A 3MTLA 1O6LA 3IG7A 4LRJA 4O4FA 3R9DA 3DK7A 4I92A 4DFNA 3OY3A 4FSQA 3LAUA 4WG3A 4XG9A 5JFVA 4D1ZA 4XV3A 3WZKA 5AP7A 1XBAA 4A9TA 2PMLX 2JFLA 4F6SA 4GVAA 1XBCA 5KHWA 4MXZA 4AGWA 4HYIA 1VJYA 3HAVA 4K6ZA 3RAWA 4DFLA 5KMLA 4FTTA 3CE3A 2H8HA 4FIIA 4UWBA 1MUOA 5HCXA 4BGQA 1QMZA 4PDOA 3LXNA 4HNFA 5CI6A 1KUTA 3SOAA 1DAYA 1OBDA 2JC6A 1GIHA 3F3ZA 2WPAA 4IAZA 3HMMA 2B9FA 3MH1A 5JH6A 5EI8A 3OWJA 1G8JA 2QR8A 2YAKA 2OKRA 4EOLA 4NYEA 5EKNA 2F49A 5KUPA 5BUEA 3WILA 3BLRA 4C62A 1J7UA 2WMUA 4FTKA 4HNIA 4O96A 2ITTA 4TRLA 2JKMA 2GMXA 2ZAZA 4L46A 4EK8A 4FTOA 3PXYA 5HG7A 2W0JA 4PL3A 1WMKA 1MRYA 2BDJA 3I4BA 3EL7A 1PMVA 4BDBA 1ZWSA 4OT5A 2XEZA 2RFDA 2VTIA 5L2TA 4U81A 1JAMA 4C35A 4DGNA 3U4WA 4FYOA 4TYEA 4OR5A 3W0MA 4RC4A 4FK6A 4H1JA 1NVQA 3OOGA 4FV9A 4E3CA 1YKRA 2BHHA 1APME 5JZJA 2VNWA 3GC9A 3NUYA 3OEFX 4LGHA 5LJJA 3RZFA 5CEQA 2PL0A 1H01A 5HORA 3QXOA 4FZ7A 4DBXA 5AV4A 3W0RA 4GK2A 4YJQA 4YC6A 4ALUA 2XF0A 4JAIA 4IW0A 2I7QA 5E4HA 4HYSA 4XYFA 1CM8A 3F7ZA 2JIIA 2HW6A 2VX0A 2Y8OA 3LZBA 5DWRA 2CN5A 2IO6A 4FVPA 3UOJA 2W1FA 4CKJA 2C68A 4CG9A 3FI2A 3CBLA 3F3WA 3JVSA 3MS9A 2V7AA 3TDWA 4LFIA 2YFXA 4PX6A 2X6DA 3LFSA 3S4QA 1VEBA 3KRLA 2XBAA 3MFUA 4TKSA 2W1EA 4I5MA 4BC6A 2AUHA 2XKDA 4HGEA 4L68A 3KMUA 1XH9A 4BBFA 1VLRA 3LLAA 2C30A 2XNEA 3CKXA 1U5QA 1UNHA 4MUQA 2Q0BA 2ERZE 4ZJIA 4FEUA 3RWQA 4EH9A 2PSQA 2YERA 4KIKA 3OWKA 3F9NA 3PZEA 4KKEA 3TG1A 2GU8A 2BZKB 4FSRA 2YIRA 1W84A 4TYHB 5C4KA 2EXMA 3PUPA 3Q5IA 3MH2A 2YCQA 4F9YA 5CF6A 2BUJA 1BLXA 4L6QA 3QTUA 1U4DA 3FE3A 4GUEA 1CDKA 4CFWA 3E92A 3RPYA 3W55A 3EQRA 3R28A 1SVEA 3UODA 5M56A 4E6QA 1ZZLA 3FLSA 5EW3A 3HRCA 4QP9A 3OCTA 3UMXA 4JBVA 1ZXEA 5HLPA 4IFGA 2O8YA 4RJ7A 4I6QA 3U51A 4JRVA 1NW1A 1NY3A 3R73A 3NS9A 4YLJA 1UNLA 5JGDA 2HK5A 4D2TA 4ZJVA 3EQBA 2PUNA 3BL9A 1OMWA 5IU2A 4TPTA