1OUYA

The structure of p38 alpha in complex with a dihydropyrido-pyrimidine inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 350
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ouyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ouyA01
3IW7A 4GJ2A 3POOA 4MYGA 4F9BA 1TQMA 4ENXA 4F63A 3CXWA 4D2RA 3EQBA 5CQUA 2RFDA 5LVLA 3V5JA 4HCUA 4MK0A 1QCFA 1L8TA 4FTJA 4S2ZA 1IAHA 3AC5A 4ZSLA 5L3AA 1YI4A 2QC6A 3AC1A 5F94A 3KRJA 4YC8A 4QYGA 4FT3A 4EOOA 4MEDA 4IFCA 5KMJA 5T3QA 4OTQA 1E1VA 1OVEA 3I7CA 2C6DA 2DUVA 2VWZA 1PXKA 4ACCA 3DCVA 4RZVA 4ZZMA 1VZOA 2J90A 4MBLA 2HZIA 2DWBA 4F70A 4IM3A 5EDRA 4D4YA 1XKKA 4QTDA 1LPUA 2CKEA 4JQ8A 3W33A 1OPJA 4GG5A 4IVBA 5H8EA 4C62A 1F5QA 3QTZA 3P7BA 3DGKA 4FKWA 3QFVA 2JKQA 2EVAA 4XJ0A 4BBEA 3LFBA 2PK9A 3EN4A 4XMOA 5EM7A 3FMLA 4AE6A 3SW4A 1OKVA 2XJ2A 5LCKA 4AA0A 3DT1A 3MWUA 4RX8A 1FGKA 3CCNA 4RVTA 5KO1A 4QMMA 3UDBA 3I4BA 3L1SA 3OWPA 1ZY4A 4MF1A 1UU8A 4X2KA 1YI6A 2OZAA 4YZNA 3NUAA 4MXZA 4FIGA 4RQKA 3UIUA 3TJCA 4XEYA 3MI9A 4EBWA 4YJUA 4FUXA 3UMXA 1NVSA 4JOAA 2BFXA 3U6HA 2W1HA 3VUKA 3VJOA 3HA6A 3NVKI 4PDPA 4E6AA 5IQFA 3LM0A 5AR5A 4BI0A 3KMMA 4BIDA 2QQ7A 5HG8A 3RJCA 4W8DA 4C3RA 5IU2A 3I81A 2WMSA 2C3IB 4CVAA 4GUEA 3VUMA 2BVAA 5FTGA 4IDTA 5AIKA 5CSPA 4QYFA 5E8XA 3EFJA 3GGFA 2QODA 3KN6A 3MIAA 5EM5A 4A4OA 4ERWA 4YZDA 3R9HA 1TVOA 5JGAA 5EDQA 3IDCA 3R02A 3LCSA 3QTIA 2VO0A 4CLIA 4YC6A 4RIWA 3S00A 2BZJA 2XIRA 2XCHA 4U44A 2XYNA 4D1ZA 2GHLA 3OW4A 3QGWA 5LARA 3R7EA 1P4OA 3ZEPA 4GYIA 4N0SA 4R7IA 3DDQA 1XH8A 2RL5A 2X6EA 4IMYA 3O50A 3R9RA 3EZVA 3OT3A 4Y95A 3SOAA 4WRSA 1U54A 3ERKA 4AZSA 3D15A 4D2TA 5HCZA 3SXRA 3I6UA 4DH1A 3R04A 4PP9A 4O0VA 3Q32A 4AOTA 2YLFA 1WBVA 2OJ9A 4JNWA 3UNKA 4H39A 2Z60A 3R6XA 4LV5A 5EQEA 3RHXA 3LE6A 5C26A 4J8NA 1RDQE 4JR3A 1OKWA 1LEWA 3ZFXA 4ACMA 5IMEA 5AR7A 4L3JA 3REPA 1OIQA 2X2MA 4NM3A 5HIDA 3F66A 5TKDA 1P2AA 3RWPA 3C50A 1Q8YA 4YLLA 3OEZA 3NUPA 2QURA 3E87A 4LOPA 1ERKA 4E3CA 4QP2A 3VC4A 3DY7A 2XK3A 5M57A 3PVWA 4X3FB 5A9UA 3SC1A 1VR2A 3PVUA 4C7TA 5E8TA 5KKRC 5E8WA 2P33A 5FP5A 5CU6A 2WTCA 4CG8A 4WBOA 3BX5A 3CY3A 5L8LA 1JKSA 5C4LA 4P4CA 3UTOA 2VWWA 2XIXA 3QLGA 2FVDA 3QALE 4WT6A 4XP2A 4C38A 3PA4A 2CGUA 2A2AA 3UMWA 5HCXA 4E93A 2C6MA 5L2WA 2PVNA 3AC4A 3QUPA 4EOJA 2VO3A 4I22A 5ETCA 5HESA 1AD5A 3CS9A 4IH8A 3WF5A 2NRYA 2OJFE 4M0YA 2C5OA 2VWUA 3PJ2A 3ZLYA 2J0IA 4PL3A 2VTAA 5DT4A 2ZV2A 4H36A 3UE4A 4FL1A 4IAYA 2AYPA 4KIKB 4MD9E 4X2JA 4BI2A 5L4QA 2BPMA 1H1WA 1W83A 3II5A 1ZZ2A 4HGSA 3EWHA 4FG9A 3SLSA 2PTKA 2HW7A 3D5UA 4ANLA 4P5ZA 2CHLA 3SRVA 2XNPA 2XKDA 4U8ZA 2WZJA 2ZM4A 4EYJA 2FO0A 4G6LA 4D0XA 3OWJA 4WO5A 3EQDA 4IWDA 3QHRA 5BVWA 3UO4A 1U59A 2OIDA 3VULA 4QQTA 3R63A 1FMOE 3CPBA 2WFYA 5FWKK 4WSQA 4U97A 5HTCA 3L9LA 2QOKA 2WTKB 3QWKA 3EQCA 4QT1A 3SXFA 5JFWA 2C5VA 4M84A 2J0MB 4I21A 4NKAA 3A7JA 2VWBA 1GAGA 3F3UA 3KEXA 4O1PA 2WMUA 2DQ7X 3NAYA 4AU8A 3OCGA 2XNOA 3BIZA 4M0ZA 2BDJA 1V1KA 2WIPA 4FKSA 3VRZA 3CGOA 2W5HA 3NX8A 2WPAA 2XYUA 2YCRA 3G0FA 3KXNA 5EOLA 5EH0A 3KXHA 2J0JA 2WU7A 3VBTA 3RTPA 3VO3A 2XNMA 1H1RA 1OM1A 2WMQA 4N6ZA 3MFSA 4W8EA 2X9EA 2RF9A 3F61A 4USFA 2WEIA 4PL4A 2ITQA 4QMTA 1IAJA 2YACA 5LVPA 3DOGA 3I1AA 3F3VA 3PSCA 5CZHA 1IA8A 2YFXA 2WXVA 1FVVA 5CF8A 2OJJA 2I40A 3BGPA 3G33A 3ZLSA 1IA9A 1OBGA 4MBIA 4OBOA 4XG8A 4QQ5A 4PL5A 3Q4UA 3UVPA 5HQ0A 5JFSA 4LMUA 1YHWA 4ASZA 1GZKA 5BYLA 1DAWA 3OBGA 2OXXA 4BDAA 3IOPA 1Q8WA 2XIZA 4TRLA 5E8ZA 5AA9A 3CD3A 3ACKA 3IPHA 2CLXA 5C1QB 4TYHA 3BKBA 3EQIA 4BDBA 5M55A 2QOCA 3Q04A 3V51A 4CYIA 2PU8A 4YSJA 5LMKC 3PP1A 2WHBA 2VTLA 3D4QA 4FX3A 3RPSA 3VUTA 4EKKA 5BYYA 4KAOA 3EKKA 4FZAB 4PUZA 3THBA 4AZVA 5EW8A 4CQEA 5L6PA 3KC3A 3R1QA 4J52A 1J3HA 3V5PA 1YWNA 3F3ZA 3QTWA 3W16A 3WILA 5B0XA 4AFEA 5CAPA 4BY9E 3MH3A 4NWMA 4YUQA 4KS7A 4IIRA 3LMHA 1AQ1A 1WMKA 1YOMA 2X2LA 3F5PA 4BVUA 3FLQA 1OB3A 2J5FA 3R8ZA 4B4LA 2HENA 3BYOA 4O0UA 4DE4A 1PW2A 1GZ8A 2QCSA 4FV4A 4L7FA 2PZ5A 3E8EA 4NTTA 4X6RA 3FZ1A 5DGZA 4CCUA 3AG9A 4RIYA 3U9NA 4LI5A 1ZRZA 2OKRA 3KVXA 3NUXA 3V8SA 5JK3A 4IAIA 5JT2A 3ANQA 1U46A 2BIYA 4F7SA 5CSXA 2F49A 2VAGA 3KB7A 3PIZA 4I3ZA 4AGUA 3RKBA 3MA6A 3OW3A 3ZRLA 5DMZA 3ZSIA 2UW5A 5LCJA 4FTAA 3EN7A 3C0GA 2O64A 2NP8A 5AX9A 3T3UA 2BRMA 3IW6A 4CD0A 4ZZNA 4BKJA 2W99B 3R7GA 4K8AA 4HW7A 2C3JA 2I1MA 3GU5A 4FZDB 5AP4A 2UW6A 4M69B 4N6YA 1KOBA 4BGQA 2GNHA 4EORA 5A6NA 5LVNA 4IAFA 5K0KA 3EN5A 4BICA 5FEDA 4O6EA 3UYSA 3ZH8A 1CKJA 4K1BA 4AP7A 4ANQA 4EONA 1A48A 1K9AA 5KUPA 1Q8UA 3HYHA 2WQBA 4ZSJA 5E1SA 5JEBA 3R9OA 4YC3A 4CFMA 3VS1A 4MXAA 1ZOEA 3HX4A 5FG8A 3UOLA 4AOJA 1I44A 4C2WA 1GY3A 2JKOA 4WG4A 2UZLA 4DBXA 2OU7A 4YPDA 2WTVA 2BHEA 4NJDA 4RVLA 4G17A 4CQGA 4G9CA 2W1IA 3LJ2A 4C58A 4F1MA 3OXTA 1H4LA 2OO8X 3KULA 4KBCA 4QPMA 1YHVA 1UU7A 2EWAA 4XLIA 3TT0A 2GPHA 3A7GA 5HBEA 1HCLA 5K9IA 3MN3A 4ALWA 3HV4A 4JQEA 2PVFA 4KKGA 3D9VA 3FZRA 5DPVA 2FSOX 3ZO2A 2YISA 2OF4A 2RFNA 1OZ1A 2UZTA 3GFEA 2B53A 4UZHA 4WKQA 4I4EA 2PUPA 4FTLA 5DR6A 3ZSGA 1YDRE 4EHZA 4NFMA 3ZYAA 4EOSA 3L9NA 2PVRA 3C4XA 2EUFB 3LAUA 4L67A 2Z7SA 5HD4A 3H0YA 1UNHA 3U4WA 2FYSA 2G2HA 5CSWA 5CXHA 3OOMA 1T45A 2FB8A 2YZAA 2E9OA 3MFRA 3QQLA 4IC7A 5KHWA 4NIFA 3R7YA 5FM2A 3QXOA 4ALVA 1NY3A 4H58A 2LGCA 4UZDA 2XJ0A 2OJGA 4BCPA 3W55A 5A14A 3MY0A 5JRSA 4DT9A 4EOPA 2Q83A 3UQGA 4QQCA 1OITA 2BZHB 2BZKB 3NUSA 4YTHA 3MH1A 2BRNA 4W9XA 5DHJA 4BFMA 3UVQA 3PZHA 3KMUA 1VYWA 3Q2MA 2PE1A 3OY1A 3F3TA 4KKHA 5EI2A 3V6SA 4LFIA 5JQ8A 1YDTE 4JX3A 5HO8A 4D5KA 2Z02A 3NR9A 4O0WA 3EB0A 2VWIA 4XYFA 3DFCB 4R77A 1G5SA 3D7TA 4U5JA 3LLTA 3E64A 1Q4LA 1W98A 3DK3A 4BZNA 4NZWB 4GT4A 3R8LA 3KA0A 4CTCA 1YVJA 1BI8A 3Q52A 4X2GA 2CNVA 1IEPA 4ZAUA 4UMQA 3K3JA 5DG5A 2VTPA 2PZRA 4CFXA 3VNTA 4JL9A 4E6CA 3ZC6A 1H1QA 2B54A 4XLVA 4O81A 4CMTA 4DTBA 4KKEA 2B7AA 1I09A 3ORMA 4CCBA 3PXQA 2VN9A 2WQEA 3BBTB 3LCOA 4FGBA 4NH1A 4A07A 3D0EA 3HMNA 2Z2WA 4GV1A 4ZY5A 2C1AA 5IA5A 4ASXA 3QA0A 3A2CA 4ZTLA 3EQHA 4LGHA 4UBAA 2G2FA 4FVRA 4FZ6A 1GZOA 5C8MA 3RCDA 1M2QA 5A6OA 3KVWA 4BIEA 3QU0A 4JIAA 4XRJA 4B8LA 4BDJA 3MW1A 2PZIA 4FKUA 4OAUC 3LKMA 4FNWA 2EB2A 1IG1A 2QO9A 3Q3BA 4S34A 3TNQB 5AV0A 1Y8GA 4EQUA 2OK1A 3FYJX 4L00A 4X0MA 1SNUA 3JS2A 3QXPA 1YXUA 4FV9A 2JFMA 1WBOA 2XKCA 3TZ9A 5DEYA 4C34A 2F9GA 3OD6X 2RKUA 3PG3A 3HEGA 4V04A 1URCA 2ZMDA 4OT6A 3TN8A 2WTWA 4AT5A 4DAWA 5DYJA 3ZLWA 4MNEA 3BPRA 4CTBA 5KKRB 4BCOA 3AMAA 3NW5A 2HYYA 3IW8A 3RWQA 2JDVA 3OHTA 4QMWA 4BWXA 4GVJA 2PZYA 4O0RA 4Y46A 3BHVA 3BE9A 1XWSA 5ETAA 3RNYA 1H00A 4DGMA 3D14A 1H24A 3KF7A 4GKIA 3VUGA 1KOAA 3ALNA 5J9ZA 3IQ7A 3FZTA 4IANA 4M7IA 1FVTA 2HZ0A 3F5XA 5I9UA 3TDWA 2O5KA 3OT8A 2W7XA 2W17A 2VO7A 3DDPA 3QQGA 4I0RA 4LQMA 4EJ7A 4IWOA 3SHEA 2OF2A 4M67A 4Q5HA 2GMXA 4AUAA 4IBMA 3U9CA 2WMAA 4DTKA 3P7AA 3HV3A 4LOQA 4IAAA 3ZUTA 1AGWA 1PXLA 5EYKA 5KX8A 3NRMA 4FIEA 3QCSA 5JGDA 4FVQA 2O3PA 2XNNA 3TG1A 3PWDA 3NS9A 3DKGA 1YXTA 4KRDA 5DBXA 4FNYA 3QC4A 2B1PA 1B6CB 2XEZA 2YM8A 3DNDA 4XG7A 2B9JA 1PY5A 4ZSGA 5IUGA 5L6OA 4TNDA 3VBQA 3JUHA 3VVHA 2GDOA 4PRJA 2V0DA 3Q5ZA 4FV2A 3C7QA 3FC1X 4D4SA 4C57A 3I60A 2JBOA 2UZNA 3LJ0A 4G5JA 5HICA 5IDPA 4ORKA 4BTKA 4QP3A 4JRVA 2GQRA 5K4JA 1WBPA 4PPBA 4YJRA 3D94A 3DQXA 2X2KA 1HCKA 3A4OX 1O6LA 3MVHA 4K11A 4JVGA 3IECA 2QO2A 5CEIA 2YWVA 4FG8A 3S0OA 5A4EA 3ZOSA 2E9PA 3DTCA 3MY1A 2OJIA 5AP5A 1PXPA 2QO7A 4X3FA 1BL6A 4TW9A 3AD6A 3ODYX 4MD8E 4IHPA 4O0TA 1MUOA 1ND4A 4C4GA 2X7GA 3R2BA 3BWFA 3GNIB 4FA2A 4DGLC 4DH8A 4XV3A 5IA0A 2Y4PA 3RPOA 2XEYA 5HNGA 3TNIA 4QYYA 5GJDA 4I5MA 3QKLA 3PRFA 3NDMA 4IX3A 4RJ6A 5HE3A 3UC4A 4EKLA 2C6EA 1Y91A 4QP8A 3RCJA 3FEGA 2PE2A 4E8AA 4FNZA 4E4LA 3U54A 3DXNA 3NUNA 4IB1A 4Y72A 4AZWA 4IWPA 5J9YA 2P55A 4FIFA 4JQ7A 2WELA 5F20A 2JC6A 2WMTA 3RHKA 4ASEA 2FUMA 5AAFA 1DI8A 3RALA 3VHEA 1REKA 4NT4A 1BX6A 4FV5A 4ITHA 4YTFA 2IPXA 3ZC5A 3B8RA 3DAKA 5HI2A 2EXMA 3ORKA 5K5NA 3WF8A 3FSKA 4O7VA 3KRXA 1J1BA 4R1YA 2ZJWA 3TACA 5A4TA 4YNOA 4FKRA 4EBVA 5TT7A 4EC8A 3E88A 4RJ7A 3HP2A 2W0JA 1JLUE 4FSMA 3PY0A 3QCQA 4LM5A 4FIHA 4FNXA 4USEA 1JWHA 3JR1A 4IZ5A 2GQGA 4GIIA 3VAPA 1XH4A 3FKNA 2AC3A 4RFYA 4DEDA 4F7LA 4NUSA 5CQWA 4AN3A 1KE9A 4PTCA 3TZ8A 4DFLA 1R78A 3A4PA 5BMSA 4RC4A 3T8OA 4CRSA 4FF8A 5LMAA 2IVSA 4MX9A 4TWPA 4CT2A 2R7BA 1LEZA 2E9UA 5CEKA 4QP4A 1NW1A 4CSVA 1XQZA 3UOJA 3TCPA 3QQHA 4R5SA 1QL6A 3OCTA 2QHNA 2BHHA 3E8DA 5JQ5A 3V8TA 3FKLA 4M13A 3RPRA 3QZFA 5KMLA 1QPJA 3FAAA 3ZLXA 2ZAZA 2ITPA 5B2LA 3SW7A 3E8CA 2G2IA 3G51A 4GJ3A 4U42A 3L8SA 3HAMA 4TKSA 3TDVA 3D5WA 4CG9A 2CGWA 3O8UA 2OXDA 3F82A 4O0YA 5M56A 5FQDC 2C5YA 5LQFA 1PMEA 5AUUA 1F0QA 4RFMA 5D12A 3ZFYA 1YOJA 3UNZA 3QKMA 5HNBA 3OCBA 1JQHA 1UNLA 2I0HA 3N4TA 3PVBA 4QOXA 4S32A 2H96A 3TM0A 3F88A 3R8MA 4B9DA 4QNAA 1T46A 2BAQA 2OFUA 4FTQA 3KN5A 3CJFA 2XM8A 4TYGA 4H1MA 3VWAA 3LXKA 4XBUA 3UP2A 1J7UA 5E8VA 4U0IA 2Q0NA 4RWLA 3GCUA 1OPLA 3WE8A 3QWJA 4O96A 4GL9A 3TTJA 2YIRA 3TIYA 4UN0C 4M12A 5FLFA 5CEPA 5ANIA 5AP6A 1NVQA 2Y6OA 4S31A 3KREA 2QOOA 2E9NA 3QYZA 4MKCA 4EH9A 2I7QA 3WZUA 4PMPA 4N4SA 3FLNC 2C68A 3RAHA 4Y8DA 4X2FA 3D5VA 3DKOA 3DNEA 4ZK5A 2J7TA 4AN9A 3S2PA 4ZZOA 2ITTA 4EZ3A 2UUEA 2XS0A 2ONLC 2A0CX 2FSLX 3W2CA 3R2YA 2PZPA 3LVPA 5L2QA 3PXKA 4UXLA 4QD6A 3MFUA 3Q60A 4QMVA 4K33A 4IZ7A 5EW9A 4AT3A 4CMOA 4EC9A 1XBBA 3ZCLA 3FHRA 4ERKA 4YJTA 2Y6MA 4YO4A 2IG7A 4NL0A 1O6KA 1OGUA 2GNIA 4IWQA 4Z9LA 4RJ3A 4E5BA 4YZ9A 1PXMA 4AG8A 2BMCA 2KTYA 3ORLA 3HMPA 2IO6A 3TTIA 5BNJA 2J50A 1ZMUA 4LRJA 3ZFMA 3PJCA 3OTUA 4GT3A 3MGYA 4BB4A 1UWJA 3FSFA 4IB5A 5CXZA 2JDOA 2GS7A 3EMGA 3I7BA 3LOKA 3C4FA 4BCNA 3FXZA 3PXRA 4UWBA 3TWJA 3G15A 3SG8A 3VF8A 3LMIA 3P23A 3G9LX 4FKTA 5GZ9A 3ZO4A 3IW4A 2W4JA 4QQJA 5AP7A 2GNLA 3MESA 4GT5A 2PVYA 3SOCA 3PDTA 2UZDA 4JBOA 1Q97A 2XB7A 4WD5A 3QQFA 5HIBA 3VUHA 4FL2A 4FZFB 4FV7A 4CXAA 3HV7A 5CWZA 3HDNA 3FL4A 4AGDA 4HNIA 2JAVA 2R3RA 4Q5EA 3A7IA 5DRDA 1M52A 2J9MA 2YAKA 4NW6A 5IA2A 2X8DA 4EK6A 3PA5A 4U6RA 2F57A 2QOQA 4CKIA 2W1EA 5BPYA 2O8YA 3EH9A 3HZTA 4RGJA 2R5TA 2ITYA 2QU5A 2VGOA 2VZ6A 4QMSA 4JDIA 1CKIA 3DAEA 5FTOA 4K18A 3OOGA 2ZYBA 4C3PA 4CLJA 4YSMA 3MV5A 4YP8A 3BLQA 3AT3A 4FTTA 3WBLA 3NUUA 3EIDA 2XJ1A 3UZTA 4CKJA 2JLDA 4D2VA 3P0MA 3P86A 3BEGA 2YLEA 4FSNA 5BQ0A 2VWVA 3KRRA 3GXLA 5KCVA 3DAJA 3Q6UA 4F99A 5CENA 2R3KA 2BFYA 3OEFX 4IEBA 3PY1A 4PP7A 4FKGA 2WU6A 2BAKA 2IVVA 2F7ZE 5DFPA 3DV3A 5HU3A 2E2BA 3LIJA 4NCTA 3FWQA 4M14A 3RM6A 4X6QC 4HZSA 1JKTA 3GC9A 1SVGA 2C6IA 4EQMA 1H26A 4XOYA 4O7NA 4XNEA 1YOLA 3SD0A 4YZBA 3ZU7A 4U81A 3OF0A 3GCVA 4OLIA 5M06A 3PYYA 4DH3A 2PUNA 4BCQA 5KMKA 2VTIA 2XUUA 2JFLA 4EK3A 2BIKB 2VV9A 4J53A 5D10A 4DG2E 4E1ZA 5B2MA 2Z7LA 2W96B 4J99A 2Y0AA 4GEOA 2OSCA 4YJOA 2HXQA 5GJFA 4F08A 4CNHA 4XS2A 2W1ZA 5K3YA 4O2PA 3IG7A 1WZYA 3CP9A 3KGAA 3O71A 5JSMA 5DNRA 1YI3A 4F6WA 4U43A 4KS8A 2Q0BA 3MBLA 4IX6A 2OG8A 3WF6A 4DFUA 2JIVA 5J1WA 4WUNA 3DS6A 5JZNA 3HRCA 4F9WA 1QPDA 2ZVAA 5CSVA 4RA5A 3N51A 1PMNA 4KWPA 2ZM3A 4NM7A 1BKXA 2IZUA 3A60A 3ORZA 4H1JA 4RRVA 2PL0A 2F7EE 3OWKA 3KK8A 4J98A 3TNWA 3ITZA 5K5XA 3UBDA 3D2KA 3GQLA 2V7AA 4QPAA 3OVVA 2Z7QA 4Y85A 3BYUA 4U79A 3R1YA 3QZIA 5HGIA 4D5HA 4UMUA 5AFVA 3F2NA 4ANOA 3A7HA 5CU2A 2ZDUA 4I5HA 4L43A 3FXWA 3AGMA 2JIUA 3DZOA 1DI9A 4QPSA 4O6LA 3NIZA 3VBWA 3EKNA 2CDZA 2QG5A 3JY0A 2J5EA 1J91A 5D9HA 3C1XA 2XRUA 4NW5A 4MWIA 5DEWA 5C9CA 5AMNA 5A54A 2YDJA 5LOHA 4C3FA 4ZSAA 1G8AA 5EOBA 5IEYA 3NNUA 3GI3A 3Q96A 3BQCA 4FIIA 4R8QA 3W2OA 4AWIA 3SVVA 4EK8A 4YHFA 1J1CA 4TWCA 1W0XC 5LXMA 4MBJA 1TQPA 3OG7A 3R0TA 3GC8A 2HY81 4UMTA 4IVAA 4K2RA 5HBHA 5J95A 4IB3A 4I92A 4MXCA 4RWKA 4BBMA 5CVGA 4E73A 3E92A 5HCYA 4BDEA 3QBNA 2X4FA 3W2QA 3MYGA 3Q4CA 3ULZA 2YCQA 5HEZA 3TL8A 1Z5MA 4MQ2A 4XV1A 4M3QA 5AV2A 3ZS5A 4BYJA 4JIKA 2Y4IB 4RT7A 2BAJA 4O7ZA 3QD0A 2B0QA 4ZJJA 5IQCA 2HIWA 4QP6A 2GU8A 1JKKA 2XK8A 4ITJA 3CGFA 4O91A 5CU3A 3FLZA 1WFCA 3G6HA 3RNIA 1S9IA 3OXIA 4XV9A 2R7IA 5FD2A 4ZTNA 3UNJA 5J79A 4Q2AA 4X2NA 2GFSA 3GBZA 3NNVA 4MWHA 4DGNA 3FQSA 2PE0A 3UC3A 2YN8A 2VUWA 4HVSA 4R5YA 4H3QA 1ZARA 1O9UA 2W1GA 3MS9A 4KD1A 4F0FA 4I1ZA 4UALA 2JKMA 3N4VA 4FTKA 4DG0E 4QMOA 3RK7A 5EHOA 3QCXA 2QONA 1H1SA 5KZ0A 4EHGA 1YDSE 3FPMA 4FBXA 5CANA 3MJ1A 5ETFA 1J7LA 3QTUA 4ARKA 3V04A 3S1HA 2I0EA 3TIZA 2QVSE 3HUBA 4LV8A 5AUZA 3FQEA 5A4LA 5C4KA 2VTSA 5KMOA 2X7OA 4OTIA 5B7VA 2WMVA 4I0SA 5AAEA 1Q41A 3AD4A 4MNFA 4BZDA 5IQHA 4H3BA 3EJ1A 4UWCA 2R3MA 1PF8A 3ELJA 4RIXB 4E4XA 2SRCA 2J51A 4GVAA 5HORA 4YGAA 3POZA 2OFVA 3KQ7A 4PF4A 4PPAA 4XRLA 5IG1A 5IDNA 5E4HA 2GSFA 3QUDA 4JBQA 4BHNA 2ITVA 4ACHA 3NLBA 4DEIA 3FMNA 5HLPA 4BTMA 1JOWB 3KU2A 4ENYA 3AOXA 4ACGA 2X6DA 4P7EA 3FI2A 4IAZA 4AFJA 3M1SA 4KSPA 2PVJA 4CZYB 3R01A 5TE0A 3DLSA 2CNQA 5EG3A 2I6LA 3OP5A 3C5IA 3UGCA 5GIOE 2ETMA 1PXJA 3R8UA 4Y83A 4P5QA 2Y7JA 2GS6A 4ZP5A 4CV8A 2PYWA 2Y8OA 4BGHA 4C36A 3MPAA 4AN2A 3LCTA 4IACA 4R3PA 5EI8A 5HBJA 5DE2A 4EH2A 5KMIA 4JG8A 1E1XA 3D83A 1Y57A 1SYKA 3CTJA 3L8VA 5L8KA 2YIWA 4IVDA 5D1JA 3EL8A 3ORIA 3VS4A 4BCJA 4IX5A 5TR6A 3VQUA 4I0TA 2HW6A 2WD1A 4AF3A 4FKJA 5IQIA 3ENHA 3JPVA 4BWPA 1XH7A 2J0KA 1Q62A 3CJGA 3FI8A 3FKOA 2OI4X 4FKOA 4XG6A 1LP4A 3W10A 3UJGA 2O2UA 4Z55A 2XNBA 2OXYA 1CSNA 2XBJA 5KMNA 2CN8A 5HO7A 2IZSA 2PVHA 3LXPA 3U55A 5TF9A 4AX8A 4YO6A 4QMQA 3TUCA 3FY2A 3O7LD 3R1SA 3L8PA 5CAVA 4UYAA 5EM6A 5EK7A 3QA8A 2C6KA 2R3HA 3MB6A 3R71A 4MXYA 2QLQA 3VF9A 2QHMA 4RVMA 4F09A 2WB8A 2C30A 1XH6A 4ZXTA 4BDDA 3HDMA 5J5SA 2YZLA 3PE1A 3QX4A 3WIGA 4LOOA 1TQIA 5IQDA 1B38A 4XBRA 2WQMA 5IZFA 4GK2A 3AMYA 3I79A 5FUTA 2UW9A 5DH3A 3H4JA 5FM3A 4DH5A 4I5CA 5C8NA 2BDWA 1OL2A 2HXLA 5JFXA 3R28A 4NTSA 1ZYLA 4BDGA 2B4SB 2XCKA 3Q9WA 3Q2JA 2WEVA 3O8PA 3BE2A 4GH2A 2YDKA 4Y5HA 2V62A 4FEXA 4PPCA 5HG5A 4YBJA 3LJ1A 3TJDA 4FKLA 2YWPA 3V5TA 3H3CA 4L01A 3BHUA 5IISA 3LFDA 3UIBA 3QD2B 4PDOA 2AUHA 4ZTSA 2UZWE 3RPYA 3PPJA 2VNWA 4GU6A 4BCGA 5CU0A 5T6KA 4E6DA 4Q9SA 4UB7A 3JVRA 2IN6A 2ZV7A 4AW1A 3PXYA 4EHVA 2OGVA 5GZAA 3K2LA 2UZUE 4DCAA 2PVMA 1SVEA 2JKKA 2JAMA 1YXXA 5E90A 1NT2A 1U5RA 4QMUA 5CYIA 4L44A 3IDPA 2QR8A 4O7RA 4LGGA 3T9IA 4EOKA 4APCA 2Z8CA 2FH9A 2OZAB 3ZONA 4M68A 4W4WA 3DB6A 4EQCA 5M4FA 3O8TA 3L8XA 4HYHA 4I6FA 2GTNA 4HYIA 3KXGA 4OTWA 4S30A 4O21A 5EKOA 3F7WA 3FZSA 2VTQA 5A46A 4TYJA 4QMYA 5A3XA 5AV1A 3GC7A 3U87A 2I0YA 4JXFA 5J1VA 4JG7A 5GZ8A 4O7SA 3BHTA 5IA1A 3DB8A 2YJRA 3R8PA 4QMNA 2PMNX 2YIQA 5ACKA 3A7FA 4DYMA 5CALA 4L46A 1WBNA 4A9UA 1Q24A 4J96A 3ZRKA 2IZTA 4RIWB 3FV8A 3M2WA 3P7CA 2VTMA 1YQJA 4Y73A 3NAXA 3FZPA 4FKQA 3DBQA 5AUTA 2CGVA 3PUPA 3GCQA 4G2FA 1JBPE 3FMJA 3LXNA 4GRBA 1Q8TA 4YNEA 3DBCA 3IOKA 5AR2A 1OKZA 4G16A 3UP7A 2QOIA 3D5XA 3OC1A 5J7BA 4HYSA 2OH4A 1U54B 2WMXA 2G9XA 1FMKA 4C02A 5IQAA 1CDKA 3EN6A 1SZMA 4G34A 2UZBA 4M8TA 4DCEA 4R7HA 3TNPC 1M2PA 4ZTRA 3NCZA 2R3JA 3R83A 3U6JA 3PP0A 4RJ8A 3WARA 5M51A 4CEGA 4AXAA 5HOAA 3F5GA 3FJQE 3KFAA 2O63A 3CEKA 2DYLA 3UYTA 3ORPA 2PUIA 4FIJA 1OBDA 4DFYA 3QRJA 4BC6A 4CT1A 4HYUA 2FGIA 4RBLA 5BVEA 2G1TA 4GIHA 4CFUA 2GNGA 3E7OA 4TPTA 2R3LA 4G1WA 3ORXA 4J71A 5CVHA 3HL7A 1F3MC 4FTIA 2CGXA 4O27B 4EK4A 3GOPA 1EH4A 5LJJA 5GNKA 3ZM9A 3FI4A 4TWOA 3EFKA 2CPKE 5A4CA 3SA0A 2XNEA 1KUTA 4UY9A 4W4VA 4Z7HA 3U8WA 4O7YA 1UWHA 2PULA 2H8HA 3PWYA 4ZY6A 5AR4A 1JAMA 4A4XA 4LG4A 3NW6A 2YM5A 2GFCA 5FTQA 4C2VA 4FT0A 2CKOA 3HLLA 1U5QA 2UW3A 4RWIA 2C0TA 4F4PA 4OTRA 3PIXA 4QYHA 2P0CA 5E92A 2WMWA 4JS8A 5DVRA 3QRTA 2R2PA 3VS3A 3DK6A 5A4QA 4B99A 5M4UA 2ITNA 2B9HA 4JAJA 4TY1A 4GG7A 2X1NA 5ICPA 2R0IA 5ANOA 4H05A 4FT7A 3DA6A 3QAME 1YKRA 2DS1A 1UVRA 4YHTA 4AW2A 1PYXA 2VRXA 2O65A 2WGJA 5F1ZA 5HLWA 4I41A 4XOZA 1GZNA 5I9ZA 3S3IA 3PLSA 4RFZA 3JY9A 3SRVB 3KXZA 4FTMA 2WMBA 4OW8A 2XRWA 3HV6A 3R8VA 3PVGA 4KBKA 5BVDA 4AQCA 1BUHA 5B2KA 4CKRA 1PXOA 2YDIA 4I5PA 2XF0A 1G3NA 2WAJA 4LYNA 5CT7A 2B55A 5CAQA 3MSSA 5J7HA 3TV4A 3RPVA 3GQIA 3ODZX 4BCIA 4QMLA 2W05A 5L2TA 1UKHA 3BHHA 3FDNA 3IO7A 4FICA 2PVLA 4TYEA 4EUTA 3GC0A 4F9CA 3UQCA 4GK4A 3AD5A 4AACA 4ACDA 2X4ZA 5HZNA 3C9WA 3PY3A 3VBVA 3MVLA 4OAVB 4ALUA 3GUBA 2A1AB 3PJ1A 1W8CA 4HOKA 3RK9A 4IZAA 4OTGA 3R7VA 3W8LA 1NXKA 2OW3A 3M42A 4JDJA 5CAUA 3PJ3A 3VBYA 3QYWA 1BYGA 1BLXA 3FBVA 4G9RA 4WRGA 3ATTA 4TZRA 3HUCA 3ORNA 3RMFA 4FKIA 3KRLA 5CI6A 4BDKA 3F5UA 1H28A 4MHAA 3C0IA 3F3WA 4YBKA 2C69A 4M15A 5DR9A 3BLHA 1ZXEA 3MDYA 2HAKA 3Q9XA 2WOTA 4L7SA 2PUUA 1OECA 3QUEA 4KIPA 4PMTA 4MD7E 3HRFA 4L45A 3UG1A 3DFAA 5CSHA 5CASA 2VO6A 1DM2A 2XKEA 3K5VA 2BUJA 4A06A 4RC3A 4DFBA 3QHWA 4D4RA 3SKCA 1B39A 4EH7A 3TKUA 3H9OA 3FLWA 5BVFA 5IH4A 4L3PA 3PFQA 2F7XE 3KCKA 3OTVA 5HNIX 3WIKA 5HE0A 1BL7A 1UKIA 5D7VA 5T68A 3FI3A 2R0UA 3RAKA 3BI6A 3VW6A 4CV9A 2WQOA 4GFOA 5HE1A 1DAYA 4KIKA 3NVMB 3COKA 3CD8A 3W1FA 1OUYA 3R1NA 4JDKA 4QTCA 3HMOA 2FA2A 1XH5A 3R00A 4MCVA 4EOMA 4J7BA 4QYEA 4BR3A 2JEDA 1YWRA 3C4WA 4KNBA 2WNTA 1DS5A 5FBNC 5CAOA 1PXNA 2BTRA 5AEPA 5F4NA 5CX9A 3BWJA 4O7TA 4I23A 2BRBA 3FXXA 3BGQA 3VS2A 2XIYA 1OL7A 2X81A 4FVPA 3V5QA 2AC5A 4PTEA 4KIQA 3JVSA 3EQGA 3R7IA 5ANGA 3NYNA 1OUKA 1XO2B 3NUYA 3CKWA 1JKLA 2VWXA 2GQSA 3COIA 2YIXA 3CC6A 4KSQA 3A61A 3AT2A 3QF9A 2IW8A 3O2MA 3KMWA 4O82A 3PIYA 5HVYA 2UW4A 4V0GB 1FINA 3P5KA 1Z57A 2GTMA 2H9VA 4J95A 2YEXA 1W7HA 4I24A 4YJSA 5CT0A 4EI4A 2XA4A 3MVJA 4G3EA 3QZGA 5DOSA 3UZPA 4FL3A 5JKGA 3FL5A 3HV5A 3K3IA 4BDHA 5HLNA 4FK6A 4BTFA 4G3CA 4GUBA 2GNFA 3WZKA 3EQPA 4L53A 3SGCA 4K9YA 2RG5A 1SM2A 5KBQA 4RX7A 3G6GA 1K2PA 3T9TA 1ZYCA 3EFWA 4DG3E 2XP2A 3C5UA 4ZOGA 1Z9XA 2X8EA 3AQVA 3VS5A 2YAAA 3DK7A 3OXZA 5J8IA 3ZXTA 4D0WA 4UEUA 5KHXA 4RA4A 4RQVA 4V01A 1TKIA 4ONAA 2EU9A 4QO9A 3V5WA 4EZ5A 4KUJA 3BEAA 4DHFA 4AE9A 2BTSA 3WZDA 2WTJA 3CBLA 4EZ7A 2PPQA 3D2IA 1NVRA 3QTSA 3ETAA 3MTFA 3PXFA 3KULB 2YM4A 4DINA 2ACXA 4L3LA 4UV0A 4KINA 5H3QA 2RFSA 2B52A 3FUPA 4L6QA 4O22A 3OFMA 1P4FA 4WBBB 4G3GA 5HTBA 4ZIMA 5AP3A 4YR8A 4FKVA 4PTGA 4IX4A 2C6LA 2P2IA 5AR3A 4ID7A 2F2CB 3K54A 4F1TA 3QRUA 1ZMVA 4DTAA 4EH3A 4FTNA 4V05A 2FSTX 5ANDA 2ZB1A 4J1RA 1P5EA 4KABA 4MH7A 3ZUVA 5HD7A 4XG2A 4GK3A 2HZNA 1OL6A 3EYHA 4PQNA 3R9DA 4DITA 4O7LA 2C5XA 2V22A 3P1AA 4WA9A 2XBAA 5IA3A 5CF5A 4XG4A 1FGIA 5CY3A 4NIFB 4EUUA 2HWOA 1R39A 4HVHA 2C0IA 3ATSA 4MAOA 2W1DA 2XH5A 4YJNA 3R30A 3S4QA 3EYGA 2EXEA 3GU7A 1UU3A 4RMZA 3HP5A 3FQHA 4NJ3A 3V5LA 3W8QA 5J5TA 5M08A 5M4CA 4ITIA 2CKQA 4M69A 5AADA 3P79A 3GU4A 5L8JA 2HZ4A 3GOKA 3T3VA 3LFQA 5C03A 3RP9A 3UVRA 4YU2A 5LVOA 1QPCA 3RGFA 2H6DA 3MVMA 4EL9A 3EL7A 4RG0A 1URWA 5CVFA 3BU6A 3HVCA 1KE6A 3PSBA 4FK3A 3SAYA 3MTLA 4XV2A 3TI1A 3QD4A 3ZO1A 3HMIA 3BQRA 4R7BA 4E5WA 4G6OA 3D7TB 2YCSA 2UV2A 4FMQA 5AM7A 2HY0A 4DGOA 2GNJA 5TO8A 4C4HA 5KBRA 5BUIA 2CN5A 3Q5IA 5M53A 5L2IA 5CTPA 3VHKA 3P78A 3RZFA 4YTIA 4GCJA 4DH7A 3SDJA 2YM3A 4ZLOA 5G1XA 1IASA 1PKGA 3QQUA 4F9AA 5IUIA 4KBAA 4PMMA 4BWKA 5H2UA 1YXSA 4GFMA 2J0LA 2R3QA 3RBWA 4D1XA 3HNGA 4FG7A 5HG7A 4TYIA 2Y9QA 3F9NA 4AGWA 5BYZA 3LQ3A 1Q99A 4MVFA 2PMIA 2BKKA 2G01A 4NCTC 3GT8A 3MJ2A 1KWPA 4I6HA 4XP0A 1M17A 3KXMA 3VS7A 4C4EA 5K4IA 3L9PA 4OT5A 3C4EA 3R21A 5DA3A 4C4JA 4CRLA 5IPJA 1MRVA 2H34A 2J6MA 4OTHA 4D9TA 3ZBXA 2XNGA 2IVUA 3OZ6A 4FYNA 4KIOA 2R3IA 3FMKA 5ITAA 3GENA 2R3OA 1OL1A 3CLYA 4XG3A 5EFQA 1PRYA 4RZWA 2QLUA 3FHIA 2QKWB 3AC2A 3NPCA 2A4LA 3PA3A 5E8SA 5FEEA 4D1SA 5JZJA 3AC8A 4BI1A 4MNEB 3FMDA 2O0UA 4L9IA 3E5AA 3H9RA 3SXSA 4TWNA 3G5DA 3ZXZA 4RPVA 2E9VA 3UOKA 4FTCA 4L8MA 2HCKA 3GCPA 1FOTA 3R7UA 1STCE 1Q61A 2VU3A 3QL8A 4NU1A 4RWJA 4TNBA 4JBPA 5EKNA 2ITOA 3ZTXA 2HWPA 5FXRA 3NEWA 3LPBA 2UZVA 3AMBA 3OY3A 3C0HA 5EYDA 4EOIA 1MP8A 4LL0A 2UW0A 3FMHA 2XZSA 3K5UA 4USDA 4W9WA 4CYJA 2C3LA 1J7IA 4H3PA 4BDIA 2XK6A 4B7TA 2WOUA 3BV3A 1GJOA 1W82A 5HX8A 4E4NA 3HGKA 5IUHA 3AT4A 4F7JA 2R3GA 3KK9A 1PMVA 4AOIA 3DXQA 4ZSEA 4BIBA 1ZAOA 2OIBA 4ANBA 3W2SA 3PPZA 4BKYA 4FSQA 2YCFA 3RAWA 5EQYA 2ITWA 1ZLTA 3F7ZA 1WAKA 4P90A 4C35A 4ANNA 3ULIA 3QQJA 4IZYA 4D9UA 3IKAA 2WIHA 1H01A 2JDTA 5D41A 3FMEA 5DWRA 3RI1A 2R3FA 1UU9A 4IJ9A 3P4KA 3TKIA 3W18A 2G15A 4GKHA 2JD5A 3WE4A 2CNUA 5GHVA 3WYYA 5M09A 4F6SA 4G3DA 2GCDA 4B0GA 3BYSA 1CMKE 4EWQA 4JI9A 1S9JA 5AM6A 2C4GA 2CCHA 3O17A 3Q53A 4C4IA 3GEQA 4GFGA 1H1PA 4F6UA 4FI1A 3I0QA 4IB0A 3JYAA 2QR7A 4DEHA 3W2PA 4OUCA 5AUXA 1H08A 5DN3A 3BCEA 4HGLA 4BDFA 2BRGA 4BL1A 4F7NA 3VRYA 2VTJA 2A27A 3PG1A 1VEBA 2JGZA 4OBPA 3LFSA 3FZOA 4LRKA 4FOCA 4UWYA 3WI6A 2VX3A 1E9HA 1PMUA 4ZTHA 3RZBA 4XCUA 5HE2A 2VD5A 1IRKA 4YJQA 2ZV9A 4AW5A 5CEMA 2PVKA 1R0EA 5ACBC 4FSWA 4PV0A 4PDYA 3E93A 3WZEA 2YA9A 3IDBA 1A06A 4I6BA 4IM2A 4RX5A 1WBWA 2GHGA 2RSVA 2W1CA 3BU3A 3BYMA 4CMUA 1JVPP 4GU9A 2QOFA 4OTFA 4FC0A 1XBCA 5CLPA 3FPQA 2IW6A 4BCMA 3HECA 4QMXA 5IQGA 3JXWA 4DFZE 5E8YA 4MF0A 1BI7A 2UVYA 1WCCA 4RSSA 3C13A 3UQFA 5ANEA 4QMPA 2JIIA 2W4KA 3A62A 4LL5A 3AC3A 1A9UA 1KE5A 3DKFA 2QD9A 5G6VA 3TXOA 5H8GA 3WF7A 4O7WA 5FXQA 5BVKA 4AA4A 4CFWA 3UO6A 5I5ZA 5IMXA 5EQPA 4KB8A 3HKOA 4HPUE 2W5AA 3NIEA 3MB7A 5E91A 4GYGA 4CFFA 1LUFA 2HOGA 3CQWA 3BELA 3EFLA 2YHVA 3DQWA 4IFGA 3ZSHA 4Z16A 5I9VA 4NM0A 4FSRA 3F2AA 1XH9A 3ZZWA 2EXCX 4R6VA 4XH6A 2OWBA 3O51A 1PKDA 1O6YA 1Q8ZA 5HIEA 1CKPA 3BHYA 3W32A 5DT0A 4OTPA 4QTBA 4I94A 3I6WA 4BDCA 5JMSA 4U41A 5I9XA 5I9WA 4FGRA 4HJOA 3E7VA 1WVWA 4YHJA 4DC2A 4FTOA 4DT8A 3AGLA 2X8IA 4G3FA 4FSZA 2UVXA 3R73A 2ZB0A 5GIPE 1H8FA 1X8BA 3RK5A 4LRMA 3LW0A 3ZEWA 1M7QA 4C33A 4EH4A 4WNKA 5BX0A 2CMWA 3NW7A 4K0YA 5IH5A 1ZOHA 3NNXA 4D2SA 1OIYA 3QRIA 4JAIA 5AUVA 1GNGA 4DN5A 3E62A 2QOHA 3CQEA 5EI6A 1M7NA 5C27A 3G0EA 4RLKA 4FEWA 2UZEA 2IVTA 3ZRMA 1MRYA 1PXIA 3B8QA 4LMNA 4GSBA 5AAGA 3LZBA 3E3BX 1RJBA 2VWYA 3BYVA 4R1VA 4KRCA 4AA5A 2RGPA 3SG9A 5BUEA 4YLJA 4W4YA 4I93A 4FEVA 3EOCA 1KE7A 3RVGA 3COMA 4WUAA 4EJNA 3LQ5A 4LUEA 3TKHA 4F65A 4F1OA 4P2KA 4JLCA 3KL8A 4D4VA 1Y6AA 3GU6A 5BVNA 5M07A 2ZMCA 3ALOA 3BZ3A 5JRQA 1WVYA 1SMHA 1W84A 3EHAA 4LUDA 3QKKA 4FEUA 1Q3DA 2PMOX 3UZRA 2VTHA 3E63A 3F2RA 3V6RA 5C01A 2B9IA 2HELA 4E20A 1REJA 4JG6A 4C0TA 5LMKA 3NZ0A 2CKPA 2QU6A 3TZ7A 4DEAA 3TEIA 4XHKB 1KE8A 4PMSA 5CU4A 4FSYA 3MIYA 3SV0A 2YABA 2REIA 4NM5A 4C61A 3F69A 5DI1A 5ANJA 2R9SA 5I4NA 3S95A 4FTRA 1WVXA 5DRBA 3H10A 3FMMA 2QG7A 4WNMA 3A8WA 3PTGA 4GS6A 2QNJA 1JSUA 3C4ZA 3FLSA 4R3RA 1H0WA 4FSTA 4V0GA 5AR8A 4WHZA 4AW0A 4OGRA 4FV0A 2NNWB 1JPAA 3COHA 1MRUA 4II5A 1BMKA 2ESMA 2W4OA 2VTNA 4IC8A 4F64A 4BCHA 4HGEA 3ANRA 3OUNB 3O7LB 4UXQA 5LVMA 1UA2A 1V0PA 3MH0A 1Q3WA 3DLZA 5I0BA 5EYMA 4U3ZA 4DFXE 2FSMX 5LMBA 4C8BA 1YXVA 3PZEA 3QQKA 4HNFA 3BRBA 4DLIA 3R7OA 4DBNA 5J9LA 5KZIA 2ZDTA 5IEXA 3OUKA 2JDRA 2NO3A 2C1BA 5DT3A 2VX1A 4M97A 4IAKA 4EOQA 4F9YA 4FT5A 4BGGA 4YJPA 5J87A 2VNYA 3LHJA 3ZMMA 4FTUA 4I6QA 4BTJA 4RVKA 3ORTA 4WNPA 3ID6C 1OKYA 2XM9A 4RJ4A 2QI8A 3EZRA 4HVIA 3LXLA 3CTQA 3DKCA 3P08A 3FYKX 4QP9A 3Q4ZA 4YZCA 4QP1A 5AUYA 5GJGA 2X9FA 4D2PA 1UNGA 4IQ6A 4R78A 4IE9A 3DZQA 4FYOA 2ETRA 1YRPA 1ATPE 3BGZA 3TZMA 3O23A 3NYOA 4DF3A 2BZIB 3CE3A 4FOBA 5AP2A 1OI9A 4EH5A 2V5QA 3NCGA 5K0XA 3Q4TA 3NYVA 4IADA 3GVUA 4BBFA 4HVDA 1H25A 5EHLA 1YWVA 3LFCA 5BVOA 3PE2A 3GCSA 4LGDA 2R3NA 4O38A 5DIAA 1G8SA 1Y6BA 2ERZE 3CIKA 2UVZA 3UIMA 3OBJA 2WMRA 4AS0A 2OLCA 2IWIA 3E3PA 4JBVA 4TL0A 4JX7A 2WTIA 5E9EA 4ZLYA 5F95A 4ZEGA 1GOLA 3VUDA 2JBPA 4A9SA 3NYXA 3CKXA 3FLYA 2NRUA 2ITUA 2UW7A 3Q6WA 2C5NA 4L68A 2QKRA 4ZMFA 3NMUF 3EQRA 5AJQA 4Y5QA 5IEVA 3UG2A 3ZO3A 4S33A 4BF2A 5LWMA 2IW9A 4BYIA 2UW8A 4IXPA 4XG9A 3V3VA 5IH6A 4CFVA 1FBNA 2YITA 3PJ8A 4WG5A 2RG6A 4AGCA 2UZOA 4IJPA 4PNKA 3KF4A 5HKMA 5F9EA 5JH6A 2ITXA 2CCIA 5CF6A 4DGGA 4UMRA 4AZFA 4G5PA 3HRBA 4U45A 4HGTA 4RLLA 5HX6A 4HCTA 1R1WA 4FE2A 3TV7A 4O1OA 2PWLA 3ZM4A 5CEQA 3UODA 5JGBA 4F0GA 4OBQA 3UO5A 5L2SA 4WSYA 3GP0A 2YERA 2NPQA 2XK9A 1ZYDA 4FV6A 2V7OA 5AUWA 3QC9A 5H9BA 3HAVA 3DBEA 4BHZA 1RQQA 3O0GA 3U51A 4ZLZA 4E7WA 1UV5A 3L9MA 4A9YA 4BZOA 2YIYA 5GINE 5AV4A 5IKWA 4AZEA 3LQ8A 2C6TA 2W9FB 2V55A 4HZRA 5I3RA 3ROCA 4HPTE 5AP0A 3DJ6A 4FV8A 5EDPA 4TTHB 5LWNA 3QTQA 3IS5A 3DJ5A 1XHAA 3OS3A 1CTPE 3B2TA 5E8UA 4ASDA 4F0IA 5I3OA 3I0OA 4YJVA 4ZTMA 1JNKA 4C4FA 1ZMWA 4ZY4A 3BU5A 2CSNA 4O83A 2OIQA 3CY2A 1PJKA 5FP6A 5CF4A 2F2UA 2JDSA 3WOWA 4ANMA 4CFNA 4G6NA 5E1EA 4QRCA 3ZHPC 3KKVA 3QZHA 4J8MA 5FRIA 3HA8A 4A4LA 5HTIA 1ZWSA 3MA3A 1GIHA 1NA7A 2EB3A 4IW0A 3MPMA 1H0VA 2C3KA 3OWLA 2C6OA 4HCVA 2VGPA 4FSUA 4ZS0A 4A9TA 1H27A 4EH6A 5M4IA 1FPUA 4EEVA 4MQ1A 5KNJA 2OBJA 2B9FA 2BRHA 5DR2A 3IONA 1YHSA 2P4IA 2ETKA 4K6ZA 2PSQA 1R3CA 3PLAE 2PMLX 3PSDA 3ACJA 2R3PA 4JDHA 4KA3A 1SNXA 3TNHA 4X3JA 3OCSA 1OL5A 3EN9A 1H07A 3A99A 4G31A 3UOHA 4RJ5A 2X39A 4IVCA 5ETIA 3TV6A 3FY0A 3U4UA 5EHYA 4EHEA 2QOBA 2VTOA 4GW8A 3ET7A 2OZOA 3Q9YA 5CS6A 1ZYJA 2JITA 3KRWA 4XUFA 5M44A 3CTHA 2ERKA 4XP3A 4CZTA 2VTRA 4FZ7A 4BN1A 5CI7A 4NEUA 1L3RE 4UMPA 3NSZA 5HU9A 4ZJVA 4BCKA 3CQUA 4RX9A 3G9NA 2X7FA 3ZBFA 4X3FC 2BKZA 2BR1A 4FODA 5CNOA 3SQQA 3DU8A 2BALA 4PY1A 4DFNA 2GHMA 2J4ZA 3IGOA 3NGAA 4L42A 3B2WA 3EQFA 3QCYA 3IK3A 3VBXA 1HOWA 3LFAA 5TOZA 4R3CA 2W1FA 3OMVA 1OIRA 2HK5A 1RE8A 2BCJA 3ZZEA 4D58A 3O96A 2CJMA 3QGYA 3QX2A 3W2RA 1QPEA 3LFNA 3DBFA 3WYXA 4OR5A 4NSTA 1KSWA 4XX9A 5HVKA 1ZYSA 3V8WA 4D28A 3QTRA 4U40A 2W06A 3DXPA 3LCKA 1Y8YA 2R64A 4YPSA 3FC2A 2YM6A 3LCDA 3N4UA 4IM0A 3NWWA 4DEEA 4N57A 2F4JA 5AP1A 5FXSA 1PHKA 4E4MA 4X21A 3R22A 4M66A 5AWMA 2IJMA 5AV3A 4EOLA 5BUJA 3OROA 2KULA 3A8XA 3LMGA 4A7CA 3CR0A 3LFFA 1WBSA 2Y4IC 5FGKA 1WBTA 2RIOA 3MY5A 4TYHB 3VN9A 4FUYA 4NK9A 5IA4A 2RFEA 3MH2A 4WNOA 5IQBA 4U7ZA 3VS0A 4E26A 1QMZA 2XMYA 5JN2A 1RW8A 4TN6A 3GU8A 1KV1A 4X7QA 5IF1A 1M14A 4CZUA 3RAIA 1VYZA 3VQHA 5D11A 2ZM1A 3H0ZA 3P9JA 3Q9ZA 2WTKC 3VW8A 4D2WA 4EH8A 3KY2A 4PX6A 4D55A 2VTTA 4O0SA 2XVDA 1CM8A 3VUIA 4B6LA 3IGGA 4J97A 4O86A 5CZIA 3BLRA 3KCFA 3LM5A 5HHWA 5FDPA 3QTXA 4TT7A 4CGAA 1V0OA 4RIYB 3PRIA 3HMMA 3UIXA 4C59A 3D7ZA 4RIOA 5D7AA 4MXOA 3H30A 4B8MA 4K77A 3QRKA 5FEQA 4U9AA 4APPA 4O2ZA 3E8NA 1KV2A 2Z7RA 1SVHA 2R4BA 3M11A 2C47A 3G90X 3AXWA 4OTDA 4YURA 1GIIA 3CSVA 3PXZA 5HG9A 5H8BA 4BRXA 2XIKA 2XK7A 5DLSA 2A19B 3LFEA 4DEGA 4ZS4A 3TUBA 1V0BA 4PWNA 2ITZA 4FV3A 1XR1A 3BBWA 3VS6A 4Z7GA 4DA5A 2PY3A 3QD3A 4BCFA 1XBAA 5L6WL 3R9NA 4A9RA 2I0VA 2ZOQA 3CPCA 5FDXA 3ZDIA 5IQEA 4BKZA 4EK5A 5CEOA 4RIXA 3MFTA 5EYCA 4E5AX 3ENMA 3PPKA 5AIRA 4IDVA 3UPXA 1PYEA 5KMMA 4JJRA 3FE3A 3QLFA 5HO6A 4ANSA 4JRNA 2BILB 4NFNA 3C4CA 1XJDA 4HVGA 4ZJIA 4JT3A 3DBDA 1FVRA 4L52A 4WG3A 3DJ7A 4E6QA 4NYEA 3C51A 2W5BA 3DPKA 3RM7A 1FQ1B 1U4DA 4YZMA 4FT9A 4O0XA 3V01A 2W9ZB 2PHKA 4O84A 3I5ZA 1M2RA 1MQ4A 4GMYA 3F6XA 4WOVA 4ZTQA 5CNNA 1K3AA 1ZOGA 3I5NA 2BDFA 3KXXA 5E7RA 1Q5KA 1P14A 2X0GA 1JSVA 4QMZA 2OH0E 1IR3A 4MTAA 2XKFA 3RINA 3VJNA 4C37A 1LR4A 3GFWA 5C8KA 4Q9ZA 4U3YA 4WIHA 4TXCA 5KE0A 2P3GX 4JR7A 4EWHA 4YTCA 5FBOA 2J2IB 3VIDA 1ZY5A 4QTEA 1OMWA 3IW5A 4AAAA 5BMMA 2LAVA 3U6IA 1GIJA 3N9XA 4FKPA 4RC2A 4UX9A 3ROYA 1YW2A 1OIUA 3WF9A 5EW3A 2CLQA 5AX3A 3LLAA 3GB2A 4QNYA 4ZMEA 5JFVA 4EYMA 1OPKA 2YJSA 2ZV8A 4DLJA 3TUDA 4W4XA 1JSTA 2WQNA 4I20A 4AZTA 3UPZA 2WKMA 2QOLA 4MXXA 2ONLA 4QTAA 2VX0A 4QP7A 4FEQA 4FV1A 5HVJA 1VJYA 3DTWA 2C0OA 2IZRA 2YM7A 5AA8A 4U80A 2GS2A 3ZUUA 2WO6A 4YMJA 3G2FA 1APME 5ANKA 1ZZLA 3BV2A 4YLKA 5I9YA 2OICA 3MPTA 1MQBA 2WTDA 4FR4A 2BROA 3H9FA 3NNWA 4PDSA 5EM8A 4NKSA 2P2HA 4N70A 2XK4A 4UYNA 3SX9A 4PNIA 4AT4A 3ZDUA 3WZJA 4DEBA 1R0PA 4I4FA 4Z3VA
chains in the Genus database with same CATH superfamily
3IW7A 4GJ2A 3POOA 4MYGA 4F9BA 1TQMA 4ENXA 4F63A 3CXWA 4D2RA 3EQBA 5CQUA 2RFDA 5LVLA 3V5JA 4HCUA 4MK0A 1QCFA 1L8TA 4FTJA 4S2ZA 1IAHA 3AC5A 4ZSLA 5L3AA 1YI4A 2QC6A 3AC1A 5F94A 3KRJA 4YC8A 4QYGA 4FT3A 4EOOA 4MEDA 4IFCA 5KMJA 5T3QA 4OTQA 1E1VA 1OVEA 3I7CA 2C6DA 2DUVA 2VWZA 1PXKA 4ACCA 3DCVA 4RZVA 4ZZMA 1VZOA 2J90A 4MBLA 2HZIA 2DWBA 3W0PA 4F70A 4IM3A 5EDRA 4D4YA 1XKKA 4QTDA 1LPUA 2CKEA 4JQ8A 3W33A 1OPJA 4GG5A 4IVBA 5H8EA 4C62A 1F5QA 3QTZA 3P7BA 3DGKA 4FKWA 3QFVA 2JKQA 2EVAA 4XJ0A 4BBEA 3LFBA 2PK9A 3EN4A 4XMOA 5EM7A 3FMLA 4AE6A 3SW4A 1OKVA 2XJ2A 5LCKA 4AA0A 3DT1A 3MWUA 4RX8A 1FGKA 3CCNA 4RVTA 5KO1A 4FJVA 4QMMA 3UDBA 3I4BA 3L1SA 3OWPA 1ZY4A 4MF1A 1UU8A 4X2KA 1YI6A 2OZAA 4YZNA 3NUAA 4MXZA 4FIGA 4RQKA 3UIUA 3TJCA 4DHJA 4XEYA 3MI9A 4EBWA 4YJUA 4FUXA 3UMXA 1NVSA 4JOAA 2BFXA 3U6HA 2W1HA 3VUKA 3VJOA 3HA6A 3NVKI 4PDPA 4E6AA 5IQFA 3LM0A 5AR5A 4BI0A 3KMMA 4BIDA 2QQ7A 5HG8A 3RJCA 4W8DA 4C3RA 5IU2A 3I81A 2WMSA 2C3IB 4CVAA 4GUEA 3VUMA 2BVAA 5FTGA 4IDTA 5AIKA 5CSPA 4QYFA 5E8XA 3EFJA 3GGFA 2QODA 3KN6A 3MIAA 5EM5A 4A4OA 4ERWA 4YZDA 3R9HA 1TVOA 5JGAA 5EDQA 3IDCA 3R02A 3LCSA 3QTIA 2VO0A 4CLIA 4YC6A 4RIWA 3S00A 2BZJA 2XIRA 2XCHA 4U44A 2XYNA 4D1ZA 2GHLA 3OW4A 3QGWA 5LARA 3R7EA 1OGYA 1P4OA 3ZEPA 4GYIA 4N0SA 4R7IA 3DDQA 1XH8A 2RL5A 2X6EA 4IMYA 3O50A 3R9RA 3EZVA 3OT3A 4Y95A 3SOAA 4WRSA 1U54A 3ERKA 4AZSA 3D15A 4D2TA 5HCZA 3SXRA 3I6UA 4DH1A 3R04A 4PP9A 4O0VA 3Q32A 4AOTA 2YLFA 1WBVA 2OJ9A 4JNWA 3UNKA 4H39A 2Z60A 3R6XA 4LV5A 5EQEA 3RHXA 3LE6A 5C26A 4J8NA 1RDQE 4JR3A 1OKWA 1LEWA 3ZFXA 4ACMA 5IMEA 5AR7A 4L3JA 3REPA 1OIQA 2X2MA 4NM3A 5HIDA 3AKKA 3F66A 5TKDA 1P2AA 3RWPA 3C50A 1Q8YA 4YLLA 3OEZA 3NUPA 2QURA 3E87A 4LOPA 1ERKA 4E3CA 4QP2A 3VC4A 3DY7A 2XK3A 5M57A 3PVWA 4X3FB 5A9UA 3SC1A 1VR2A 3PVUA 4C7TA 5E8TA 5KKRC 5E8WA 2P33A 5FP5A 5CU6A 2WTCA 4CG8A 4WBOA 3BX5A 3CY3A 5L8LA 1JKSA 5C4LA 4P4CA 3UTOA 2VWWA 2XIXA 3QLGA 2FVDA 3QALE 4WT6A 4XP2A 4C38A 3PA4A 2CGUA 2A2AA 3UMWA 5HCXA 4E93A 2C6MA 5L2WA 2PVNA 3AC4A 3QUPA 4EOJA 2VO3A 4I22A 5ETCA 5HESA 1AD5A 3CS9A 4IH8A 3WF5A 2NRYA 2OJFE 4M0YA 2C5OA 2VWUA 3PJ2A 3ZLYA 2J0IA 4PL3A 2VTAA 5DT4A 2ZV2A 4H36A 3UE4A 4FL1A 4IAYA 2AYPA 4KIKB 4MD9E 4X2JA 4BI2A 5L4QA 2BPMA 1H1WA 1W83A 3II5A 1ZZ2A 4HGSA 3EWHA 4FG9A 3SLSA 2PTKA 2HW7A 3D5UA 4ANLA 4P5ZA 2CHLA 3SRVA 2XNPA 2XKDA 4U8ZA 2WZJA 2ZM4A 4EYJA 2FO0A 4G6LA 4D0XA 3OWJA 4WO5A 3EQDA 4IWDA 3QHRA 5BVWA 3UO4A 1U59A 2OIDA 3VULA 4QQTA 3R63A 1FMOE 3CPBA 2WFYA 5FWKK 4WSQA 4U97A 5HTCA 3L9LA 2QOKA 2WTKB 3QWKA 3EQCA 4QT1A 3SXFA 5JFWA 2C5VA 4M84A 2J0MB 4I21A 4NKAA 3A7JA 2VWBA 1GAGA 3F3UA 3KEXA 4O1PA 2WMUA 2DQ7X 3NAYA 4AU8A 3OCGA 2XNOA 3BIZA 4M0ZA 2BDJA 1V1KA 2WIPA 4FKSA 4O4DA 3VRZA 4AQKA 3CGOA 2W5HA 3NX8A 2WPAA 2XYUA 2YCRA 3G0FA 3KXNA 5EOLA 5EH0A 3KXHA 2J0JA 2WU7A 3VBTA 3RTPA 3VO3A 2XNMA 1H1RA 1OM1A 2WMQA 4N6ZA 3MFSA 4W8EA 2X9EA 2RF9A 3F61A 4USFA 2WEIA 4PL4A 2ITQA 4QMTA 1IAJA 2YACA 5LVPA 3DOGA 3I1AA 3F3VA 3PSCA 5CZHA 1IA8A 2YFXA 2WXVA 1FVVA 4O4EA 5CF8A 2OJJA 2I40A 3BGPA 3G33A 3ZLSA 1IA9A 1OBGA 4MBIA 4OBOA 4XG8A 4QQ5A 4PL5A 3Q4UA 3UVPA 5HQ0A 5JFSA 4LMUA 1YHWA 4ASZA 1GZKA 5BYLA 1DAWA 3OBGA 2OXXA 4BDAA 3IOPA 1Q8WA 2XIZA 4TRLA 5E8ZA 5AA9A 3CD3A 3ACKA 3IPHA 4O4BB 2CLXA 5C1QB 4TYHA 3BKBA 3EQIA 4BDBA 5M55A 2QOCA 3Q04A 3V51A 4CYIA 2PU8A 4YSJA 5LMKC 3PP1A 2WHBA 2VTLA 3D4QA 4FX3A 3RPSA 3VUTA 4EKKA 5BYYA 4KAOA 3EKKA 4FZAB 4PUZA 3THBA 4AZVA 5EW8A 4CQEA 5L6PA 3KC3A 3R1QA 4J52A 1J3HA 3V5PA 1YWNA 3F3ZA 3QTWA 3W16A 3WILA 5B0XA 4AFEA 5CAPA 4BY9E 3MH3A 4NWMA 4YUQA 4KS7A 4IIRA 3LMHA 1AQ1A 1WMKA 1YOMA 2X2LA 3F5PA 4BVUA 3FLQA 1OB3A 2J5FA 3R8ZA 4B4LA 2HENA 3BYOA 4O0UA 1ST4A 4DE4A 1PW2A 1GZ8A 2QCSA 4FV4A 4L7FA 2PZ5A 3E8EA 4NTTA 4X6RA 3FZ1A 5DGZA 4CCUA 3AG9A 4RIYA 3U9NA 4LI5A 1ZRZA 2OKRA 3KVXA 3NUXA 3V8SA 5JK3A 4IAIA 5JT2A 3ANQA 1U46A 2BIYA 4F7SA 5CSXA 2F49A 2VAGA 3KB7A 3PIZA 4I3ZA 4AGUA 3RKBA 3MA6A 3OW3A 3ZRLA 5DMZA 3ZSIA 2UW5A 5LCJA 4FTAA 4F78A 3EN7A 3C0GA 2O64A 2NP8A 5AX9A 3T3UA 2BRMA 3IW6A 4CD0A 4ZZNA 4BKJA 2W99B 3R7GA 4K8AA 4HW7A 2C3JA 2I1MA 3GU5A 4FZDB 5AP4A 2UW6A 4M69B 4N6YA 1KOBA 4BGQA 2GNHA 4EORA 5A6NA 5LVNA 4IAFA 5K0KA 3EN5A 4BICA 5FEDA 4O6EA 3UYSA 3ZH8A 1CKJA 4K1BA 4AP7A 4ANQA 4EONA 1A48A 1K9AA 5KUPA 1Q8UA 3HYHA 2WQBA 4ZSJA 5E1SA 5JEBA 3R9OA 4YC3A 3W0NA 4CFMA 3VS1A 4MXAA 1ZOEA 3HX4A 5FG8A 3UOLA 4AOJA 1I44A 4C2WA 1GY3A 2JKOA 4WG4A 2UZLA 4DBXA 2OU7A 4YPDA 2WTVA 2BHEA 4NJDA 4RVLA 4G17A 4CQGA 4G9CA 2W1IA 3LJ2A 4C58A 4F1MA 3OXTA 1H4LA 2OO8X 3KULA 4KBCA 4QPMA 1YHVA 1UU7A 2EWAA 4XLIA 3TT0A 2GPHA 3A7GA 5HBEA 1HCLA 5K9IA 3MN3A 4ALWA 3HV4A 4JQEA 2AQXA 2PVFA 4KKGA 3D9VA 3FZRA 5DPVA 2FSOX 3ZO2A 2YISA 2OF4A 2RFNA 1OZ1A 2UZTA 3GFEA 2B53A 4UZHA 4WKQA 4I4EA 2PUPA 4FTLA 5DR6A 3ZSGA 1YDRE 4EHZA 4NFMA 3ZYAA 4EOSA 3L9NA 2PVRA 3C4XA 2EUFB 3LAUA 4L67A 2Z7SA 5HD4A 3H0YA 1UNHA 3U4WA 2FYSA 2G2HA 5CSWA 5CXHA 3OOMA 1T45A 2FB8A 2YZAA 2E9OA 3MFRA 3QQLA 4IC7A 5KHWA 4NIFA 3R7YA 5FM2A 3QXOA 4ALVA 1NY3A 4H58A 2LGCA 4UZDA 2XJ0A 2OJGA 4BCPA 3W55A 5A14A 3MY0A 5JRSA 4DT9A 4EOPA 2Q83A 3UQGA 4QQCA 1OITA 2BZHB 2BZKB 3NUSA 4YTHA 3MH1A 2BRNA 4W9XA 5DHJA 4BFMA 3UVQA 3PZHA 3KMUA 1VYWA 3Q2MA 2PE1A 3OY1A 3F3TA 4KKHA 5EI2A 3V6SA 4LFIA 1XMLA 5JQ8A 1YDTE 4JX3A 5HO8A 4D5KA 2Z02A 3NR9A 4O0WA 3EB0A 2VWIA 4XYFA 3DFCB 4R77A 1G5SA 3D7TA 4U5JA 1VLRA 3LLTA 3E64A 1Q4LA 1W98A 3DK3A 4BZNA 4NZWB 4GT4A 3R8LA 3KA0A 4CTCA 1YVJA 1BI8A 3Q52A 4X2GA 2CNVA 1IEPA 3P5JC 4ZAUA 4UMQA 3K3JA 5DG5A 2VTPA 2PZRA 4CFXA 3VNTA 4JL9A 4E6CA 3ZC6A 1H1QA 2B54A 4XLVA 4O81A 4CMTA 4DTBA 4KKEA 2B7AA 1I09A 3ORMA 4CCBA 3PXQA 2VN9A 2WQEA 3BBTB 3LCOA 4FGBA 4NH1A 4A07A 3D0EA 3HMNA 2Z2WA 4GV1A 4ZY5A 2C1AA 5IA5A 4ASXA 3QA0A 3A2CA 4ZTLA 3EQHA 4LGHA 4UBAA 2G2FA 4FVRA 4FZ6A 1GZOA 5C8MA 3RCDA 1M2QA 5A6OA 3KVWA 4BIEA 3QU0A 4JIAA 4XRJA 4B8LA 4BDJA 3MW1A 2PZIA 4FKUA 4OAUC 3LKMA 4FNWA 2EB2A 1IG1A 2QO9A 3Q3BA 4S34A 3TNQB 5AV0A 1Y8GA 4EQUA 2OK1A 3FYJX 4L00A 4X0MA 1SNUA 3JS2A 3QXPA 1YXUA 4FV9A 2JFMA 1WBOA 2XKCA 3TZ9A 5DEYA 4C34A 2F9GA 3OD6X 2RKUA 3PG3A 3HEGA 4V04A 1URCA 2ZMDA 4OT6A 3TN8A 2WTWA 4AT5A 4DAWA 5DYJA 4DHIB 3ZLWA 4MNEA 3BPRA 4CTBA 5KKRB 4BCOA 3AMAA 3NW5A 2HYYA 3IW8A 3RWQA 2JDVA 3OHTA 4QMWA 4BWXA 4GVJA 2PZYA 4O0RA 4Y46A 3BHVA 3BE9A 1XWSA 5ETAA 3RNYA 1H00A 4DGMA 3D14A 1H24A 3KF7A 4GKIA 3VUGA 1KOAA 3ALNA 5J9ZA 3IQ7A 3FZTA 4IANA 4M7IA 1FVTA 2HZ0A 3F5XA 5I9UA 3TDWA 2O5KA 3OT8A 2W7XA 2W17A 2VO7A 3DDPA 3QQGA 4I0RA 4LQMA 4EJ7A 4IWOA 3SHEA 2OF2A 4M67A 4Q5HA 2GMXA 4AUAA 4IBMA 3U9CA 2WMAA 4DTKA 3P7AA 3HV3A 4LOQA 4IAAA 3ZUTA 1AGWA 1PXLA 5EYKA 5KX8A 3NRMA 4FIEA 3QCSA 5JGDA 4FVQA 2O3PA 2XNNA 3TG1A 3PWDA 3NS9A 3DKGA 1YXTA 4KRDA 5DBXA 4FNYA 3QC4A 2B1PA 1B6CB 2XEZA 2YM8A 3DNDA 4QEBA 4XG7A 2B9JA 1PY5A 4ZSGA 5IUGA 5L6OA 4TNDA 3VBQA 3JUHA 3VVHA 2GDOA 4PRJA 2V0DA 3Q5ZA 4FV2A 3C7QA 3FC1X 4D4SA 4C57A 3I60A 1TFFA 2JBOA 2UZNA 3LJ0A 4G5JA 5HICA 5IDPA 4ORKA 4BTKA 4QP3A 4JRVA 2GQRA 5K4JA 1WBPA 4PPBA 4YJRA 3D94A 3DQXA 2X2KA 1HCKA 3A4OX 1O6LA 3MVHA 4K11A 4JVGA 3IECA 2QO2A 5CEIA 2YWVA 4FG8A 3S0OA 5A4EA 3ZOSA 2E9PA 3DTCA 3MY1A 2OJIA 5AP5A 2IEWA 1PXPA 2QO7A 4X3FA 1BL6A 4TW9A 3AD6A 3ODYX 4MD8E 4IHPA 4O0TA 1MUOA 1ND4A 4C4GA 2X7GA 3R2BA 3BWFA 3GNIB 4FA2A 4DGLC 4DH8A 4XV3A 5IA0A 2Y4PA 3RPOA 2XEYA 5HNGA 3TNIA 4QYYA 5GJDA 4I5MA 3QKLA 3PRFA 3NDMA 4IX3A 4RJ6A 5HE3A 3UC4A 4EKLA 2C6EA 1Y91A 3BL9A 4QP8A 3RCJA 3FEGA 2PE2A 4E8AA 4FNZA 4E4LA 3U54A 3DXNA 3NUNA 4IB1A 4Y72A 4AZWA 4IWPA 5J9YA 2P55A 4FIFA 4JQ7A 2WELA 5F20A 2JC6A 2WMTA 3RHKA 4ASEA 2FUMA 2IF8A 5AAFA 1DI8A 3RALA 3VHEA 1REKA 4NT4A 1BX6A 4FV5A 4ITHA 4YTFA 2IPXA 3ZC5A 3B8RA 3DAKA 5HI2A 2EXMA 3ORKA 5K5NA 3WF8A 3FSKA 4O7VA 3KRXA 1J1BA 4R1YA 2ZJWA 3TACA 5A4TA 4YNOA 4FKRA 4EBVA 5TT7A 4EC8A 3E88A 4RJ7A 3HP2A 2W0JA 1JLUE 4FSMA 3PY0A 3QCQA 4LM5A 4FIHA 4FNXA 4USEA 1JWHA 3JR1A 4IZ5A 2GQGA 4GIIA 3VAPA 1XH4A 3FKNA 2AC3A 4RFYA 4DEDA 4F7LA 4NUSA 5CQWA 4AN3A 1KE9A 4PTCA 3TZ8A 4DFLA 1R78A 3A4PA 5BMSA 4RC4A 3T8OA 4CRSA 4FF8A 5LMAA 2IVSA 2A98A 4MX9A 4TWPA 4CT2A 2R7BA 1LEZA 2E9UA 5CEKA 1W2FA 4QP4A 1NW1A 4CSVA 1XQZA 3UOJA 3TCPA 3QQHA 4R5SA 1QL6A 3OCTA 2QHNA 2BHHA 3E8DA 5JQ5A 3V8TA 3FKLA 4M13A 3RPRA 3QZFA 5KMLA 1QPJA 3FAAA 3ZLXA 2ZAZA 2ITPA 5B2LA 3SW7A 3E8CA 2G2IA 3G51A 4GJ3A 4U42A 3L8SA 3HAMA 4TKSA 3TDVA 3D5WA 4CG9A 2CGWA 3O8UA 2OXDA 3F82A 4O0YA 5M56A 5FQDC 2C5YA 5LQFA 1PMEA 5AUUA 1F0QA 4RFMA 5D12A 3ZFYA 1YOJA 3UNZA 3QKMA 5HNBA 3OCBA 1JQHA 1UNLA 2I0HA 3N4TA 3PVBA 4QOXA 4S32A 2H96A 3TM0A 3F88A 3R8MA 4B9DA 4DHZA 4QNAA 1T46A 2BAQA 2OFUA 4FTQA 3KN5A 3CJFA 2XM8A 4TYGA 4H1MA 3VWAA 3LXKA 4XBUA 3UP2A 1J7UA 5E8VA 4U0IA 2Q0NA 4RWLA 3GCUA 1XMMA 1OPLA 3WE8A 3QWJA 4O96A 4GL9A 3TTJA 2YIRA 3TIYA 4UN0C 4M12A 5FLFA 5CEPA 5ANIA 5AP6A 1NVQA 2Y6OA 4S31A 3KREA 2QOOA 2E9NA 3QYZA 4MKCA 4EH9A 2I7QA 3WZUA 4PMPA 4N4SA 3FLNC 2C68A 3RAHA 4Y8DA 4X2FA 3D5VA 3DKOA 3DNEA 4ZK5A 2J7TA 4AN9A 3S2PA 4ZZOA 2ITTA 4EZ3A 2UUEA 2XS0A 2ONLC 1W2DA 2A0CX 2FSLX 3W2CA 3R2YA 2PZPA 3LVPA 5L2QA 3PXKA 4UXLA 4QD6A 3MFUA 3Q60A 4QMVA 4K33A 4IZ7A 5EW9A 4AT3A 4CMOA 4EC9A 1XBBA 3ZCLA 3FHRA 4ERKA 4YJTA 2Y6MA 4YO4A 2IG7A 4NL0A 1O6KA 1OGUA 2GNIA 4IWQA 4Z9LA 4RJ3A 4E5BA 4YZ9A 1PXMA 4AG8A 2BMCA 2KTYA 3ORLA 3HMPA 2IO6A 3TTIA 5BNJA 2J50A 1ZMUA 4LRJA 3ZFMA 3PJCA 3OTUA 4GT3A 3MGYA 4BB4A 1UWJA 3FSFA 4IB5A 5CXZA 2JDOA 4MUQA 2GS7A 3EMGA 3I7BA 3LOKA 3C4FA 4BCNA 3FXZA 3PXRA 4UWBA 3TWJA 4O4CA 3G15A 3SG8A 3VF8A 3LMIA 3P23A 3G9LX 4FKTA 5GZ9A 3ZO4A 3IW4A 2W4JA 4QQJA 4LV7A 5AP7A 2GNLA 3MESA 4GT5A 2PVYA 3AKLA 3SOCA 3PDTA 2UZDA 4JBOA 1Q97A 2XB7A 4WD5A 3QQFA 5HIBA 3VUHA 4FL2A 4FZFB 4FV7A 4CXAA 3HV7A 5CWZA 3HDNA 3FL4A 4AGDA 4HNIA 2JAVA 2R3RA 4Q5EA 3A7IA 5DRDA 1M52A 2J9MA 2YAKA 4NW6A 5IA2A 2X8DA 4EK6A 3PA5A 4U6RA 2F57A 2QOQA 4CKIA 2ZFYA 2W1EA 5BPYA 2O8YA 3EH9A 3HZTA 4RGJA 2R5TA 2ITYA 2QU5A 2VGOA 2VZ6A 4QMSA 4JDIA 1CKIA 3DAEA 5FTOA 4K18A 3OOGA 2ZYBA 4C3PA 4CLJA 4YSMA 3MV5A 4YP8A 3BLQA 3AT3A 4FTTA 3WBLA 3NUUA 3EIDA 2XJ1A 3UZTA 4CKJA 2JLDA 4D2VA 3P0MA 3P86A 3BEGA 2YLEA 4FSNA 5BQ0A 2VWVA 3KRRA 3GXLA 5KCVA 3DAJA 3Q6UA 4F99A 5CENA 2R3KA 2BFYA 3OEFX 4IEBA 3PY1A 4PP7A 4FKGA 2WU6A 2BAKA 2IVVA 2F7ZE 5DFPA 3DV3A 5HU3A 2E2BA 3LIJA 4NCTA 3FWQA 4M14A 3RM6A 4X6QC 4HZSA 1JKTA 3GC9A 1SVGA 2C6IA 4EQMA 1H26A 4XOYA 4O7NA 4XNEA 1YOLA 3SD0A 4YZBA 3ZU7A 4U81A 3OF0A 3GCVA 4OLIA 5M06A 3PYYA 4DH3A 2PUNA 4BCQA 5KMKA 2VTIA 2XUUA 2JFLA 4EK3A 2BIKB 2VV9A 4J53A 5D10A 4DG2E 4E1ZA 5B2MA 2Z7LA 2W96B 4J99A 2Y0AA 4GEOA 2OSCA 4YJOA 2HXQA 5GJFA 4F08A 4CNHA 4XS2A 2W1ZA 5K3YA 4O2PA 3IG7A 1WZYA 3CP9A 3KGAA 3O71A 5JSMA 5DNRA 1YI3A 4F6WA 4U43A 4KS8A 2Q0BA 3MBLA 4IX6A 2OG8A 3WF6A 2XAOA 2JIVA 5J1WA 4DFUA 4WUNA 3DS6A 5JZNA 3HRCA 4F9WA 1QPDA 2ZVAA 5CSVA 4RA5A 3N51A 1PMNA 4KWPA 2ZM3A 4NM7A 1BKXA 2IZUA 3A60A 3ORZA 4H1JA 4RRVA 2PL0A 2F7EE 3OWKA 3KK8A 4J98A 3TNWA 3ITZA 5K5XA 3UBDA 3D2KA 3GQLA 2V7AA 4QPAA 3OVVA 2Z7QA 4Y85A 3BYUA 4U79A 3R1YA 3QZIA 5HGIA 4D5HA 4UMUA 5AFVA 3F2NA 4ANOA 3A7HA 5CU2A 2ZDUA 4I5HA 4L43A 3FXWA 3AGMA 2JIUA 3DZOA 1DI9A 4QPSA 4O6LA 3NIZA 3VBWA 3EKNA 2CDZA 2QG5A 3JY0A 2J5EA 1J91A 5D9HA 3C1XA 2XRUA 4NW5A 4MWIA 5DEWA 5C9CA 5AMNA 5A54A 2YDJA 5LOHA 4C3FA 4ZSAA 1G8AA 5EOBA 5IEYA 3NNUA 3GI3A 3Q96A 3BQCA 4FIIA 4R8QA 3W2OA 4AWIA 3SVVA 4EK8A 4YHFA 4QDEA 1J1CA 4TWCA 1W0XC 5LXMA 2XALA 4MBJA 1TQPA 3OG7A 3R0TA 3GC8A 2HY81 4UMTA 4IVAA 4K2RA 5HBHA 5J95A 4IB3A 4I92A 4MXCA 4RWKA 4BBMA 5CVGA 4E73A 3E92A 5HCYA 4BDEA 3QBNA 2X4FA 3W2QA 3MYGA 3Q4CA 3ULZA 2YCQA 4BJJB 5HEZA 3TL8A 1Z5MA 4MQ2A 4XV1A 4M3QA 5AV2A 3ZS5A 4BYJA 4JIKA 2Y4IB 4RT7A 2BAJA 4O7ZA 3QD0A 2B0QA 4ZJJA 5IQCA 2HIWA 4QP6A 2GU8A 1JKKA 2XK8A 4ITJA 3CGFA 4O91A 5CU3A 3FLZA 1WFCA 3G6HA 3RNIA 1S9IA 3OXIA 4XV9A 2R7IA 5FD2A 4ZTNA 3UNJA 5J79A 4Q2AA 4X2NA 2GFSA 3GBZA 3NNVA 4MWHA 4DGNA 3FQSA 2PE0A 3UC3A 2YN8A 2VUWA 4HVSA 4R5YA 4H3QA 1ZARA 1O9UA 2W1GA 3MS9A 4KD1A 4F0FA 4I1ZA 4UALA 2JKMA 3N4VA 4FTKA 3NFGB 4DG0E 4QMOA 3RK7A 5EHOA 3QCXA 2QONA 1H1SA 5KZ0A 4EHGA 1YDSE 3FPMA 4FBXA 5CANA 3MJ1A 5ETFA 1J7LA 3QTUA 4ARKA 3V04A 3S1HA 2I0EA 3TIZA 2QVSE 3HUBA 4LV8A 5AUZA 3FQEA 5A4LA 5BV3A 2VTSA 5KMOA 5C4KA 2X7OA 4OTIA 5B7VA 2WMVA 4I0SA 5AAEA 1Q41A 3AD4A 4MNFA 4BZDA 5IQHA 4H3BA 3EJ1A 3PFYA 4UWCA 2R3MA 4AXCA 1PF8A 3ELJA 4RIXB 4E4XA 2SRCA 2J51A 4GVAA 5HORA 4YGAA 3POZA 2OFVA 3KQ7A 4PF4A 4PPAA 4XRLA 5IG1A 5IDNA 5E4HA 2GSFA 3QUDA 4JBQA 4BHNA 3W0OA 2ITVA 4ACHA 3NLBA 4DEIA 3FMNA 5HLPA 4BTMA 1JOWB 3KU2A 4ENYA 3AOXA 4ACGA 2X6DA 4P7EA 3FI2A 4IAZA 4AFJA 3M1SA 4KSPA 2PVJA 4CZYB 3R01A 5TE0A 3DLSA 2CNQA 5EG3A 2I6LA 3OP5A 3C5IA 3UGCA 5GIOE 2ETMA 1PXJA 3R8UA 4Y83A 4P5QA 2Y7JA 2GS6A 4ZP5A 4CV8A 2PYWA 2Y8OA 4BGHA 4C36A 3MPAA 4AN2A 3LCTA 4IACA 4R3PA 5EI8A 5HBJA 5DE2A 4EH2A 5KMIA 4JG8A 1E1XA 3D83A 1Y57A 1SYKA 3CTJA 3L8VA 5L8KA 2YIWA 4IVDA 5D1JA 3EL8A 3ORIA 3VS4A 4BCJA 4IX5A 5TR6A 3VQUA 4I0TA 2HW6A 2WD1A 4AF3A 4FKJA 5IQIA 3ENHA 3JPVA 4BWPA 1XH7A 2J0KA 1Q62A 3CJGA 2NYAA 3FI8A 3FKOA 2OI4X 4FKOA 4XG6A 1LP4A 3W10A 3VONA 3UJGA 2O2UA 4Z55A 2XNBA 2OXYA 1CSNA 2XBJA 5KMNA 2CN8A 5HO7A 2IZSA 2PVHA 3LXPA 3U55A 5TF9A 4AX8A 4YO6A 4QMQA 3TUCA 3BL7A 3FY2A 3O7LD 3R1SA 3L8PA 5CAVA 4UYAA 5EM6A 5EK7A 3QA8A 2C6KA 2R3HA 3MB6A 3R71A 4MXYA 2QLQA 3VF9A 2QHMA 4RVMA 4F09A 2WB8A 2C30A 1XH6A 4ZXTA 4BDDA 3HDMA 5J5SA 2YZLA 3PE1A 3QX4A 1G8KA 3WIGA 4LOOA 1TQIA 5IQDA 1B38A 4XBRA 2WQMA 5IZFA 4GK2A 3AMYA 3I79A 5FUTA 2UW9A 5DH3A 3H4JA 5FM3A 4DH5A 4I5CA 5C8NA 2BDWA 1OL2A 2HXLA 5JFXA 3R28A 4NTSA 1ZYLA 4BDGA 2B4SB 2XCKA 3Q9WA 3Q2JA 2WEVA 3O8PA 3BE2A 4GH2A 2YDKA 4Y5HA 2V62A 4FEXA 4PPCA 5HG5A 4YBJA 3LJ1A 3TJDA 4FKLA 2YWPA 3V5TA 3H3CA 4L01A 3BHUA 5IISA 3LFDA 3UIBA 3QD2B 4PDOA 2AUHA 4ZTSA 2UZWE 3RPYA 3PPJA 2VNWA 4GU6A 4BCGA 5CU0A 5T6KA 4E6DA 4Q9SA 4UB7A 3JVRA 2IN6A 2ZV7A 4AW1A 3PXYA 4AXFA 4EHVA 2OGVA 5GZAA 3K2LA 2UZUE 4DCAA 2PVMA 1SVEA 2JKKA 2JAMA 1YXXA 5E90A