1OUYA

The structure of p38 alpha in complex with a dihydropyrido-pyrimidine inhibitor
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
350
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 350
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ouyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ouyA01
3ORPA 4ZS0A 4U6RA 2P3GX 4FV9A 4AGDA 1TQPA 4C2WA 2G2IA 4BKZA 4IM2A 2UV2A 5HE2A 3ODZX 4BZOA 4CFNA 5IH4A 3TUDA 5IQFA 2DS1A 5HU3A 2P55A 3NYNA 1G8AA 3PJCA 1LEZA 4N70A 1SMHA 2UW9A 3FI3A 4TY1A 5CF5A 4O86A 3CR0A 5FEEA 4L3LA 4JBPA 5EYMA 4R77A 3OCSA 1Q61A 2BRNA 3LM5A 3NNXA 4MBJA 2ZB0A 3ZHPC 3CPBA 1RW8A 2YM6A 4AP7A 4AZFA 4AZTA 5LOHA 4F6WA 3OC1A 3AG9A 2C6DA 2ZVAA 4G9RA 5HICA 3LIJA 2G2FA 4QMUA 4ACHA 3EN5A 2PK9A 4RIXB 5ITAA 4C35A 4G16A 3OD6X 5FBNC 1DAYA 3G9NA 3D15A 1WAKA 4IANA 4YHJA 4L67A 3QQJA 5CAVA 2ZDTA 2WQNA 2ZDUA 1Q8ZA 3D5XA 1YI3A 2ITXA 2J9MA 4LGGA 1U54A 1IA9A 2J90A 3EN4A 1S9IA 5KNJA 3S4QA 2VWVA 2X81A 3QCSA 2J7TA 3FQHA 3DBDA 2C6LA 4JS8A 3BLQA 3W2RA 4EBWA 2Y9QA 2UZDA 4WNMA 5HNIX 1PXLA 3QRTA 4LYNA 4NYEA 3V5PA 4MQ1A 3KN5A 4G5PA 3PXZA 3O51A 3RGFA 4EOOA 3DQXA 4FSUA 3GU4A 4II5A 3BYUA 3BE2A 3CKXA 4MQ2A 2P4IA 5EHOA 4ZTHA 4I0TA 4WHZA 4BRXA 4DLIA 3R1NA 4TL0A 4KUJA 5LVPA 3UNKA 5IQDA 3NCGA 1FBNA 1GZNA 1K2PA 3FL4A 3WF6A 4L53A 5J1WA 2XIKA 4H05A 4O1OA 3CBLA 4RC3A 4YTFA 5FQDC 2VTMA 3UTOA 3U51A 2SRCA 3A2CA 1OKWA 3E8DA 5LCJA 4LMNA 3PWDA 2J0IA 3DV3A 5F4NA 4I21A 3PP0A 4ASEA 5AAGA 2W1CA 2P33A 4G6NA 4M14A 4QQTA 3OOGA 4HNIA 3P78A 5A46A 5KBRA 1ATPE 2BZIB 2V55A 2YDKA 2RIOA 2O8YA 5C27A 2NNWB 3UO5A 5GIPE 4YSJA 3MB7A 3RBWA 1L8TA 4U81A 2OIBA 1CMKE 3TNQB 3DXQA 5HBHA 5KMOA 2W5HA 4M8TA 2UW3A 2OF2A 4D0WA 4RA5A 2UZVA 4RG0A 3SDJA 1KOAA 3Q4TA 4X2KA 3JVSA 4DGGA 2R64A 3DKCA 5LVMA 3P79A 3ZC6A 5DEYA 5IUIA 1BLXA 4JLCA 3LCKA 5HCXA 4ACDA 2I0HA 2XKEA 5IA1A 1STCE 5KHXA 5AV1A 3BYMA 2RFNA 3LJ2A 3IW5A 4NM3A 3F66A 3SC1A 3CCNA 5KMNA 2CGUA 3G33A 4O96A 4O27B 4S32A 4G31A 4N6YA 4X7QA 3AC2A 3PJ3A 4GW8A 4IZYA 4U3YA 5AP2A 4YJOA 3ORNA 2C3IB 4EH6A 1O6LA 3KRWA 1FVTA 3LLTA 4IJ9A 3FLSA 4YZMA 3UOJA 4ZS4A 3LJ1A 1OIUA 1ZMVA 2YHVA 3PRFA 2I0VA 3OWJA 4FV2A 3JY9A 4BDDA 4JIKA 4BWPA 3POOA 4CQGA 5AJQA 2ITYA 2BZJA 3RWPA 4BDCA 4O2ZA 4AA4A 4QMLA 3LFCA 2JDRA 1CKPA 3NNVA 4FTJA 4AU8A 4F9YA 2IPXA 3FKNA 4PDPA 5CNOA 1QPEA 1UU3A 3Q9WA 1ZOEA 5JKGA 3R73A 1FMKA 4AA5A 4ZSAA 5LCKA 3EQBA 4RIWA 3HECA 3IKAA 3FXZA 1CM8A 2PE2A 3IW7A 2J4ZA 5M57A 4QQCA 4AOTA 2H6DA 2E9OA 5IUGA 4FG9A 4CT2A 4R7BA 2IZTA 1H1PA 5IF1A 2XIYA 5CY3A 4P7EA 3SRVA 4EKKA 3VUHA 4CKRA 4JR3A 3UYSA 5AX3A 1Q3WA 3PVWA 4M69A 4W8DA 3RCJA 5HORA 2HYYA 3GNIB 2FSLX 3EQPA 5A4EA 4F70A 2C0OA 1DM2A 3LFDA 5GJGA 2OXDA 1WVWA 5EFQA 3V5LA 4BDEA 5IA4A 5EI6A 2BMCA 5EKOA 4CG9A 3MH3A 2J50A 2REIA 2X8DA 4BCMA 3PSBA 5JFSA 4OBQA 5HG7A 4CD0A 1KE7A 3GQLA 4RGJA 3LQ3A 4AN3A 3C50A 3R1QA 2OI4X 3NUYA 3QHWA 5HO8A 2OLCA 2XF0A 2QO2A 3NRMA 4F7LA 2UUEA 4U79A 5AMNA 3UVPA 4E20A 4O84A 5DGZA 2F4JA 2G1TA 1PMEA 3PYYA 4FOBA 4DTAA 1JSTA 5HBEA 5HVYA 4EEVA 1OB3A 5IG1A 3GGFA 5E90A 4I41A 2XCHA 4ANOA 3MFUA 5T68A 4BTMA 2I6LA 3GEQA 3F5XA 1YKRA 1Y91A 4TYJA 2VGPA 4YSMA 5FTQA 3FLQA 3QWJA 5A4LA 5AV4A 4MXAA 4NSTA 5FXRA 1IR3A 2O3PA 1E1VA 3NAXA 5HTCA 5KBQA 5IMEA 3OW4A 2CJMA 2XBAA 5JZNA 2GS7A 4KD1A 3F5UA 4PRJA 3FMEA 2WMAA 1JWHA 5FG8A 3TTIA 4BZNA 4YPDA 4AGUA 4GS6A 4AW0A 3ZTXA 5EQPA 3OTVA 4F63A 4IVDA 4QMXA 4ITHA 4BBMA 4C2VA 3ZSIA 4DA5A 4PDOA 3ZLWA 2WQEA 2X0GA 5DA3A 2FSTX 5IQBA 2C6OA 2QLUA 2PTKA 4D9TA 4S34A 5HD7A 1TVOA 3E92A 2CNQA 5IA3A 1YXUA 3UE4A 5KMIA 2JBPA 3GCSA 3R01A 4EKLA 4EUTA 1KE8A 3T9TA 2JIIA 4O82A 1P2AA 2OIQA 1JPAA 2JDTA 3QD0A 2X6EA 4KIQA 3QQLA 1A06A 4K2RA 4MNEB 4FZAB 2PHKA 3IO7A 3ZRKA 4YJSA 3W10A 3LZBA 3QZIA 2XK3A 2R3KA 1H24A 1WFCA 4S33A 5CQUA 1MRYA 3QF9A 2ZV8A 5ANKA 4FUYA 4B9DA 3WZJA 4AZEA 4FTMA 3CGFA 3UVQA 1YOLA 2QOOA 4AW5A 5BUIA 2Z7QA 3EOCA 2ITNA 3I5ZA 3GCUA 3BBTB 4YJVA 3VW8A 3HDMA 2A0CX 1OL7A 2VV9A 4JRNA 5D7VA 3Q53A 4EH9A 3MBLA 2C3LA 4A4LA 3D83A 4JBQA 4KS8A 1PMUA 1W84A 5DLSA 1Q3DA 3NSZA 2P2HA 1KOBA 3W55A 2C4GA 4QMYA 3PZHA 3R7OA 5BYLA 2R4BA 4ANNA 3KN6A 5M07A 3R8VA 3KMMA 4FT3A 2JDSA 4JAIA 2B9IA 1F5QA 2Q0NA 2VNYA 3MI9A 5EI2A 5H3QA 5HHWA 1P4FA 3ZXTA 4V01A 2OSCA 4A9UA 3EZVA 4USFA 1HCLA 2PUIA 4MF1A 3O7LD 5ETFA 1U46A 2W1HA 5A9UA 4HCUA 3TJDA 3TL8A 3KVWA 4S31A 4XBUA 4B99A 3UPZA 2XK8A 3BHTA 3F6XA 4NK9A 3A61A 3RKBA 5IA2A 5HE0A 4HW7A 3VO3A 1SVEA 2XZSA 4RIYB 2VTJA 4M12A 2CLQA 3W8LA 3ZO3A 2XEYA 4EQMA 5A4CA 2XIZA 4XJ0A 4FNXA 3QZGA 1RJBA 3OBGA 4JI9A 2UVZA 5GINE 1IA8A 3CQEA 4H3BA 4QP9A 2YZLA 2FSMX 5FM2A 4QRCA 3BYOA 2W1DA 4FTRA 4XRLA 3ZO1A 3A4PA 2QU6A 3U6HA 4LG4A 3HKOA 4OAVB 2IG7A 2VTQA 2PUUA 4CVAA 5EDRA 5IH6A 1E9HA 4YGAA 2OH0E 1V0BA 5HEZA 1JNKA 2VTRA 5DMZA 4HYIA 2QKRA 4ARKA 3R8PA 4M3QA 4ZY6A 4DH1A 4B7TA 2R3MA 2XM8A 3ZSHA 2XM9A 4ZAUA 4QP7A 4ERKA 3ENMA 4UB7A 4PNIA 5K5XA 1NT2A 5DH3A 3UGCA 4BICA 3ZM9A 2IW9A 3CGOA 3EL7A 3DQWA 5T3QA 2BAQA 2JEDA 4CFXA 2B9HA 4ZMFA 2ZV7A 3HMMA 2O5KA 2XKFA 1R3CA 2VO6A 3PVUA 4F1OA 4FMQA 5F9EA 3AC4A 4LGDA 1R1WA 3ZOSA 4PTEA 4RQKA 3CSVA 1ZWSA 3FPMA 1E1XA 1OECA 4GT4A 3BU6A 4C0TA 4GSBA 2RL5A 1WCCA 4A7CA 3HV6A 5I9ZA 5KMJA 1I44A 3AD6A 3L8SA 5M4FA 3C13A 4V05A 4UX9A 2EB2A 4AE6A 2Y4PA 3E8CA 4O21A 4MXZA 4FTKA 3PPKA 5B7VA 5J87A 4TWCA 5JT2A 3E62A 4WBOA 4F1TA 3JVRA 2RFDA 1VEBA 3HP5A 4W9WA 1H28A 5DE2A 1LUFA 4NW6A 3UZPA 3HP2A 4IQ6A 4L3PA 2VTNA 3R02A 4HVIA 3HMNA 3A7FA 4C34A 1J3HA 4O7NA 1JVPP 3ZMMA 2IO6A 5CF6A 2BIKB 3QXOA 4B6LA 3I6WA 3K5UA 4H3QA 3UQGA 4FV5A 4WSQA 4FZFB 1OIRA 4FL2A 5JN2A 3LFBA 4DGOA 2OJ9A 4Q5EA 4J99A 3Q04A 3EQCA 4NTTA 4DH5A 2C6EA 4FKJA 2WU6A 2WPAA 5FWKK 2WHBA 4QYGA 5AA8A 5LQFA 2Y6OA 4JJRA 5HLPA 3R8LA 3FQEA 3DK7A 3Q6WA 4RJ8A 3ZUTA 4H58A 5DPVA 2UVXA 5FD2A 3DBCA 3FXWA 4J8NA 5DFPA 3DAEA 3E5AA 4O0VA 4PMMA 4YLKA 5J9LA 1W98A 4E4NA 2VN9A 3KFAA 3PE1A 4F9AA 2EXCX 1U5QA 2HY0A 5ICPA 1PY5A 3PXKA 3ZZWA 5AA9A 5M4UA 5LMBA 5M4CA 3OVVA 3MTFA 2UZOA 4EZ3A 4UMPA 4TYHA 4EJNA 2F7ZE 4BI1A 2XKCA 3IK3A 4CCUA 4FTCA 4FTQA 4FODA 5LWNA 3IECA 2CCHA 3AQVA 3T3VA 3S0OA 2HZ4A 3HVCA 5FBOA 4F0GA 2C1AA 4F99A 4GVJA 2V7OA 3CKWA 2HAKA 2V62A 2J6MA 2RF9A 3KULB 4IC8A 3RZFA 4HOKA 2VWUA 3OUKA 2BVAA 4FTLA 4MK0A 4YC8A 1ND4A 4HJOA 3F7ZA 3LQ5A 3OTUA 3N9XA 1LP4A 1P14A 4O0UA 3R2BA 3QQFA 2GDOA 2IVUA 4XEYA 2QONA 2JKQA 2A4LA 4UBAA 5ANOA 3CPCA 1JKKA 2I40A 2H34A 3R00A 4C62A 3UVRA 3CJFA 3SG8A 4U43A 1URWA 5GIOE 5HO7A 4DAWA 4IAAA 2YWVA 3ROCA 2PUPA 4ZP5A 1QMZA 3VS6A 2WD1A 3C0HA 3LQ8A 4FIGA 1KSWA 1Q5KA 2PVHA 4X6QC 4MEDA 5ETAA 3ZXZA 4C57A 1OITA 4C36A 3C1XA 3LXKA 5IUHA 5LMAA 3BWFA 4CFUA 4FNYA 3WZEA 4NW5A 2IW6A 1G5SA 3FY2A 3NMUF 3COHA 2R5TA 3NAYA 4D55A 5K9IA 5GJFA 1JKLA 3E64A 3T3UA 1H0WA 1YOMA 5AP5A 3ETAA 4NU1A 4BHNA 2VWYA 3P08A 5IDNA 5CEMA 2CKQA 1DS5A 3EMGA 3RM7A 1H1RA 5BNJA 5L2IA 5D10A 4YJQA 4QP6A 3W1FA 3ZLSA 4FVRA 3G90X 4IVCA 3G15A 4BIDA 4R1YA 3HUBA 5EG3A 5H8GA 5EHLA 4IWDA 3HV4A 2PPQA 3GVUA 5BPYA 1Q8WA 4ZTNA 1H00A 2E9VA 3FHRA 1Y8YA 3FZOA 1Q99A 4I23A 4RX8A 4NJDA 4FTTA 4QTDA 4EQUA 3R21A 2QURA 3OZ6A 3B8RA 4L01A 2WTCA 3IS5A 3ZFYA 4Q9ZA 2PVFA 1OL2A 4RIOA 3R8UA 4YBJA 1WZYA 3VJNA 4MBIA 2OXYA 2BRGA 1I09A 3I7BA 3QC9A 2NP8A 4UV0A 4YPSA 5IDPA 5AM7A 3QKMA 4DEEA 3PJ2A 4GG7A 5DT4A 3OROA 4J53A 3FWQA 3NUSA 4F08A 3BLRA 2R2PA 5L6PA 3DOGA 3OBJA 1H07A 3QA0A 3G51A 4BYJA 4JG8A 3QCQA 2BTRA 4QT1A 2C0IA 3ZO4A 2O64A 4XH6A 3OT8A 1Z5MA 4IACA 4XUFA 4XX9A 2A27A 3CY3A 4J97A 3EIDA 3OFMA 5E8VA 5JFWA 4OLIA 1XKKA 3UO4A 4CMTA 3ZCLA 4FE2A 2CKEA 1ZMUA 4G3EA 2BAKA 1G8SA 3H4JA 4ASZA 3V8WA 3MA6A 3LFQA 5H2UA 4DBNA 3ZUVA 2XNOA 2B9JA 4IJPA 3JXWA 3BGZA 4BDIA 2CCIA 5M55A 5LXMA 3C4FA 3L1SA 2J5EA 5IQAA 3HUCA 3ZFMA 5AR2A 1WBVA 1YI6A 4DE4A 5JGAA 1OPJA 3A7JA 3HA8A 1PW2A 4JR7A 3AC1A 4YTHA 3FLNC 4BCIA 4O6LA 4FKRA 1NW1A 3KKVA 4GK4A 5IA0A 3Q2MA 5ANJA 2C69A 4L43A 3UG2A 1PXNA 4B4LA 4QNAA 4D58A 3TUCA 4FKSA 5TE0A 3JR1A 3QRUA 2HWPA 4OTQA 5BVKA 3KU2A 5HIEA 4FKUA 5L3AA 5DRDA 4IAIA 2B53A 4X21A 4L7SA 4GH2A 3KCKA 4J96A 5JZJA 2CHLA 5CU6A 3TI1A 3S95A 2C5XA 1H01A 3OXIA 3HRBA 3QQGA 3UZTA 2G15A 2PE1A 4GMYA 3W18A 4IAYA 3IDBA 4AF3A 4P5ZA 4UYAA 5CX9A 3VRZA 2Z2WA 3MA3A 2GCDA 2WMSA 4XP2A 3WYXA 2XNGA 2XNMA 3QCXA 4ACMA 4FVQA 5CSWA 5EW8A 4IDVA 1PYXA 1XH9A 4EH3A 2FYSA 5AUWA 4BKYA 2B1PA 3NGAA 3F3WA 3T8OA 4R3CA 4KBAA 5A54A 2YM5A 5EKNA 1BX6A 5FEDA 5EM7A 3LW0A 5HCZA 4CMUA 4DYMA 2XB7A 3QU0A 3RI1A 4DEIA 3OUNB 3O8PA 4GV1A 3IW8A 3A8XA 1ZYCA 4C7TA 4HNFA 3V01A 5CAOA 1PJKA 1WVXA 2WNTA 3VN9A 4G3CA 3FJQE 3DB8A 3D7TB 5HZNA 3R71A 3NW6A 3HDNA 3U54A 3R7UA 5KMKA 3VS1A 4B0GA 4KIPA 5AV2A 4CV9A 2AC5A 2VX3A 5EK7A 4UWBA 4ACGA 3BI6A 3OY1A 4LUDA 4EOJA 2R3JA 4U8ZA 3ZRMA 2F9GA 4O7YA 4HGEA 3DAJA 4YJTA 3V6SA 4ERWA 3WZDA 5I9WA 2JLDA 5FUTA 3TTJA 5JGBA 4TRLA 5CXHA 4DGNA 4C4IA 4F1MA 4ITJA 3BHUA 3KC3A 2WKMA 3UC4A 5E8UA 5EHYA 3GCVA 1H26A 3AMYA 3VBWA 4ZTQA 3UPXA 1Q97A 3D7ZA 5CU4A 2Y4IC 1LPUA 2VWWA 4FSQA 4MAOA 3HX4A 3QGWA 4KSPA 4G2FA 4RWLA 4ITIA 4C3PA 2B54A 4YO4A 3SVVA 4RC2A 5M44A 3SW7A 4EK4A 1ZZLA 3FBVA 3R28A 4JDIA 3K5VA 1JQHA 5HTBA 1DAWA 3DJ7A 4ZSLA 5HG5A 3TKUA 3O71A 2R7BA 3C7QA 3PPJA 4C38A 2EXMA 5A3XA 2VGOA 3PTGA 3ACKA 3FI2A 1YDSE 4LMUA 2VAGA 1GZKA 3HLLA 4E5WA 4TNBA 5BQ0A 3EFJA 3LAUA 1PXOA 2QR8A 5EM5A 3VBYA 4PX6A 3KXMA 3VUMA 5DYJA 3R0TA 4IADA 4NKAA 1PXJA 4D4SA 4NH1A 4IZAA 1T46A 1MQBA 3DB6A 2HOGA 5DNRA 4FV4A 4USEA 3GOKA 5HVJA 1U54B 3EQDA 4PTCA 3NNUA 3PZEA 3MGYA 3PG3A 2FB8A 3Q60A 3KREA 3QKLA 4I5PA 2W7XA 2WOTA 1ERKA 1Y57A 2R0IA 4I5CA 1H0VA 5AP3A 3W2QA 1FVVA 2WTJA 3VUTA 3HL7A 4D28A 2HIWA 3ORTA 2WAJA 3OHTA 3D0EA 2PZ5A 3ZYAA 4XYFA 2UW4A 1HOWA 2GU8A 3FY0A 4IX6A 4YNOA 3PVBA 2QO9A 4HYHA 1IAJA 3PUPA 1VYWA 1GIHA 2H9VA 3RHXA 2ETRA 4FUXA 4MWHA 5HE1A 4ACCA 1VR2A 1M7QA 2X8EA 3PWYA 4LRKA 2IZSA 4GU9A 4XMOA 4AW2A 4WRGA 3DA6A 4IZ7A 4NTSA 4FL1A 2HW6A 1J7IA 2GHMA 2QKWB 3A7HA 4ANSA 4G6OA 3GUBA 3DZOA 4ASXA 5HGIA 3FMNA 4IH8A 4OTGA 5JFVA 4WG4A 2WELA 5EQYA 1JOWB 3C0GA 3G5DA 3QTQA 4FKLA 5CYIA 3WIKA 2G01A 4YJPA 5CANA 3AD4A 2F7EE 2OBJA 4AA0A 3LMIA 2IZRA 3KRXA 3QHRA 2W96B 3E93A 4FTOA 4XP0A 3O2MA 2UZLA 3GCQA 2W17A 4UMRA 5M56A 3H9FA 3L9MA 3WIGA 5IQEA 1BL7A 4FZ7A 1ZLTA 3G6GA 3MVMA 4PUZA 2YJRA 5IISA 4CQEA 3VHEA 3PLSA 5EYCA 4JIAA 4X6RA 3F82A 4YR8A 4O91A 5GZ8A 4KINA 3EKKA 5HG9A 4MD8E 3VWAA 5HIBA 5BVFA 3RCDA 3SHEA 2BDJA 4AN9A 3VUGA 4F9CA 4YTCA 3KY2A 3FMHA 5E8YA 3WZKA 2C6KA 4GFMA 4KABA 2UZWE 3KMUA 4I6BA 4U41A 4EHEA 5ANEA 3UJGA 3MFSA 1YXXA 3F3ZA 4YC6A 3M1SA 4LI5A 1WBPA 3QUDA 4FTAA 4KAOA 2C6MA 4CLJA 1XBAA 3FZRA 3MVHA 4FKGA 2WMQA 4AFEA 4GJ3A 3WYYA 3F5GA 1HCKA 3HAMA 2QO7A 4L42A 3U55A 3KL8A 4HZRA 4DFZE 2C1BA 3A99A 4FIFA 4C33A 4R78A 2W1IA 2CDZA 4AOIA 4PMSA 5H8BA 3I1AA 5AADA 4OTPA 1EH4A 3V51A 1SYKA 5BVOA 4DEAA 1UU7A 1OL6A 4XG3A 5J1VA 4OT6A 1TQMA 5KZIA 4CZYB 4DCEA 4O7ZA 3NW5A 3WZUA 2JFMA 1Q8UA 2ZM4A 1FQ1B 4I93A 3PXFA 4YJUA 3PY0A 4IW0A 5DR9A 4GKIA 2PZIA 4KA3A 1H1WA 5E8WA 4CTCA 2UZBA 4Q5HA 4EK6A 4RIWB 4BCOA 2C6IA 3CQWA 4F7JA 4ZY4A 2BZHB 5CEOA 3C9WA 2XP2A 1XH8A 2BDFA 2WXVA 2XKDA 5E7RA 1H08A 4U44A 5J7HA 3MH2A 5FEQA 5T6KA 3AMAA 1MRUA 4BY9E 4EONA 5CU0A 5FDXA 3SRVB 2QNJA 4FL3A 3DXNA 5E8ZA 5TR6A 4A9SA 3SX9A 4R7HA 1M2PA 4M69B 2WMWA 4GK3A 2X7OA 4J95A 3UDBA 4ZJVA 5C1QB 4GL9A 3IGOA 5M08A 3H9OA 3Q96A 5HCYA 3MV5A 5J9YA 2UZUE 3OWLA 3DCVA 3ZFXA 3N4UA 1VJYA 3ORIA 2UZEA 4C02A 3B2WA 3OY3A 1PKDA 3D5WA 4OTDA 4Z7GA 3Q5ZA 4JT3A 3NIZA 4FOCA 3LHJA 2EU9A 3RPVA 1YHWA 3MFTA 3TT0A 2BDWA 3H3CA 4V0GA 5A14A 3FQSA 4FV3A 5KE0A 2Q83A 5C4KA 2YIYA 3UNZA 4JAJA 1W82A 4ZZOA 4J52A 2LAVA 3FKOA 5HNGA 4IB5A 5ANGA 4NJ3A 4JG7A 5DIAA 4RZWA 2DUVA 5AV0A 4BR3A 2YISA 3VBVA 1OKYA 4MXOA 3CS9A 2F7XE 2VUWA 4YZBA 5CZIA 3P9JA 5KMLA 4MVFA 1OPLA 2R3OA 5FXSA 3TDVA 4U7ZA 3ZSGA 4O7SA 4FNWA 3MFRA 5EOBA 3PLAE 1YDTE 5GJDA 3D9VA 1PHKA 1UNHA 1O9UA 2IVVA 3DNDA 2CGVA 3EFLA 4EJ7A 4CEGA 2AYPA 2BUJA 2ZAZA 4CYJA 3F88A 4FIJA 2UW7A 4DH3A 3KB7A 2IVSA 2J0LA 2VTOA 4FIHA 1PRYA 4L8MA 4JXFA 3F5PA 5C8MA 3RAWA 3DZQA 3L9LA 3V5JA 4NCTA 4PDYA 3PG1A 2GMXA 5HI2A 2PVRA 4I5MA 2C5OA 3VUDA 1R0EA 1JSVA 1AGWA 1GJOA 4E4MA 3AT2A 5M4IA 4E1ZA 3N4TA 2XBJA 4BCGA 2ZMCA 3GOPA 5DG5A 5I9XA 2VO7A 4AAAA 1OMWA 3KXXA 4ONAA 5CAUA 3FMKA 3EWHA 1JBPE 3CC6A 3VBXA 4WT6A 3R7EA 5L6WL 1KV2A 3MYGA 1FPUA 4UZDA 3FI8A 3AC3A 3NVKI 4NM7A 2JITA 3MW1A 4FI1A 1OVEA 5CT7A 3DK3A 3HRFA 2ITWA 3FZTA 1Q4LA 2JGZA 4M15A 1UWJA 3RAKA 5JQ8A 4R1VA 1OL1A 5CVHA 5L8JA 5HX8A 3V3VA 2W99B 5AR5A 4HGLA 4GVAA 4ZJIA 3D14A 5ANDA 3NVMB 1UU9A 2OJJA 3AC5A 4ZSJA 1XR1A 4Y5QA 4EH2A 4BHZA 4D2SA 4EHZA 3BV3A 2BR1A 2ETMA 4BVUA 4BIBA 2G2HA 3QAME 5I4NA 2VX0A 5AIKA 3TXOA 5ETIA 3FXXA 3TJCA 3S00A 3H0YA 2PULA 2QG5A 4IWPA 5EDPA 5AV3A 2WMBA 4S30A 4WA9A 4GUEA 3TN8A 3PXQA 3ZRLA 1SNUA 1W7HA 4OW8A 4O0XA 1ZXEA 1ZAOA 1FGIA 1YWNA 3SW4A 5CXZA 3LFAA 4YZDA 2W1GA 3UP7A 2ZOQA 4HYSA 4LL5A 3OS3A 5J8IA 4O83A 5DR6A 1OZ1A 4IAZA 3COMA 5C03A 3VVHA 3ZC5A 3GU6A 5DR2A 3R8MA 4CRLA 2JDOA 3HZTA 4YP8A 2JKKA 4EOPA 3QC4A 3DJ5A 3NYOA 4ZMEA 4CNHA 3R9OA 3LLAA 4DCAA 5K3YA 3GFEA 5AM6A 4C59A 1M14A 1WBWA 3AXWA 5CS6A 5EM6A 3A7IA 4MD9E 5H8EA 4K11A 2YA9A 4KKHA 5L2QA 4FK3A 3LCOA 2R3HA 4EYMA 2VU3A 3OWPA 4FR4A 1M2QA 4FGBA 1FOTA 3I79A 4IAFA 2PU8A 1W8CA 2PZRA 1XH5A 4JQ7A 2WU7A 4OR5A 3OXZA 2GHLA 3FAAA 2ITUA 3O96A 2UZTA 4MNFA 3VQUA 3WF7A 4K8AA 3TNPC 4CRSA 4FZDB 4Y95A 3W16A 2PWLA 2QQ7A 4RWJA 2QI8A 5E92A 4TZRA 3W2CA 2O0UA 4BDAA 2JKOA 3UIMA 3HMOA 3VS5A 2W06A 3V04A 4TTHB 4A9RA 2BROA 4ENXA 4A4OA 1GIIA 3PIZA 4PQNA 5IQGA 5DN3A 4FSYA 1CTPE 1Q24A 4AOJA 4D2TA 4D1XA 3T9IA 4C3RA 4IFGA 4JDKA 3BPRA 5EW3A 2W05A 4D5HA 4E5AX 3C4ZA 3GQIA 3PA5A 2HZ0A 5DVRA 3OCBA 2RFEA 4ZOGA 4NUSA 1UU8A 4BCKA 3TDWA 4HVSA 5J79A 2QOFA 2OG8A 5KHWA 4BYIA 3BRBA 2NRYA 3D2KA 2W9ZB 2QOQA 3BHHA 4BTJA 4O7LA 4QPAA 4RX7A 4BDHA 3NYVA 5D9HA 5L4QA 2J5FA 2XS0A 4KSQA 2YJSA 3OP5A 3S2PA 2W4JA 3NLBA 2Y4IB 4CCBA 3QTUA 4I20A 3EFWA 1RQQA 2W5BA 3F7WA 3FV8A 4DG0E 3HMPA 4G3DA 2WEIA 4O0RA 5LMKA 2OJIA 5M53A 3P7CA 3ZBFA 4ANLA 3QQHA 5KX8A 4DFUA 2ONLA 2I0YA 4O0WA 4UWYA 5BVNA 5CNNA 4HVHA 1PXIA 2QODA 5FGKA 4OT5A 3U4UA 3CTJA 2EWAA 3PXRA 4O7VA 3Q5IA 2HW7A 3GP0A 2J51A 5DBXA 3WARA 4DLJA 5D12A 4HGSA 4ZZNA 3PIXA 1YXVA 1J1BA 5FM3A 4E5BA 4C61A 2PY3A 4QTAA 3EZRA 5EYDA 4UN0C 1ZRZA 3KCFA 4AFJA 4D1ZA 4TYHB 3FSFA 4W9XA 2PL0A 3DDPA 2WTDA 2XNPA 4OTIA 5D41A 3RM6A 3E3PA 4GKHA 3BIZA 4OAUC 5CZHA 3R22A 4BCNA 2I1MA 4TYGA 5AWMA 5AP1A 1XJDA 1K9AA 3F2AA 4KKGA 4MYGA 3W2SA 2WO6A 2XJ0A 2B7AA 3WF9A 4DH8A 4XV2A 5BUJA 1QCFA 5F20A 5CAQA 3SXFA 4EOSA 3DTWA 2YCSA 3TIZA 3LFNA 3K3JA 3MJ2A 4E6AA 3KK9A 4XG4A 2WTVA 3BGPA 3NNWA 1JLUE 1ZYLA 2H8HA 4I6HA 4CYIA 5CASA 3AMBA 3TV6A 2ITOA 3BBWA 3MY5A 4G9CA 3C4WA 3UIUA 3NEWA 3SGCA 4U42A 3TKIA 5GZ9A 3MY1A 2NRUA 4KRDA 3FDNA 5I0BA 2VWZA 2YZAA 5FDPA 2UVYA 2GTMA 3HA6A 4M84A 4ZSGA 5AP4A 2ZM1A 3QFVA 2RKUA 4FZ6A 4UWCA 5CEPA 3PSDA 1W0XC 4FG7A 5B0XA 3DBEA 5I3RA 3OCTA 4RFZA 4H36A 3C51A 2CN5A 3MB6A 4QPSA 1PKGA 4QTBA 4QYYA 2IW8A 3CTHA 2XRWA 2XMYA 4MXYA 4O22A 4XG9A 5HE3A 1OBDA 3L8PA 2IN6A 2YLEA 4DTKA 2YIRA 2YWPA 4I3ZA 4AN2A 2HELA 4O2PA 4FV8A 1A9UA 4I0SA 3PA3A 4GRBA 3IDPA 4FSMA 3U9NA 4FV6A 4X3JA 4PF4A 3RHKA 4AG8A 1OPKA 4E7WA 2QHNA 4TNDA 2H96A 4BCPA 5JEBA 2CNUA 4F6SA 3C5IA 4NCTC 4AE9A 2XK9A 1KE9A 2KTYA 4HPTE 4QMOA 3UMXA 3KXZA 3VIDA 3Q4UA 2YN8A 4IWOA 2HY81 2OJGA 5BVEA 1XQZA 4ID7A 2R3NA 3GENA 2X4ZA 2QCSA 4CFWA 1LEWA 4UMQA 4WOVA 2OWBA 3VULA 5HIDA 4C4FA 2JD5A 5HKMA 4QP8A 2FA2A 1CKJA 1WBTA 1ZYJA 1SM2A 2P0CA 4DN5A 3QCYA 4ANBA 2YABA 4J8MA 4G3FA 4M66A 2ITVA 4OTWA 2YDJA 3SOCA 2YM8A 4QO9A 4G3GA 3GCPA 4N0SA 4RJ5A 3KF7A 5ACKA 4JX7A 4MX9A 3M2WA 2WOUA 5E91A 3A60A 2PVNA 4M67A 4EZ7A 5AUZA 3ALNA 4NWMA 2OIDA 3QTWA 1OM1A 3QTIA 4RRVA 4C4HA 1ZOHA 3CD3A 2W0JA 3OEFX 1VYZA 2Z7LA 2WMVA 3KXHA 2J0JA 3NUAA 2Y0AA 3P1AA 3EN6A 4TWPA 2BPMA 2Z60A 4BGHA 5HQ0A 1FVRA 2IVTA 4AWIA 2R3IA 2PMIA 5I9YA 2ZMDA 3PY3A 3G0FA 1OUKA 4U5JA 3BX5A 3AD5A 5JK3A 4PPAA 4KBCA 4CFVA 3MVJA 2UZNA 5L2SA 1Z9XA 1XWSA 5CSPA 2VTLA 3TEIA 4CMOA 5IZFA 1KE6A 3S1HA 3RPRA 3QX2A 3R6XA 4U97A 4EH4A 4JQEA 4CGAA 3CLYA 3V5WA 3GC0A 4CSVA 1H4LA 1GZ8A 1YDRE 4D2VA 4Z9LA 4FNZA 3OG7A 4AW1A 1TKIA 4MCVA 4F4PA 1APME 4XRJA 4P2KA 4Y83A 4ZZMA 4A9TA 1K3AA 1GZOA 2X39A 5LWMA 1XH6A 2R3PA 3DGKA 4LQMA 3U6JA 4ALUA 2OZAA 4RMZA 4FBXA 4Z7HA 1UVRA 4PL5A 4UXQA 3F3VA 1RDQE 4YZCA 3Q9YA 3Q2JA 3RAHA 4IFCA 5EYKA 1OGUA 3DPKA 5HO6A 2I0EA 5GNKA 4UMUA 5KUPA 4FKQA 3EYGA 4JG6A 1XHAA 1Q8TA 2IJMA 2WFYA 3R1YA 4MXCA 4QYHA 4DEHA 5FLFA 4QMMA 3GC7A 3Q4CA 1PMNA 1BI8A 3P0MA 5AAFA 3KMWA 1WMKA 2X6DA 4WUNA 5JSMA 3TIYA 3NUNA 3GC8A 3KRLA 5E1SA 3DU8A 3F9NA 3JS2A 3KRRA 3AOXA 4QYEA 4L7FA 3TM0A 3Q4ZA 1RE8A 3ZONA 3FMDA 1DI8A 1ZY4A 5AUVA 5M09A 5FP5A 4UALA 3B2TA 3H9RA 4RVLA 5CI6A 3IG7A 3SD0A 4PV0A 4D1SA 5ETCA 5C8KA 1CKIA 3DFCB 3FYJX 2YITA 3UP2A 2NO3A 2F49A 2HENA 3O17A 5AUUA 3Q32A 3U87A 5E9EA 4YLJA 5CAPA 1QPDA 4FVPA 4DFYA 2C5VA 2X1NA 4YURA 4W4WA 3TNIA 4G5JA 2PE0A 3AGMA 3E8EA 4I24A 4AACA 4R3PA 4HYUA 3NS9A 2PVJA 3W2PA 3BHVA 4NFNA 2AC3A 2V7AA 4K33A 3FHIA 4MF0A 2GQSA 5TT7A 3W2OA 4C4GA 1XH7A 4L52A 4PP9A 1WBOA 3GFWA 5LMKC 2UW5A 3G0EA 3LCTA 3V5QA 4B8MA 4PNKA 2I7QA 2GNFA 3BCEA 4IZ5A 4RT7A 5I9VA 1WVYA 2Z7RA 3ALOA 5CEIA 4N6ZA 5CEQA 5DRBA 2GS2A 1AQ1A 3SXRA 2ONLC 3ACJA 4AQCA 4BI2A 4TW9A 4Z16A 1P5EA 4FT7A 4LV8A 4JRVA 4RLLA 4W4XA 4QTEA 4CXAA 2J0MB 3F69A 3KXGA 4YHFA 1FGKA 4FT5A 4FEWA 5IQIA 1IAHA 1PYEA 2YIWA 5F94A 4N57A 4AS0A 1M2RA 4BC6A 2WEVA 2ITPA 4FICA 1UNGA 2VTAA 3DY7A 3MDYA 4QD6A 2J0KA 4XS2A 4X3FA 3W32A 4APCA 4CFMA 4WNOA 3QA8A 4JQ8A 2BILB 4MH7A 2GFSA 1IRKA 2OF4A 4IBMA 2GNGA 3V5TA 1IEPA 3EH9A 4UY9A 2YIQA 5CVGA 3UODA 3FUPA 3NUXA 4WO5A 1OIYA 3EN7A 5LVOA 2ZJWA 5CSVA 3M11A 4QMVA 1XBCA 2R7IA 2CSNA 4MTAA 3SXSA 4E26A 1GIJA 3PXYA 4PL3A 4BWKA 4F9WA 2JKMA 1Q62A 2RSVA 4B8LA 2W1FA 2XJ2A 5LJJA 4L9IA 5IEXA 3MSSA 3SKCA 4IXPA 4R6VA 4YUQA 1YWRA 2QOIA 4FF8A 2C5YA 3UOKA 2WTIA 2ITQA 3SOAA 2X7GA 4EK5A 3ORZA 4I5HA 4RJ3A 1J91A 4M97A 2OU7A 4FKPA 3NYXA 4AUAA 3QWKA 2EXEA 2AUHA 3ZO2A 4EZ5A 5AUTA 4JDJA 4M0YA 4DF3A 2BHEA 3JY0A 3EJ1A 1NVRA 2HCKA 4QOXA 5CU3A 4C4EA 3SG9A 3R9NA 1KE5A 3PJ8A 4ZLYA 1XO2B 4FG8A 3DT1A 5HX6A 3Q9ZA 3DKOA 3FPQA 4XHKB 4AGCA 1WBNA 2PVKA 3CE3A 3ENHA 5CTPA 4BDGA 3O7LB 3G9LX 4MKCA 4FKIA 1O6YA 4G17A 3HV7A 3OXTA 3QRIA 2GQRA 2WTKC 2ERKA 5EW9A 1NXKA 4BWXA 4USDA 3R1SA 3VS4A 5B2LA 2WZJA 3LXLA 2Z8CA 4CLIA 3DS6A 3WBLA 3VRYA 1BMKA 4DBXA 3EHAA 3QRKA 1B6CB 4GU6A 2PSQA 4ENYA 2QOCA 3HV5A 2CGXA 3WE8A 4E6CA 2C3JA 1Q41A 1UWHA 3A62A 3N4VA 3HV3A 3U9CA 1FMOE 2XCKA 4WUAA 3F3TA 4FT9A 3NCZA 4O0YA 4KNBA 4EHGA 3LFFA 2B52A 3TV4A 4DGLC 5L6OA 1GY3A 3O8UA 4FSZA 1YW2A 4RIXA 1GNGA 5HNBA 4BDFA 4QP4A 1NY3A 4Y5HA 3KVXA 1YOJA 4AX8A 4EWQA 2Y7JA 4D4YA 1MUOA 4F0FA 5HG8A 4XNEA 3TZ9A 4U80A 1REJA 2XIRA 3IGGA 4CT1A 1BUHA 4PDSA 3ORKA 4FKWA 2R3GA 2BAJA 4IWQA 4NL0A 5CEKA 4HZSA 5KO1A 3V6RA 4IEBA 4BDKA 2R3FA 3RZBA 3OF0A 3D5UA 3L9PA 4K1BA 1REKA 4C37A 1LR4A 3N51A 1IG1A 3QALE 4EYJA 3FC2A 1O6KA 3FLWA 5F95A 5CALA 5BYYA 3TKHA 5E1EA 3U8WA 2UW8A 4A9YA 2QLQA 3FLZA 4DC2A 4C4JA 1R0PA 3PIYA 4UXLA 4EK3A 4YU2A 4RJ4A 4R5SA 1OI9A 2VTSA 4TT7A 2B0QA 2YAKA 2BZKB 3VHKA 4FA2A 4QTCA 4X2FA 3I5NA 3BGQA 3KQ7A 4OGRA 3EQRA 4P4CA 4ZXTA 3MESA 2VO3A 1YXSA 4QPMA 3HGKA 3LVPA 4NIFB 5H9BA 4HPUE 4WG3A 4D9UA 4AZSA 4RZVA 3LCDA 3Q6UA 3JPVA 4CFFA 3E63A 5HLWA 3BKBA 1XH4A 1QPJA 3O0GA 2QR7A 3DLSA 4D0XA 3UG1A 2OFVA 2XK7A 2VRXA 1XBBA 4Z55A 3DKGA 1H8FA 1SVHA 4BZDA 3RK9A 2ITTA 3UOLA 3SQQA 5CSXA 3VUKA 3FE3A 4W8EA 1YXTA 2PVLA 4ZIMA 4FEUA 4O7TA 4NIFA 4RVKA 1OL5A 5JQ5A 3O8TA 2BKKA 3P4KA 5CF8A 5AUYA 1F3MC 4KIKB 4IVAA 4KIOA 4PPBA 4WSYA 4YZNA 2OKRA 3RWQA 4DEBA 4V0GB 1TQIA 3A4OX 1H25A 1J7LA 4RQVA 3GT8A 4QP3A 1B38A 1WBSA 3L9NA 4P90A 3R8ZA 4E93A 5E4HA 4IVBA 4JBOA 4R7IA 4EQCA 4F65A 3DXPA 4EUUA 2CLXA 2BCJA 4L00A 3ATSA 1H27A 4ZK5A 2GPHA 3OWKA 3MIYA 4KIKA 3FEGA 3BEGA 1G3NA 2Q0BA 2GNIA 3HNGA 3PSCA 2FGIA 4BFMA 1UNLA 4IIRA 1Y8GA 4ZLZA 4E6QA 5LVNA 3KA0A 3REPA 2P2IA 3OOMA 2X2MA 2DWBA 3F61A 3C4CA 3IOKA 4ZTRA 1M7NA 1OBGA 2QC6A 5M51A 1CSNA 1PXMA 3ANRA 4RA4A 4DFXE 3SV0A 4EOMA 5IKWA 2VO0A 4RVTA 3ODYX 5K4JA 3RPOA 4OTHA 2LGCA 3IPHA 2Z7SA 5DHJA 2R9SA 2JFLA 4GJ2A 3R9DA 3LOKA 3BQRA 3NZ0A 3EQHA 3PDTA 1YHVA 3E7OA 4ZSEA 3I60A 2QOHA 2JAMA 4E4LA 3WILA 3ZUUA 2ERZE 2HWOA 5TKDA 4OBOA 4E3CA 2V22A 3ORXA 2GHGA 5J9ZA 5IA5A 5K4IA 4I6QA 4DG3E 2A1AB 1OKVA 4NFMA 4Y46A 1ZY5A 4TWNA 4W4YA 2F57A 4ANMA 4NKSA 4XV1A 1GOLA 3QD3A 1M17A 4NEUA 4FSTA 2OXXA 4DFBA 5JGDA 1PF8A 2V5QA 4LL0A 2O2UA 5DEWA 3VBTA 2YACA 4F7NA 3F3UA 5L2WA 4ZTMA 2WQMA 3WF5A 2R3LA 3BLHA 3PVGA 2HK5A 3DAKA 5TO8A 3MIAA 2WMXA 3AT4A 2WMTA 3F2NA 4CZUA 4E4XA 3H30A 1YWVA 5CU2A 2E9UA 3AC8A 1UV5A 5D11A 3HYHA 3MY0A 3QRJA 3ITZA 3KF4A 4IB3A 2VD5A 3PA4A 3RP9A 4LGHA 5A6OA 4F9BA 4KB8A 5B2KA 4S2ZA 3ZS5A 2W4OA 3E8NA 2WIHA 2E2BA 5AX9A 3FZ1A 4XBRA 4F7SA 4HGTA 4QQ5A 2FO0A 2YCFA 3D2IA 5BMMA 5JFXA 4UZHA 4I92A 4BIEA 2Y6MA 4AZVA 4Z3VA 4D2PA 4EC9A 3V8TA 3FL5A 3IW4A 4IB1A 5J7BA 5K5NA 5AP6A 2IZUA 4XLIA 3GU7A 3ATTA 3PPZA 3DKFA 4F6UA 4E6DA 2WGJA 3O50A 1ZARA 4XG2A 4XV9A 2C30A 3QTXA 4AZWA 4D2WA 4X3FC 3LMHA 3QUEA 5F1ZA 5B2MA 3E87A 3SAYA 4BL1A 1UA2A 3BQCA 3R04A 3CTQA 4WBBB 3FZSA 4FK6A 3RK7A 3UNJA 4ASDA 2F2CB 2JC6A 3K54A 4RVMA 5BYZA 4YJNA 2C5NA 1QPCA 4RWIA 1Y6AA 4TWOA 4ZTLA 3KEXA 3LFEA 4DTBA 4DGMA 3KXNA 2NPQA 4KBKA 2RGPA 3AGLA 2R0UA 2ESMA 3ZEWA 2GS6A 1BYGA 5EOLA 2XNNA 1S9JA 2X9FA 4IC7A 3DDQA 4NM0A 4RFYA 2X2LA 4DINA 2B55A 4M68A 5DT0A 5FTOA 3MJ1A 2FUMA 4IB0A 4J98A 5M06A 3BZ3A 4FSNA 4L6QA 5KKRC 5HVKA 3M42A 2E9PA 2ACXA 2XYUA 4R8QA 2VTPA 3QD4A 4RC4A 3SA0A 2YERA 3NIEA 3ORMA 3QYWA 4GEOA 2PVYA 2ZB1A 4BCHA 3P7AA 2W1EA 3LXPA 4KRCA 5JH6A 2CPKE 3VNTA 2XNBA 4MNEA 2PYWA 4GFOA 2FH9A 5AR3A 4L45A 3VJOA 4JNWA 2VWIA 4QNYA 4EH8A 3P5KA 5JMSA 4BGGA 1BKXA 1BI7A 1W83A 2W1ZA 3QZFA 4W4VA 4EORA 3BELA 5FXQA 1SZMA 3OEZA 5CENA 3TNWA 1KUTA 1PXKA 4EOIA 4L3JA 4BF2A 3ZDIA 4D5KA 3LCSA 2J2IB 1Q8YA 4FEVA 3HAVA 3UZRA 1R39A 5C4LA 4Y8DA 2UW6A 3LFSA 2OICA 4PP7A 4RX5A 4LOOA 4H1MA 3OT3A 3HEGA 4IM0A 1JKTA 3UQCA 3PRIA 4RX9A 4ZY5A 3PFQA 3IONA 5FTGA 4RLKA 4X0MA 1T45A 4ANQA 1JSUA 4DEDA 4AT3A 4I4EA 3GBZA 4I22A 3C0IA 1ZOGA 3GXLA 3FSKA 5CQWA 4PMPA 3PP1A 4NZWB 4IMYA 5AP0A 1H1QA 2PVMA 2W9FB 1URCA 3BHYA 1BL6A 2BRMA 4ALVA 2XYNA 4FSWA 4FTNA 4LRMA 1GAGA 4PY1A 3RNIA 2YM3A 2BFXA 3V8SA 4BCFA 3CIKA 3QBNA 2PZPA 2YIXA 3WE4A 5HU9A 5G1XA 4TPTA 3WI6A 4YTIA 2XH5A 5BUEA 3RK5A 3ORLA 4RIYA 5AAEA 4KKEA 4FYNA 4RJ7A 5J95A 4BI0A 4UEUA 1YRPA 4WRSA 3C5UA 1NVQA 5AEPA 4HVGA 1KWPA 4JDHA 5I9UA 3DFAA 3DK6A 1ZYDA 3TNHA 2B9FA 4YLLA 2GNLA 1DI9A 2XUUA 4EC8A 4R3RA 5C8NA 2VNWA 1UKIA 5EQEA 1PXPA 3WF8A 3FI4A 4TYIA 4YMJA 4FT0A 3UMWA 3LE6A 4FIEA 2OFUA 3KRJA 3ZEPA 4JL9A 2CN8A 3QX4A 4QMQA 3CXWA 4FC0A 4XP3A 2JIUA 3EN9A 4A4XA 3CD8A 4U3ZA 4F64A 3EQIA 4F09A 4O38A 4TN6A 2JIVA 4EHVA 3UIXA 4ZLOA 5IQHA 2EVAA 1KV1A 2KULA 4JOAA 3QD2B 5I3OA 4RPVA 2QOBA 4LV5A 2QOKA 4O0TA 4BTKA 4CKIA 4JX3A 3KK8A 4PL4A 3MH0A 3EQFA 4KS7A 3R2YA 4FV0A 1U59A 3HRCA 4TXCA 3QLGA 5CI7A 3ZDUA 2OGVA 3RALA 2VTHA 2Z02A 3JUHA 4K9YA 4H3PA 3RPYA 2QOLA 2YM7A 4DT9A 4IX4A 4C58A 4D2RA 3BV2A 3Q52A 1OUYA 3VF8A 3I0OA 3U6IA 4AT5A 4L68A 2X4FA 3NUUA 3I6UA 3GC9A 2YCQA 5G6VA 2EUFB 4ZEGA 3UC3A 3MWUA 3U4WA 3B8QA 5FP6A 2C0TA 2YEXA 3D94A 2XRUA 1QL6A 1NA7A 4XG7A 5EH0A 2A2AA 4ZJJA 4HCVA 2RFSA 2OZOA 5IEVA 3QGYA 2QVSE 5DWRA 4H39A 5AP7A 2PMNX 3E3BX 4M0ZA 5HOAA 3I0QA 1YVJA 4EI4A 3GU5A 4DHFA 2WTKB 1J7UA 3GI3A 3ROYA 2ZV9A 4IX5A 2GTNA 3II5A 3DNEA 4ORKA 4J1RA 4RSSA 4FKVA 4FKOA 3ZLYA 3VBQA 3EQGA 4L46A 3P7BA 4EOQA 3H10A 4FEXA 4LM5A 4EL9A 3THBA 3TUBA 4IE9A 5DT3A 3ZZEA 4PTGA 4AXAA 2V0DA 2E9NA 4UMTA 2CNVA 1V0PA 3G2FA 4XCUA 2CGWA 2GSFA 4G6LA 3ULZA 1ZMWA 1L3RE 4TYEA 4YNEA 5L8KA 4QP1A 4BDJA 5A4QA 4MHAA 3CP9A 4O7RA 2BALA 1OIQA 5AUXA 3LXNA 4RWKA 4K18A 5E8TA 2UW0A 2WQBA 5LARA 3CJGA 4Q2AA 3VS7A 3LPBA 4DFLA 3IW6A 5KCVA 3QKKA 4J71A 3RVGA 2R3RA 4FGRA 3DBQA 4BN1A 3ZH8A 2F2UA 2QD9A 4LFIA 3MN3A 2OK1A 2WQOA 4K0YA 2ETKA 1AD5A 2WB8A 3OCGA 4GK2A 4GYGA 4QP2A 4XOZA 4Y85A 5DI1A 3TG1A 3TWJA 3ULIA 2OW3A 3ZLXA 3BYSA 3R7GA 1MP8A 5K0KA 4MD7E 4R5YA 4WD5A 5HD4A 2YAAA 4QMNA 4EOLA 4APPA 4G34A 3KULA 5ANIA 3TZ7A 2FVDA 3WOWA 5AR4A 3H0ZA 2WMUA 4QYFA 1ZYSA 4E8AA 3QTZA 4Y72A 3LMGA 4BCJA 2HXQA 4O0SA 3RMFA 3LJ0A 3AT3A 2VZ6A 3LKMA 5AR7A 3ELJA 3VS0A 5FRIA 5TOZA 3QXPA 3VF9A 4LOQA 5DOSA 2BRBA 3QQUA 4FV7A 3MTLA 3K3IA 4GIHA 4M13A 3Q3BA 4AT4A 4CKJA 2PMOX 4DG2E 4M7IA 4BCQA 3FMMA 2C3KA 4YC3A 3BEAA 4FTUA 5L2TA 2HZIA 3EKNA 5D1JA 4QMZA 5D7AA 1Z57A 2BIYA 4EH7A 4I0RA 3TACA 3EL8A 2C47A 2YCRA 5AIRA 3FLYA 3BE9A 3S3IA 3FC1X 2G9XA 3FYKX 4WNPA 1A48A 3QYZA 4QQJA 5EM8A 3R7IA 3R9HA 2XVDA 5LVLA 3POZA 4O7WA 4GG5A 4OBPA 4XG8A 4BGQA 3UOHA 1X8BA 2R3QA 5HESA 2IWIA 3E7VA 3QTSA 2Y8OA 3COIA 4X2NA 3BU3A 4D4RA 3MVLA 5IMXA 3VS3A 5K0XA 3MPTA 4WG5A 3VC4A 4QMSA 3ANQA 2YM4A 3VUIA 2W4KA 4DITA 3QTRA 2DQ7X 4MWIA 2JBOA 1ZZ2A 1MQ4A 2PZYA 2QHMA 4XLVA 4IM3A 5IH5A 4PPCA 2BKZA 4GCJA 2OZAB 3P23A 5E8SA 4P5QA 3A7GA 2OO8X 4O1PA 3RJCA 4BTFA 4HVDA 1CDKA 3BWJA 2VWBA 4DH7A 3GU8A 4BB4A 4TKSA 3VAPA 2XA4A 4GT3A 5TF9A 4U9AA 4FEQA 2GQGA 3BU5A 5J5SA 5CT0A 4AGWA 4D4VA 4O81A 3Q9XA 5C01A 5E8XA 2XNEA 3W8QA 4FYOA 3VQHA 4FSRA 4PWNA 4EWHA 4Y73A 4Q9SA 4O6EA 5A4TA 3UBDA 5A6NA 3RPSA 3EFKA 2XIXA 1YI4A 4JBVA 4U0IA 4WIHA 2C6TA 3RAIA 3NUPA 2XK4A 4CV8A 3F2RA 1JAMA 3R30A 3QZHA 2CKPA 1YHSA 3PJ1A 3TZ8A 3UO6A 4F0IA 3DTCA 4N4SA 4EK8A 4RFMA 3ET7A 5HTIA 3MH1A 3PY1A 3I81A 5CSHA 1V1KA 1V0OA 3QL8A 5CF4A 3TZMA 5IEYA 3IOPA 2PMLX 1H1SA 3EB0A 4LUEA 5EDQA 4DEGA 4C3FA 4MXXA 5GZAA 4GIIA 5JRSA 3NR9A 4FX3A 5JRQA 2XK6A 2ITZA 2XEZA 4LOPA 2GNHA 2VX1A 4GT5A 4RJ6A 4YO6A 2BRHA 4E73A 4YJRA 1Y6BA 3D4QA 4K77A 2YFXA 4OUCA 4XG6A 5L8LA 2W5AA 4NM5A 2BFYA 3L8VA 3NPCA 5IPJA 4WKQA 4RBLA 1FINA 1NVSA 2JAVA 3ERKA 4XV3A 4J7BA 1MRVA 3BYVA 3RTPA 2GNJA 3FMLA 4KWPA 3COKA 5I5ZA 2CKOA 3I7CA 3CQUA 2ZV2A 4I4FA 3QUPA 3UIBA 2WIPA 3ZU7A 2BHHA 2O63A 4QMTA 2C68A 4V04A 2VTIA 2B4SB 3L8XA 2X9EA 4OTFA 1VZOA 2FSOX 4FIIA 4MBLA 3MS9A 4GFGA 4IDTA 3CEKA 3UYTA 3IQ7A 4L44A 5BX0A 1UKHA 2ZYBA 3RINA 3JYAA 4EH5A 1F0QA 5AR8A 5BVDA 4I6FA 5HBJA 3W33A 5EI8A 3NWWA 5ACBC 2O65A 3NX8A 4EOKA 4X2GA 3QQKA 4ZTSA 4OTRA 4IX3A 2X8IA 4EBVA 5KZ0A 1B39A 3FKLA 1U4DA 3R7YA 1SNXA 4U45A 3R9RA 4X3FB 1R78A 3NW7A 2BTSA 4HCTA 5GHVA 4PMTA 3R83A 5J5TA 3K2LA 4ALWA 4LRJA 4BDBA 2X2KA 2YDIA 2RG5A 3NDMA 1M52A 3I4BA 2A19B 4FKTA 4QMPA 5CWZA 2QG7A 3QLFA 2VTTA 2OJFE 3HMIA 3FZPA 5C9CA 3RNYA 5HLNA 4FTIA 3IDCA 4CZTA 4A07A 4QMWA 3PE2A 4X2JA 2HXLA 1PMVA 4DT8A 1J1CA 3D7TA 4H1JA 3VW6A 3ZBXA 1IASA 5AFVA 2PUNA 1P4OA 3ID6C 3P86A 2OH4A 2QU5A 2XJ1A 4K6ZA 5CLPA 5KMMA 5BVWA 3DBFA 4FV1A 4GYIA 5IQCA 5IU2A 2VWXA 3DJ6A 4GUBA 4JVGA 5KKRB 1SVGA 3R63A 4XOYA 4BBEA 2X7FA 1YQJA 4BBFA 4CG8A 2GFCA 3EYHA 4NT4A 4U40A 2DYLA 1OKZA 3FMJA 4WNKA 2JDVA 3G6HA 3VS2A 3C4XA 3O23A 3C4EA 2RG6A 3E88A 4I1ZA 3TCPA 3TV7A 4BKJA 4I94A 1U5RA 4IHPA 4YZ9A 4YHTA 3R7VA 4A06A 3D5VA 3OMVA 4C8BA 3UQFA 5BMSA 3OW3A 4CTBA 3ZM4A 2HZNA 3KGAA 3LM0A 2CMWA 4UYNA 3CY2A 1JKSA 3SLSA 3A8WA 5CVFA 4G1WA 5C26A 3MPAA 2YLFA 2EB3A 2ZM3A 4IAKA 3GB2A 2WMRA 4YBKA 3MPMA 4DFNA 3DLZA 2WTWA
chains in the Genus database with same CATH superfamily
3ORPA 4ZS0A 4U6RA 2P3GX 4FV9A 4AGDA 1TQPA 4C2WA 2G2IA 4BKZA 4IM2A 2UV2A 5HE2A 3ODZX 4BZOA 4CFNA 5IH4A 3TUDA 5IQFA 2DS1A 5HU3A 2P55A 3NYNA 1G8AA 3PJCA 1LEZA 4N70A 1SMHA 2UW9A 3FI3A 4TY1A 5CF5A 4O86A 3CR0A 5FEEA 4L3LA 4JBPA 5EYMA 4R77A 3OCSA 1Q61A 2BRNA 3LM5A 3NNXA 4MBJA 2ZB0A 3ZHPC 3CPBA 1RW8A 2YM6A 4AP7A 4AZFA 4AZTA 5LOHA 4F6WA 3OC1A 3AG9A 2C6DA 2ZVAA 4G9RA 5HICA 3LIJA 2G2FA 4QMUA 4ACHA 3EN5A 2PK9A 4RIXB 5ITAA 4C35A 4G16A 3OD6X 5FBNC 1DAYA 3G9NA 3D15A 1WAKA 4IANA 4YHJA 4L67A 3QQJA 5CAVA 2ZDTA 2WQNA 2ZDUA 1Q8ZA 3D5XA 1YI3A 2ITXA 2J9MA 4LGGA 1U54A 1IA9A 2J90A 3EN4A 1S9IA 5KNJA 3S4QA 2VWVA 2X81A 3QCSA 2J7TA 3FQHA 3DBDA 2C6LA 4JS8A 3BLQA 3W2RA 4EBWA 2Y9QA 2UZDA 4WNMA 5HNIX 1PXLA 3QRTA 4LYNA 4NYEA 3V5PA 4MQ1A 3KN5A 4G5PA 3PXZA 3O51A 3RGFA 4EOOA 3DQXA 4FSUA 3GU4A 4II5A 3BYUA 3BE2A 3CKXA 4MQ2A 2P4IA 5EHOA 4ZTHA 4I0TA 4WHZA 4BRXA 4DLIA 3R1NA 4TL0A 4KUJA 5LVPA 3UNKA 5IQDA 3NCGA 1FBNA 1GZNA 1K2PA 3FL4A 3WF6A 4L53A 5J1WA 2XIKA 4H05A 4O1OA 3CBLA 4RC3A 4YTFA 5FQDC 2VTMA 3UTOA 3U51A 2SRCA 3A2CA 1OKWA 3E8DA 5LCJA 4LMNA 3PWDA 2J0IA 3DV3A 5F4NA 4I21A 3PP0A 4ASEA 5AAGA 2W1CA 2P33A 4G6NA 4M14A 4QQTA 3OOGA 4HNIA 3P78A 5A46A 5KBRA 1ATPE 2BZIB 2V55A 2YDKA 2RIOA 2O8YA 5C27A 2NNWB 3UO5A 5GIPE 4YSJA 3MB7A 3RBWA 1L8TA 4U81A 2OIBA 1CMKE 3TNQB 3DXQA 5HBHA 5KMOA 2W5HA 4M8TA 2UW3A 2OF2A 4D0WA 4RA5A 2UZVA 4RG0A 3SDJA 1KOAA 3Q4TA 4X2KA 3JVSA 4DGGA 2R64A 3DKCA 5LVMA 3P79A 3ZC6A 5DEYA 5IUIA 1BLXA 4JLCA 3LCKA 5HCXA 4ACDA 2I0HA 2XKEA 5IA1A 1STCE 5KHXA 5AV1A 3BYMA 2RFNA 3LJ2A 3IW5A 4NM3A 3F66A 3SC1A 3CCNA 5KMNA 2CGUA 3G33A 4O96A 4O27B 4S32A 4G31A 4N6YA 4X7QA 3AC2A 3PJ3A 4GW8A 4IZYA 4U3YA 5AP2A 4YJOA 3ORNA 2C3IB 4EH6A 1O6LA 3KRWA 1FVTA 3LLTA 4IJ9A 3FLSA 4YZMA 3UOJA 4ZS4A 3LJ1A 1OIUA 1ZMVA 2YHVA 3PRFA 2I0VA 3OWJA 4FV2A 3JY9A 4BDDA 4JIKA 4BWPA 3POOA 4CQGA 5AJQA 2ITYA 2BZJA 3RWPA 4BDCA 4O2ZA 4AA4A 4QMLA 3LFCA 2JDRA 1CKPA 3NNVA 4FTJA 4AU8A 4F9YA 2IPXA 3FKNA 4PDPA 5CNOA 1QPEA 1UU3A 3Q9WA 1ZOEA 5JKGA 3R73A 1FMKA 4AA5A 4ZSAA 5LCKA 3EQBA 4RIWA 3HECA 3IKAA 3FXZA 1CM8A 2PE2A 3IW7A 2J4ZA 5M57A 4QQCA 4AOTA 2H6DA 2E9OA 5IUGA 4FG9A 4CT2A 4R7BA 2IZTA 1H1PA 5IF1A 2XIYA 5CY3A 4P7EA 3SRVA 4EKKA 3VUHA 4CKRA 4JR3A 3UYSA 5AX3A 1Q3WA 3PVWA 4M69A 4W8DA 3RCJA 5HORA 2HYYA 3GNIB 2FSLX 3EQPA 5A4EA 4F70A 2C0OA 1DM2A 3LFDA 5GJGA 2OXDA 1WVWA 5EFQA 3V5LA 4BDEA 5IA4A 5EI6A 2BMCA 5EKOA 2XANA 4CG9A 3MH3A 2J50A 2REIA 2X8DA 4BCMA 3PSBA 5JFSA 4OBQA 5HG7A 4CD0A 1KE7A 3GQLA 4RGJA 3LQ3A 4AN3A 3C50A 3R1QA 2OI4X 3NUYA 3QHWA 5HO8A 2OLCA 2XF0A 2QO2A 3NRMA 4F7LA 2UUEA 4U79A 5AMNA 3UVPA 4E20A 4O84A 5DGZA 2F4JA 2G1TA 1PMEA 3PYYA 4FOBA 4DTAA 1JSTA 5HBEA 5HVYA 4EEVA 1OB3A 5IG1A 3GGFA 5E90A 4I41A 2XCHA 4ANOA 3MFUA 5T68A 4BTMA 2I6LA 3GEQA 3F5XA 1YKRA 1Y91A 4TYJA 2VGPA 4YSMA 5FTQA 3FLQA 3QWJA 5A4LA 5AV4A 4MXAA 4NSTA 5FXRA 1IR3A 2O3PA 1E1VA 3NAXA 5HTCA 5KBQA 5IMEA 3OW4A 2CJMA 2XBAA 5JZNA 2GS7A 4KD1A 3F5UA 4PRJA 3FMEA 2WMAA 1JWHA 5FG8A 3TTIA 4BZNA 4YPDA 4AGUA 4GS6A 4AW0A 3ZTXA 5EQPA 3OTVA 4F63A 1OGYA 4IVDA 4QMXA 4ITHA 4BBMA 4C2VA 3ZSIA 4DA5A 4PDOA 3ZLWA 2WQEA 2X0GA 5DA3A 2FSTX 5IQBA 2C6OA 2QLUA 2PTKA 4D9TA 4S34A 5HD7A 1TVOA 3E92A 2CNQA 5IA3A 1YXUA 3UE4A 5KMIA 2JBPA 3GCSA 3R01A 4EKLA 4EUTA 1KE8A 3T9TA 2JIIA 4O82A 1P2AA 2OIQA 1JPAA 2JDTA 3QD0A 2X6EA 4KIQA 3QQLA 1A06A 4K2RA 4MNEB 4FZAB 2PHKA 3IO7A 3ZRKA 4YJSA 3W10A 3LZBA 3QZIA 2XK3A 2R3KA 1H24A 1WFCA 4S33A 5CQUA 1MRYA 3QF9A 2ZV8A 5ANKA 4FUYA 4B9DA 3WZJA 4AZEA 4FTMA 3CGFA 3UVQA 1YOLA 2QOOA 4AW5A 5BUIA 2Z7QA 3EOCA 2ITNA 3I5ZA 3GCUA 3BBTB 4YJVA 3VW8A 3HDMA 2A0CX 1OL7A 2VV9A 4JRNA 5D7VA 3Q53A 4EH9A 3MBLA 2C3LA 4A4LA 3D83A 4JBQA 4KS8A 1PMUA 1W84A 5DLSA 1Q3DA 3NSZA 2P2HA 1KOBA 3W55A 2C4GA 4QMYA 3PZHA 3R7OA 5BYLA 2R4BA 4ANNA 3KN6A 5M07A 3R8VA 3KMMA 4FT3A 2JDSA 4JAIA 2B9IA 1F5QA 2Q0NA 2VNYA 3MI9A 5EI2A 5H3QA 5HHWA 1P4FA 3ZXTA 4V01A 2OSCA 4A9UA 3EZVA 3BLAA 4USFA 1HCLA 2PUIA 4LDTA 4MF1A 3O7LD 5ETFA 1U46A 2W1HA 5A9UA 4HCUA 3TJDA 3TL8A 3KVWA 4S31A 4XBUA 4B99A 3UPZA 2XK8A 3BHTA 3F6XA 4NK9A 3A61A 3RKBA 5IA2A 5HE0A 4HW7A 3VO3A 1SVEA 2XZSA 4RIYB 2VTJA 4M12A 2CLQA 3W8LA 3ZO3A 2XEYA 4EQMA 5A4CA 2XIZA 4XJ0A 4FNXA 3QZGA 1RJBA 3OBGA 4JI9A 2UVZA 5GINE 1IA8A 3CQEA 4H3BA 4QP9A 2YZLA 2FSMX 5FM2A 4QRCA 3BYOA 2W1DA 4FTRA 4XRLA 3ZO1A 3A4PA 2QU6A 3U6HA 4LG4A 3HKOA 4OAVB 2IG7A 2VTQA 2PUUA 4CVAA 5EDRA 5IH6A 1E9HA 1TZDA 2OH0E 4YGAA 1V0BA 5HEZA 4FRFA 1JNKA 2VTRA 5DMZA 4HYIA 2QKRA 4ARKA 3R8PA 4M3QA 4ZY6A 4DH1A 4B7TA 2R3MA 2XM8A 3ZSHA 2XM9A 4ZAUA 4QP7A 4ERKA 3ENMA 4UB7A 4PNIA 5K5XA 1NT2A 5DH3A 3UGCA 4BICA 3ZM9A 2IW9A 3CGOA 3EL7A 3DQWA 5T3QA 2BAQA 2JEDA 4CFXA 2B9HA 4ZMFA 2ZV7A 3HMMA 2O5KA 2XKFA 1R3CA 2VO6A 3PVUA 4F1OA 4FMQA 5F9EA 3AC4A 4LGDA 1R1WA 3ZOSA 4PTEA 4RQKA 3CSVA 1ZWSA 3FPMA 1E1XA 1OECA 4GT4A 3BU6A 4C0TA 4GSBA 2RL5A 1WCCA 4A7CA 3HV6A 5I9ZA 5KMJA 1I44A 3AD6A 3L8SA 5M4FA 3C13A 4V05A 2X0QA 2EB2A 4AE6A 2Y4PA 3E8CA 4O21A 4MXZA 4FTKA 3PPKA 5B7VA 5J87A 4TWCA 5JT2A 3E62A 4WBOA 4F1TA 3JVRA 2RFDA 1VEBA 3HP5A 4W9WA 1H28A 2IF8A 5DE2A 1LUFA 4NW6A 3UZPA 3HP2A 4IQ6A 4L3PA 2VTNA 3R02A 4HVIA 3HMNA 3A7FA 4C34A 1J3HA 4O7NA 1JVPP 3ZMMA 3KIOC 2IO6A 5CF6A 2BIKB 3QXOA 4B6LA 4AXDA 3I6WA 3K5UA 4H3QA 3UQGA 4FV5A 4WSQA 4FZFB 1OIRA 4FL2A 5JN2A 3LFBA 4DGOA 2OJ9A 4Q5EA 4J99A 3Q04A 3AKLA 3EQCA 4NTTA 4DH5A 2C6EA 4FKJA 2WU6A 2WPAA 5FWKK 2WHBA 4QYGA 5AA8A 5LQFA 2Y6OA 4JJRA 5HLPA 3R8LA 3FQEA 3DK7A 3Q6WA 4RJ8A 3ZUTA 4H58A 5DPVA 2UVXA 5FD2A 3DBCA 3FXWA 4J8NA 5DFPA 3DAEA 3E5AA 4O0VA 4PMMA 4YLKA 5J9LA 1W98A 4E4NA 2VN9A 3KFAA 3PE1A 4F9AA 2EXCX 1U5QA 2HY0A 5ICPA 1PY5A 3PXKA 3ZZWA 5AA9A 5M4UA 5LMBA 5M4CA 3OVVA 3MTFA 2UZOA 4EZ3A 4UMPA 4TYHA 4EJNA 2F7ZE 4BI1A 2XKCA 3IK3A 4CCUA 4FTCA 4FTQA 4FODA 5LWNA 3IECA 2CCHA 3AQVA 3T3VA 3S0OA 2HZ4A 3HVCA 5FBOA 4F0GA 2C1AA 4F99A 4GVJA 2V7OA 3CKWA 2HAKA 2V62A 2J6MA 2RF9A 3KULB 4IC8A 3RZFA 4HOKA 2VWUA 3OUKA 2BVAA 4FTLA 4MK0A 4YC8A 1ND4A 4HJOA 4BJJB 3F7ZA 3LQ5A 3OTUA 3N9XA 1LP4A 1P14A 4O0UA 3R2BA 3QQFA 2GDOA 2IVUA 4XEYA 2QONA 2JKQA 2A4LA 4UBAA 5ANOA 3CPCA 1JKKA 2I40A 2H34A 3R00A 4C62A 3UVRA 3CJFA 3SG8A 4U43A 1URWA 5GIOE 5HO7A 4DAWA 4IAAA 2YWVA 3ROCA 2PUPA 4ZP5A 1QMZA 3VS6A 2WD1A 3C0HA 3LQ8A 4FIGA 1KSWA 1Q5KA 2PVHA 4X6QC 4MEDA 5ETAA 3ZXZA 4C57A 1OITA 4C36A 3C1XA 3LXKA 5IUHA 5LMAA 3BWFA 4CFUA 4FNYA 3WZEA 4NW5A 2IW6A 1G5SA 3FY2A 3NMUF 3COHA 2R5TA 3NAYA 4D55A 5K9IA 5GJFA 1JKLA 3E64A 3T3UA 1H0WA 1YOMA 5AP5A 3ETAA 4NU1A 4BHNA 2VWYA 3P08A 5IDNA 5CEMA 2CKQA 1DS5A 3EMGA 3RM7A 1H1RA 5BNJA 5L2IA 5D10A 4YJQA 4QP6A 3W1FA 3ZLSA 4FVRA 3G90X 4IVCA 3G15A 4I6LA 4BIDA 4R1YA 3HUBA 5EG3A 5H8GA 5EHLA 4IWDA 3HV4A 2PPQA 3GVUA 5BPYA 1Q8WA 4ZTNA 1H00A 2E9VA 3FHRA 1Y8YA 3FZOA 1Q99A 4I23A 4RX8A 4NJDA 4FTTA 4QTDA 4EQUA 3R21A 4DHIB 2QURA 3OZ6A 3B8RA 4L01A 2WTCA 3IS5A 3ZFYA 4Q9ZA 3PUFC 2PVFA 1OL2A 4RIOA 3R8UA 4YBJA 1WZYA 3VJNA 3W0NA 4MBIA 2OXYA 2BRGA 1I09A 3I7BA 3QC9A 2NP8A 4UV0A 4YPSA 5IDPA 5AM7A 3QKMA 4DEEA 3PJ2A 4GG7A 5DT4A 3OROA 4J53A 3FWQA 3NUSA 4F08A 3BLRA 2R2PA 5L6PA 3DOGA 4DHZA 3OBJA 1H07A 3VONA 3QA0A 3G51A 4BYJA 4JG8A 3QCQA 2BTRA 4QT1A 2C0IA 3ZO4A 2O64A 4XH6A 2X0PA 1Z5MA 3OT8A 4IACA 4XUFA 4XX9A 2A27A 3CY3A 4J97A 3EIDA 3OFMA 5E8VA 5JFWA 4OLIA 1XKKA 3UO4A 4CMTA 3ZCLA 4FE2A 2CKEA 1ZMUA 4G3EA 2BAKA 1G8SA 3H4JA 4ASZA 3V8WA 3MA6A 3LFQA 5H2UA 4DBNA 3ZUVA 2XNOA 2B9JA 4IJPA 3JXWA 3BGZA 4BDIA 2CCIA 5M55A 5LXMA 3C4FA 3L1SA 2J5EA 5IQAA 3HUCA 3ZFMA 5AR2A 1WBVA 1YI6A 4DE4A 5JGAA 1OPJA 3A7JA 3HA8A 1PW2A 4JR7A 3AC1A 4YTHA 3FLNC 4BCIA 4O6LA 4FKRA 1NW1A 3KKVA 4GK4A 5IA0A 3Q2MA 5ANJA 2C69A 4L43A 3UG2A 1PXNA 4B4LA 4QNAA 4D58A 3TUCA 4FKSA 5TE0A 3JR1A 3QRUA 2HWPA 4OTQA 5BVKA 3KU2A 5HIEA 4FKUA 5L3AA 3NFGB 5DRDA 4IAIA 2B53A 4X21A 4L7SA 4GH2A 3KCKA 4J96A 5JZJA 2CHLA 5CU6A 3TI1A 3S95A 2C5XA 1H01A 3OXIA 3HRBA 3QQGA 3UZTA 2G15A 2PE1A 4GMYA 3W18A 4IAYA 3IDBA 4AF3A 4P5ZA 4UYAA 5CX9A 3VRZA 2Z2WA 3MA3A 2GCDA 2WMSA 4XP2A 3WYXA 2XNGA 2XNMA 3QCXA 4ACMA 4FVQA 5CSWA 5EW8A 4IDVA 1PYXA 1XH9A 4EH3A 2FYSA 5AUWA 4BKYA 2B1PA 3NGAA 3F3WA 3T8OA 4R3CA 4KBAA 5A54A 2YM5A 5EKNA 1BX6A 5FEDA 1TFFA 5EM7A 3LW0A 5HCZA 4CMUA 4DYMA 2XB7A 3QU0A 3RI1A 4DEIA 3OUNB 3O8PA 4GV1A 3IW8A 3A8XA 1ZYCA 4C7TA 4HNFA 3V01A 5CAOA 1PJKA 1WVXA 2WNTA 3VN9A 4G3CA 3FJQE 3DB8A 3D7TB 5HZNA 3R71A 3NW6A 3HDNA 3U54A 3R7UA 5KMKA 3VS1A 4B0GA 4KIPA 5AV2A 4CV9A 2AC5A 2VX3A 5EK7A 4UWBA 4ACGA 3BI6A 3OY1A 4LUDA 4EOJA 2R3JA 4U8ZA 2AEGA 3ZRMA 2F9GA 4O7YA 4HGEA 3DAJA 4YJTA 3V6SA 4ERWA 3WZDA 5I9WA 3BL9A 2JLDA 5FUTA 3W0MA 3TTJA 5JGBA 4TRLA 5CXHA 4DGNA 4C4IA 4F1MA 4ITJA 3BHUA 3KC3A 2WKMA 3UC4A 5E8UA 1W2CA 5EHYA 3GCVA 1H26A 3AMYA 3VBWA 4ZTQA 3UPXA 1Q97A 3D7ZA 5CU4A 2Y4IC 1LPUA 2VWWA 4FSQA 4MAOA 3HX4A 3QGWA 4KSPA 4G2FA 4RWLA 4ITIA 4C3PA 2B54A 4YO4A 3SVVA 4RC2A 5M44A 3SW7A 4EK4A 1ZZLA 3FBVA 3R28A 4JDIA 3K5VA 1JQHA 5HTBA 1DAWA 3DJ7A 4ZSLA 5HG5A 3TKUA 3O71A 2R7BA 3C7QA 3PPJA 4C38A 2EXMA 5A3XA 2VGOA 3PTGA 3ACKA 3FI2A 1YDSE 4LMUA 2VAGA 1GZKA 3HLLA 4E5WA 4TNBA 5BQ0A 3EFJA 3LAUA 2XAOA 1PXOA 2QR8A 5EM5A 4O4FA 3VBYA 4PX6A 3KXMA 3VUMA 5DYJA 3R0TA 4IADA 4NKAA 1PXJA 4D4SA 4NH1A 4IZAA 1T46A 1MQBA 3DB6A 2HOGA 5DNRA 4FV4A 4USEA 3GOKA 5HVJA 1U54B 3EQDA 4PTCA 3NNUA 3PZEA 3MGYA 3PG3A 2FB8A 3Q60A 3KREA 3QKLA 4I5PA 2W7XA 2WOTA 1ERKA 1Y57A 2R0IA 4I5CA 1H0VA 5AP3A 3W2QA 1FVVA 2WTJA 3VUTA 3HL7A 4D28A 2HIWA 3ORTA 4LV7A 2WAJA 3OHTA 3D0EA 2PZ5A 3ZYAA 4XYFA 2UW4A 1HOWA 2GU8A 3FY0A 4IX6A 4YNOA 3PVBA 4AXCA 2QO9A 4HYHA 1IAJA 3PUPA 1VYWA 1GIHA 2H9VA 3RHXA 2ETRA 4FUXA 4MWHA 5HE1A 4ACCA 1VR2A 1M7QA 2X8EA 3PWYA 4LRKA 2IZSA 4GU9A 4XMOA 4AW2A 4WRGA 3DA6A 4IZ7A 4NTSA 4FL1A 2HW6A 1J7IA 2GHMA 2QKWB 3A7HA 4ANSA 4G6OA 3GUBA 3DZOA 4ASXA 5HGIA 3FMNA 4IH8A 4OTGA 5JFVA 4WG4A 2WELA 5EQYA 1JOWB 3C0GA 3G5DA 3QTQA 4FKLA 5CYIA 3WIKA 2G01A 4YJPA 5CANA 3AD4A 2F7EE 2OBJA 4AA0A 3LMIA 4DDIA 2IZRA 3KRXA 3QHRA 2W96B 3E93A 4FTOA 4XP0A 3O2MA 2UZLA 3GCQA 2W17A 4UMRA 5M56A 3H9FA 3L9MA 3WIGA 5IQEA 1BL7A 4FZ7A 1ZLTA 3G6GA 3MVMA 4PUZA 2YJRA 5IISA 4CQEA 3VHEA 3PLSA 5EYCA 4JIAA 4X6RA 3F82A 4YR8A 4O91A 5GZ8A 4KINA 3EKKA 5HG9A 4MD8E 3VWAA 5HIBA 5BVFA 3RCDA 3SHEA 2BDJA 4AN9A 3VUGA 4F9CA 4YTCA 3KY2A 3FMHA 5E8YA 3WZKA 2C6KA 4GFMA 4KABA 2UZWE 3KMUA 4I6BA 4U41A 4EHEA 5ANEA 3UJGA 3MFSA 1YXXA 4F78A 3F3ZA 4YC6A 3M1SA 4LI5A 1WBPA 3QUDA 4FTAA 4KAOA 2C6MA 4CLJA 1XBAA 3FZRA 3MVHA 4FKGA 2WMQA 4AFEA 4GJ3A 3WYYA 3F5GA 1HCKA 3HAMA 2QO7A 4L42A 3U55A 3KL8A 4HZRA 4DFZE 2C1BA 3A99A 4FIFA 4C33A 4R78A 2W1IA 2CDZA 4AOIA 4PMSA 5H8BA 3I1AA 5AADA 4OTPA 1EH4A 3V51A 1SYKA 5BVOA 4DEAA 1UU7A 1OL6A 4XG3A 5J1VA 4OT6A 1TQMA 5KZIA 4CZYB 4DCEA 4O7ZA 3NW5A 3WZUA 2JFMA 1Q8UA 2ZM4A 1FQ1B 4I93A 3PXFA 4YJUA 3PY0A 4IW0A 5DR9A 4GKIA 2PZIA 4KA3A 1H1WA 5E8WA 4CTCA 2UZBA 4Q5HA 4EK6A 4RIWB 4BCOA 2C6IA 3CQWA 4F7JA 4ZY4A 2BZHB 5CEOA 3C9WA 2XP2A 1XH8A 2BDFA 2WXVA 2XKDA 5E7RA 1H08A 4U44A 5J7HA 3MH2A 5FEQA 5T6KA 3AMAA 1MRUA 4AAYA 4BY9E 4EONA 5CU0A 5FDXA 3SRVB 2QNJA 4FL3A 3DXNA 5E8ZA 5TR6A 4A9SA 3SX9A 4R7HA 1M2PA 4M69B 2WMWA 4GK3A 2X7OA 4J95A 3UDBA 4ZJVA 5C1QB 4GL9A 3IGOA 5M08A 3H9OA 3Q96A 5HCYA 3MV5A 5J9YA 2UZUE 3OWLA 3DCVA 3ZFXA 3N4UA 1VJYA 3ORIA 2UZEA 4C02A 3B2WA 3OY3A 1PKDA 3D5WA 4OTDA 4Z7GA 3Q5ZA 4JT3A 3NIZA 4FOCA 3LHJA 2EU9A 3RPVA 1YHWA 3MFTA 3TT0A 2BDWA 3H3CA 4V0GA 5A14A 3FQSA 4FV3A 5KE0A 2Q83A 5C4KA 2YIYA 3UNZA 4JAJA 1W82A 4ZZOA 4J52A 2LAVA 3FKOA 5HNGA 4IB5A 5ANGA 4NJ3A 4JG7A 5DIAA 4RZWA 2DUVA 5AV0A 4BR3A 2YISA 3VBVA 1OKYA 4MXOA 3CS9A 2F7XE 2VUWA 4YZBA 5CZIA 3P9JA 5KMLA 4MVFA 1OPLA 2R3OA 5FXSA 3TDVA 4U7ZA 3ZSGA 4O7SA 5BV3A 4FNWA 3MFRA 5EOBA 3PLAE 1YDTE 5GJDA 3D9VA 1PHKA 1UNHA 1O9UA 2IVVA 3DNDA 2CGVA 3EFLA 4EJ7A 4CEGA 2AYPA 2BUJA 2ZAZA 4CYJA 1G8JA 3F88A 4FIJA 2UW7A 4DH3A 3KB7A 2IVSA 2J0LA 2VTOA 4FIHA 1PRYA 4L8MA 4JXFA 3F5PA 5C8MA 3RAWA 3DZQA 3L9LA 3V5JA 4NCTA 4PDYA 3PG1A 2GMXA 5HI2A 2PVRA 4I5MA 2C5OA 3VUDA 1R0EA 1JSVA 1AGWA 1GJOA 4E4MA 3AT2A 5M4IA 4E1ZA 3N4TA 2XBJA 4BCGA 2ZMCA 3GOPA 5DG5A 5I9XA 1ST4A 2VO7A 4AAAA 1OMWA 3KXXA 4ONAA 5CAUA 3FMKA 3EWHA 1JBPE 3CC6A 3VBXA 4WT6A 3W0PA 3R7EA 5L6WL 1KV2A 3MYGA 1FPUA 4UZDA 3FI8A 3AC3A 3NVKI 4O4DA 4NM7A 2JITA 3MW1A 4FI1A 1OVEA 5CT7A 3DK3A 3HRFA 2ITWA 3FZTA 1Q4LA 2JGZA 4M15A 1UWJA 3RAKA 5JQ8A 4R1VA 1OL1A 5CVHA 5L8JA 5HX8A 3PFYA 3V3VA 2W99B 5AR5A 4HGLA 4GVAA 4ZJIA 3D14A 5ANDA 3NVMB 1UU9A 2OJJA 3AC5A 4ZSJA 1XR1A 4Y5QA 4EH2A 4BHZA 4D2SA 4EHZA 3BV3A 2BR1A 2ETMA 4BVUA 4BIBA 2G2HA 3QAME 5I4NA 2VX0A 5AIKA 3TXOA 5ETIA 3FXXA 3TJCA 1W2DA 3S00A 4MUQA 3O5AA 3H0YA 2PULA 2QG5A 4IWPA 5EDPA 5AV3A 2WMBA 4S30A 4WA9A 4GUEA 3TN8A 3PXQA 3ZRLA 1SNUA 1W7HA 4OW8A 4O0XA 1ZXEA 1ZAOA 1FGIA 1YWNA 3SW4A 5CXZA 3LFAA 4YZDA 2W1GA 3UP7A 2ZOQA 4HYSA 4LL5A 3OS3A 5J8IA 4O83A 5DR6A 1OZ1A 4IAZA 3COMA 5C03A 3VVHA 3ZC5A 3GU6A 5DR2A 3R8MA 4CRLA 2JDOA 3HZTA 4YP8A 2JKKA 4EOPA 3QC4A 3DJ5A 3NYOA 4ZMEA 4CNHA 3R9OA 3LLAA 4DCAA 5K3YA 3GFEA 5AM6A 4C59A 1M14A 1WBWA 3AXWA 5CS6A 5EM6A 3A7IA 4MD9E 5H8EA 4K11A 2YA9A 4KKHA 5L2QA 4FK3A 3LCOA 2R3HA 4EYMA 2VU3A 3OWPA 4FR4A 1M2QA 4FGBA 1FOTA 3I79A 4IAFA 2PU8A 1W8CA 2PZRA 1XH5A 4JQ7A 3UDTA 2WU7A 4OR5A 3BL7A 3OXZA 2GHLA 3FAAA 2ITUA 3O96A 2UZTA 4MNFA 3VQUA 3WF7A 4K8AA 3TNPC 4CRSA 4FZDB 4Y95A 3W16A 3P5JC 2PWLA 2QQ7A 4RWJA 2QI8A 5E92A 4TZRA 3W2CA 2O0UA 4BDAA 2JKOA 3UIMA 3HMOA 3VS5A 1XMMA 2W06A 3V04A 4TTHB 4A9RA 2BROA 4ENXA 4A4OA 1GIIA 3PIZA 4PQNA 5IQGA 5DN3A 4FSYA 1CTPE 2XARA 1Q24A 4AOJA 4D2TA 4D1XA 3T9IA 4C3RA 4IFGA 4JDKA 3BPRA 5EW3A 2W05A 4D5HA 4E5AX 3C4ZA 3GQIA 3PA5A 2HZ0A 5DVRA 3OCBA 2RFEA 4ZOGA 4NUSA 4QEBA 1UU8A 4BCKA 3TDWA 4HVSA 5J79A 2QOFA 2OG8A 5KHWA 4BYIA 3BRBA 2NRYA 3D2KA 2W9ZB 2QOQA 3BHHA 4BTJA 4O7LA 4QPAA 4RX7A 4BDHA 3NYVA 5D9HA 5L4QA 2J5FA 2XS0A 4KSQA 2YJSA 3OP5A 3S2PA 2W4JA 3NLBA 2Y4IB 4CCBA 3QTUA 4I20A 3EFWA 1RQQA 2W5BA 3F7WA 3FV8A 4DG0E 3HMPA 4G3DA 2WEIA 4O0RA 5LMKA 3W0SA