1GZKA

Molecular mechanism for the regulation of protein kinase b/akt by hydrophobic motif phosphorylation
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
296
structure length
271
Chain Sequence
b'KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 72
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gzkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gzkA02
4DG0E 3DK6A 3QGYA 3SDJA 3EYHA 2IW6A 3CLYA 1XKKA 4GYIA 4FL1A 4NM7A 3HMIA 5EM5A 3UVPA 3ZO2A 3W32A 2UZTA 4ACHA 2W96B 4GT5A 5EW8A 2HOGA 4LUDA 4BZNA 3OCTA 3G2FA 2ZB1A 3CJGA 4ZOGA 5TE0A 3BU6A 2WEIA 1R39A 4IM0A 3MW1A 4M15A 4F1OA 4ZZOA 3LM5A 4KS8A 4GK3A 3H30A 1ZOGA 2XKCA 3BYMA 3Q6UA 3AMYA 5L8JA 3CGFA 4ITJA 5HD7A 3DKOA 3EFLA 3ZLSA 5HI2A 4EK3A 2UW9A 3DBQA 3FSKA 3FLYA 3GENA 4Y46A 1Q97A 4F9WA 2CN5A 3E3PA 3TKHA 1A48A 2QO2A 4APCA 2PVJA 4EOOA 4FZDB 3I0OA 3DFAA 3UG1A 4EH6A 1R0EA 5FBOA 2YDIA 5AP1A 3E8EA 4JX7A 5DLSA 2XNBA 3DNDA 4O1OA 4PL3A 4A4XA 2VTLA 3VULA 2UZVA 4DBXA 4O91A 3Q9YA 2AUHA 4E93A 3RHXA 4D4SA 4FEWA 4OT6A 3NYXA 1WZYA 1XO2B 3NSZA 2V7OA 3VQHA 5CZIA 4RWJA 3WZJA 4YJUA 4RA4A 2G01A 2UW6A 2ZV2A 3BLRA 3FDNA 4LI5A 3G90X 3ZEWA 5DA3A 2EUFB 3Q6WA 3FC1X 3QCYA 3C51A 4AE9A 2V0DA 2VRXA 1JWHA 3FY2A 3MY1A 3CTHA 4JNWA 3DLSA 3R21A 2W1GA 4TY1A 3JPVA 4OTPA 4WRSA 5BVDA 4F99A 5HLWA 3KF7A 3F3ZA 5L2SA 5HG7A 4C02A 4XLIA 5K3YA 3F69A 4D9TA 3VBWA 4A9SA 3EQCA 3MESA 3IG7A 5EI6A 3JXWA 2BUJA 2OF2A 3VBYA 4K11A 3OZ6A 4UMUA 4QPSA 2OIDA 1Z9XA 2VTRA 2FYSA 3Q32A 3A4OX 1PRYA 3FXWA 4BCMA 2QODA 3LW0A 2GS2A 2BHHA 4ASZA 4UMQA 5EQEA 2WB8A 5C27A 4BDGA 2R5TA 2ITTA 5DT3A 3MI9A 4OTHA 2F2CB 3JS2A 4MXAA 4N4SA 4U41A 4FYOA 3QXPA 3VUDA 1U46A 1Y8GA 3MFTA 4RPVA 3ZH8A 3OROA 1P14A 5IH4A 5I4NA 4DITA 2BZJA 2PSQA 4RZVA 3HAMA 3WYYA 4IQ6A 3MJ1A 1UU9A 4L68A 5D10A 4ALWA 2JIVA 3F2AA 3OBGA 5BVEA 4C4HA 3QTXA 3TWJA 2C68A 5KCVA 5AADA 3CEKA 4FC0A 3ZS5A 1SVHA 2YM7A 1YQJA 3A7GA 4IW0A 4Q9SA 1WBVA 3QZIA 2J2IB 2X7OA 4M69A 2BVAA 2VX1A 1U5RA 5HBHA 4KIOA 4OT5A 5CNNA 4A4OA 4Y85A 3ZDUA 2CN8A 2HIWA 3K5VA 4XV3A 2QO9A 3ATTA 4ZEGA 4DA5A 1GNGA 4DH8A 5IQIA 5DG5A 3Q53A 3LFQA 3NEWA 5LMKC 2RFNA 3KF4A 3TG1A 5AAGA 4L44A 4ZMEA 3VUHA 5L2TA 3FSFA 2IZUA 5E90A 4F9BA 5M4FA 4GVAA 4I6BA 4IZ7A 4KBKA 3RM6A 3WZEA 3PP1A 2GQRA 4UV0A 4EQUA 3R0TA 2XNNA 4EBWA 1CTPE 3LLAA 4I23A 2XNPA 4A4LA 3FZPA 4D58A 4QMQA 4FV7A 2ITZA 3PFQA 3PIYA 5DR6A 3QTIA 2W5AA 3NW7A 5A3XA 4CFXA 3VUGA 3D5XA 4EWHA 3DNEA 4HGEA 4W9WA 5CALA 5CF5A 4FX3A 2C6OA 4J7BA 3HVCA 4FYNA 4N57A 1DS5A 1LEWA 2FO0A 2OF4A 3V5LA 5EM8A 4G9RA 4M66A 1PYEA 2ETMA 3BV3A 5EKOA 3DK3A 4D2TA 5DWRA 4IDTA 4CFFA 2GS6A 4R7HA 3V5TA 3M42A 4K1BA 4O6LA 5JRSA 4O7RA 1ZWSA 3S4QA 2I0YA 2J50A 3HA8A 4MF0A 4EZ3A 3NMUF 2WMUA 3UMWA 3R04A 1UV5A 3Q2JA 2YAKA 3ANRA 4NH1A 3UZTA 4FKLA 3ZRKA 4U9AA 5AAEA 3ODZX 3LAUA 1AD5A 4AF3A 4BFMA 3CJFA 3MDYA 3IS5A 3VBTA 2ERZE 4H3BA 4CRLA 4M3QA 5F4NA 1CDKA 4CRSA 2A2AA 4FV3A 5JZJA 1JNKA 4JDKA 3BHHA 4RQVA 3F5GA 3R8ZA 3NAYA 5CS6A 2WNTA 3C7QA 4PTCA 5B0XA 4FA2A 3R63A 1NA7A 5EM7A 5M4UA 3N4VA 3G33A 5E7RA 3FWQA 5CVGA 5HLNA 2VWVA 2UZNA 4J98A 3V6RA 4P5QA 4FV5A 4BDAA 1JKKA 4QQCA 5JGDA 3ZXZA 4MAOA 3EN7A 3U9CA 4EH3A 2BZIB 3ULZA 4GJ3A 3VS1A 3OY1A 5M09A 4U3YA 3C4CA 3LFAA 4G3EA 2BAKA 2XP2A 4DYMA 5CU2A 3C4XA 2OU7A 3DKCA 4L3PA 3VS5A 3SQQA 5CAOA 5AM7A 5GJFA 2J4ZA 1YXUA 3OOMA 1XBCA 2VTHA 3F82A 4OUCA 3ZSHA 4XG3A 1WBTA 4S34A 5C01A 5ANIA 1ZAOA 4XV1A 4BBEA 4QP8A 4F09A 4K6ZA 1JKSA 3FPQA 4DTBA 4ACCA 2UW3A 3C9WA 1O9UA 3TUCA 3R7IA 2UZUE 3OT3A 5AP0A 2PU8A 3NYNA 5BVWA 3F3TA 4DBNA 2F4JA 4IM2A 2C3LA 3U51A 1XBAA 3RBWA 2CMWA 4EK4A 2XK8A 1YWRA 3CCNA 4O0TA 2BKZA 3MY0A 5CT0A 1MRUA 3P1AA 2YM5A 4PWNA 1UVRA 3G51A 1UU3A 3AD6A 2B9HA 4O0WA 3KRRA 1NVQA 4HCVA 4I24A 4NUSA 4LM5A 2XNEA 3FLWA 3FQSA 4X2GA 4TNBA 2BHEA 4ASEA 4KRDA 3RWPA 3K5UA 4EWQA 3LFEA 3F66A 1Y8YA 5EQYA 3ZC6A 4CLIA 4AP7A 4FNZA 2GFSA 3P08A 3NNWA 4F9YA 5AJQA 4IAYA 4RFZA 3PYYA 4YMJA 4WUNA 1FBNA 3LM0A 4G1WA 4JG7A 4QMTA 4YZNA 3LXPA 5AP6A 1OIRA 1UNGA 2R7BA 3MBLA 1RJBA 3FYKX 4K0YA 3O17A 3OHTA 3EH9A 3H9FA 4H1JA 4PPBA 3E3BX 2R3RA 2BRBA 5JQ8A 1SVEA 3AT4A 5K0KA 3ORNA 1P2AA 3R02A 4R3CA 4D2VA 4EZ5A 1OPKA 4RIYA 3VUTA 3TXOA 3CXWA 3A62A 5CWZA 3I81A 3KMUA 3LXNA 4DGOA 3MN3A 4AZWA 3HP5A 3R9HA 4Z16A 2ZJWA 3SVVA 4IACA 5JSMA 4O96A 4E26A 4D0WA 2GNJA 1Q62A 2Q0BA 3HECA 3DTWA 5E1SA 5IDPA 5IKWA 4IB1A 4E4MA 4IB3A 3W2PA 3NUAA 3Q9XA 3VAPA 4N6YA 3S00A 4PDPA 1OIQA 4AXAA 3LQ5A 1OGUA 4JDHA 5BQ0A 3FI8A 4NTSA 2R3MA 4GT3A 4ZSLA 5I5ZA 5CT7A 3UVRA 2VN9A 5JRQA 1F0QA 4G6LA 4MXYA 3SW4A 4FG7A 4UBAA 3RALA 4DEGA 2X8IA 3EFJA 3L9NA 4EUTA 3QZGA 1TKIA 4PY1A 3ORXA 4O82A 3O50A 3QTSA 4QMLA 3QCXA 4AAAA 2R2PA 4JRVA 3NNXA 2GPHA 4Y83A 3IO7A 4U45A 2YITA 5CAPA 2QD9A 2X6EA 2X39A 4R8QA 5TOZA 3V5PA 4C36A 4PV0A 4EH2A 4C2WA 3KXZA 3OF0A 4L42A 3UE4A 2QCSA 3ORZA 4RWKA 3KXMA 4IC8A 3BELA 4D5KA 1DM2A 5HORA 4QYYA 4FIIA 4RX5A 3DT1A 3BGZA 3GUBA 4O84A 4ANLA 4FSTA 5CEPA 3PVBA 1YWVA 4GT4A 4H39A 4UYAA 3V5WA 4RVLA 4BKZA 1NT2A 3A4PA 4TN6A 2H34A 4QMWA 4U5JA 4E5WA 5IMXA 4PQNA 3CTQA 2F57A 3L9LA 4DN5A 3IDPA 2XNMA 3OXIA 3WE8A 3BLHA 2VWWA 4F0IA 3FHRA 4EUUA 5IUHA 4E4LA 3IOKA 3BEAA 1OUKA 3EKNA 2ITWA 2WTKB 2VAGA 3LIJA 3OG7A 2X7FA 2OZOA 5AIKA 2C6MA 4A9TA 4BCKA 4X6QC 2UZOA 2OKRA 2W1CA 5AP5A 1FGIA 5HNGA 2IZRA 4XLVA 4GCJA 1Q61A 3F5XA 4AT3A 5HCXA 3I6UA 1YWNA 2XRUA 4C3PA 4WG4A 1U4DA 2VTQA 4UWYA 3NAXA 2NPQA 2YFXA 3OWKA 5HO6A 3W2SA 3AMAA 1OBGA 2BZHB 4JDJA 2LGCA 3AXWA 4OBPA 2C5XA 2NRYA 3EFWA 3R8LA 4IXPA 4M0ZA 2XKDA 5H2UA 4FEVA 4YZBA 4FSUA 4YP8A 3ZU7A 3P4KA 4FTQA 4BWXA 4FV6A 4EYJA 4HCTA 2GNHA 3GCVA 4WA9A 5T6KA 1OB3A 4TYGA 3ZRLA 4JLCA 4CV9A 3RK7A 3QQUA 1WVXA 5EHOA 5EKNA 3KRXA 4FT9A 3RNYA 2XH5A 3TKIA 3E93A 2WEVA 2YDJA 3ODYX 2YLEA 4IZAA 2CCIA 5IEYA 4C59A 4G5JA 4XG9A 4IAAA 2JBPA 3R7OA 5FBNC 3RAHA 4BDJA 3UOLA 5E8WA 4D55A 3DV3A 5FP6A 2YIXA 4DG2E 3TDWA 3EN5A 4IJPA 2BRGA 2I40A 3PA4A 4AW1A 3VS7A 2B9JA 2QG7A 3F3VA 5J87A 1IR3A 3HYHA 3FL5A 3M1SA 4BDFA 1A9UA 4CEGA 4EHGA 3HV6A 4LGGA 4BIDA 5AUUA 5M4CA 5D7AA 4DF3A 2X8DA 3EL7A 4J99A 3F3WA 3GOPA 3Q4TA 4FV8A 4YHTA 2E2BA 2XVDA 2YM3A 3W55A 3DTCA 3E88A 3GCUA 3AC8A 3VBVA 5KMOA 4RT7A 3C4FA 3VO3A 2GQSA 2UVYA 3C0IA 4OBOA 1P5EA 3DXPA 4H05A 5B2KA 4UB7A 5DI1A 4KINA 4BTJA 4QMYA 4KKGA 4HVDA 3C0HA 3K3IA 1YDTE 4D4RA 3FLSA 4FT0A 4YTIA 3RMFA 4BCFA 3FZSA 4HVHA 2BRNA 3EN9A 3I4BA 4BR3A 4D1SA 5KMIA 5IDNA 2DWBA 4RC3A 4XG6A 1CMKE 4YO6A 4A9RA 5CSVA 4DFUA 1XQZA 2W05A 1S9JA 3RP9A 4QMPA 4WIHA 5BMMA 5LQFA 1OPLA 4I5MA 4TT7A 3TZ7A 4X2FA 5FXRA 4AE6A 5J9LA 2RG5A 2XK3A 3DB6A 3P7CA 4RIXB 3AD5A 4FODA 4OLIA 5KZ0A 4USDA 3LCSA 3MB6A 4AOIA 2FGIA 3UOHA 4O0UA 5AV0A 5TKDA 3WI6A 4ZJIA 5TT7A 2VTSA 3TNPC 4C7TA 3G5DA 3ZYAA 3HP2A 4TPTA 2J0KA 3QD3A 4YR8A 5L6PA 4NFNA 4CCBA 3K54A 3D5WA 3PPJA 4X7QA 3ZUVA 4EC8A 4P5ZA 4ITIA 3L9PA 3GQIA 2CKOA 2XNOA 2BTSA 2QR8A 2XK7A 4FSYA 2QOKA 4DEDA 4IX4A 4UEUA 3RI1A 3TNQB 4PDYA 4L45A 2IO6A 5IG1A 3ENHA 3LFDA 5AP7A 3S95A 4GFGA 1YXXA 3MIAA 3DBEA 5JEBA 2YHVA 3VS6A 5EFQA 4D1ZA 1OMWA 3AGMA 1KV1A 2ZDUA 5IQAA 4DFBA 1Q3DA 2XYNA 4UMTA 3BYUA 3VC4A 3SG8A 3EQGA 4BRXA 2CGUA 3KK9A 4DGGA 2VWXA 3TUDA 4Z7HA 3HAVA 4XS2A 3DS6A 3HMPA 4HVGA 2CHLA 4QMVA 3Q4CA 4QTDA 3R22A 4YZMA 5LOHA 5EW3A 3SXRA 2GCDA 3BX5A 1ZYSA 4WSQA 4MXCA 2JAMA 3KVXA 5A46A 3UNKA 1H24A 3TJCA 4XG4A 2SRCA 2BFYA 3ORTA 5JFSA 1YRPA 5T3QA 4DEBA 4F7JA 4L7SA 3GC8A 5M51A 4Q2AA 4JBPA 4C33A 4U97A 3UQFA 4FVPA 1OPJA 4B4LA 4BWPA 2V7AA 2Y0AA 4KBAA 1WFCA 3E7VA 3HL7A 1V0PA 5IEXA 3KA0A 3DJ7A 3S1HA 2RFEA 3UZRA 1KE7A 3NUUA 3DDPA 3KC3A 4IVBA 2IW9A 2YWVA 2Z02A 4QMZA 3M11A 3F2RA 3PWDA 4DGNA 2WTCA 4JDIA 3COKA 3OW4A 2O65A 5AEPA 1FQ1B 1APME 3ITZA 2WHBA 2IW8A 2VTIA 3FLZA 3KXXA 5JFXA 2JDVA 2VO6A 3FHIA 1SVGA 1W0XC 3NGAA 4FKSA 4EYMA 3BHUA 2ERKA 5DBXA 3Q9ZA 3AC4A 3Q2MA 4GKIA 5HIBA 1FINA 5C8MA 4DH1A 3LHJA 4EOLA 5M53A 3IQ7A 5IA0A 1JVPP 4WNOA 5DT4A 3Q60A 4ZIMA 5CEQA 3QF9A 4DTKA 5A4LA 4R77A 2BRMA 4YLLA 3QRTA 3SOAA 1ZYDA 2I1MA 2PVRA 2PVMA 4FICA 2R3HA 5CEMA 4I41A 5FEEA 1BI8A 4S2ZA 4CFVA 3R8VA 4B6LA 3TT0A 4OTGA 4EOPA 5L2WA 2BIKB 3I6WA 3ORPA 3GBZA 3MJ2A 4XJ0A 2YCFA 3UIBA 4ERKA 2Z8CA 4ZLYA 5L6OA 2BZKB 2VU3A 4O0YA 3TV6A 4MWHA 4XX9A 3A8XA 4F9AA 3GCPA 4AOTA 1O6LA 4JR7A 3EQDA 2GQGA 4F6UA 4C38A 5CYIA 4CKJA 4UMPA 2B54A 3UTOA 2B7AA 3NUSA 1Q4LA 3BYOA 1ATPE 3U54A 4W4WA 1ERKA 3W8LA 4TYHB 5H8GA 5KKRC 3C1XA 4RC4A 2YDKA 3B2TA 5FEDA 3V01A 3FZRA 3T8OA 4WG3A 3F7ZA 3I5NA 3TACA 3WZUA 4C4IA 5LVNA 3HZTA 4YC6A 4ZSGA 4DEAA 2O63A 2XA4A 5E8UA 1LPUA 2YWPA 1ZOHA 2W9FB 3OWJA 4HNIA 4EH9A 3EQFA 2J0IA 4FIEA 4JT3A 4NU1A 2YIRA 2OG8A 3QCSA 4GU9A 4KS7A 4FNXA 3EN6A 3EQHA 4LL5A 4ZZNA 3H0YA 3ZDIA 3PZHA 4G34A 1XH7A 2HAKA 4U79A 5HNBA 4QTBA 2R3KA 5BYYA 1ZMVA 3OCGA 4BTKA 3F5PA 4EH7A 3QQLA 1DI9A 4W8EA 2YCRA 4HGLA 2PZRA 4DFYA 1A06A 2YEXA 3BE2A 4NWMA 4BYIA 2HELA 2HXLA 2ZMDA 3L8PA 4PF4A 4PL4A 2WTJA 4JG6A 4NFMA 3HDMA 5EG3A 4JOAA 1WBPA 5AR8A 3P86A 3H9RA 4GG5A 3SKCA 4DAWA 4O7SA 2P33A 5BVKA 3OC1A 2ITYA 1BLXA 1OL5A 1LP4A 2R3PA 2GMXA 3MH2A 4FSMA 4AN3A 2HXQA 4R7IA 2ITVA 2QR7A 3ID6C 2F49A 3DCVA 5AAFA 3FXZA 1K3AA 3P23A 3PA5A 3DXNA 3LQ8A 5HE0A 4AUAA 3RVGA 2X2KA 4I93A 2GHGA 2Y4IC 4EKKA 3ZONA 2QO7A 4FEXA 3ZFYA 3FQEA 3JY9A 4V0GB 5ANOA 3ZXTA 3CR0A 3NUXA 1PXOA 3OD6X 2R3LA 1TQIA 3R30A 4MNFA 4YLKA 5DGZA 3VS0A 4U6RA 4B7TA 5C1QB 4XRLA 3QAME 4OW8A 3KULB 2OFVA 2NO3A 3KCFA 2I0HA 2ZMCA 1Y6AA 1JPAA 3MH3A 4X3JA 1RDQE 4MBLA 2W9ZB 3MWUA 3GGFA 1EH4A 3COIA 5AR4A 3FKLA 2G1TA 4LL0A 2NRUA 1VEBA 2O64A 1OUYA 5AFVA 4FUYA 4P7EA 4BCIA 2YZLA 2J51A 4JVGA 3I0QA 1JKTA 3IONA 3QQJA 4E1ZA 3S2PA 2XKEA 1I44A 5FDPA 4YJNA 3E5AA 4M14A 4FEQA 2W1IA 3JYAA 3UO6A 4FGRA 3PLAE 4TXCA 3UJGA 1WBSA 2VWZA 5JH6A 2I7QA 3IDCA 1UNHA 3G9NA 3GNIB 4JG8A 4IJ9A 4FK6A 4AS0A 4FF8A 4U0IA 1H01A 1UA2A 3UMXA 4UZHA 5AX3A 5CF8A 1ZOEA 3U87A 3SD0A 1KWPA 1QL6A 2IVVA 4RC2A 3DAJA 4BGHA 3GVUA 3UC4A 3NIZA 2YABA 4BHZA 1ND4A 5GJDA 3QTRA 3PVWA 2PTKA 5KMKA 4RVTA 2CCHA 2W99B 4W4YA 4G16A 1IG1A 2W1DA 5CI6A 4IB5A 4DH3A 4M97A 5A4EA 1B39A 3OW3A 4E7WA 3UPXA 5DE2A 1ZMWA 2XMYA 4UALA 5TR6A 3ZHPC 3I5ZA 2B55A 3QZFA 2WMWA 3R6XA 5DFPA 4JIAA 3TV7A 3FUPA 3EJ1A 4O0XA 4AFEA 2XCKA 3ULIA 4H3QA 2WMRA 2WMSA 4PTGA 4ZSEA 2C6DA 1CSNA 2OO8X 2WMBA 4QO9A 1JOWB 1OKZA 4S31A 2WQOA 4EHEA 4V01A 2V22A 3KXHA 2QI8A 2X0GA 3E8CA 3QLGA 4IADA 4M8TA 3V8TA 1QCFA 3ZO3A 3T3UA 4LRMA 1CKIA 4NW5A 4BL1A 4ENXA 2PMIA 4RMZA 5KKRB 1HCKA 3HMNA 4RJ6A 5DR9A 2P55A 2VTNA 5HOAA 2CNVA 4C4FA 4FZ6A 1Q8TA 5ETFA 5AV2A 2OIQA 2F2UA 5FM3A 3D7TB 2HYYA 4IZ5A 2QHMA 3A7FA 4NM3A 4F0FA 5C9CA 4AT4A 2WFYA 4UMRA 5IQGA 3PJ3A 3ORIA 3PPZA 4GEOA 4ZLZA 5JGAA 5K0XA 4BI1A 3EWHA 4ALVA 2RKUA 4K9YA 3C0GA 5HIEA 3W33A 2XBJA 4I1ZA 5BYLA 2CKEA 4Z9LA 2DYLA 1GZKA 2QOOA 2ZAZA 4QNAA 4ZY6A 1QMZA 1W82A 2QONA 2W4JA 2Z2WA 4XMOA 4YBJA 2CLQA 3DOGA 4QP3A 3ZM9A 4LRJA 3DAEA 3EFKA 3R9NA 3WE4A 4NK9A 3R7EA 3TZ9A 3DQWA 2XCHA 4L43A 3DJ5A 1O6YA 1OL1A 4GSBA 4AU8A 3FE3A 4KSQA 1FVTA 3MH0A 3MA6A 5FDXA 1PXKA 3U9NA 4C61A 1KSWA 4AGCA 2GNGA 4O86A 2A1AB 5EK7A 4L53A 1FVVA 3MA3A 5J7HA 2R3GA 4ASDA 3IW6A 3L9MA 4MTAA 5JFVA 3DFCB 4NM0A 5CLPA 3BQRA 3Q5IA 2Y4IB 5BVNA 1PMUA 5HX8A 2C5NA 3ZC5A 2B0QA 2J5FA 3OS3A 4RIXA 3OWLA 5IA1A 5HHWA 5E8VA 4QTAA 2QURA 4KA3A 4XP2A 5JN2A 3REPA 3UOKA 2XJ0A 3RPVA 4O1PA 4NM5A 4RA5A 5DEYA 4D4VA 1OI9A 2NP8A 2C6KA 4N70A 5CANA 3CSVA 1J7LA 3BZ3A 2PK9A 4J53A 1F3MC 2PZ5A 4DCAA 3CPCA 3QKKA 4LOPA 4MX9A 4QMUA 4V04A 3IK3A 1UKIA 4XYFA 3QC9A 4HNFA 1XH8A 4JS8A 5CU3A 4ZTMA 2XZSA 4KRCA 3ZTXA 5E91A 4CKRA 2J5EA 4WNMA 2J0MB 2XIZA 4LYNA 3SRVB 1OKYA 4YJQA 2F7ZE 2OZAA 4J8MA 4BKJA 3QX4A 4ZTRA 4A9YA 2X9FA 1STCE 4L67A 4FE2A 1KE5A 3C50A 5CEKA 5AUYA 2DUVA 4C3FA 3PJCA 4OTIA 2HCKA 5D11A 3A60A 5EYKA 4C57A 3N4TA 4WHZA 3WBLA 4D5HA 1JKLA 1K2PA 4LOOA 4EZ7A 2F7EE 5IEVA 3KN5A 4F1MA 2VNYA 2JDSA 3IECA 4GW8A 4RBLA 2VWBA 4DEIA 1P4FA 4CTBA 3H0ZA 3DAKA 4E6CA 2PYWA 3UIUA 3ERKA 3MYGA 3TTIA 5G1XA 3PA3A 3SXSA 4FK3A 4MHAA 4LMUA 2JC6A 3UIXA 3V5QA 4QNYA 4TNDA 4HYUA 3A7JA 2RSVA 4RJ3A 5HG5A 4I4EA 4FIHA 4I5HA 3FMEA 4KABA 4C8BA 4XP0A 4GYGA 3R8PA 5AIRA 3PXFA 3W10A 2YM6A 3E92A 1GZOA 3DQXA 3P0MA 1JSVA 3VRYA 4BGGA 3R1NA 3CY3A 1U54B 3DDQA 2WTVA 2RG6A 4RQKA 2OXXA 5L2QA 2HY0A 5EOLA 4I6FA 4NSTA 2WQNA 3OTVA 3EQPA 4RLLA 1YI4A 2XYUA 2GFCA 4F7SA 3MVJA 4IEBA 1H00A 3IKAA 1GZ8A 3E8NA 2VUWA 3TKUA 2OIBA 4G3CA 3TNIA 1R3CA 2HWPA 3G6GA 3BI6A 3SC1A 4I92A 4FTLA 2HENA 4DFXE 2WTKC 1H26A 4DC2A 2CGVA 1Q3WA 1W7HA 2XB7A 4HCUA 4JBQA 4PNIA 1Q41A 1WVWA 1ZZLA 4IBMA 3KEXA 4YC3A 5ANEA 1GIJA 3UYTA 3ZLYA 2WKMA 3ZCLA 4WRGA 4FIJA 3NCGA 3VS3A 2C1BA 1SM2A 5AP4A 3IW4A 4F6WA 2PULA 1PMEA 3C4EA 4Q5EA 3LZBA 3VUIA 3D15A 3OCSA 2VWUA 4OAVB 5CSHA 2VO7A 4EORA 3DXQA 1FOTA 1YXVA 2FSMX 3QWKA 5HO7A 5ICPA 2XRWA 3V8SA 2P3GX 5BMSA 2EXMA 4AA5A 4EH5A 4YO4A 4D9UA 3QD0A 3SLSA 5LWNA 2Y7JA 3VJNA 2C6LA 2BTRA 3L1SA 4TYHA 3RGFA 3TDVA 2OH4A 5AV3A 1KE8A 4I0RA 2FSLX 2WMVA 4O7LA 4Y5QA 3QTUA 4JQ8A 5GJGA 5H8EA 4LOQA 4CFWA 5EW9A 5A4TA 4GKHA 1UWJA 2C30A 2Y6MA 5JGBA 3OTUA 4EKLA 5CSWA 2VZ6A 2PUIA 2VWYA 3I7BA 4HPUE 3F3UA 1YHSA 2WQEA 3ENMA 3I79A 2XM8A 2FB8A 4FSQA 4K77A 3POOA 2BDJA 2QOLA 1ZYCA 5CX9A 5JQ5A 4ORKA 2W1EA 3UG2A 4D2WA 3GP0A 3LKMA 4IHPA 4QOXA 2BALA 2VWIA 1H1RA 4GU6A 3G0EA 3FI3A 5ITAA 4GJ2A 2ZOQA 4RSSA 5IQHA 2GHMA 4FR4A 1PKDA 4YTHA 2JDRA 4GH2A 4F0GA 3V8WA 1ZY5A 4JI9A 4CFNA 4Y72A 4WKQA 4ANOA 3QYWA 4TW9A 4AZVA 4Z55A 3LCKA 5C03A 2E9VA 3ZO1A 5C26A 3FKNA 4NZWB 1H07A 3PSDA 2YCQA 4JIKA 3UOJA 4BY9E 4N6ZA 4PX6A 4YPSA 3WOWA 4ANBA 2OFUA 2YLFA 4S30A 1G3NA 4UX9A 2X9EA 3CD3A 2VTJA 3R2YA 1H28A 2EXEA 3GU6A 1J1CA 2O3PA 5DIAA 3VVHA 4QTEA 3NR9A 2CKQA 5IQEA 5IQFA 3QTQA 4V0GA 2PHKA 5AM6A 5GZ9A 5KX8A 4PDOA 3SA0A 1Q8YA 2E9PA 1KE9A 3O71A 1YOJA 3QFVA 5IUIA 4ACDA 3FEGA 3KULA 1YW2A 3CIKA 1ZYLA 5KMNA 1VYWA 2C5VA 5CSPA 2OXDA 4JJRA 1KE6A 2WTDA 4GMYA 4LG4A 3NUPA 4KKEA 1Q8WA 1PYXA 3BPRA 4O2PA 4R3RA 4AFJA 5FQDC 4LGHA 3R8MA 3VF8A 4FOBA 4QP1A 5DHJA 3RCDA 3PRFA 4RX9A 4XH6A 4OTQA 2WIHA 2W5HA 5A9UA 4C62A 2ZM3A 1BKXA 4UXQA 3LFCA 3O8PA 3MSSA 2R3QA 5K5XA 1ZLTA 4EH4A 1B38A 1RE8A 2G15A 4C34A 5BX0A 4YUQA 2PMNX 2Y4PA 4IH8A 5ANKA 4L46A 3MTLA 3UNZA 1IA8A 3TIZA 3QQHA 5DH3A 5HE3A 1YHWA 3UVQA 4I0TA 3TEIA 4FSRA 3R00A 3MFSA 1PXNA 2BCJA 3ACJA 5CU6A 1VZOA 4FG9A 5E1EA 4FV0A 3Q4UA 1L3RE 3ALOA 3PJ1A 1Q8ZA 1SMHA 3U8WA 5CVFA 2R3FA 1H4LA 5IH5A 2VGPA 1U5QA 4O81A 2CJMA 2B52A 3E63A 5CY3A 4USFA 3HV3A 5HD4A 5HQ0A 5I9WA 2C0OA 3FMLA 1YOLA 4QP4A 3TIYA 3EKKA 2E9NA 2A27A 2G2HA 5BVFA 5LVLA 4AW2A 4CMOA 2YM4A 4EH8A 1FMKA 4DTAA 3W2RA 3PVGA 5D9HA 2OJGA 4BCJA 3ET7A 5I0BA 2JIIA 4IM3A 3MB7A 4FKJA 4IVCA 1PKGA 4ANMA 3BHVA 4AT5A 2YACA 4MD9E 4NJ3A 4R78A 5AA9A 1H8FA 4Y73A 4OTDA 4BTMA 5A6OA 4V05A 3HRBA 4XBRA 5H9BA 1DI8A 4O7VA 4Z3VA 3F61A 3PIXA 2H6DA 4GK2A 4CD0A 4OBQA 3RTPA 3DBDA 2UW0A 5KMLA 2R64A 2J6MA 4DHFA 1PXMA 4Y8DA 4BCNA 3VUKA 1GAGA 2WIPA 2GU8A 2ETRA 5G6VA 3NRMA 2C4GA 4TL0A 3RM7A 2VV9A 5BVOA 3RNIA 3D7ZA 4ZK5A 2W17A 3RJCA 3R01A 3HV7A 3RZFA 4G5PA 5ACKA 5CU0A 5KZIA 2FVDA 4P4CA 4DINA 5E4HA 2HZ0A 4JAIA 5ANGA 3UQCA 2XIYA 3PE2A 3QRKA 3ZOSA 5A14A 3EIDA 3UQGA 4CVAA 4WOVA 4E6QA 4BCHA 4QT1A 5CAVA 2UZBA 5AMNA 4ZSAA 2GTMA 3PUPA 2RF9A 3BYSA 4J1RA 4KBCA 5E8TA 2YA9A 4E6AA 3CTJA 4CQGA 5IU2A 4A7CA 2OWBA 3FZ1A 3FI2A 5CTPA 4AN2A 3CD8A 1WAKA 2BR1A 4JAJA 4AGUA 3VRZA 3S0OA 3VJOA 5DRBA 2JEDA 2JGZA 3EMGA 3C4ZA 5T68A 4PMMA 4MH7A 3WYXA 4XUFA 1GIIA 4JQ7A 2RFSA 3HLLA 4FTMA 4RJ4A 5HU3A 4AWIA 3JR1A 4E4XA 3O7LB 1WCCA 4ERWA 5HO8A 4LGDA 4RJ5A 3QYZA 2WMTA 5GZAA 2X6DA 5E9EA 1PJKA 4D2SA 3RK5A 5IQCA 3Q4ZA 3FMMA 2UW5A 3NUYA 4PMTA 3G6HA 4RWLA 4RGJA 3AOXA 1KUTA 5C4LA 1FGKA 3LPBA 1YDSE 4H3PA 4I4FA 4JR3A 4E73A 2OK1A 3OVVA 4QP6A 5FEQA 2XNGA 1OIUA 5ETIA 2O0UA 4L8MA 2XUUA 3GFEA 4X0MA 2QVSE 4I21A 2QOCA 5DOSA 5DRDA 1NY3A 5HBEA 5IZFA 3D14A 4CZYB 3EZVA 3QRIA 5F20A 4EJNA 4PP7A 1PW2A 3F6XA 5F95A 4BZDA 4GS6A 3QUEA 3SXFA 2EXCX 4FV1A 2VX0A 3PY0A 3QRJA 3EN4A 4I5CA 3PXRA 3SRVA 4Z7GA 4CLJA 2PWLA 4BDBA 3NCZA 3LLTA 3R2BA 5LVOA 5EYDA 3BBWA 3QA8A 3F7WA 3K2LA 3QTZA 3FYJX 3TV4A 2BKKA 3CY2A 2GNFA 3MPMA 4B99A 3O51A 4BGQA 4FKPA 3MFUA 2UZEA 5I9ZA 2C3KA 5L4QA 3HUBA 3BGQA 4PPAA 4NTTA 4E20A 1IAHA 4GV1A 4DCEA 4FKGA 4M13A 5CASA 1AQ1A 3E7OA 4EOQA 5HX6A 5HICA 3ZLWA 3EB0A 5AV1A 2BAJA 5E8YA 4NJDA 2R7IA 3FPMA 3Q04A 3LVPA 4GUEA 5D12A 3MVHA 4CZTA 4EHZA 2HWOA 2XIKA 3E8DA 4IX5A 3R7GA 3VIDA 2PZPA 4BCGA 1UKHA 5CQUA 3BE9A 2PE0A 1SNUA 3PLSA 3FZTA 4CSVA 2YISA 2B53A 4HVIA 1H1SA 5AR3A 5JFWA 3QU0A 4I20A 4ZAUA 2WELA 4MNEB 1WBOA 5BUIA 2W1HA 4YHJA 3RAKA 3W8QA 4MBIA 4O0SA 4C58A 4WNKA 3GCSA 4FEUA 3P5KA 3G15A 5C8NA 5CAQA 1YVJA 3PTGA 2UW7A 1LR4A 4KNBA 2VGOA 1PXPA 2EVAA 4MXXA 5JT2A 5L8KA 1G8SA 3WF6A 3FZOA 3KKVA 1FPUA 3BKBA 3F2NA 3CQEA 5KUPA 3MPAA 3LJ2A 2DS1A 4L3JA 2VO3A 5CQWA 4FKRA 4XOYA 1KV2A 2JFLA 4IWQA 4DGMA 4PNKA 4X3FB 3CS9A 3CE3A 3CGOA 3LMGA 4M67A 4XCUA 4NL0A 3MH1A 4FNWA 2ZVAA 4IFGA 4KIKB 4RJ7A 3MV5A 4KIPA 4NEUA 4RG0A 5CVHA 4XG2A 3VF9A 3O8UA 1ZMUA 1E1XA 4M7IA 4O27B 5CI7A 5LMBA 3AGLA 4ONAA 5BPYA 4B8LA 5FXQA 1OKVA 4O7YA 5HU9A 3FMNA 1Y6BA 2QLQA 3NLBA 3E62A 4AW0A 4L01A 4E5BA 3TNHA 3IW7A 4O0RA 3R7YA 4ZSJA 2RIOA 4B0GA 4YURA 3QKMA 4WSYA 2VX3A 2BILB 4JX3A 3AMBA 4TKSA 3R7UA 3CBLA 3GI3A 4IWPA 4MQ2A 2PMOX 5JMSA 4MQ1A 2FSOX 4QD6A 1X8BA 4G3DA 1F5QA 2YJRA 3KMMA 4J8NA 4QQ5A 4WO5A 4HPTE 4TYJA 3COMA 4PMPA 3C5UA 5HVKA 5I9YA 3QQKA 2WQBA 4FTIA 3GB2A 4UY9A 3R9DA 4ARKA 1MQ4A 3OEZA 4TYIA 4WT6A 5HG9A 1JBPE 1XH5A 3WF9A 5AR2A 2X81A 4I22A 5CSXA 4RWIA 5E8XA 4QYGA 4ACGA 4QYFA 5J79A 4BIEA 4U8ZA 3LMHA 4I5PA 1YOMA 2IWIA 3GC9A 4FT3A 4W4XA 3UBDA 3PVUA 1IASA 4EQMA 4AZEA 2PE1A 4IVAA 3IDBA 2A19B 4NCTA 3VW8A 4BZOA 2XIXA 4YJVA 2WMQA 4D0XA 3GEQA 3FV8A 4ZTSA 3DK7A 3KCKA 4CYIA 2YERA 2J7TA 1ZXEA 3A99A 4FTAA 3BV2A 5A4CA 5EI2A 4LFIA 2CDZA 4L7FA 2PMLX 4TZRA 2C5YA 3CP9A 3OFMA 1OITA 4S33A 3C13A 3QRUA 3F5UA 5J5TA 3M2WA 4MD8E 4XG7A 1G8AA 4FTRA 1L8TA 2OICA 1JQHA 1V1KA 2B1PA 4UYNA 5M06A 3KGAA 2V55A 3TZ8A 1ZZ2A 4U43A 5IH6A 2VNWA 4YJTA 4AZFA 4GIHA 3HV5A 4IVDA 4BDDA 2W5BA 3PZEA 3V5JA 3W2OA 2C69A 3ZM4A 2E9UA 5EH0A 2WGJA 5F9EA 5LVPA 5H8BA 3DKGA 4KWPA 4HGTA 2YCSA 5FRIA 3VHKA 4QMNA 2A4LA 4Y5HA 2P4IA 4QMOA 2ITOA 4G31A 1H1PA 4MBJA 2HW7A 1ZYJA 1REJA 3IGGA 5L6WL 2I0VA 3UPZA 2H8HA 2UUEA 1CKPA 4BDKA 3MGYA 4RIYB 2OI4X 4IX6A 4FKUA 3R7VA 2H96A 4I94A 4LUEA 4PP9A 3RINA 2XK6A 3R1YA 4BTFA 4AN9A 4XHKB 3UIMA 3PXYA 2XIRA 3PIZA 4XRJA 5K9IA 4ANSA 5DNRA 2JKOA 5IF1A 3RCJA 3KY2A 3LFSA 4FT7A 3BHYA 1J1BA 3AC5A 3L8SA 5TF9A 5AUWA 2JD5A 1J3HA 2QNJA 1OL2A 2OJIA 3GQLA 1FMOE 3KU2A 2QQ7A 3HMMA 3D2KA 3K3JA 4O7TA 4J71A 3ZMMA 3E64A 4FL2A 2GNLA 3HRFA 3EQBA 3I1AA 3F88A 3KL8A 3VNTA 5CAUA 3QGWA 1XWSA 3NS9A 4ZY5A 2AC3A 1MRYA 3LOKA 3LXKA 3UZPA 2JAVA 2B9IA 4YJRA 4O7ZA 2YAAA 3SV0A 3Q52A 3GCQA 2YIYA 4PTEA 3LCTA 5D7VA 1R1WA 2HK5A 2O2UA 2DQ7X 4D2PA 4C4GA 3CKXA 2B9FA 5M44A 4MK0A 5KBRA 3DJ6A 4G2FA 1XH4A 1YXSA 5ANJA 1J7UA 4U42A 5CEOA 3OBJA 4ALUA 2FUMA 2BRHA 3UGCA 2ITUA 2BFXA 4QMXA 3AG9A 3Q9WA 4UZDA 5CXHA 4YSMA 1W98A 1URCA 3SW7A 2XF0A 4NIFB 4F1TA 3FL4A 3MS9A 3QTWA 2WTIA 5FM2A 4C3RA 3HUCA 4JQEA 4KSPA 4X2NA 3RZBA 4FIGA 2QOBA 2UZLA 5FTOA 5HE2A 4CXAA 5IPJA 3PDTA 4G3GA 4BC6A 2X4FA 4EHVA 3PG1A 4BBFA 4CFUA 4G17A 1M52A 4G6OA 2VTPA 4F08A 1M2PA 5IA3A 3EHAA 3KVWA 4ANQA 3R73A 1UNLA 3DZQA 2XBAA 2GSFA 3O7LD 3QUDA 2WD1A 2VTTA 1RW8A 5K4JA 4EJ7A 3WZKA 2O8YA 3UP2A 1XH9A 5HIDA 4FTOA 4FKTA 3SX9A 3ZFMA 4C0TA 3T3VA 3WZDA 2Y9QA 4BKYA 4L6QA 2A0CX 3U6JA 5CNOA 4ZZMA 4ZTQA 3PSBA 5JKGA 5LJJA 3OY3A 2X4ZA 4DGLC 4M12A 4R3PA 1Q24A 2EU9A 2QOHA 4ENYA 4TWPA 2PVLA 3NW6A 4QP9A 3PSCA 2YZAA 4IC7A 4W4VA 4BDCA 4W8DA 3SOCA 3B8QA 4PMSA 3TTJA 4RZWA 4NYEA 4WBOA 1NXKA 2QHNA 3FAAA 2I0EA 3QC4A 3MIYA 3KRJA 4KIQA 2YM8A 5BUJA 5KMJA 4GG7A 5M57A 4F6SA 1YI3A 2GDOA 3DLZA 3R71A 2Z7LA 3V3VA 1XR1A 5I3RA 3N4UA 4B8MA 1U59A 3FJQE 5FUTA 5GINE 4KAOA 1R78A 3W2QA 4FVQA 4RIWB 4R1YA 3QA0A 2G2FA 4YC8A 4LQMA 1SYKA 4L52A 1WBWA 3VS4A 2WU6A 1Z5MA 2ZM1A 1W8CA 3KQ7A 5AUVA 4BN1A 5JK3A 4QP2A 5EDPA 4F64A 4OTRA 4NCTC 5IMEA 4R7BA 1OZ1A 1H1WA 2OW3A 3H10A 3QCQA 5HKMA 5BUEA 4RIOA 5EDRA 4D1XA 4IAFA 5CXZA 4U44A 4OAUC 3PWYA 5J7BA 4NW6A 5FWKK 4FKOA 3I60A 5HVYA 4F7NA 3BEGA 3DB8A 4PUZA 1TQPA 3AD4A 3S3IA 3C5IA 4J96A 3JVSA 5GNKA 1JAMA 5J95A 4CZUA 1T46A 5EOBA 2HY81 4ITHA 3ORMA 3CPBA 2G2IA 1PF8A 2Q83A 3HNGA 2JITA 1LUFA 2R3OA 4IZYA 2ITPA 5AUTA 3OXZA 4IE9A 1WMKA 3BIZA 3H4JA 5FTGA 2HZ4A 2VTMA 3FI4A 4S32A 1E9HA 2HZIA 5B2LA 3G9LX 4MVFA 4RVMA 1Y57A 1H08A 2PVFA 3B2WA 3N51A 4IWDA 4LRKA 5FG8A 4AG8A 4O22A 5E8ZA 5CEIA 2Z7RA 4O2ZA 2O5KA 4DH5A 2CPKE 2JDTA 4AZSA 3TNWA 4EOIA 4HYSA 5LARA 4OR5A 3EYGA 4JL9A 5GIOE 4GL9A 2BIYA 4XOZA 3RAWA 4AX8A 3D5UA 3ORLA 3AQVA 3ZSGA 3QX2A 4MNEA 2WAJA 3RWQA 5KMMA 2OLCA 3PP0A 1W84A 4H36A 2QG5A 2W1ZA 3BLQA 1QPDA 3OXTA 4ZTLA 3LCDA 1BYGA 4RVKA 3UO4A 4F9CA 1BMKA 4USEA 3ZZWA 3AT3A 4XEYA 4AGDA 5D41A 4HOKA 1H1QA 3D83A 3V04A 3KMWA 3HRCA 4H58A 4YGAA 3WF8A 1IAJA 3FQHA 2ETKA 4FKQA 2Z7SA 3QD4A 4N0SA 4YNOA 4BHNA 4E5AX 4X3FA 2W0JA 3AC2A 4FTJA 3TCPA 5EHYA 5HE1A 2BDFA 4KIKA 3TZMA 3JY0A 5HG8A 5A54A 1IRKA 2ONLA 5IA5A 4BICA 4PRJA 3TI1A 3LCOA 2I6LA 3NYOA 3RPOA 5HCZA 4MF1A 5BYZA 4FZFB 4L3LA 3OT8A 3MPTA 4BCPA 3AC1A 2GS7A 2AYPA 3HV4A 3PJ2A 3BYVA 4G9CA 5F94A 5J1WA 5K4IA 3NIEA 4FSZA 5AX9A 2V5QA 1MQBA 4ZJVA 1UU8A 2BDWA 4CG8A 4TWNA 1M2QA 5D1JA 2X7GA 2VTOA 2R3IA 5HEZA 4W9XA 4LV8A 3P9JA 4AOJA 3BHTA 4MXZA 1YHVA 5AUXA 4DE4A 4D4YA 2RL5A 4FV2A 4DFLA 4F7LA 4WBBB 3RAIA 3ZLXA 3VWAA 5J1VA 2UZWE 1VYZA 4XP3A 2PUPA 3FC2A 3NDMA 2R4BA 3ORKA 4CTCA 2Z7QA 3GC7A 2C0TA 3U6IA 1IEPA 3II5A 2X2LA 1OL6A 3O23A 4KUJA 1J7IA 3A8WA 2QU5A 4U81A 5EDQA 4WNPA 3FBVA 5HTCA 5IA4A 4U80A 2WOTA 4YJPA 4P2KA 4A07A 3DZOA 5HNIX 2PZIA 4ZS4A 1O6KA 3BCEA 2QOQA 2G9XA 3QWJA 5JZNA 4H1MA 5AWMA 4GUBA 5LVMA 3BRBA 3E87A 1OL7A 3KFAA 4AGWA 2ZV9A 4UWBA 3D94A 4G3FA 4EK5A 3P7AA 2C5OA 4EK8A 1XJDA 4RX7A 3NVKI 3DU8A 2EB2A 5AR7A 5ETAA 1M2RA 3I7CA 4FTUA 2OSCA 4YSJA 3HMOA 2LAVA 2JLDA 4CT1A 4NT4A 4O7WA 3BBTB 3LFFA 4FTKA 3R1SA 2OJJA 3CKWA 5K5NA 3C4WA 2OJFE 2QC6A 4GFMA 4QTCA 5CF4A 4FUXA 3L8VA 4K2RA 4BDIA 4QPMA 5J5SA 2PVYA 5L2IA 4QMSA 3QZHA 4BB4A 1XH6A 4I6QA 3VQUA 3RPRA 2CLXA 2YN8A 3PXKA 4O21A 3GT8A 2WO6A 2R9SA 1REKA 5KNJA 4UXLA 4EOSA 4OGRA 1BI7A 3HA6A 4II5A 1H27A 4QMMA 4CG9A 1M17A 3OUNB 3HEGA 3ACKA 3QQFA 5M55A 4F65A 1E1VA 3H9OA 5M08A 2QLUA 4R6VA 5FTQA 1V0BA 3GFWA 4HYHA 4YJOA 4I6HA 2W06A 4EOJA 3GU8A 3R1QA 1S9IA 3DGKA 3NPCA 4A06A 1NVSA 2WXVA 4ACMA 3OP5A 3SHEA 4D2RA 4BIBA 2YIQA 3EL8A 2R3NA 3GU5A 4FOCA 5CF6A 3BWFA 4F70A 5CENA 1GJOA 4OTWA 3BQCA 4IDVA 3HKOA 3IPHA 3IW8A 1PXIA 2AC5A 3AT2A 3EZRA 3D5VA 3PXQA 3IGOA 3P7BA 4FL3A 4FMQA 1ZRZA 4I3ZA 4LV5A 3O96A 5A6NA 3W16A 2UW4A 2ZB0A 3Q96A 4MEDA 5E8SA 2Z60A 4F4PA 3FXXA 4CKIA 5IISA 3LJ1A 2XJ2A 1PHKA 2PZYA 2WPAA 2WZJA 1H0WA 4FI1A 3RKBA 2H9VA 4K33A 1OKWA 5FGKA 1CKJA 3A2CA 3WARA 1KOBA 3PG3A 1V0OA 4DFNA 3N9XA 3LJ0A 4QQJA 2IN6A 1Q8UA 3ALNA 3HDNA 4PL5A 4WG5A 4E3CA 1ZARA 5HGIA 5FXSA 4C35A 3ZSIA 4JBVA 3QBNA 4AACA 4FKIA 3NWWA 3QD2B 2R0UA 3O8TA 4RFMA 3CQWA 4ZS0A 2IVTA 2J9MA 4L00A 1GY3A 1NW1A 5C4KA 1M7QA 2Y8OA 2P2HA 4ZLOA 4FKVA 3VUMA 3FY0A 3GOKA 3U55A 1VJYA 4YJSA 3SGCA 4U40A 2UZDA 5AV4A 3R83A 4QQTA 3FMJA 1JLUE 3MVLA 4NIFA 2QOIA 5H3QA 3VBQA 4CV8A 5LCJA 4XV9A 2C1AA 5EYCA 4M0YA 5KE0A 3PJ8A 4O7NA 4BBMA 3MY5A 4XNEA 2CNQA 4X3FC 4YZ9A 3CQUA 2ZDTA 5E92A 4BI0A 5ETCA 4EL9A 2X8EA 4YPDA 2ONLC 4MD7E 4WD5A 2XM9A 4P90A 1JSUA 4QYEA 4AA4A 2OXYA 2ZV8A 1WVYA 2HW6A 1I09A 1QPJA 1DAWA 3D7TA 2GTNA 5EYMA 3D9VA 2CNUA 1J91A 4IIRA 5IQBA 4FTTA 3P78A 2RFDA 4ZP5A 5DT0A 2ITXA 4FSWA 3UP7A 3ROYA 2Q0NA 4R5YA 3RPYA 2KTYA 4CMUA 3ZBFA 4JRNA 4FZAB 3H3CA 3HX4A 4GVJA 2CKPA 4HJOA 3O0GA 1LEZA 4EQCA 2JKKA 3MFRA 3UNJA 5HTIA 3Q5ZA 4FKWA 5LWMA 2JIUA 3A61A 4RJ8A 4GK4A 2C6TA 2PVHA 4WUAA 2UV2A 3OCBA 4RX8A 2VO0A 3OMVA 2BAQA 3QL8A 4K18A 4ZY4A 1QPCA 4PDSA 5ACBC 3JUHA 4MKCA 3R8UA 2C6IA 1H0VA 1VR2A 1G5SA 3ANQA 4M68A 1Y91A 1PXLA 4CYJA 4CNHA 3UODA 4RLKA 3SAYA 3ELJA 3PE1A 4FNYA 4O0VA 4RIWA 3IW5A 5TO8A 4DLJA 1PXJA 3QHWA 3TJDA 3W18A 4DEHA 5L3AA 1OIYA 2PUUA 4X6RA 2W1FA 4R5SA 5J8IA 2IZSA 4BCQA 4HYIA 2X1NA 5HTBA 4CFMA 3R9RA 3TL8A 2OGVA 4FV4A 5DVRA 4MYGA 3KRWA 1PY5A 1YKRA 4XG8A 3UC3A 1XHAA 4X2JA 4CT2A 1CM8A 5DR2A 3EQRA 4APPA 4EEVA 4TWCA 4YTCA 4IANA 2GHLA 4BCOA 4BI2A 1R0PA 2ESMA 4GFOA 4M69B 3ZBXA 2IPXA 5EQPA 1RQQA 2FSTX 2OBJA 3GU7A 1MRVA 4CMTA 1BUHA 2PUNA 2BPMA 2XEZA 2ITNA 3DY7A 1YXTA 4IWOA 4J95A 3WF7A 5M07A 3ETAA 3FKOA 2OH0E 3KK8A 1AGWA 4YBKA 1HOWA 5AP3A 3G0FA 4DFZE 4E6DA 3UDBA 2JKMA 3FLQA 3DPKA 3COHA 3RK9A 1HCLA 1YDRE 4IAKA 2ACXA 3AC3A 3U6HA 1SZMA 2RGPA 3KB7A 4QRCA 2XK9A 4FG8A 4L9IA 5IA2A 5FD2A 5HCYA 5AA8A 4GRBA 4FGBA 2VTAA 1P4OA 3OEFX 4FV9A 4TRLA 3WF5A 2QKRA 3ZZEA 1Q99A 2IJMA 2P2IA 4YNEA 4TWOA 4EOMA 4KB8A 5GZ8A 5HLPA 4UN0C 5HBJA 4K8AA 4ZJJA 1DAYA 3UO5A 2JKQA 4RRVA 2Y6OA 3KXNA 1UU7A 3NNUA 4LMNA 5B7VA 3IOPA 4BWKA 3OWPA 2QU6A 3QALE 4KKHA 4ANNA 4F63A 4XBUA 3CC6A 1BL7A 5LCKA 4ZMFA 1URWA 4XV2A 3EOCA 4YZCA 3ZEPA 2YIWA 5GIPE 3A7HA 1M14A 4ZTNA 5IUGA 2HZNA 3HGKA 4FIFA 2F9GA 3LQ3A 4JXFA 3VBXA 2OZAB 3QQGA 4E8AA 2C3IB 2IZTA 3WIGA 4HVSA 3QXOA 3TUBA 3L8XA 4IAIA 4D28A 4BYJA 4IX3A 5M56A 1OBDA 5CZHA 4BDEA 3NZ0A 3OUKA 4HW7A 3ZO4A 1U54A 4CCUA 5B2MA 2R3JA 2UW8A 5EHLA 3MTFA 3VW6A 5J9YA 1W83A 4C4EA 2E9OA 2WMAA 4QPAA 4FVRA 4M84A 4BVUA 1PMNA 3TN8A 3JVRA 3SG9A 3QKLA 4C37A 4OTFA 4YHFA 3V6SA 5KO1A 2PE2A 3ROCA 5LMAA 2GNIA 3RPSA 3PPKA 2W4OA 1GZNA 2IVUA 3V51A 4O6EA 2WOUA 2BROA 2R0IA 2UVZA 3WIKA 3NNVA 4FBXA 3W1FA 1T45A 2XEYA 5CU4A 5HZNA 2FA2A 4U3ZA 3BWJA 1BX6A 4EI4A 3ATSA 3TM0A 5FLFA 1OECA 1Z57A 1B6CB 1WBNA 2VD5A 2WU7A 2XJ1A 4TYEA 4IFCA 2QKWB 4IAZA 4R1VA 2WQMA 4AQCA 1XBBA 4CQEA 4YZDA 3O2MA 4B9DA 3KXGA 4UWCA 5AUZA 2ITQA 3DBCA 4C4JA 3FMKA 1GIHA 1GOLA 1K9AA 4FTNA 2YJSA 3PXZA 4FTCA 2PVKA 3B8RA 5DEWA 4DEEA 4QP7A 1TQMA 5I9UA 3DA6A 3NYVA 5BNJA 4JBOA 4E4NA 3BGPA 5DN3A 3DKFA 1H25A 1IA9A 3PY3A 3ZRMA 5LXMA 3P79A 5M4IA 5KHWA 2FH9A 4I0SA 4TTHB 2F7XE 2NNWB 4MCVA 2C6EA 3GU4A 2WTWA 4HZRA 5I3OA 1PMVA 4DG3E 4MWIA 4BDHA 4EOKA 3LE6A 5HESA 3PY1A 3A7IA 3KRLA 4U7ZA 3WILA 4EBVA 3KN6A 3W2CA 4DH7A 5L8LA 4RFYA 3U4WA 4DT9A 1TVOA 4BF2A 2JDOA 3POZA 1FVRA 3VHEA 2EB3A 3D4QA 4X21A 3THBA 4A9UA 2V62A 4ASXA 4HZSA 4DLIA 2X2MA 2PY3A 2ZV7A 2REIA 3R9OA 4HGSA 5LMKA 3F9NA 2C3JA 4C2VA 1SNXA 1ZY4A 4Q9ZA 3QLFA 3PRIA 5AR5A 1KOAA 2C47A 5AP2A 2CSNA 2ZM4A 5GHVA 4ZXTA 1BL6A 3DBFA 5J9ZA 2OJ9A 1MUOA 1NVRA 3Q3BA 2XKFA 3UYSA 5A4QA 3ZFXA 5F1ZA 4DT8A 3LXLA 3GXLA 3RHKA 2W4KA 3OOGA 3EQIA 4PPCA 2KULA 3LFNA 5KBQA 4G6NA 2QOFA 4X2KA 3BU3A 3GC0A 1YI6A 2UVXA 2PVNA 1Q5KA 4FSNA 5FP5A 2C0IA 3LFBA 4YLJA 5HVJA 2EWAA 4AA0A 3FMDA 4FZ7A 2XS0A 3NX8A 5DPVA 4EC9A 2PPQA 3U4UA 3D0EA 3MVMA 3LMIA 4NKAA 2J90A 4NKSA 3VS2A 3ZUTA 3FMHA 2IG7A 4EK6A 3R28A 5EM6A 5DMZA 2CGXA 2W7XA 3FLNC 4IMYA 4CGAA 1QPEA 3T9IA 4MXOA 3ZUUA 5ANDA 3D2IA 4FT5A 5C8KA 1OVEA 1JSTA 2J0LA 4Y95A 3VN9A 5KHXA 5IQDA 2ZYBA 1M7NA 3BU5A 4IB0A 3NVMB 2JFMA 2BMCA 3NW5A 2WMXA 4J52A 3KREA 4QYHA 1MP8A 2PL0A 1UWHA 2CGWA 1OM1A 4GIIA 4KD1A 4ZTHA 4YU2A 5I9XA 3QHRA 4Q5HA 4O38A 4ID7A 2B4SB 4AZTA 2XK4A 3T9TA 2J0JA 4J97A 4EONA 4AW5A 2JBOA 5EI8A 3NUNA 2P0CA 4O83A 2IVSA 5I9VA 3QUPA 4YTFA 5DYJA
chains in the Genus database with same CATH superfamily
4DG0E 3W0RA 3DK6A 3QGYA 3SDJA 3EYHA 2IW6A 3CLYA 1XKKA 4GYIA 4FL1A 4NM7A 3HMIA 5EM5A 3UVPA 3ZO2A 3W32A 2UZTA 4ACHA 2W96B 4GT5A 5EW8A 2HOGA 4LUDA 4BZNA 3OCTA 3G2FA 2ZB1A 3CJGA 4ZOGA 5TE0A 3BU6A 2WEIA 1R39A 4IM0A 3MW1A 4M15A 4F1OA 4ZZOA 3LM5A 4KS8A 4GK3A 3H30A 1ZOGA 2XKCA 3BYMA 3Q6UA 3AMYA 5L8JA 3CGFA 4ITJA 5HD7A 3DKOA 3EFLA 3ZLSA 5HI2A 4EK3A 2UW9A 3DBQA 3FSKA 3FLYA 3GENA 4Y46A 1Q97A 4F9WA 2CN5A 3E3PA 3TKHA 1A48A 2QO2A 4APCA 2PVJA 4EOOA 4FZDB 3I0OA 3DFAA 3UG1A 4EH6A 1R0EA 5FBOA 2YDIA 5AP1A 3E8EA 4JX7A 5DLSA 2XNBA 3DNDA 4O1OA 4PL3A 4A4XA 2VTLA 3VULA 2UZVA 4DBXA 4O91A 3Q9YA 2AUHA 4E93A 3RHXA 4D4SA 4FEWA 4OT6A 3NYXA 1WZYA 1XO2B 3NSZA 2V7OA 3VQHA 5CZIA 4RWJA 3WZJA 4YJUA 4RA4A 2G01A 2UW6A 2ZV2A 3BLRA 3FDNA 4LI5A 3G90X 3ZEWA 5DA3A 2EUFB 3Q6WA 3FC1X 3QCYA 3C51A 4AQKA 4AE9A 2V0DA 2VRXA 1JWHA 3FY2A 3MY1A 3CTHA 4JNWA 3DLSA 3R21A 2W1GA 4TY1A 3JPVA 4OTPA 4WRSA 5BVDA 4F99A 5HLWA 3KF7A 3F3ZA 5L2SA 5HG7A 4C02A 4XLIA 5K3YA 3F69A 4D9TA 3VBWA 4A9SA 3EQCA 3MESA 3IG7A 5EI6A 3JXWA 2BUJA 2OF2A 3VBYA 4K11A 3OZ6A 4UMUA 4QPSA 2OIDA 1Z9XA 2VTRA 2FYSA 3Q32A 3A4OX 1PRYA 3FXWA 4BCMA 2QODA 3LW0A 2GS2A 2BHHA 4ASZA 4UMQA 5EQEA 2WB8A 5C27A 4BDGA 2R5TA 2ITTA 5DT3A 3MI9A 4OTHA 2F2CB 3JS2A 4MXAA 4N4SA 4U41A 4FYOA 3QXPA 3VUDA 1U46A 1Y8GA 3MFTA 4RPVA 3ZH8A 3OROA 1P14A 2AQXA 5I4NA 4DITA 2BZJA 2PSQA 4RZVA 3HAMA 3WYYA 4IQ6A 3MJ1A 1UU9A 4L68A 5D10A 4ALWA 2JIVA 3F2AA 3OBGA 5BVEA 4C4HA 3QTXA 3TWJA 2C68A 5KCVA 5AADA 3CEKA 4FC0A 3ZS5A 1SVHA 2YM7A 1YQJA 3A7GA 4IW0A 4Q9SA 1WBVA 3QZIA 2J2IB 2X7OA 4M69A 2BVAA 2VX1A 1U5RA 5HBHA 4KIOA 4OT5A 5CNNA 4A4OA 4Y85A 3ZDUA 2CN8A 2HIWA 3K5VA 4XV3A 2QO9A 3ATTA 4ZEGA 4DA5A 1GNGA 4DH8A 5IQIA 5DG5A 3Q53A 3LFQA 3NEWA 5LMKC 2RFNA 3KF4A 3TG1A 5AAGA 4L44A 4ZMEA 3VUHA 5L2TA 3FSFA 2IZUA 5E90A 4F9BA 5M4FA 4GVAA 4I6BA 4IZ7A 4KBKA 3RM6A 3WZEA 3PP1A 2GQRA 4UV0A 4EQUA 3R0TA 2XNNA 4EBWA 1CTPE 3LLAA 4I23A 2XNPA 4A4LA 3FZPA 4D58A 4QMQA 4FV7A 2ITZA 3PFQA 3PIYA 5DR6A 3QTIA 2W5AA 3NW7A 5A3XA 4CFXA 3VUGA 3D5XA 4EWHA 3DNEA 4HGEA 4W9WA 5CALA 5CF5A 4FX3A 2C6OA 4J7BA 3HVCA 4FYNA 4N57A 1DS5A 1LEWA 2FO0A 2OF4A 3V5LA 5EM8A 4G9RA 4M66A 1PYEA 2ETMA 3BV3A 5EKOA 3DK3A 4D2TA 5DWRA 4IDTA 4CFFA 2GS6A 4R7HA 3V5TA 3M42A 4K1BA 4O6LA 5JRSA 4O7RA 1ZWSA 3S4QA 2I0YA 2J50A 3HA8A 4MF0A 4EZ3A 3NMUF 2WMUA 3UMWA 3R04A 1UV5A 3Q2JA 2YAKA 3ANRA 4NH1A 3UZTA 4FKLA 3ZRKA 4U9AA 5AAEA 3ODZX 3LAUA 1AD5A 4AF3A 4BFMA 3CJFA 3MDYA 3IS5A 3VBTA 2ERZE 4H3BA 4CRLA 4M3QA 5F4NA 1CDKA 4CRSA 2A2AA 4FV3A 5JZJA 1JNKA 4JDKA 3BHHA 4RQVA 3F5GA 3R8ZA 3NAYA 5CS6A 2WNTA 3C7QA 4PTCA 5B0XA 4FA2A 3R63A 1NA7A 5EM7A 5M4UA 1VLRA 3N4VA 3G33A 5E7RA 3FWQA 5CVGA 5HLNA 2VWVA 2UZNA 4J98A 3V6RA 4P5QA 4FV5A 4BDAA 1JKKA 4QQCA 5JGDA 3ZXZA 4MAOA 3EN7A 3U9CA 4EH3A 2BZIB 3ULZA 4GJ3A 3VS1A 3OY1A 5M09A 4U3YA 3C4CA 3LFAA 4G3EA 2BAKA 2XP2A 4DYMA 5CU2A 3C4XA 2OU7A 3DKCA 4L3PA 3VS5A 3SQQA 5CAOA 5AM7A 5GJFA 5IH4A 2J4ZA 1YXUA 3OOMA 1XBCA 2VTHA 3F82A 4OUCA 3ZSHA 4XG3A 1WBTA 4S34A 5C01A 5ANIA 1ZAOA 4XV1A 4BBEA 4QP8A 4F09A 4K6ZA 1JKSA 3FPQA 4DTBA 4ACCA 2UW3A 3C9WA 1O9UA 3TUCA 3R7IA 2UZUE 3OT3A 5AP0A 2PU8A 3NYNA 5BVWA 3F3TA 4DBNA 2F4JA 4IM2A 2C3LA 3U51A 1XBAA 3RBWA 2CMWA 4EK4A 2XK8A 1YWRA 3CCNA 4O0TA 2BKZA 3MY0A 5CT0A 1MRUA 3P1AA 2YM5A 4PWNA 1UVRA 3G51A 1UU3A 3AD6A 2B9HA 4O0WA 3KRRA 1NVQA 4HCVA 4I24A 4NUSA 4LM5A 2XNEA 3FLWA 3FQSA 4X2GA 4TNBA 2BHEA 4ASEA 4KRDA 3RWPA 3K5UA 4EWQA 3LFEA 3F66A 1Y8YA 5EQYA 3ZC6A 4CLIA 4AP7A 4FNZA 2GFSA 3P08A 3NNWA 4F9YA 5AJQA 4IAYA 4RFZA 3PYYA 4YMJA 4WUNA 1FBNA 3LM0A 4G1WA 4JG7A 4QMTA 4YZNA 3LXPA 5AP6A 1OIRA 1UNGA 2R7BA 3MBLA 1RJBA 3FYKX 4K0YA 3O17A 3OHTA 3EH9A 3H9FA 4H1JA 4PPBA 3E3BX 2R3RA 2BRBA 5JQ8A 1SVEA 3AT4A 5K0KA 3ORNA 1P2AA 3R02A 4R3CA 4D2VA 4EZ5A 1OPKA 4RIYA 3VUTA 3TXOA 3CXWA 3A62A 5CWZA 3I81A 3KMUA 3LXNA 4DGOA 3MN3A 4AZWA 3HP5A 3R9HA 4Z16A 2ZJWA 3SVVA 4IACA 5JSMA 4O96A 4E26A 4D0WA 2GNJA 1Q62A 2Q0BA 3HECA 3DTWA 5E1SA 5IDPA 5IKWA 4IB1A 4E4MA 4IB3A 3W2PA 3NUAA 3Q9XA 3VAPA 4N6YA 3S00A 4PDPA 1OIQA 4AXAA 3LQ5A 1OGUA 4JDHA 5BQ0A 3FI8A 4NTSA 2R3MA 4LDTA 4GT3A 4ZSLA 5I5ZA 5CT7A 3UVRA 2VN9A 5JRQA 1F0QA 4G6LA 4MXYA 3SW4A 4FG7A 4UBAA 3RALA 4DEGA 2X8IA 3EFJA 3L9NA 4EUTA 3QZGA 1TKIA 4PY1A 3ORXA 4O82A 3O50A 3QTSA 4QMLA 3QCXA 4AAAA 2R2PA 4JRVA 3NNXA 2GPHA 4Y83A 3IO7A 2X0PA 4U45A 2YITA 5CAPA 2QD9A 2X6EA 2X39A 4R8QA 5TOZA 3V5PA 4C36A 4PV0A 4EH2A 4C2WA 3KXZA 3OF0A 4L42A 3UE4A 2QCSA 3ORZA 4RWKA 4DHZA 3KXMA 4IC8A 3BELA 4D5KA 1DM2A 5HORA 3AKJA 4QYYA 4FIIA 4RX5A 3DT1A 3BGZA 3GUBA 4DHIB 4O84A 4ANLA 4FSTA 5CEPA 3PVBA 2A98A 1YWVA 4GT4A 4H39A 4UYAA 3V5WA 4RVLA 4BKZA 1NT2A 3A4PA 4TN6A 2H34A 4QMWA 4U5JA 4E5WA 5IMXA 4PQNA 3CTQA 2F57A 3L9LA 4DN5A 3IDPA 2XNMA 3OXIA 3WE8A 3BLHA 2VWWA 4F0IA 3FHRA 4EUUA 5IUHA 4E4LA 3IOKA 3BEAA 1OUKA 3EKNA 2ITWA 2WTKB 2VAGA 3LIJA 3OG7A 2X7FA 2OZOA 5AIKA 2C6MA 4A9TA 4BCKA 4X6QC 2UZOA 2OKRA 2W1CA 5AP5A 1FGIA 5HNGA 2IZRA 4XLVA 4GCJA 1Q61A 3F5XA 4AT3A 5HCXA 3I6UA 1YWNA 2XRUA 4C3PA 4WG4A 1U4DA 2VTQA 4UWYA 3NAXA 2NPQA 2YFXA 3OWKA 5HO6A 3W2SA 3AMAA 1OBGA 2BZHB 4JDJA 2LGCA 3AXWA 4OBPA 2C5XA 2NRYA 3EFWA 3R8LA 4IXPA 4M0ZA 2XKDA 5H2UA 4FEVA 4YZBA 4FSUA 4YP8A 3ZU7A 3P4KA 3BL7A 4FTQA 4BWXA 4FV6A 4EYJA 4HCTA 2GNHA 3GCVA 4WA9A 5T6KA 1OB3A 4TYGA 3ZRLA 4JLCA 4CV9A 3RK7A 3QQUA 1WVXA 5EHOA 5EKNA 3KRXA 4FT9A 3RNYA 2XH5A 3TKIA 3E93A 2WEVA 2YDJA 3ODYX 2YLEA 4IZAA 2CCIA 5IEYA 4C59A 4G5JA 2XANA 4XG9A 4IAAA 2JBPA 3R7OA 5FBNC 3RAHA 4BDJA 3UOLA 5E8WA 4D55A 3DV3A 5FP6A 2YIXA 4DG2E 3TDWA 3EN5A 4IJPA 2BRGA 2I40A 3PA4A 4AW1A 3VS7A 2B9JA 2QG7A 3F3VA 5J87A 1IR3A 3HYHA 3FL5A 3M1SA 4BDFA 1A9UA 4CEGA 4EHGA 3HV6A 4LGGA 4BIDA 5AUUA 5M4CA 5D7AA 4DF3A 2X8DA 3EL7A 4J99A 3F3WA 3GOPA 3Q4TA 4FV8A 4YHTA 2E2BA 2XVDA 2YM3A 3W55A 3DTCA 3E88A 3GCUA 3AC8A 3VBVA 5KMOA 4RT7A 3C4FA 3VO3A 2GQSA 2UVYA 3C0IA 4OBOA 1P5EA 3DXPA 4H05A 5B2KA 4UB7A 5DI1A 4KINA 4BTJA 4QMYA 4KKGA 4HVDA 3C0HA 3K3IA 1YDTE 4D4RA 3FLSA 4FT0A 4YTIA 3RMFA 4BCFA 3FZSA 4HVHA 2BRNA 3EN9A 3I4BA 4BR3A 4D1SA 2XARA 5KMIA 5IDNA 2DWBA 4RC3A 4XG6A 1CMKE 4YO6A 4A9RA 5CSVA 4DFUA 1XQZA 4AXDA 2W05A 1S9JA 3RP9A 4QMPA 4WIHA 5BMMA 5LQFA 1OPLA 4I5MA 4TT7A 3TZ7A 4X2FA 5FXRA 4AE6A 3O5AA 5J9LA 2RG5A 2XK3A 3DB6A 3P7CA 4RIXB 3AD5A 4FODA 4OLIA 5KZ0A 4USDA 3LCSA 3MB6A 4AOIA 2FGIA 3UOHA 4O0UA 5AV0A 5TKDA 3WI6A 4ZJIA 5TT7A 2VTSA 3TNPC 4C7TA 3G5DA 3ZYAA 3HP2A 4TPTA 2J0KA 3QD3A 4YR8A 5L6PA 4NFNA 4CCBA 3K54A 3D5WA 3PPJA 4X7QA 3ZUVA 4EC8A 4P5ZA 4ITIA 3L9PA 3GQIA 2CKOA 2XNOA 2BTSA 2QR8A 2XK7A 4FSYA 2QOKA 4DEDA 4IX4A 4UEUA 3RI1A 3TNQB 4PDYA 4L45A 2IO6A 5IG1A 3ENHA 3LFDA 5AP7A 3S95A 4GFGA 1YXXA 3MIAA 3DBEA 5JEBA 2YHVA 3VS6A 5EFQA 4D1ZA 1OMWA 3AGMA 1KV1A 2ZDUA 5IQAA 4DFBA 1Q3DA 2XYNA 4UMTA 3BYUA 3VC4A 3SG8A 3EQGA 4BRXA 2CGUA 3KK9A 4DGGA 2VWXA 3TUDA 4Z7HA 3HAVA 4XS2A 3DS6A 3HMPA 2IEWA 4HVGA 2CHLA 4QMVA 3Q4CA 4QTDA 3R22A 4YZMA 5LOHA 5EW3A 3SXRA 2GCDA 3BX5A 1ZYSA 4WSQA 4MXCA 2JAMA 3KVXA 5A46A 3UNKA 1H24A 3TJCA 4XG4A 2SRCA 2BFYA 3ORTA 5JFSA 1YRPA 5T3QA 4DEBA 4F7JA 1XMMA 4L7SA 3GC8A 5M51A 4Q2AA 4JBPA 4C33A 4U97A 3UQFA 4FVPA 1OPJA 4B4LA 4BWPA 2V7AA 2Y0AA 4KBAA 1WFCA 3E7VA 3HL7A 1V0PA 5IEXA 3KA0A 3DJ7A 3S1HA 2RFEA 3UZRA 1KE7A 3NUUA 3DDPA 3KC3A 4IVBA 2IW9A 2YWVA 2Z02A 4QMZA 3M11A 3F2RA 3PWDA 4DGNA 2WTCA 4JDIA 3COKA 3OW4A 2O65A 5AEPA 1FQ1B 1APME 3ITZA 2WHBA 2IW8A 2VTIA 3FLZA 3KXXA 5JFXA 2JDVA 2VO6A 3FHIA 1SVGA 1W0XC 3NGAA 4FKSA 4EYMA 3BHUA 2ERKA 4AXCA 5DBXA 3Q9ZA 3AC4A 3Q2MA 4GKIA 5HIBA 1FINA 5C8MA 4DH1A 3LHJA 4EOLA 5M53A 3IQ7A 3KIOC 5IA0A 1JVPP 4WNOA 5DT4A 3Q60A 4ZIMA 5CEQA 3QF9A 4DTKA 5A4LA 4R77A 2BRMA 4YLLA 3QRTA 3SOAA 1ZYDA 2I1MA 2PVRA 2PVMA 4FICA 2R3HA 5CEMA 4I41A 5FEEA 1BI8A 4S2ZA 4CFVA 3R8VA 4B6LA 3TT0A 4OTGA 4EOPA 5L2WA 2BIKB 3I6WA 3ORPA 3GBZA 3MJ2A 4XJ0A 2YCFA 3UIBA 4ERKA 2Z8CA 4ZLYA 5L6OA 2BZKB 2VU3A 4O0YA 3TV6A 4MWHA 4XX9A 3A8XA 4F9AA 3GCPA 4AOTA 1O6LA 4JR7A 3EQDA 2GQGA 4F6UA 4C38A 5CYIA 4CKJA 4UMPA 3NFGB 2B54A 3UTOA 2B7AA 3NUSA 1Q4LA 3BYOA 1ATPE 3U54A 4W4WA 1ERKA 3W8LA 4TYHB 5H8GA 5KKRC 3C1XA 4RC4A 2YDKA 3B2TA 5FEDA 3V01A 3FZRA 3T8OA 4WG3A 3F7ZA 3I5NA 3TACA 3WZUA 4C4IA 5LVNA 3HZTA 4YC6A 4ZSGA 4DEAA 2O63A 2XA4A 5E8UA 1LPUA 2YWPA 1ZOHA 2W9FB 3OWJA 4HNIA 4EH9A 3EQFA 2J0IA 4FIEA 4JT3A 4NU1A 2YIRA 2OG8A 3QCSA 4GU9A 4KS7A 4FNXA 3EN6A 3EQHA 4LL5A 4ZZNA 3H0YA 3ZDIA 3PZHA 4G34A 1XH7A 2HAKA 4U79A 5HNBA 4QTBA 2R3KA 5BYYA 1ZMVA 3OCGA 4BTKA 3F5PA 4EH7A 3QQLA 1DI9A 4W8EA 2YCRA 4HGLA 2PZRA 3UDZA 4DFYA 1A06A 2YEXA 3BE2A 4NWMA 4BYIA 2HELA 2HXLA 2ZMDA 3L8PA 4PF4A 4PL4A 2WTJA 4JG6A 4NFMA 3HDMA 5EG3A 4JOAA 1WBPA 5AR8A 3P86A 3H9RA 4GG5A 3SKCA 4DAWA 4O7SA 2P33A 5BVKA 3OC1A 2ITYA 1BLXA 1OL5A 1LP4A 2R3PA 2GMXA 3MH2A 4FSMA 4AN3A 2HXQA 4R7IA 2ITVA 2QR7A 3ID6C 2F49A 3DCVA 5AAFA 3FXZA 1K3AA 3P23A 3PA5A 3DXNA 3LQ8A 5HE0A 4AUAA 3RVGA 2X2KA 4I93A 2GHGA 2Y4IC 4EKKA 3ZONA 2QO7A 2AEGA 4FEXA 3ZFYA 3FQEA 3JY9A 4V0GB 5ANOA 3ZXTA 3CR0A 3NUXA 1PXOA 3OD6X 2R3LA 1TQIA 3R30A 4MNFA 4YLKA 5DGZA 3VS0A 4U6RA 4B7TA 5C1QB 4XRLA 3QAME 4OW8A 3KULB 2OFVA 2NO3A 3KCFA 2I0HA 2ZMCA 1Y6AA 1JPAA 3MH3A 4X3JA 1RDQE 4MBLA 2W9ZB 3MWUA 3GGFA 1EH4A 3COIA 5AR4A 3FKLA 2G1TA 4LL0A 2NRUA 1VEBA 2O64A 1OUYA 5AFVA 4FUYA 4P7EA 4BCIA 2YZLA 2J51A 4JVGA 3I0QA 1JKTA 3IONA 3QQJA 4E1ZA 3S2PA 2XKEA 1I44A 5FDPA 4YJNA 3E5AA 4M14A 4FEQA 2W1IA 3JYAA 3UO6A 4FGRA 3PLAE 4TXCA 4DHJA 3UJGA 1WBSA 2VWZA 5JH6A 2I7QA 3IDCA 1UNHA 3G9NA 3GNIB 4JG8A 4IJ9A 4FK6A 4AS0A 4FF8A 4U0IA 1H01A 1UA2A 3UMXA 4UZHA 5AX3A 5CF8A 1ZOEA 3U87A 3SD0A 1KWPA 1QL6A 2IVVA 4RC2A 3DAJA 4BGHA 3GVUA 3UC4A 3NIZA 2YABA 4BHZA 1ND4A 5GJDA 3QTRA 3PVWA 2PTKA 5KMKA 4RVTA 2CCHA 2W99B 4W4YA 4G16A 1IG1A 2W1DA 5CI6A 4IB5A 4DH3A 4M97A 5A4EA 1B39A 3OW3A 4E7WA 3UPXA 5DE2A 1ZMWA 2XMYA 4UALA 5TR6A 3ZHPC 3I5ZA 2B55A 3QZFA 2WMWA 3R6XA 5DFPA 4JIAA 3TV7A 3FUPA 3EJ1A 4O0XA 4AFEA 2XCKA 4AXEA 3ULIA 4H3QA 2WMRA 2WMSA 4PTGA 4ZSEA 2C6DA 1CSNA 2OO8X 2WMBA 4QO9A 1JOWB 1OKZA 4S31A 2WQOA 4EHEA 4V01A 2V22A 3KXHA 2QI8A 2X0GA 3E8CA 3QLGA 4IADA 4M8TA 3V8TA 1QCFA 3ZO3A 3T3UA 4LRMA 1CKIA 4NW5A 4BL1A 4ENXA 2PMIA 4RMZA 5KKRB 1HCKA 3HMNA 4RJ6A 5DR9A 2P55A 2VTNA 5HOAA 2CNVA 4C4FA 4FZ6A 1Q8TA 5ETFA 5AV2A 2OIQA 2F2UA 5FM3A 3D7TB 2HYYA 4IZ5A 2QHMA 3A7FA 4NM3A 4F0FA 5C9CA 4AT4A 2WFYA 4UMRA 5IQGA 3PJ3A 3ORIA 3PPZA 4GEOA 4ZLZA 5JGAA 5K0XA 4BI1A 3EWHA 4ALVA 2RKUA 4K9YA 3C0GA 5HIEA 3W0PA 3W33A 2XBJA 4I1ZA 5BYLA 2CKEA 4Z9LA 2DYLA 1GZKA 2QOOA 2ZAZA 4QNAA 4ZY6A 1QMZA 1W82A 2QONA 2W4JA 2Z2WA 4XMOA 4YBJA 2CLQA 3DOGA 4QP3A 3ZM9A 4LRJA 3DAEA 3EFKA 3R9NA 3WE4A 4NK9A 3R7EA 3TZ9A 3DQWA 2XCHA 4L43A 3DJ5A 1O6YA 1OL1A 4GSBA 4AU8A 3FE3A 4KSQA 1FVTA 3MH0A 3MA6A 5FDXA 1PXKA 3U9NA 4C61A 1KSWA 4AGCA 2GNGA 4O86A 2A1AB 5EK7A 4L53A 1FVVA 3MA3A 5J7HA 2R3GA 4ASDA 3IW6A 3L9MA 4MTAA 5JFVA 3DFCB 4NM0A 5CLPA 3BQRA 3Q5IA 2Y4IB 5BVNA 1PMUA 5HX8A 2C5NA 3ZC5A 2B0QA 4O4CA 2J5FA 3OS3A 4RIXA 3OWLA 5IA1A 5HHWA 5E8VA 1G8JA 3BLAA 4QTAA 2QURA 4KA3A 4XP2A 5JN2A 3REPA 3UOKA 2XJ0A 3RPVA 4O1PA 4NM5A 4RA5A 5DEYA 4D4VA 1OI9A 2NP8A 2C6KA 4N70A 5CANA 3CSVA 1J7LA 3BZ3A 2PK9A 4J53A 1F3MC 2PZ5A 4DCAA 3CPCA 3QKKA 4LOPA 4MX9A 4QMUA 4V04A 3IK3A 1UKIA 4XYFA 3QC9A 3PUFC 4HNFA 1XH8A 4JS8A 5CU3A 4ZTMA 2XZSA 4KRCA 3ZTXA 5E91A 4CKRA 2J5EA 4WNMA 2J0MB 2XIZA 4LYNA 3SRVB 1OKYA 4YJQA 2F7ZE 2OZAA 4J8MA 4BKJA 3QX4A 4ZTRA 4A9YA 2X9FA 1STCE 4L67A 4FE2A 1KE5A 3C50A 5CEKA 5AUYA 2DUVA 4C3FA 3PJCA 4OTIA 2HCKA 5D11A 3A60A 5EYKA 4C57A 3N4TA 4WHZA 3WBLA 4D5HA 1JKLA 1K2PA 4LOOA 4EZ7A 2F7EE 5IEVA 3KN5A 4F1MA 2VNYA 2JDSA 3IECA 4GW8A 4RBLA 2VWBA 4DEIA 1P4FA 4CTBA 3H0ZA 3DAKA 4E6CA 2PYWA 3UIUA 3ERKA 3MYGA 3TTIA 5G1XA 3PA3A 3SXSA 4FK3A 4MHAA 4LMUA 2JC6A 3UIXA 3V5QA 4QNYA 4TNDA 4HYUA 3A7JA 2RSVA 4RJ3A 5HG5A 3AKKA 4I4EA 4FIHA 4I5HA 3FMEA 4KABA 4C8BA 4XP0A 4GYGA 3R8PA 5AIRA 3PXFA 3W10A 2YM6A 3E92A 1GZOA 3DQXA 3P0MA 1JSVA 3VRYA 4BGGA 3R1NA 3CY3A 1U54B 3DDQA 2WTVA 2RG6A 4RQKA 2OXXA 5L2QA 2HY0A 5EOLA 4I6FA 4NSTA 2WQNA 3OTVA 3EQPA 4RLLA 1YI4A 2XYUA 2GFCA 4F7SA 3MVJA 4IEBA 1H00A 3IKAA 1GZ8A 3E8NA 2VUWA 3TKUA 2OIBA 4G3CA 3TNIA 3TMOA 1R3CA 2HWPA 3G6GA 3BI6A 3SC1A 4I92A 4FTLA 2HENA 4DFXE 2WTKC 1H26A 4DC2A 2CGVA 1Q3WA 1W7HA 2XB7A 4HCUA 4JBQA 4PNIA 1Q41A 1WVWA 1ZZLA 4IBMA 3KEXA 4YC3A 5ANEA 1GIJA 3UYTA 3ZLYA 2WKMA 3ZCLA 4WRGA 4FIJA 3NCGA 3VS3A 2C1BA 1SM2A 5AP4A 3IW4A 4F6WA 2PULA 1PMEA 3C4EA 4Q5EA 3LZBA 3VUIA 3D15A 3OCSA 2VWUA 3W0QA 4OAVB 5CSHA 2VO7A 4EORA 3DXQA 1FOTA 1YXVA 2FSMX 3QWKA 5HO7A 5ICPA 2XRWA 3V8SA 2P3GX 5BMSA 2EXMA 4AA5A 4EH5A 4YO4A 4D9UA 3QD0A 3SLSA 5LWNA 2Y7JA 3VJNA 2C6LA 2BTRA 3L1SA 4TYHA 3RGFA 3TDVA 2OH4A 5AV3A 1KE8A 4I0RA 2FSLX 2WMVA 4JMQA 4O7LA 4Y5QA 3QTUA 4JQ8A 5GJGA 5H8EA 4LOQA 4CFWA 5EW9A 5A4TA 4GKHA 1UWJA 2C30A 2Y6MA 5JGBA 3OTUA 4EKLA 5CSWA 2VZ6A 3TYKA 2PUIA 2VWYA 3I7BA 4HPUE 3F3UA 1YHSA 2WQEA 3ENMA 3I79A 2XM8A 2FB8A 4FSQA 4K77A 3POOA 2BDJA 2QOLA 1ZYCA 5CX9A 5JQ5A 4ORKA 2W1EA 3UG2A 4D2WA 3GP0A 3LKMA 4IHPA 4QOXA 2BALA 2VWIA 1H1RA 4GU6A 3G0EA 3FI3A 5ITAA 4GJ2A 2ZOQA 4RSSA 5IQHA 2GHMA 4FR4A 1PKDA 4YTHA 2JDRA 4GH2A 4F0GA 3V8WA 1ZY5A 4JI9A 4CFNA 4Y72A 4WKQA 4ANOA 3QYWA 4TW9A 4AZVA 4Z55A 3LCKA 5C03A 2E9VA 3ZO1A 5C26A 3FKNA 4NZWB 1H07A 3PSDA 2YCQA 4JIKA 3UOJA 4BY9E 4N6ZA 4PX6A 4YPSA 3WOWA 4ANBA 2OFUA 2YLFA 4S30A 1G3NA 4UX9A 2X9EA 3CD3A 2VTJA 3R2YA 1H28A 2EXEA 3GU6A 1J1CA 2O3PA 5DIAA 3VVHA 4QTEA 3NR9A 2CKQA 5IQEA 5IQFA 3QTQA 4V0GA 2PHKA 5AM6A 5GZ9A 5KX8A 4PDOA 3SA0A 1Q8YA 2E9PA 1KE9A 3O71A 1YOJA 3QFVA 5IUIA 4ACDA 3FEGA 3KULA 1YW2A 3CIKA 1ZYLA 5KMNA 1VYWA 2C5VA 5CSPA 2OXDA 4JJRA 2XAOA 1KE6A 2WTDA 4GMYA 4LG4A 3NUPA 4KKEA 1Q8WA 1PYXA 3BPRA 4O2PA 4R3RA 4AFJA 5FQDC 4LGHA 3R8MA 3VF8A 4FOBA 4QP1A 5DHJA 3RCDA 3PRFA 4RX9A 4XH6A 4OTQA 2WIHA 2W5HA 5A9UA 4C62A 2ZM3A 1BKXA 4UXQA 3LFCA 3O8PA 3MSSA 2R3QA 5K5XA 1ZLTA 4EH4A 1B38A 1RE8A 2G15A 4C34A 5BX0A 4YUQA 3W0NA