1GZKA

Molecular mechanism for the regulation of protein kinase b/akt by hydrophobic motif phosphorylation
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
296
structure length
271
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Kinase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gzkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gzkA02
5JRQA 3ZRLA 5M4CA 2ERKA 4YLLA 4G3CA 1AQ1A 4ANBA 4BHNA 2B9HA 4LV8A 4XG3A 3FXZA 2E9UA 2JLDA 3LIJA 3SW4A 2DWBA 3RZFA 3EFLA 4MXZA 4B4LA 4BTJA 1G5SA 2A1AB 4EK8A 2VTPA 3PVWA 4BIEA 3E8DA 2JKOA 1NW1A 5FRIA 4LG4A 3ZLWA 4H05A 2PVHA 2JDVA 5AR3A 1KOAA 3RAHA 3VUHA 3ZDIA 2ITYA 3E87A 2WMWA 5AM6A 1J7IA 3F66A 5KMMA 4NW5A 1IASA 1PXNA 3HVCA 4FOBA 3I7BA 3RP9A 5J1VA 1YXVA 2PZYA 5GHVA 4M0YA 4AA5A 4KB8A 2BAKA 5KZ0A 1KE5A 3Q4UA 5HE0A 3PA5A 2ONLC 3KK8A 5B7VA 4XH6A 4D1SA 5HESA 3F2NA 4KIOA 2ZV2A 4E6CA 2RFDA 2W0JA 4Y83A 5CWZA 4RZVA 2WOUA 1GIHA 1KE7A 5AM7A 3TG1A 4BWKA 5L6OA 3KRRA 2BRHA 3HA6A 4KA3A 3KN5A 3W2CA 2VGOA 1XH7A 2Z8CA 3OEZA 2GHLA 4I22A 5HNGA 1SZMA 2QU5A 5EW8A 2Y7JA 4NL0A 2PYWA 2QD9A 5EI8A 1WVWA 1YHSA 3NWWA 4IB3A 3M11A 4NM3A 4RJ4A 5HGIA 1YOJA 4FODA 3LQ3A 3PZHA 3PY1A 4O21A 3F2AA 4N6YA 3TJCA 5DR2A 4C4HA 5DT3A 3FLQA 5FDPA 1B39A 3QUPA 2BDWA 2BPMA 5C8KA 4ALUA 4HYHA 4NM0A 5JFVA 2WKMA 1MRYA 2B0QA 3QZHA 1UA2A 4L00A 4OT6A 5AADA 3W2RA 4IM3A 3EN9A 5DPVA 4L46A 3NX8A 3NUYA 4C3FA 5K0XA 4E5BA 4FMQA 4FSQA 3RK7A 3UZPA 4I5CA 1ZAOA 1QPCA 3ENHA 4TPTA 4K9YA 3I6UA 2WMQA 1T45A 4EHVA 3TZ8A 4G9CA 3ORKA 3GVUA 4P7EA 4YJQA 4Y72A 3WZDA 4O27B 3ZFXA 3SC1A 4S31A 4FSWA 2B1PA 3QXPA 3OEFX 5EFQA 4AZTA 4FZ6A 4QMMA 5LCJA 1UU9A 2Y8OA 4LUDA 5H2UA 2PVJA 4QT1A 4CT2A 1MUOA 2QOLA 4QYFA 3R7UA 2EXMA 3R30A 4DAWA 5IEYA 4FIJA 5EDPA 3KC3A 3DBQA 4CKIA 4OTIA 1YXTA 4DC2A 3UBDA 3S0OA 5K3YA 2CCHA 4TYJA 4A9UA 1WBTA 2J90A 2ZB1A 3ZMMA 3HMMA 4E8AA 3PRIA 4DCAA 3ZEWA 4LGGA 3RM6A 4E5WA 4IB0A 3V6SA 3BGZA 5B2LA 4WRGA 3R71A 3QFVA 4UMUA 4HVGA 2PVRA 5ICPA 5KBRA 1A48A 4R3PA 4XEYA 1OIQA 4FEVA 2HZ4A 2ITNA 3S1HA 3A2CA 4JRVA 3Q6UA 4FKRA 4O0XA 1YHVA 2YIWA 3QYZA 3D5XA 3IO7A 4YZBA 4EHZA 5EQYA 2XKEA 2WTIA 5L8LA 4YO4A 1G8AA 4B8LA 4CRSA 5I9ZA 3ZSGA 1I09A 3VUTA 2OH0E 3TT0A 4AAAA 3FDNA 4U3YA 4DGMA 3F3TA 4JI9A 4G3DA 2ITOA 1PYXA 1YVJA 3BE2A 5HVYA 3FMMA 4BCKA 2GHMA 4DH7A 4FYOA 4R1YA 5JQ5A 5FUTA 1OPJA 4OTWA 5J7HA 4EK4A 3R8MA 4G5JA 5AA8A 4C0TA 1ZYDA 3UC4A 3IW7A 4BCOA 5C01A 4XV1A 5M4IA 2PMNX 5ANJA 3NW5A 4WT6A 4DFZE 3UNKA 4U81A 3ZO3A 3KXMA 3M1SA 2WNTA 3OCSA 3GC8A 4YJSA 1K9AA 3PXQA 2QU6A 2UZTA 2QQ7A 4QTCA 3GU5A 4GT3A 5CF8A 3ORPA 4FSZA 5M56A 1H24A 4JDKA 3PG1A 3AMBA 4NW6A 4ZJJA 5B2KA 5CF5A 2WQBA 4PL3A 3DKCA 4FVRA 3EMGA 4CYJA 3ACKA 1LUFA 3QCQA 4D1ZA 3MH3A 4HCUA 4QMTA 5DH3A 2LGCA 4FIEA 1YW2A 5J7BA 2R3PA 4B6LA 4UX9A 2ACXA 4LYNA 4CMOA 3TM0A 2Y6OA 3PY0A 3VHKA 4RPVA 4E4MA 3EFJA 4USFA 4HGTA 3NUSA 4JT3A 4E6DA 4WHZA 2ETKA 4BBFA 4BTFA 4HVHA 4M0ZA 3OT8A 4IZAA 3P1AA 4F0IA 3NAXA 2R3OA 4ACHA 2OW3A 3OOMA 3TCPA 2C4GA 2RFSA 4JNWA 4BDBA 3L8PA 4JXFA 3BWFA 4DFYA 4ALVA 2XA4A 3KN6A 2WHBA 2NP8A 2UUEA 4FK6A 1XBAA 3ZUVA 4O1PA 3W10A 3QD4A 1QPJA 2FSOX 3AC8A 3AG9A 3D14A 3BU3A 2QHMA 4U0IA 5EW3A 5M51A 2XCHA 3EQPA 4K11A 4HZSA 4JQEA 4QPSA 2RFEA 2XS0A 3KRXA 4II5A 3CC6A 3SG8A 3DPKA 1LEWA 4Z55A 3ZTXA 3DBEA 3R2YA 3VF8A 2P2IA 4XRLA 5GNKA 2J5FA 5F95A 4CFWA 4O2ZA 3AC3A 3KRJA 4CT1A 2C47A 3I6WA 4G16A 3VC4A 3GENA 3DXQA 2ZB0A 4PY1A 4X3FA 2VNYA 3QA0A 3ORXA 5C4KA 4FV3A 4N6ZA 5FBOA 3LMIA 4YSMA 5HIDA 4ZTMA 4BI0A 1CKPA 2PSQA 2QURA 5KUPA 1REJA 2BTSA 4MBJA 3OC1A 5ETIA 2VZ6A 2VWYA 3LJ1A 3DS6A 3V5QA 4O84A 4Q9ZA 2WZJA 3KF7A 3FYKX 3FI4A 1U4DA 3QBNA 3F3UA 4HZRA 3PZEA 3Q4CA 3VBTA 1KE8A 3ZOSA 5AAEA 4KINA 3ID6C 4XP2A 4OTFA 4YO6A 5I9WA 3VO3A 1P5EA 4TXCA 5EHLA 3ZBFA 4CTBA 3Q5IA 4BI1A 3B2TA 3L9LA 4RX5A 5HX6A 4RSSA 5HX8A 3NR9A 3KXNA 2QOFA 4XG6A 3FZ1A 3IK3A 3LJ0A 3RWQA 3QTZA 1DI8A 2XIKA 3P79A 3VS5A 3BQCA 2XBJA 4AT4A 2B9IA 5KHWA 5KO1A 2QHNA 2A0CX 2R3KA 4IFCA 4E93A 3TN8A 3QUDA 4IAKA 4BCGA 3C5UA 2ZOQA 3F61A 2PPQA 3SA0A 1WBVA 1H27A 2O0UA 3MY5A 4O96A 4C3RA 4DBNA 2BKKA 4LRKA 4RBLA 4KBCA 3IOPA 5EKOA 3ROCA 4UMTA 4EORA 2YCRA 3LXKA 4AW0A 3BELA 3A61A 2I7QA 2ITTA 1OIRA 4WBBB 2NO3A 4BVUA 1QPDA 3BV3A 2XBAA 3HKOA 4ZTNA 1JKTA 5C8MA 1U46A 3DK3A 3QYWA 1BYGA 3QWJA 4L52A 2UZBA 3ZHPC 5D10A 1WVXA 5LMAA 3G33A 3M42A 3V5PA 1H28A 4JX3A 4ZTLA 4RX9A 4FTMA 5HE1A 3DB8A 3UG1A 3DQXA 2UV2A 4EOQA 1Z5MA 3COHA 2C0IA 4Y73A 3RMFA 1YWNA 4EUUA 1O6YA 2WQEA 3SLSA 3MDYA 3SQQA 5KMNA 4W4WA 3SXRA 3VN9A 3QTWA 4X2GA 1ND4A 5E8SA 2C0TA 4YUQA 5CU3A 2OF2A 2XEZA 2RFNA 3FMKA 4JR7A 5JZJA 4BCPA 4X21A 3NYVA 5M44A 1KUTA 5IH4A 4TWOA 4F7LA 5HNIX 4PMMA 3U6HA 3UTOA 4QMNA 2YIQA 2Z02A 3ALNA 3KEXA 4GYIA 4PPAA 2J2IB 1PKDA 4AN2A 4QQTA 4XP3A 3RALA 1ZOEA 3CQUA 3ORNA 2XRWA 3OY1A 2GS7A 1OL2A 2XVDA 5BVKA 3T8OA 4O7RA 5AR5A 3IECA 2YLEA 4BTMA 2OWBA 4QP1A 4F9AA 4BKZA 3WILA 4HYIA 2IVUA 3F2RA 1G8SA 1WFCA 2OSCA 2WQNA 4JDJA 2C6EA 2CKPA 5ANIA 3KCFA 4JBPA 1S9IA 3TV4A 3Q53A 5M06A 3LCKA 3R8LA 3E8NA 2GNFA 3OOGA 2JITA 4F1MA 4FC0A 4L53A 3U55A 3C0GA 4P4CA 2G2HA 4LL5A 4NFNA 2WTDA 5HD7A 5E9EA 3EQHA 2W1EA 2P3GX 1FVTA 2UZDA 1XBBA 4HOKA 3VBVA 4W8EA 3KFAA 4MD7E 5KNJA 2A4LA 4ENYA 1I44A 2R0UA 3G0EA 3EQBA 3VF9A 4LMUA 3NDMA 1WBNA 2XCKA 4EH6A 2H96A 2P2HA 4AF3A 5A9UA 4N57A 4XG2A 3QZFA 5AP4A 3HUCA 1P4OA 4AOTA 1HCKA 4U3ZA 3POZA 3OXIA 4LRJA 4BZOA 5C8NA 2X8IA 4O83A 4E4NA 1H1WA 3ORTA 4R5SA 3UO4A 5H8BA 2PVNA 1VEBA 4D5HA 3BV2A 2W1IA 3TKIA 4F6SA 3HV5A 3IW4A 5A4LA 2R2PA 2IPXA 2C6IA 4KKGA 2W9ZB 3KGAA 5TR6A 4FTOA 5GJGA 3U9CA 4ERWA 5BUEA 3FPMA 4XRJA 5JSMA 4WSYA 2YABA 4W4YA 2WU7A 3OUKA 5EYKA 4DGLC 1STCE 4TYHB 2ETMA 4GYGA 4IX6A 5LVOA 4D2SA 4A9SA 5JRSA 4ZTHA 4MNFA 2NRUA 2G2FA 3KMMA 3SOCA 4FNWA 2GFCA 4ZS4A 3UPZA 1NT2A 3MTLA 3O17A 4A7CA 4FV8A 2V62A 3H4JA 3D7TB 3OFMA 4YTFA 1BI8A 1FVRA 4H39A 4M69B 3OT3A 4UYNA 5CF6A 3TUDA 4IADA 2PUPA 3OWKA 4G31A 3R83A 3RPVA 3K54A 4M12A 4PRJA 1LR4A 1OL6A 3Q9ZA 4EZ3A 1Q8YA 2WMTA 5BYLA 2BAQA 3F5UA 4F0FA 2IWIA 4HGSA 4CG9A 3DTWA 2JDSA 4A06A 4I6HA 3A4PA 4X2FA 5H3QA 3AT2A 2J0KA 1MP8A 5IUGA 2P55A 3QC4A 3FMNA 5A4QA 4KIKB 3IGOA 5KMKA 4G3FA 5AP1A 2E2BA 5E1SA 3PLSA 3FKNA 5CEIA 4CKRA 3NUPA 2HZ0A 3HMNA 4YJVA 4HCVA 2C5XA 3DT1A 4YSJA 4IWPA 4CGAA 1H1SA 4K18A 4MBLA 2W7XA 3UO6A 1RJBA 4MNEA 2R0IA 3OTVA 3HRBA 2BRBA 3EN4A 3GU7A 3NUNA 5AIKA 5G6VA 5M4FA 3U8WA 4FL3A 5J9ZA 1OBGA 1WBOA 5DEYA 5L8JA 3O2MA 5JFXA 3BHUA 5C03A 2JBOA 5K5NA 3UNJA 4MWHA 5DHJA 4QNYA 2I6LA 4MF1A 4X6RA 2ITWA 4YR8A 3W55A 2W06A 2YISA 3E63A 3TWJA 2FH9A 3WIGA 3ZH8A 2Q83A 4TYEA 5IQDA 3RAKA 3D5VA 4ZY5A 4FV7A 4Y5QA 1LPUA 4KBAA 3FMEA 2WTJA 4X3FC 4YNEA 2QR7A 4AZEA 5IA4A 3MFTA 3WF8A 2ZDTA 5CVFA 1QPEA 3C7QA 3ZYAA 3QD2B 4WA9A 2KULA 3NNWA 2UZNA 2QI8A 1Y91A 2WEVA 3II5A 3O23A 5HEZA 1GZNA 4NU1A 3V8TA 4S32A 3LMGA 3UQCA 3UP2A 4JX7A 3H30A 2CJMA 3GCPA 5D12A 4EONA 3FI8A 2ZM4A 3PA3A 4FTUA 2NRYA 2BZJA 3F7WA 2CLXA 3PG3A 2VRXA 5IH6A 4EBVA 2RKUA 3RCDA 2H8HA 2UVZA 2YIRA 3G0FA 5LOHA 2X6EA 3GXLA 4BDIA 2ZAZA 3TKHA 2C6TA 2QOOA 4EC9A 5EQPA 2CGWA 4C4GA 2J0JA 2YAKA 5ETCA 3RHXA 3BLHA 4EQUA 5FG8A 3UGCA 3H10A 4J52A 1NVSA 1UU7A 4JVGA 2BMCA 3FBVA 5EM6A 4DH5A 4EQCA 2ETRA 3CEKA 2XK4A 4ASXA 5CF4A 4OTRA 5EYDA 4A9TA 5LQFA 4BRXA 4PNIA 2JDTA 3BRBA 1P14A 4FTNA 4EOLA 4R6VA 2PWLA 1FINA 2HAKA 1KV1A 5CSWA 5I3RA 3FLSA 2F4JA 4I93A 4TL0A 4ZSEA 5CU4A 5J87A 5IA5A 5JMSA 1PYEA 3QL8A 5HD4A 4UMPA 1YKRA 1XH5A 4IZ5A 4L7FA 5CY3A 4Y46A 5H8GA 3TNIA 4BTKA 3FI2A 5BVDA 3I81A 4U97A 1GY3A 3WE4A 4FG9A 4G2FA 3BZ3A 3HV6A 2GNJA 3LFQA 4IVDA 2EUFB 1OL7A 5AV3A 3ROYA 4RC2A 4F4PA 2XUUA 5AAGA 1J1CA 2C0OA 4MD9E 3DK7A 5LVNA 4EH4A 2OXYA 4ALWA 3H3CA 4C57A 4EH9A 3F3ZA 3PSDA 5CNNA 5E8ZA 3ORIA 1OBDA 5AUYA 2WD1A 3PFQA 5L3AA 4J7BA 2OICA 4BHZA 4ZZMA 4BKJA 1GOLA 3JVSA 4CZYB 4QMUA 4U42A 4BCJA 5M09A 3K2LA 4WNOA 4NKAA 3AMAA 4GK3A 3CKWA 2B55A 4BZDA 3TZMA 4YJRA 4JBVA 2H34A 2OFVA 4WNPA 2OJJA 4ZTRA 4F9WA 4KS8A 3QALE 4PDOA 1Y6AA 2QR8A 4QO9A 4TYHA 1JSVA 4QMXA 4QTEA 2WMRA 5M55A 4ZS0A 4ZLZA 3SXFA 1J7UA 3VUGA 4OBPA 5BPYA 4BDDA 5HO7A 3CP9A 4M3QA 3UOHA 4CFFA 1JKSA 2SRCA 1RQQA 3CXWA 4RLKA 3TXOA 2PTKA 4D2PA 4KABA 4M8TA 4FEXA 4ARKA 4WNMA 5FM2A 2QKWB 1R78A 3A99A 3D7TA 3FZPA 4L67A 3I5NA 3QD0A 3W2QA 2HWOA 3BLRA 3PJ8A 3ZO2A 3ZM4A 3EHAA 1TVOA 1ZYCA 3H9RA 5HORA 2CDZA 1GZOA 2EB3A 3OS3A 3JY0A 4KS7A 4E4XA 2C3JA 5CZHA 3FZRA 4EOPA 5HOAA 3TKUA 2ITUA 5AP0A 1UNHA 3MJ1A 3Q6WA 2B53A 1XHAA 5CAVA 5M08A 5IQGA 1PRYA 5ETFA 3QCYA 4PDPA 4AN9A 1K3AA 2AC3A 4U5JA 4XG7A 3EL7A 4U40A 4HVDA 3UZRA 4KIKA 4IB1A 4CNHA 2FSLX 3EN5A 5EDRA 4BCMA 4YTCA 3A7JA 3CD8A 4PTEA 4MF0A 1SVGA 3FLYA 1SNXA 2HENA 2JGZA 5AP5A 5M57A 3GC0A 4K33A 3PXRA 2AYPA 3VULA 3VUIA 1QMZA 2VO0A 4M13A 3PXFA 4OBOA 5CXZA 3V51A 3LFCA 4L42A 1GIJA 2B7AA 5IQAA 3JUHA 3O7LB 5AEPA 3ALOA 4EHGA 4NTTA 3HX4A 5J5TA 4ORKA 4GMYA 4EZ7A 1ZMUA 3EL8A 4KSQA 4IVBA 2YEXA 3E7OA 4IX3A 4D55A 2YM4A 1M7QA 3WF6A 5CSPA 4IHPA 3OD6X 3JS2A 3I7CA 3P9JA 2HK5A 5K0KA 4FV0A 1MRVA 5FTOA 3PWYA 4QNAA 1YWVA 3MJ2A 2HZIA 2XK7A 2JKKA 4B8MA 1DAYA 1DS5A 2BAJA 4D2TA 3VS7A 3EN6A 3C4CA 5ETAA 5HCYA 3UOKA 3QHWA 4ZOGA 3PTGA 5J1WA 5HTCA 4HYUA 5TT7A 2C6KA 1ZMWA 3U54A 4PQNA 2P4IA 4OBQA 3G9NA 4EBWA 3FC2A 3EQGA 3TDWA 4LRMA 4CV8A 4LGHA 1MQ4A 1GZKA 1CM8A 4GVJA 4F0GA 4H3PA 2OIBA 5AV1A 4CTCA 3EQCA 2WIPA 4UV0A 3EWHA 1BMKA 1H01A 4O7WA 5BYYA 5HIBA 4YP8A 4FSUA 2EB2A 3LXNA 2CNQA 3PVGA 5CEMA 4NH1A 3LMHA 4CG8A 3MY0A 4FV5A 4UN0C 4Z7HA 1RW8A 5JGAA 2WTWA 4X3FB 1XJDA 4EK5A 1WAKA 4E73A 1L8TA 1WBPA 3QWKA 1H4LA 1UKIA 2PUIA 3CJGA 3DFCB 2I0HA 4BGQA 4C2WA 1R0EA 3LQ5A 4UMQA 5CTPA 3DKGA 5BUIA 1IG1A 4I92A 1M52A 3FL5A 1IRKA 3Q32A 4C8BA 3D5UA 4FTKA 5CT7A 2R5TA 5AV4A 3R7GA 2OH4A 5HG8A 4X6QC 3IKAA 4QP8A 3RI1A 4OUCA 3TI1A 3P5KA 4AS0A 4C7TA 3W32A 3TIYA 4BDCA 4BN1A 1KE9A 1YXSA 1SMHA 4U79A 3IDBA 1Q41A 4QMWA 2BKZA 2XMYA 4AFEA 4IBMA 5GZ9A 4XYFA 5CAQA 2GNLA 5E8YA 2QOQA 3LFFA 4AG8A 1UV5A 3WF5A 3OVVA 4M15A 5BVEA 3UIXA 3R1NA 2PZPA 5IG1A 3BWJA 2HYYA 3CTJA 4DF3A 5J95A 2BHEA 2EXCX 4YLJA 4ACMA 1TQIA 1M2PA 4BIDA 2R3MA 4PNKA 1F0QA 3FEGA 2WEIA 3REPA 3ULIA 4AA4A 3EOCA 3PUPA 2PY3A 5CU0A 4LL0A 1T46A 3QF9A 5EM8A 4GKHA 2E9PA 2V5QA 3MPTA 2GDOA 2YZAA 3MI9A 3R01A 4FKSA 4QMYA 3VW8A 3RNIA 2PK9A 5DE2A 3R22A 4AW5A 2QLQA 2QKRA 4ZTSA 3BPRA 3FPQA 3R7YA 3ZS5A 1JLUE 3CGFA 4CMUA 2ZM1A 3QC9A 1JVPP 5CU2A 3V04A 5C27A 2XIXA 4GEOA 4D1XA 4BCQA 4AWIA 2X9EA 3FY0A 3BE9A 1W98A 4BY9E 3QQHA 4FG8A 3G2FA 2VWIA 3KVXA 3HRCA 2FGIA 3F3WA 4EH8A 2X4ZA 4DEAA 5DA3A 3Q04A 5EW9A 1JBPE 3FHIA 3DKOA 4DYMA 1ZYJA 4I0SA 4I24A 3RPOA 2PE1A 5EQEA 2Q0NA 3F3VA 1OPLA 3Q9YA 2X8DA 5IUHA 3U6IA 4AE9A 3PJ2A 4AQCA 3PDTA 4C59A 1FMOE 3LCSA 3R7IA 3R9OA 4AGDA 2VTAA 5AFVA 3FZSA 2VWBA 2VTOA 4XUFA 3ZSHA 4D4SA 2QOBA 3VS3A 4J53A 3D4QA 4RWJA 3HL7A 4QP6A 1NVRA 2E9NA 2R3NA 4M67A 2IO6A 4WRSA 1IA9A 4IDVA 3CS9A 3NVMB 5E8UA 5E92A 4DTBA 1OM1A 2ITPA 1ZXEA 2CN8A 5CSVA 2R3JA 3UVRA 1XH4A 2ITVA 5AAFA 3DLZA 4DEDA 1OIYA 3E5AA 2QOCA 4QQ5A 5IQEA 4KD1A 4UALA 4Z7GA 2ZDUA 3QZGA 4QTAA 3UOLA 3QUEA 4IC8A 4DFXE 5EYCA 3PY3A 4JDIA 4FKUA 2VWUA 2DYLA 3MGYA 5IH5A 3Q2MA 5DRBA 5C9CA 3DV3A 3VRYA 2VU3A 3C4FA 4GH2A 3VUKA 4BB4A 4FZDB 4E5AX 2ITQA 1OUYA 4R7HA 4YNOA 1OUKA 1GNGA 4UEUA 4FKTA 3R04A 5HZNA 1PXOA 1PXLA 5E8XA 5L2TA 3ENMA 3CSVA 4EOOA 4BDGA 5HVKA 2NPQA 4HGEA 3WYYA 3OWPA 3P7AA 4LOPA 4YJOA 4D28A 4FA2A 5HBJA 1UWJA 2HELA 4NJDA 3VIDA 4O6LA 2VTLA 4OTHA 4FKVA 3FUPA 4FSRA 4J95A 4EEVA 1NA7A 2QNJA 5AP3A 2VTMA 3BCEA 3WARA 1JWHA 4EC8A 4AUAA 2Q0BA 2WU6A 3R21A 2C3KA 3C51A 3TEIA 4NYEA 2Z7LA 3EQDA 4GFGA 3KK9A 4MXXA 4BDAA 5G1XA 3D15A 1ZARA 3ZU7A 3RHKA 3SW7A 2XK8A 3GT8A 3PPZA 3H9FA 4D0WA 5AJQA 4DHFA 3QAME 1V0BA 3OROA 3MFUA 5K4JA 4OR5A 1YI4A 2PVMA 3O51A 4HJOA 5EG3A 4CYIA 3DJ6A 5BUJA 5C4LA 3E8EA 5C26A 2JBPA 2XJ2A 3DXNA 3ACJA 4RX7A 3W33A 3G90X 4L6QA 4BCHA 4EOJA 2XK3A 1UWHA 3W18A 4KKHA 1AD5A 2F49A 3ERKA 4XBRA 3LXLA 3KREA 3HAMA 3DZOA 3RCJA 1YXXA 2JKQA 2BZIB 4HCTA 3QTSA 5AP7A 4FX3A 3CPBA 4MAOA 2HW7A 2J0IA 4BBEA 1GZ8A 3COKA 3N9XA 4DE4A 3C13A 3EQIA 3JXWA 4CQGA 1ZOHA 3TL8A 2XB7A 4LGDA 4MTAA 5DVRA 3BEGA 3FWQA 3E3PA 2IVSA 3A7GA 2GHGA 1OZ1A 4HNFA 3VJNA 1IA8A 3FMDA 5H9BA 5IA1A 4BWXA 3PJ1A 3LFBA 2C1BA 3UOJA 5KE0A 3O96A 4MNEB 2UZVA 2XIRA 2ZYBA 3DBDA 2WTKB 2G1TA 3MVLA 3G51A 4IEBA 4DEHA 4ANLA 1PXMA 4Y5HA 5BVFA 3PE1A 3SD0A 4DH1A 1BI7A 4F7SA 2XIYA 2XM8A 5CXHA 5E8VA 4ZLOA 3RM7A 3BYMA 3GCQA 5AUVA 3A8XA 3ZFYA 4RWKA 1OMWA 1XBCA 5M07A 5BYZA 4LV5A 4RRVA 4GFOA 3UG2A 5DLSA 5DBXA 4UZHA 5I9UA 3OBJA 4QTBA 3ATSA 4RIOA 2J5EA 4F64A 2QCSA 2PULA 4FKJA 4FT7A 3GQLA 4MK0A 4O7ZA 2PE2A 3W8QA 4XX9A 3MSSA 4CXAA 3VVHA 3UPXA 1H08A 1M2QA 3QD3A 3TNPC 2B9FA 2EVAA 4I5HA 2X2KA 2C3IB 4N0SA 3UC3A 4ANMA 2I1MA 4ZTQA 5HI2A 4CSVA 4IVAA 4QYEA 3U4UA 2RL5A 2XRUA 3QA8A 3F9NA 2GSFA 4RFZA 4DGNA 2LAVA 4S34A 3BBWA 3UMWA 1LP4A 3B8RA 2X7FA 4AGCA 2UW6A 3NCGA 4QMSA 4O2PA 5HE2A 3E8CA 5J8IA 4D2VA 5F20A 3UJGA 4YURA 3EB0A 2VX1A 4PL4A 4D4YA 4DG2E 5AUUA 2F7EE 3QGWA 4ERKA 2W96B 3JYAA 2CSNA 4FK3A 5TOZA 3G6GA 3JPVA 4EH7A 4CV9A 1WVYA 1Q8ZA 4FIGA 3LLAA 5HQ0A 4C36A 4OTQA 5CVHA 3L1SA 4IB5A 3RAIA 5IZFA 4L44A 1Q3WA 2VNWA 3NUXA 4FV4A 4G17A 3SRVA 3UNZA 4I5MA 4LUEA 3R7EA 5EOLA 2XJ1A 3BHTA 2XF0A 3CGOA 3GB2A 3VBQA 3C4ZA 4WKQA 1PXKA 4ACGA 4V05A 3R7VA 4QQJA 2V55A 4IM2A 1RE8A 1K2PA 3WYXA 4EQMA 3PIXA 4YJPA 1JPAA 1YI3A 4FT0A 1RDQE 3ODZX 3A62A 3L8VA 4O91A 1ATPE 5BMMA 3ZONA 2E9OA 4MQ2A 3ZBXA 3W2SA 3ZLYA 4AE6A 5IISA 4FL2A 5IQBA 4D9UA 3P23A 4EH3A 4FT5A 2BDFA 2GU8A 5EHYA 3RPSA 3O8TA 3F5GA 2E9VA 3QXOA 4O86A 3NYNA 4NEUA 5C1QB 3GFWA 5DI1A 4AXAA 1BUHA 3LXPA 3QKLA 4BWPA 3LM5A 4D58A 3EYHA 5IMXA 5JT2A 3QRUA 3SDJA 4ZLYA 4JR3A 5T6KA 3NVKI 4BGHA 4U7ZA 4DLJA 2GTNA 3ZLXA 2ZJWA 4ZY6A 3UDBA 2EXEA 3L9PA 1YQJA 1V0PA 3HNGA 2BIYA 4J97A 2RF9A 3WZEA 3JVRA 4BGGA 2O65A 5CVGA 4ASEA 3IDPA 3NUAA 2FB8A 4AZFA 2IW6A 2ZMDA 2W17A 2WPAA 4MH7A 3ZC6A 3BYUA 1Q97A 2HCKA 4O6EA 3DGKA 2YM3A 3GBZA 2UW4A 5AP6A 5EK7A 3A60A 3R8VA 3W2PA 4GUBA 4IWQA 5ITAA 5D41A 3P86A 3KULB 3HYHA 2WMUA 1E1VA 4XNEA 5DN3A 5HICA 4Y95A 5CSXA 3RJCA 4E6AA 3R8ZA 4FKGA 2OIDA 3A7HA 3BYVA 4DA5A 3EJ1A 2PL0A 5K4IA 1U54B 3V5WA 3DBCA 3B2WA 1Q3DA 4F63A 2QOHA 3KXXA 2RG5A 4GU6A 4O0VA 4UWCA 1UU3A 5CEOA 2X6DA 5A4EA 3N4UA 4QRCA 2GQSA 1NVQA 5IQIA 4YTIA 4Q9SA 2O8YA 3HECA 4Z3VA 3OZ6A 4CD0A 3FV8A 2GS6A 2PMLX 3BI6A 2CLQA 4RIYB 4EWHA 1PMVA 4EL9A 4RIXB 3CY2A 4M97A 4WNKA 3O8PA 5I5ZA 1VR2A 3FKLA 4IXPA 3OW3A 5F9EA 2PUNA 1CKJA 4RJ8A 2ZMCA 3BHVA 3FMLA 4O0UA 3Q4ZA 3R28A 3QTUA 1VYZA 4KIQA 4ZMFA 5T3QA 5I4NA 4G3GA 4C58A 2WGJA 4H58A 5CEPA 5J79A 3NNXA 3NRMA 3MVJA 5KX8A 1W0XC 2OO8X 5IDNA 3PSBA 3TV7A 2BFXA 3E88A 3KY2A 5JFSA 3DA6A 2JKMA 3RWPA 2PU8A 3MTFA 1QCFA 2CN5A 4FTLA 3V5TA 3N4VA 1Z57A 2W99B 5EKNA 3EKKA 4ANSA 4RX8A 5BVNA 3F5PA 2WMVA 3UYSA 4D0XA 4YPDA 2GMXA 1LEZA 5HO6A 3FHRA 4IM0A 3PJCA 2V7OA 3A8WA 5GIPE 2BDJA 2OBJA 3SVVA 2FA2A 3BU5A 4EH2A 3ZRMA 3OG7A 2Z60A 1U5QA 2HY0A 2BHHA 4NJ3A 5HO8A 3TUCA 3QX4A 4F7JA 2VTJA 4FUYA 4PPBA 5ANKA 4YPSA 5A4CA 4RA4A 3EQFA 2XKDA 5HCXA 4NFMA 3L8SA 3LM0A 4ZXTA 5IEXA 3H0YA 5M4UA 5EI6A 3C0IA 3CJFA 1YI6A 1CDKA 5E1EA 5CI7A 1H0WA 3U6JA 4UYAA 2PMOX 3ELJA 5HHWA 2RGPA 4IAFA 3PVBA 4PP7A 4QMZA 4IAAA 5EI2A 2F9GA 1A06A 1OI9A 4OW8A 3I60A 2WXVA 3PPJA 4F9CA 4XG4A 4BC6A 4FV2A 1H8FA 1H1PA 1J1BA 2C6DA 4RA5A 3RZBA 3CLYA 3E64A 4AZWA 4BIBA 3MS9A 4FI1A 4W4XA 3FI3A 3T3VA 3Q9XA 3QRKA 3ZLSA 4G9RA 4I23A 4UZDA 1YWRA 3HDNA 4C4JA 4HPUE 4YGAA 3N51A 4X2NA 3PP0A 3Q9WA 2F2UA 3VWAA 2YJRA 1BL6A 4IVCA 5FP5A 2VO7A 1P2AA 5A46A 4EOIA 1SYKA 4MHAA 5DR9A 2W4OA 2O63A 3O50A 4O0SA 2PVKA 4S30A 3R9DA 5CLPA 2HXQA 3EIDA 2R64A 5CASA 5IDPA 2WO6A 3NYOA 3SV0A 5K9IA 5LWNA 3FLWA 1QL6A 4FE2A 2F2CB 2CCIA 5DEWA 5FM3A 4Q2AA 3AC5A 4XG9A 5L2IA 4WG3A 4BDJA 3AQVA 2OU7A 5CU6A 1PJKA 5DWRA 5GJDA 2WIHA 3C5IA 4FVPA 3PWDA 4UMRA 5IKWA 1P4FA 4YLKA 1OPKA 5DT4A 4C37A 2ZV7A 3E7VA 3Q4TA 1IR3A 3GUBA 1E9HA 1NXKA 3NUUA 4NM7A 4E3CA 3NMUF 4JOAA 1WCCA 5CEKA 4QD6A 3RAWA 2VAGA 2H6DA 3ETAA 3NSZA 5HBHA 5L2QA 4P5ZA 2W1HA 3I79A 3RVGA 3FYJX 5LXMA 1H0VA 3C4WA 3F7ZA 5FTGA 3O71A 1Q24A 3V3VA 3KXHA 2YN8A 3D7ZA 1GAGA 2C6OA 2OJ9A 4ZSGA 4GJ2A 2G15A 4CFUA 2X4FA 2X8EA 3PA4A 3MBLA 3U87A 4APCA 4BCFA 5IQCA 2C1AA 3Q96A 5KBQA 4Z9LA 5CNOA 2B9JA 4PTCA 5I9XA 4FZAB 4PDYA 4PUZA 4C38A 3R00A 5DYJA 3I1AA 3PVUA 4I4EA 4GIIA 3VRZA 4AT3A 3MPMA 1Q5KA 4WD5A 1Q99A 4FV9A 4MVFA 4ASDA 3MB7A 1YOLA 5JQ8A 3EYGA 4AOIA 3GU8A 3KF4A 4X2JA 4FSYA 3HMPA 3V8WA 4E7WA 5HG7A 2BIKB 3VS4A 4BFMA 2CKOA 4IIRA 2IJMA 4O7TA 3ULZA 3R1QA 4EOKA 3KULA 3L9MA 4FNZA 5GINE 4U44A 4DG3E 3LE6A 5EOBA 2FVDA 3GC7A 1SVHA 2UW3A 3ANQA 2OXDA 4FNYA 3MA3A 4F99A 4GUEA 3PRFA 4IACA 1U54A 1XH9A 1O6KA 2H9VA 2VTRA 2ZVAA 4LFIA 4YC3A 4C34A 4I5PA 4C2VA 4CMTA 4RVMA 2WTVA 3PYYA 2VX0A 4DEEA 3KMUA 2OZAB 4GSBA 5FEQA 2PMIA 4YJNA 2DS1A 2IN6A 5BMSA 5AP2A 4RIYA 4ZIMA 2FYSA 3AMYA 3IQ7A 3OUNB 4J71A 5JFWA 3ZZEA 4FBXA 1URCA 4JLCA 4RIXA 4L01A 3KKVA 3P4KA 5AIRA 3D83A 3LHJA 4Q5EA 3SOAA 2QOIA 4L7SA 4ONAA 2PVFA 4IAYA 3ZFMA 1GIIA 4QOXA 2B4SB 5EM7A 3DB6A 4WSQA 3BU6A 2BALA 5EM5A 3UQFA 2R3LA 3R02A 5CSHA 5D11A 5TF9A 4PMSA 5LCKA 1MRUA 4BCIA 3GCVA 4KIPA 4FTRA 3P08A 4N4SA 3I0QA 1PW2A 2V7AA 5CX9A 5F4NA 4TNDA 4ENXA 2J4ZA 4H1JA 4IW0A 4TWPA 5LJJA 5LMKC 4QP3A 2BCJA 3BKBA 1A9UA 4FUXA 4U8ZA 5JGBA 4A9RA 2YM8A 4DCEA 3DNDA 1B38A 2X7GA 2YM5A 4L3LA 4RQVA 4DFNA 3P7CA 4FGBA 4F70A 5LVPA 3NNVA 4CLIA 3CR0A 4ANNA 1DI9A 4WOVA 4UY9A 5AX3A 4AT5A 2OKRA 2F7ZE 4IQ6A 3DBFA 5FTQA 3QLGA 3V5JA 4DEGA 3ORMA 3HRFA 4QYGA 3EN7A 5BNJA 3DFAA 5IU2A 4U80A 5AUZA 1VJYA 2OJGA 5A4TA 4CFXA 4IE9A 3CCNA 4FKQA 1FVVA 2XYUA 3C0HA 3KU2A 4IH8A 4TN6A 2QODA 3OCBA 3OW4A 4XV9A 4QMPA 3VNTA 4AACA 2BROA 3VBXA 3LFDA 4GU9A 3GC9A 3ZZWA 2YZLA 2VO3A 2YCFA 3F6XA 3FY2A 5A6OA 1TKIA 3JY9A 4R5YA 4PL5A 1M7NA 5HG5A 4IWDA 4UXLA 3QCXA 1E1XA 3EZRA 4DTAA 2UVXA 3DZQA 4OTPA 3BYSA 2CNVA 2FO0A 2OLCA 3P7BA 5HU3A 1VZOA 5IUIA 3DDPA 5E7RA 1Y8YA 4F9YA 4M84A 1OB3A 2UZOA 2J50A 3K3IA 5DNRA 1R0PA 1PMEA 2YERA 4CEGA 2C6MA 2CKQA 2C30A 4O0WA 4FKIA 2UW9A 3GCSA 4J1RA 2QVSE 2ESMA 4RG0A 4QTDA 2PZ5A 4EUTA 4ZSAA 1PXPA 4BKYA 5L6WL 2PZIA 4GL9A 3EFWA 3CKXA 3PIYA 3S95A 4TT7A 3FL4A 4I4FA 1X8BA 4QYHA 4P90A 4X3JA 3DDQA 4CRLA 3Q5ZA 4B9DA 2IG7A 4G6LA 3MV5A 3IS5A 1ZZLA 5HE3A 2WTKC 4QMLA 4B7TA 1JNKA 2JAMA 2YIYA 4FTTA 1YOMA 2JIVA 3M2WA 4MXYA 2HW6A 4QMVA 5ACBC 3OCGA 3VS2A 2UW0A 5HTIA 4I0TA 4RWLA 3LJ2A 4QPMA 4FL1A 4EWQA 3R73A 2VTQA 2AUHA 3GOKA 4YJTA 3DTCA 4RFYA 2J7TA 3OY3A 4GS6A 4BDFA 2XM9A 4HNIA 3JR1A 4BYJA 2W1FA 5FBNC 4DTKA 4ZZOA 3RK9A 2ITXA 2ITZA 4GW8A 4TWCA 3FQHA 4U41A 3VUDA 5I9VA 5JK3A 3HV4A 4UXQA 2B54A 5IQFA 4MXAA 2X0GA 5CS6A 5HLWA 1UNLA 3E92A 1Y8GA 2YITA 3MVHA 1Q8WA 2RIOA 4RIWB 4C35A 3CBLA 5J9YA 2J9MA 3D0EA 4FTCA 1JSTA 3TIZA 1ZY4A 4MQ1A 4PV0A 3QRIA 2QG5A 3SG9A 4S2ZA 3NYXA 3MH1A 3O8UA 4I6QA 4JDHA 4S33A 1U5RA 4MXCA 4GIHA 2QONA 2CMWA 3OMVA 3T9IA 5AA9A 2BZHB 4YMJA 5J5SA 2YWVA 5A6NA 4RVTA 4AP7A 4R1VA 5ANGA 3DAKA 4TTHB 3V6RA 2OGVA 3QCSA 1GJOA 4XCUA 2P0CA 3S00A 2R3FA 4FTIA 4PP9A 2OG8A 4RJ5A 2CHLA 2Z7QA 3BQRA 4PTGA 5HNBA 4QMQA 2VTSA 5JEBA 4YTHA 2FSMX 1KSWA 3F69A 3R0TA 3PE2A 4GG5A 3G6HA 3Q3BA 4KSPA 4EZ5A 4M7IA 3ZXTA 4BDHA 3UYTA 1JQHA 3TNQB 4EK3A 1JSUA 4QP4A 3DXPA 4ITJA 2UW5A 2JIIA 1J91A 2G9XA 2JDOA 4L3PA 5E8TA 4JG8A 3FSKA 5IA0A 3HA8A 2OZAA 2WELA 4PMPA 3MFRA 3UIBA 2Y0AA 4A4XA 3G15A 2CGUA 4WO5A 5A14A 3PLAE 4MD8E 4KBKA 4FSTA 4EH5A 3CQWA 4FIFA 4DINA 2YM7A 4JL9A 2QG7A 2PZRA 3R1SA 3ODYX 5BVWA 3E93A 5FWKK 3PSCA 4NCTC 4O7VA 2XIZA 5KCVA 1O6LA 2C5OA 3SKCA 3TV6A 4DLIA 1AGWA 3AC2A 3Q2JA 1Q61A 1Z9XA 1OECA 2DUVA 1WBSA 5E90A 4FKOA 4FZ7A 4JJRA 2ZV9A 2BVAA 3NCZA 4I6FA 4JQ8A 5DRDA 3EFKA 3RGFA 4ZZNA 5B0XA 3F88A 4YJUA 4CQEA 2P33A 1SM2A 2HOGA 3QTXA 4ZSLA 3GNIB 4H36A 4LOQA 4KRCA 2IVTA 2IW8A 3QGYA 3NAYA 3SRVB 1G3NA 2A2AA 2Y6MA 3QQFA 5CEQA 4EOMA 3PXZA 4CFVA 4IX4A 5CQUA 4DH3A 3DAEA 2C5YA 4L43A 5AV0A 4GT5A 2BUJA 3ZO4A 4EOSA 5HIEA 4MWIA 5GZAA 5FXQA 4RFMA 4TW9A 3UE4A 2GCDA 3ZUTA 4CVAA 1H07A 1OITA 2WMAA 4ZY4A 4FOCA 4TRLA 2BRMA 2J51A 4R3RA 1W82A 3WZKA 2OF4A 5LWMA 1H26A 3DAJA 3QQUA 2G2IA 4FV1A 4I1ZA 4RVKA 2O64A 3SX9A 3VBWA 4C02A 5KMIA 5AUXA 3UO5A 2CNUA 1YDTE 1H00A 3FQSA 3G9LX 3GI3A 3QRTA 1Q4LA 4IZYA 3MYGA 5IA2A 2WQOA 4TYIA 5AUWA 3GU6A 4JIAA 5GIOE 3TJDA 3U4WA 5TO8A 4EJNA 4LOOA 3FLNC 4V0GB 3SXSA 4DFBA 5FDXA 3FC1X 4FSNA 3KL8A 4W4VA 3ET7A 5FLFA 3LAUA 2R4BA 3NW7A 4O82A 2O3PA 3D9VA 5B2MA 4LI5A 1Y57A 2A27A 4XLVA 1W83A 5JZNA 3RTPA 1TQMA 3H0ZA 4ITHA 4PMTA 5AV2A 4D2WA 4ASZA 5IF1A 3W1FA 2J6MA 1BLXA 2W5AA 4FIHA 1FBNA 4FEQA 4OTDA 5CAOA 4BZNA 4AOJA 3AT4A 5T68A 4LM5A 4XOZA 2R3GA 3WI6A 4ACDA 2XKCA 4DN5A 5HCZA 4F9BA 2OZOA 4MYGA 2OXXA 2IZTA 3IGGA 5HLPA 4G34A 4A07A 4OLIA 3HGKA 4K0YA 1OKWA 3I4BA 5FEDA 1NY3A 3QZIA 2W1CA 1H1RA 1FQ1B 2HY81 2WAJA 1WZYA 3B8QA 4NK9A 5L2SA 4V04A 5AR7A 3CD3A 4FTAA 2ERZE 5E8WA 4QPAA 3EQRA 3I0OA 3MWUA 3R6XA 5F94A 1YHWA 4ZJIA 1HOWA 3IW8A 2OJIA 4H1MA 3WOWA 4X2KA 3RPYA 5FXRA 4O81A 4FR4A 4IFGA 2WMBA 3K5UA 3MH0A 5HKMA 5EDQA 5EH0A 4YZ9A 5AUTA 4V01A 4DG0E 4QP9A 2WTCA 3AOXA 2F7XE 4OGRA 4DEIA 5L6PA 4OT5A 3SHEA 4DT8A 3WZJA 4IAIA 4DGGA 1YXUA 4QYYA 2YHVA 3UIMA 4O0RA 4Y8DA 3BIZA 4Y85A 2W9FB 3MIAA 4XG8A 4AZSA 3VS6A 1Q62A 3VHEA 2HXLA 4TY1A 3ANRA 4G1WA 2Y4IC 5IA3A 3QHRA 1REKA 3HLLA 3ORLA 4XS2A 2X7OA 5FP6A 2CGXA 1ZLTA 4F1TA 4RIWA 5CANA 2QC6A 4XJ0A 3O7LD 3MW1A 3C50A 3MVMA 3LFAA 3OXZA 4JBQA 2R3IA 4BDEA 4HPTE 2XJ0A 5AMNA 2XNOA 2XYNA 3DOGA 3DQWA 3FAAA 3ORZA 4I6BA 5D9HA 5GJFA 3UODA 4RQKA 3TTIA 4AU8A 4C4EA 5HLNA 4I20A 3A4OX 4C61A 4L3JA 2HWPA 3LQ8A 4ZMEA 1PHKA 5KZIA 1XR1A 4FG7A 4XMOA 1JKLA 3FMHA 3BEAA 3E3BX 4FF8A 3CIKA 1XWSA 4EI4A 4K77A 3IDCA 4FTQA 1YDSE 2YJSA 2PUUA 4BL1A 3CTHA 4XHKB 3S2PA 4IANA 2YA9A 3LZBA 4L45A 4EJ7A 2A19B 2BRGA 4UWYA 4J98A 4I21A 4C33A 4FKWA 4PDSA 1TQPA 4NWMA 2XK9A 4P5QA 5BQ0A 1PXIA 4BDKA 4O7SA 2HIWA 5CALA 3OTUA 1FPUA 2IZUA 4I3ZA 4IJ9A 3VBYA 4GKIA 2CGVA 1IAJA 2O5KA 4M68A 2AC5A 4GCJA 2EWAA 2JFLA 3QKMA 3LOKA 2VWWA 4FIIA 5J9LA 4USDA 3WIKA 2YDKA 3GGFA 2WOTA 5E91A 4LQMA 3ZO1A 5CQWA 3MIYA 4K6ZA 5DGZA 1PMUA 3ZSIA 4D4VA 4GJ3A 1HCLA 3DLSA 4QP7A 2GS2A 5L2WA 2YDJA 3QKKA 1ZYLA 1Q8UA 2YCSA 4WBOA 2W05A 5KKRC 2VTNA 4FEWA 1M17A 4NSTA 1S9JA 4RGJA 5EHOA 3R9HA 4FGRA 3DKFA 3QTQA 2OFUA 4D2RA 2BR1A 3DK6A 2OI4X 1M2RA 4FEUA 4AW2A 2C6LA 4I0RA 3AXWA 4I41A 4F1OA 4K2RA 4YC6A 3V5LA 5BVOA 3OBGA 1KE6A 2GNIA 3IW6A 2OIQA 3UQGA 3GFEA 3V8SA 3LVPA 4CLJA 4RMZA 1J3HA 3UP7A 3MESA 4E20A 2CPKE 5H8EA 4ANQA 5FXSA 1XQZA 2GNHA 4N70A 4XP0A 4Z16A 4USEA 3FSFA 1ZZ2A 4U43A 4F7NA 4A4LA 1APME 2GNGA 3KRWA 4CFMA 2UW7A 3MFSA 3TDVA 5KMOA 3K5VA 5ACKA 3PPKA 4O7NA 5AX9A 2GTMA 4HYSA 4YU2A 4R3CA 2JD5A 4DFUA 2ZV8A 4HVIA 3UIUA 3PXYA 2WMXA 4RZWA 2DQ7X 1ZRZA 3VW6A 3ZDUA 2JC6A 3KXZA 5DOSA 1W7HA 5D7VA 5F1ZA 2FUMA 3HUBA 4IMYA 3D2IA 1B6CB 4TYGA 4DITA 5JKGA 3BHYA 4EKKA 3FJQE 4KAOA 2I0YA 4AFJA 3DCVA 4GK4A 4BCNA 2VWZA 3AGLA 3TZ9A 4QQCA 4TKSA 3HV7A 3R8UA 4R78A 3HEGA 1KOBA 1URWA 2X2LA 4FT9A 1J7LA 4V0GA 2JAVA 5FEEA 3ITZA 3KRLA 1OL5A 3HMIA 4FTJA 4TZRA 4O7LA 3ZEPA 2XKFA 3HZTA 5A54A 2W1DA 3FKOA 3QQKA 1KWPA 3MPAA 4O38A 3OF0A 1OVEA 2I0EA 2XNGA 3AD4A 3MY1A 1ZOGA 4RLLA 2VWXA 3WZUA 3HP5A 4MXOA 5LMKA 4F09A 1BKXA 2PVYA 5IEVA 2IZRA 3KXGA 3H9OA 4K1BA 4X0MA 3QU0A 2C3LA 2VN9A 3GQIA 3DU8A 4LMNA 4TNBA 2JDRA 4MCVA 3RKBA 1PF8A 4PF4A 3HV3A 4W9WA 4FYNA 4APPA 2R3QA 4YC8A 1XKKA 4YZDA 3IG7A 1SVEA 4ZSJA 2BZKB 3FE3A 4RJ7A 2JFMA 3AD6A 1U59A 1IEPA 4UBAA 3FQEA 3IW5A 4U6RA 3FXWA 2R7BA 3BX5A 4J96A 3TNWA 4F6UA 3R2BA 3LCDA 4YHTA 5ANEA 3R8PA 1IAHA 3QLFA 4H3QA 2VO6A 4AW1A 3C1XA 2ZM3A 4ZK5A 1YRPA 4C4FA 4AZVA 1PMNA 2R3HA 3OWLA 3D94A 3LFEA 3FZTA 3P78A 4UWBA 1V0OA 3DJ5A 4O0TA 4J8MA 5LARA 4XV2A 3SGCA 3PXKA 3QRJA 4QP2A 1UKHA 3KA0A 1CKIA 4FVQA 3VS1A 1XH6A 4IJPA 4EKLA 4NUSA 2YWPA 4FICA 2XNMA 4GVAA 4JIKA 2Y4PA 1R3CA 4G3EA 5KHXA 3PIZA 4FKPA 4J8NA 4BI2A 4JG6A 2XZSA 2WFYA 3LLTA 2VTHA 4G6NA 2PE0A 4L9IA 2W1GA 2G01A 4W8DA 2QOKA 2J0MB 2W5BA 3BLQA 2BILB 3KQ7A 4JAJA 4O1OA 4PWNA 2C5VA 4NT4A 5EYMA 5FQDC 1CTPE 1JOWB 2QO2A 3MN3A 4NM5A 3TNHA 3FMJA 1OGUA 3OCTA 3NEWA 3GP0A 5I3OA 2Y9QA 1JKKA 4IWOA 3W8LA 4BYIA 4DH8A 2VV9A 4WUNA 2PHKA 4MEDA 2VUWA 5HU9A 5TKDA 3RBWA 4ZEGA 4ZJVA 1H1QA 3HMOA 5DG5A 5L8KA 4KKEA 1EH4A 1KV2A 1OIUA 1Y6BA 2W4KA 4I94A 4O0YA 3QTIA 1CMKE 4L68A 2W5HA 2X1NA 4GT4A 5DFPA 5DMZA 1FGIA 2REIA 3CQEA 3CTQA 4F08A 3L9NA 4KRDA 1JAMA 4D9TA 3DNEA 4EYMA 3LKMA 4FNXA 3VQHA 2W1ZA 4AGWA 4NKSA 3C4EA 2ONLA 4F65A 5BX0A 3TTJA 1PY5A 4AN3A 3PJ3A 1VYWA 4CZUA 3R7OA 2Y4IB 2VX3A 3QQGA 4CFNA 2RG6A 5CYIA 3LW0A 2I0VA 2GPHA 3ZC5A 2XK6A 3FXXA 2V22A 4AGUA 5D1JA 2OK1A 3NIZA 3MA6A 4R7BA 4XV3A 3WF9A 3T9TA 4WUAA 2EU9A 2KTYA 1R39A 2O2UA 2VGPA 3R63A 4JQ7A 4NIFB 4CCUA 3WBLA 1L3RE 2XNNA 2F57A 2OJFE 3GU4A 3WF7A 3G5DA 4WIHA 2RSVA 3C9WA 5L4QA 4EK6A 3EKNA 4G5PA 3SAYA 4ANOA 3COMA 2HZNA 2BTRA 4J99A 4JBOA 5I0BA 4U9AA 3R9NA 5AR8A 3RK5A 3OP5A 4JAIA 2XH5A 3GEQA 5FGKA 5DR6A 1WBWA 2PVLA 5E4HA 4MX9A 3KB7A 5AR4A 3VQUA 4DGOA 3AC4A 5LVLA 2FSTX 3OHTA 3S4QA 2QO7A 4IDTA 4JG7A 1XO2B 4KNBA 4E26A 1ZYSA 5K5XA 1WMKA 4JRNA 2YIXA 3P0MA 4IZ7A 4JS8A 4DT9A 4ACCA 3EZVA 3QQLA 3PP1A 3NLBA 4YZNA 4B0GA 4FT3A 3A7FA 3D2KA 2Z7RA 4RJ3A 1M14A 1ZWSA 1OKYA 3KVWA 3BBTB 3AD5A 5KKRB 3CE3A 3F82A 3U51A 4W9XA 4IX5A 1DM2A 2IZSA 4NCTA 2UVYA 4YZCA 5CT0A 4D4RA 4YBJA 4OAVB 3K3JA 3AT3A 2WMSA 1SNUA 2BRNA 5HG9A 3MB6A 3THBA 3HAVA 2XEYA 4O7YA 4E1ZA 3IPHA 5TE0A 5M53A 3ATTA 2C5NA 1OKVA 3IONA 1UU8A 1O9UA 1ZY5A 4YZMA 5KMLA 1FOTA 2VTIA 3BYOA 4ID7A 2V0DA 3E62A 1YDRE 2X39A 3I5ZA 2IW9A 4R77A 4FV6A 2IVVA 4XBUA 4E4LA 4A4OA 2GQRA 4MKCA 4QMOA 5KMJA 1FMKA 1UNGA 2X2MA 4RC3A 2GFSA 1OKZA 3COIA 3U9NA 3OXTA 4HGLA 4U45A 1ZMVA 2YM6A 4BICA 3BGPA 4DFLA 4L8MA 1BL7A 2R9SA 2YAAA 4HW7A 4AA0A 4NZWB 2XNPA 3FLZA 3LCTA 4FSMA 4PPCA 4C4IA 1W8CA 1V1KA 3F5XA 2VWVA 2YACA 4YHFA 1XH8A 4PX6A 3RINA 3RNYA 3BHHA 4TWNA 3LCOA 4UB7A 5DT0A 4O22A 2UZWE 3V01A 1OL1A 4GFMA 2CKEA 3VUMA 5JH6A 3ZRKA 3Q52A 3HP2A 4GV1A 5CZIA 4X7QA 4R7IA 3TZ7A 3UVPA 2I40A 5HVJA 3DJ7A 3T3UA 3R1YA 4NTSA 2XNEA 3CY3A 3KMWA 5HTBA 4CKJA 1ERKA 2WB8A 4OAUC 3DY7A 4CZTA 4R8QA 3QX2A 4P2KA 3TACA 1F3MC 3VAPA 4OTGA 3R9RA 4XLIA 4WG5A 3C4XA 3D5WA 4WG4A 3A7IA 3CPCA 2VD5A 4EYJA 5CAPA 5IQHA 2R7IA 1Q8TA 5IPJA 4RT7A 5A3XA 5CI6A 4GK2A 5CAUA 3UZTA 4ZP5A 3LPBA 4M69A 2QO9A 4MBIA 4HVSA 2C68A 3W2OA 2UW8A 5ANDA 3LFSA 2JEDA 1PXJA 3L8XA 1DAWA 3NW6A 2R3RA 5ANOA 4BR3A 1CSNA 2X81A 1UVRA 2Z2WA 1W84A 4B99A 3N4TA 2YFXA 4YHJA 3AGMA 3EH9A 2B52A 4IAZA 2C69A 5AWMA 2Z7SA 2XNBA 2VTTA 5LVMA 3FZOA 3NZ0A 2YDIA 1R1WA 1H25A 3ZUUA 4E6QA 2JIUA 3QTRA 4GG7A 4M66A 4RWIA 4K8AA 3NS9A 3VJOA 4EHEA 2XP2A 3WE8A 5GZ8A 3IOKA 5CENA 2UZEA 3QQJA 3BGQA 2X9FA 4RC4A 3VS0A 4Q5HA 5IMEA 5JN2A 3GCUA 3OWJA 4YBKA 4AX8A 3NNUA 4H3BA 4C62A 4BF2A 2NNWB 1FGKA 3NIEA 5DIAA 4BBMA 4RVLA 4CCBA 5JGDA 3RPRA 4IC7A 1MQBA 4RJ6A 5D7AA 3LFNA 3MH2A 3POOA 3HDMA 3UMXA 3GOPA 4GRBA 5I9YA 2GQGA 4M14A 1F5QA 2J0LA 3AC1A 3NGAA 4DBXA 3S3IA 3ZXZA 4A9YA 3TUBA 3KCKA 4NIFA 3ZM9A 5AR2A 2BFYA 4FZFB 3W16A 3ZCLA 4ZAUA 3O0GA 5HBEA 5LMBA 2QLUA 4ITIA 4XOYA 4KUJA 1BX6A 4D5KA 4DEBA 2UZLA 2YLFA 2UZUE 2W4JA 2YCQA 3Q60A 4KWPA 4FKLA 3UVQA 4C3PA 4F6WA 3NPCA 5FD2A 2WQMA 4G6OA 1PKGA
chains in the Genus database with same CATH superfamily
5JRQA 3ZRLA 5M4CA 2ERKA 4YLLA 4G3CA 1AQ1A 4ANBA 4BHNA 2B9HA 4LV8A 4XG3A 3FXZA 2E9UA 2JLDA 3LIJA 3SW4A 2DWBA 3RZFA 3EFLA 4MXZA 4B4LA 4BTJA 1G5SA 2A1AB 4EK8A 2VTPA 3PVWA 4BIEA 4QDVA 3E8DA 2JKOA 1NW1A 2X0OA 5FRIA 4LG4A 3ZLWA 4H05A 2PVHA 2JDVA 5AR3A 1KOAA 3RAHA 3VUHA 3ZDIA 2ITYA 3E87A 2WMWA 5AM6A 1J7IA 3F66A 5KMMA 4NW5A 1IASA 1PXNA 3HVCA 4FOBA 3I7BA 3VONA 3RP9A 5J1VA 1YXVA 2PZYA 5GHVA 4M0YA 4AA5A 4KB8A 2BAKA 5KZ0A 1KE5A 3Q4UA 5HE0A 3PA5A 2ONLC 3KK8A 5B7VA 4XH6A 4D1SA 5HESA 3F2NA 4KIOA 2ZV2A 4E6CA 2RFDA 2W0JA 4Y83A 5CWZA 4RZVA 2WOUA 1GIHA 1KE7A 5AM7A 3TG1A 4BWKA 5L6OA 3KRRA 2BRHA 3HA6A 4KA3A 3KN5A 3W2CA 2VGOA 1XH7A 2Z8CA 3OEZA 2GHLA 4I22A 5HNGA 1SZMA 2QU5A 5EW8A 2Y7JA 4NL0A 2PYWA 2QD9A 5EI8A 1WVWA 1YHSA 3NWWA 4IB3A 3M11A 4NM3A 4RJ4A 5HGIA 1YOJA 4FODA 2XARA 3LQ3A 3PZHA 3PY1A 4O21A 3F2AA 4N6YA 3TJCA 5DR2A 4C4HA 5DT3A 3FLQA 5FDPA 1B39A 3QUPA 2BDWA 2BPMA 5C8KA 4ALUA 4HYHA 4NM0A 5JFVA 2WKMA 1MRYA 2B0QA 3QZHA 1UA2A 4L00A 4OT6A 5AADA 3W2RA 4IM3A 3EN9A 5DPVA 4L46A 3NX8A 3NUYA 4C3FA 5K0XA 4E5BA 4FMQA 4FSQA 3RK7A 3UZPA 4I5CA 1ZAOA 1QPCA 3ENHA 4TPTA 4K9YA 3I6UA 2WMQA 1T45A 4EHVA 3TZ8A 4G9CA 3ORKA 3GVUA 4P7EA 4YJQA 4Y72A 3WZDA 4O27B 3ZFXA 3SC1A 4S31A 4FSWA 2B1PA 2IF8A 3OEFX 3QXPA 5EFQA 4AZTA 4FZ6A 4QMMA 5LCJA 1UU9A 2Y8OA 4LUDA 5H2UA 2PVJA 4QT1A 4CT2A 1MUOA 2QOLA 4QYFA 3R7UA 2EXMA 3R30A 4DAWA 5IEYA 4FIJA 5EDPA 3KC3A 3DBQA 4CKIA 4OTIA 1YXTA 4DC2A 3UBDA 3S0OA 5K3YA 2CCHA 4TYJA 4A9UA 1WBTA 2J90A 2ZB1A 3ZMMA 3HMMA 4E8AA 3PRIA 3AKLA 4DCAA 3ZEWA 4LGGA 3RM6A 4E5WA 4IB0A 3V6SA 3BGZA 5B2LA 4WRGA 3R71A 3QFVA 4UMUA 4HVGA 2PVRA 5ICPA 5KBRA 1A48A 4R3PA 4XEYA 1OIQA 2XAMA 4FEVA 2HZ4A 2ITNA 3S1HA 3A2CA 4JRVA 3Q6UA 4FKRA 4O0XA 1YHVA 2YIWA 3QYZA 3D5XA 3IO7A 4YZBA 4EHZA 5EQYA 2XKEA 2WTIA 5L8LA 4YO4A 1G8AA 4B8LA 4CRSA 5I9ZA 3ZSGA 1I09A 3VUTA 2OH0E 3TT0A 4AAAA 3FDNA 4U3YA 4DGMA 3F3TA 4JI9A 4G3DA 2ITOA 1PYXA 1YVJA 3BE2A 5HVYA 3FMMA 4BCKA 2GHMA 4DH7A 4FYOA 4R1YA 5JQ5A 5FUTA 1OPJA 4OTWA 5J7HA 4EK4A 3R8MA 4G5JA 5AA8A 4C0TA 1ZYDA 3UC4A 3IW7A 4BCOA 5C01A 4XV1A 5M4IA 2PMNX 5ANJA 3NW5A 4WT6A 4DFZE 3UNKA 4U81A 3ZO3A 3KXMA 3M1SA 2WNTA 3OCSA 3GC8A 4YJSA 1K9AA 3PXQA 2QU6A 2UZTA 2QQ7A 4QTCA 3GU5A 4GT3A 5CF8A 3ORPA 4FSZA 5M56A 1H24A 4JDKA 3PG1A 3AMBA 4NW6A 4ZJJA 5B2KA 3TYKA 5CF5A 2WQBA 4PL3A 3DKCA 4FVRA 2AQXA 3EMGA 3ACKA 4CYJA 1LUFA 3QCQA 4D1ZA 3MH3A 4HCUA 4QMTA 5DH3A 2LGCA 4FIEA 1YW2A 3NFFB 5J7BA 2R3PA 4B6LA 4UX9A 2ACXA 4LYNA 4CMOA 3TM0A 2Y6OA 3PY0A 3VHKA 4RPVA 4E4MA 3EFJA 4USFA 4HGTA 3NUSA 4JT3A 4E6DA 4WHZA 2ETKA 4BBFA 4BTFA 4HVHA 4M0ZA 3OT8A 4IZAA 3P1AA 4F0IA 3NAXA 2R3OA 4ACHA 2OW3A 3OOMA 3TCPA 2C4GA 2RFSA 4JNWA 4BDBA 3L8PA 4JXFA 3BWFA 4DFYA 4ALVA 2XA4A 3KN6A 2WHBA 2NP8A 2UUEA 4FK6A 1XBAA 3ZUVA 4O1PA 3W10A 3QD4A 1QPJA 2FSOX 3AC8A 3AG9A 3D14A 3BU3A 2QHMA 4U0IA 5EW3A 5M51A 2XCHA 3EQPA 4K11A 4HZSA 4JQEA 4QPSA 2RFEA 2XS0A 3KRXA 4II5A 3CC6A 3SG8A 3DPKA 1LEWA 4Z55A 3ZTXA 3DBEA 3R2YA 3VF8A 2P2IA 4XRLA 5GNKA 2J5FA 5F95A 4CFWA 4O2ZA 3AC3A 3KRJA 4CT1A 2C47A 3I6WA 4G16A 3VC4A 3GENA 3DXQA 2ZB0A 4PY1A 4X3FA 2VNYA 3QA0A 3ORXA 5C4KA 4FV3A 4N6ZA 5FBOA 3LMIA 4YSMA 5HIDA 4ZTMA 4BI0A 1CKPA 2PSQA 2QURA 5KUPA 1REJA 2BTSA 4MBJA 3OC1A 5ETIA 2VZ6A 2VWYA 3LJ1A 3DS6A 3V5QA 4O84A 4Q9ZA 2WZJA 3KF7A 3FYKX 3FI4A 1U4DA 3QBNA 3F3UA 4HZRA 3PZEA 3Q4CA 3VBTA 1KE8A 3ZOSA 5AAEA 4KINA 3ID6C 4XP2A 4OTFA 4YO6A 5I9WA 3VO3A 1P5EA 4TXCA 5EHLA 3ZBFA 4CTBA 3Q5IA 4BI1A 3B2TA 3L9LA 4RX5A 5HX6A 4RSSA 5HX8A 3NR9A 3KXNA 2QOFA 4XG6A 3FZ1A 3IK3A 3LJ0A 3RWQA 3QTZA 1DI8A 2XIKA 3P79A 3VS5A 3BQCA 2XBJA 4AT4A 2B9IA 5KHWA 5KO1A 2QHNA 2A0CX 2R3KA 4IFCA 4E93A 3TN8A 3QUDA 4IAKA 4BCGA 3C5UA 2ZOQA 3F61A 2PPQA 3SA0A 1WBVA 1H27A 2O0UA 3MY5A 4O96A 4C3RA 4DBNA 2BKKA 4LRKA 4RBLA 4KBCA 3IOPA 5EKOA 3ROCA 4UMTA 4EORA 2YCRA 3LXKA 4AW0A 3BELA 3A61A 2I7QA 2ITTA 1OIRA 4WBBB 2NO3A 4BVUA 1QPDA 3BV3A 2XBAA 3HKOA 4ZTNA 1JKTA 5C8MA 1U46A 3DK3A 3QYWA 1BYGA 3QWJA 4L52A 2UZBA 4F78A 3ZHPC 5D10A 1WVXA 5LMAA 3G33A 3M42A 3V5PA 1H28A 4JX3A 4ZTLA 4RX9A 4FTMA 5HE1A 3DB8A 3UG1A 3DQXA 2UV2A 4EOQA 1Z5MA 3COHA 2C0IA 4Y73A 3RMFA 1YWNA 4EUUA 1O6YA 2WQEA 3SLSA 3MDYA 3SQQA 5KMNA 4W4WA 3SXRA 3VN9A 3QTWA 4X2GA 1ND4A 5E8SA 2C0TA 4YUQA 5CU3A 2OF2A 2XEZA 2RFNA 3FMKA 4JR7A 5JZJA 4BCPA 4X21A 3NYVA 5M44A 1KUTA 5IH4A 4TWOA 4F7LA 5HNIX 4PMMA 3U6HA 3UTOA 4QMNA 2YIQA 2Z02A 3ALNA 3KEXA 4GYIA 4PPAA 2J2IB 1PKDA 4AN2A 4QQTA 4XP3A 3RALA 1ZOEA 3CQUA 3ORNA 2XRWA 3OY1A 2GS7A 1OL2A 2XVDA 5BVKA 3T8OA 3BL7A 4O7RA 5AR5A 3IECA 2YLEA 4BTMA 2OWBA 4QP1A 4F9AA 4BKZA 3WILA 4HYIA 2IVUA 3F2RA 1G8SA 1WFCA 2OSCA 2WQNA 4JDJA 2C6EA 2CKPA 5ANIA 3KCFA 4JBPA 1S9IA 3TV4A 3Q53A 5M06A 3LCKA 3R8LA 3E8NA 2GNFA 3OOGA 2JITA 4F1MA 4FC0A 4L53A 3U55A 3C0GA 4P4CA 2G2HA 4LL5A 4NFNA 2WTDA 5HD7A 5E9EA 3EQHA 2W1EA 2P3GX 1FVTA 2UZDA 1XBBA 4HOKA 3VBVA 4W8EA 3KFAA 4MD7E 5KNJA 2A4LA 4ENYA 1I44A 2R0UA 3G0EA 3EQBA 3VF9A 4LMUA 3NDMA 1WBNA 2XCKA 4EH6A 2H96A 2P2HA 4AF3A 5A9UA 4N57A 4XG2A 3QZFA 5AP4A 3HUCA 1P4OA 4AOTA 1HCKA 4U3ZA 3POZA 3OXIA 4LRJA 4BZOA 5C8NA 2X8IA 4O83A 4E4NA 1H1WA 3ORTA 4R5SA 3UO4A 5H8BA 2PVNA 1VEBA 4D5HA 3BV2A 2W1IA 3TKIA 4F6SA 3HV5A 3IW4A 5A4LA 2R2PA 2IPXA 2C6IA 4KKGA 2W9ZB 3KGAA 5TR6A 4FTOA 5GJGA 3U9CA 4ERWA 5BUEA 3FPMA 4XRJA 5JSMA 4WSYA 2YABA 4W4YA 2WU7A 3OUKA 5EYKA 4DGLC 1STCE 4TYHB 2ETMA 4GYGA 4IX6A 5LVOA 4D2SA 4A9SA 5JRSA 4ZTHA 4MNFA 2NRUA 2G2FA 3KMMA 3SOCA 4FNWA 2GFCA 4ZS4A 3UPZA 1NT2A 3MTLA 3O17A 4QEBA 4A7CA 4FV8A 2A98A 2V62A 3H4JA 3D7TB 3OFMA 4YTFA 1BI8A 1FVRA 4H39A 4M69B 3OT3A 4UYNA 5CF6A 3TUDA 4IADA 2PUPA 3OWKA 4G31A 3R83A 3RPVA 3K54A 4M12A 4PRJA 1LR4A 1OL6A 3Q9ZA 4EZ3A 1Q8YA 2WMTA 5BYLA 2BAQA 3F5UA 4F0FA 2IWIA 4HGSA 4CG9A 3DTWA 2JDSA 4A06A 4I6HA 3A4PA 4X2FA 5H3QA 3AT2A 2J0KA 1G8KA 1TFFA 1MP8A 5IUGA 2P55A 3QC4A 3FMNA 5A4QA 4KIKB 4DHIB 3IGOA 5KMKA 4G3FA 5AP1A 2E2BA 5E1SA 3PLSA 3FKNA 5CEIA 4CKRA 3NUPA 4QDEA 2HZ0A 3HMNA 4YJVA 4HCVA 2C5XA 3DT1A 4YSJA 4IWPA 4CGAA 1H1SA 4K18A 4MBLA 2W7XA 3UO6A 1RJBA 3W0SA 4MNEA 2R0IA 3OTVA 3HRBA 2BRBA 3EN4A 3GU7A 3NUNA 5AIKA 5G6VA 5M4FA 3U8WA 4FL3A 5J9ZA 1OBGA 1WBOA 5DEYA 5L8JA 3O2MA 5JFXA 3BHUA 5C03A 2JBOA 5K5NA 3UNJA 4MWHA 5DHJA 4QNYA 2I6LA 4MF1A 4X6RA 2ITWA 4YR8A 3W55A 2W06A 2YISA 3E63A 3TWJA 2FH9A 3WIGA 3ZH8A 2Q83A 4TYEA 5IQDA 3RAKA 3D5VA 4ZY5A 4FV7A 4Y5QA 1LPUA 4KBAA 3FMEA 2WTJA 4X3FC 4YNEA 2QR7A 4AZEA 5IA4A 3MFTA 3WF8A 2ZDTA 5CVFA 1QPEA 3C7QA 3ZYAA 3QD2B 4WA9A 2KULA 3NNWA 2UZNA 2QI8A 1Y91A 2WEVA 3II5A 3O23A 5HEZA 1GZNA 4NU1A 3V8TA 4S32A 3LMGA 3UQCA 1G8JA 3UP2A 4JX7A 3H30A 2CJMA 3GCPA 5D12A 4EONA 3FI8A 2ZM4A 3PA3A 4FTUA 2NRYA 2BZJA 3F7WA 2CLXA 3PG3A 2VRXA 5IH6A 4EBVA 2RKUA 3RCDA 2H8HA 2UVZA 2YIRA 3G0FA 5LOHA 2X6EA 3GXLA 4BDIA 2ZAZA 3TKHA 2C6TA 2QOOA 4EC9A 5EQPA 2CGWA 4C4GA 2J0JA 2YAKA 5ETCA 3RHXA 3BLHA 3UDTA 4EQUA 5FG8A 3UGCA 3H10A 4J52A 1NVSA 1UU7A 4JVGA 2BMCA 3FBVA 5EM6A 4DH5A 4EQCA 2ETRA 2IEWA 3CEKA 2XK4A 4ASXA 5CF4A 4OTRA 5EYDA 4A9TA 5LQFA 4BRXA 4PNIA 2JDTA 3BRBA 1P14A 4FTNA 4EOLA 4R6VA 2PWLA 1FINA 2HAKA 1KV1A 5CSWA 5I3RA 3FLSA 2F4JA 4I93A 4TL0A 4ZSEA 5CU4A 5J87A 5IA5A 5JMSA 1PYEA 3QL8A 5HD4A 4UMPA 1YKRA 1XH5A 4IZ5A 4L7FA 5CY3A 4Y46A 5H8GA 3TNIA 4BTKA 3FI2A 5BVDA 3I81A 4U97A 1GY3A 3WE4A 4FG9A 4G2FA 2X0PA 3BZ3A 2GNJA 3HV6A 3LFQA 2EUFB 1OL7A 4IVDA 4O4FA 5AV3A 3ROYA 4RC2A 4F4PA 2XUUA 5AAGA 1J1CA 2C0OA 4MD9E 3DK7A 5LVNA 4EH4A 2OXYA 4ALWA 3H3CA 4C57A 4EH9A 3F3ZA 3PSDA 5CNNA 5E8ZA 3ORIA 1OBDA 5AUYA 2WD1A 3PFQA 5L3AA 4J7BA 2OICA 4BHZA 4ZZMA 4BKJA 1GOLA 3JVSA 4CZYB 4QMUA 4U42A 4BCJA 5M09A 3K2LA 4WNOA 4NKAA 3AMAA 4GK3A 3CKWA 2B55A 4BZDA 3TZMA 4YJRA 4JBVA 2H34A 2OFVA 4WNPA 2OJJA 4ZTRA 4F9WA 4KS8A 3QALE 4PDOA 1Y6AA 2QR8A 4QO9A 4TYHA 1JSVA 4QMXA 4QTEA 2WMRA 5M55A 4ZS0A 4ZLZA 3SXFA 1J7UA 3VUGA 4OBPA 5BPYA 4BDDA 5HO7A 3CP9A 4M3QA 3UOHA 4CFFA 1JKSA 2SRCA 1RQQA 3CXWA 4RLKA 3TXOA 2PTKA 4D2PA 4KABA 4M8TA 3KIOC 4FEXA 4ARKA 4WNMA 5FM2A 2QKWB 1R78A 3A99A 3D7TA 3FZPA 4L67A 3I5NA 3QD0A 3W2QA 2HWOA 3BLRA 3PJ8A 3ZO2A 3ZM4A 3EHAA 1TVOA 1ZYCA 3H9RA 5HORA 2CDZA 1GZOA 2EB3A 3OS3A 3JY0A 4KS7A 4E4XA 2C3JA 5CZHA 3FZRA 4EOPA 5HOAA 3TKUA 2ITUA 5AP0A 1UNHA 3MJ1A 3Q6WA 2B53A 1XHAA 5CAVA 5M08A 5IQGA 1PRYA 5ETFA 3QCYA 4PDPA 4AN9A 1K3AA 2AC3A 4U5JA 4XG7A 3EL7A 4U40A 4HVDA 3UZRA 4KIKA 4IB1A 4CNHA 3TMOA 2FSLX 3EN5A 5EDRA 4BCMA 4YTCA 3A7JA 3CD8A 4PTEA 4MF0A 1SVGA 3FLYA 1SNXA 2HENA 2JGZA 5AP5A 5M57A 3GC0A 4K33A 3PXRA 2AYPA 3VULA 3VUIA 1QMZA 2VO0A 4M13A 3PXFA 4OBOA 5CXZA 3V51A 3LFCA 4L42A 1GIJA 2B7AA 5IQAA 3JUHA 3O7LB 5AEPA 3ALOA 4EHGA 4NTTA 3HX4A 5J5TA 4ORKA 4AAYA 4GMYA 4EZ7A 1ZMUA 3EL8A 4KSQA 4IVBA 2YEXA 3E7OA 4IX3A 4D55A 2YM4A 1M7QA 3WF6A 5CSPA 4IHPA 3OD6X 3JS2A 3I7CA 3P9JA 2HK5A 5K0KA 4FV0A 1MRVA 5FTOA 3PWYA 4QNAA 1YWVA 3MJ2A 2HZIA 2XK7A 2JKKA 4B8MA 1DAYA 1DS5A 2BAJA 4D2TA 3VS7A 3EN6A 3C4CA 5ETAA 5HCYA 3UOKA 2AEGA 3QHWA 4ZOGA 3PTGA 5J1WA 5HTCA 4HYUA 5TT7A 2C6KA 1ZMWA 3U54A 4PQNA 2P4IA 4OBQA 3G9NA 4EBWA 3FC2A 3EQGA 3TDWA 4LRMA 3BL9A 4CV8A 4LGHA 1MQ4A 1GZKA 1CM8A 4GVJA 4F0GA 4H3PA 2OIBA 5AV1A 4CTCA 3EQCA 2WIPA 4UV0A 3EWHA 1BMKA 1H01A 4O7WA 5BYYA 5HIBA 4YP8A 4FSUA 2EB2A 3LXNA 2CNQA 3PVGA 5CEMA 4NH1A 3LMHA 4CG8A 3MY0A 4FV5A 4UN0C 4Z7HA 1RW8A 5JGAA 2WTWA 4X3FB 1XJDA 4EK5A 1WAKA 4E73A 1L8TA 1WBPA 3QWKA 1H4LA 1UKIA 2PUIA 3CJGA 3DFCB 2I0HA 4BGQA 4C2WA 1R0EA 3LQ5A 4UMQA 5CTPA 3DKGA 5BUIA 1IG1A 4I92A 4LV7A 1M52A 3FL5A 1IRKA 3Q32A 4C8BA 3D5UA 4FTKA 5CT7A 2R5TA 5AV4A 3R7GA 2OH4A 5HG8A 4X6QC 3IKAA 4QP8A 3RI1A 4OUCA 3TI1A 3P5KA 4AS0A 4C7TA 3UDZA 3W32A 3TIYA 4BDCA 4BN1A 1KE9A 1YXSA 1SMHA 4U79A 3IDBA 1Q41A 4QMWA 2BKZA 2XMYA 4AFEA 4IBMA 5GZ9A 4XYFA 5CAQA 2GNLA 5E8YA 2QOQA 3LFFA 4AG8A 1ST4A 1UV5A 1W2DA 3OVVA 4M15A 5BVEA 3UIXA 3WF5A 3R1NA 2PZPA 5IG1A 3BWJA 2HYYA 3CTJA 4DF3A 5BV3A 5J95A 2BHEA 2EXCX 4YLJA 4ACMA 1TQIA 1M2PA 4BIDA 2R3MA 4PNKA 1F0QA 3FEGA 2WEIA 3REPA 3ULIA 4AA4A 3EOCA 3PUPA 2PY3A 5CU0A 4LL0A 1T46A 3QF9A 5EM8A 4GKHA 2E9PA 2V5QA 3MPTA 2GDOA 2YZAA 3MI9A 3R01A 4FKSA 4QMYA 3VW8A 3RNIA 2PK9A 5DE2A 3R22A 4AW5A 2QLQA 2QKRA 4ZTSA 3BPRA 3FPQA 3R7YA 3ZS5A 1JLUE 3CGFA 4CMUA 2ZM1A 3QC9A 1JVPP 5CU2A 3V04A 5C27A 2XIXA 4GEOA 4D1XA 4BCQA 4AWIA 2X9EA 3FY0A 3BE9A 1W98A 4BY9E 3QQHA 4FG8A 3G2FA 4DDGA 2VWIA 3KVXA 3HRCA 2FGIA 4FRFA 3F3WA 4EH8A 2X4ZA 4DEAA 5DA3A 3Q04A 5EW9A 1JBPE 3FHIA 3DKOA 4DYMA 1ZYJA 4I0SA 4I24A 3RPOA 2PE1A 5EQEA 2Q0NA 3F3VA 1XMMA 1OPLA 3Q9YA 2X8DA 5IUHA 3U6IA 4AE9A 3PJ2A 4AQCA 3PDTA 4C59A 1FMOE 3LCSA 3R7IA 3R9OA 4AGDA 2VTAA 5AFVA 3PFYA 3FZSA 2VWBA 2VTOA 4XUFA 3ZSHA 4D4SA 2QOBA 3VS3A 4J53A 3D4QA 4RWJA 3HL7A 4QP6A 1NVRA 2E9NA 4AQKA 2R3NA 4M67A 2IO6A 4WRSA 1IA9A 4IDVA 3CS9A 3NVMB 5E8UA 5E92A 4DTBA 1OM1A 2ITPA 1ZXEA 2CN8A 5CSVA 2R3JA 3UVRA 1XH4A 2ITVA 5AAFA 3DLZA 4DEDA 1OIYA 3E5AA 2QOCA 4QQ5A 5IQEA 4KD1A 4UALA 4Z7GA 2ZDUA 3QZGA 4QTAA 3UOLA 3QUEA 4IC8A 4DFXE 5EYCA 3PY3A 4AXFA 2XANA 4JDIA 4FKUA 2VWUA 2DYLA 3MGYA 5IH5A 3Q2MA 5DRBA 5C9CA 3DV3A 3VRYA 2VU3A 3C4FA 4GH2A 3VUKA 4BB4A 4FZDB 4E5AX 2ITQA 1OUYA 4R7HA 4YNOA 1OUKA 1GNGA 4UEUA 4FKTA 3R04A 5HZNA 1PXOA 1PXLA 5E8XA 5L2TA 3ENMA 3CSVA 4EOOA 4BDGA 5HVKA 2NPQA 4HGEA 3WYYA 3OWPA 3P7AA 4LOPA 4YJOA 4D28A 4FA2A 5HBJA 1UWJA 2HELA 4NJDA 3VIDA 4O6LA 2VTLA 4AXEA 4OTHA 4FKVA 3FUPA 4FSRA 4J95A 4EEVA 3W0NA 1NA7A 2QNJA 5AP3A 2VTMA 3BCEA 3WARA 1JWHA 4EC8A 4AUAA 2Q0BA 2WU6A 3R21A 2C3KA 3C51A 3TEIA 4NYEA 2Z7LA 3EQDA 4GFGA 3KK9A 4MXXA 4BDAA 5G1XA 3D15A 1ZARA 3ZU7A 3RHKA 3SW7A 2XK8A 3GT8A 3PPZA 1OGYA 3H9FA 4D0WA 5AJQA 4DHFA 3QAME 1V0BA 3OROA 3MFUA 5K4JA 4OR5A 1YI4A 2PVMA 3O51A 4HJOA 5EG3A 4CYIA 3DJ6A 5BUJA 5C4LA 3E8EA 5C26A 2JBPA 2XJ2A 3DXNA 3ACJA 4RX7A 3W33A 3G90X 4L6QA 4BCHA 4EOJA 2XK3A 1UWHA 3W18A 4KKHA 1AD5A 2F49A 3ERKA 4XBRA 3LXLA 3KREA 3HAMA 3DZOA 3RCJA 1YXXA 2JKQA 2BZIB 4HCTA 3QTSA 5AP7A 4FX3A 3CPBA 4MAOA 3NFGB 2HW7A 2J0IA 4BBEA 1GZ8A 3COKA 3N9XA 4DE4A 3C13A 3EQIA 3JXWA 4CQGA 1ZOHA 3TL8A 2XB7A 4LGDA 4MTAA 5DVRA 3BEGA 3FWQA 3E3PA 2IVSA 3A7GA 2GHGA 1OZ1A 4HNFA 3VJNA 1IA8A 3FMDA 5H9BA 5IA1A 4BWXA 3PJ1A 3LFBA 2C1BA 3UOJA 5KE0A 3O96A 4MNEB 3P5JC 2UZVA 2XIRA 2ZYBA 3DBDA 2WTKB 2G1TA 3MVLA 3G51A 4IEBA 4DEHA 4ANLA 1PXMA 4Y5HA 5BVFA 3PE1A 3SD0A 3AKJA 4DH1A 1BI7A 4F7SA 2XIYA 2XM8A 5CXHA 5E8VA 4ZLOA 3RM7A 3BYMA 3GCQA 5AUVA 3A8XA 3ZFYA 4RWKA 1OMWA 1XBCA 5M07A 5BYZA 4LV5A 4RRVA 4GFOA 3UG2A 5DLSA 5DBXA 4UZHA 5I9UA 3OBJA 4QTBA 3ATSA 4RIOA 2J5EA 4F64A 2QCSA 2PULA 4FKJA 4FT7A 3GQLA 4MK0A 4O7ZA 2PE2A 3W8QA 4XX9A 3MSSA 4CXAA 3VVHA 3UPXA 1H08A 1M2QA 3QD3A 3TNPC 2B9FA 2EVAA 4I5HA 2X2KA 2C3IB 4N0SA 3UC3A 4ANMA 2I1MA 4ZTQA 5HI2A 4CSVA 4IVAA 4QYEA 3U4UA 2RL5A 2XRUA 3QA8A 3F9NA 2GSFA 4RFZA 4DGNA 2LAVA 4S34A 3BBWA 3UMWA 1LP4A 3B8RA 2X7FA 4AGCA 2UW6A 3NCGA 4QMSA 4O2PA 5HE2A 3E8CA 5J8IA 4D2VA 5F20A 3UJGA 4O4DA 4YURA 3EB0A 2VX1A 4PL4A 4D4YA 4DG2E 5AUUA 2F7EE 2X0QA 3QGWA 4ERKA 2W96B 3JYAA 2CSNA 4FK3A 5TOZA 3G6GA 3JPVA 4EH7A 4CV9A 1WVYA 1Q8ZA 4FIGA 3LLAA 5HQ0A 4C36A 4OTQA 5CVHA 3L1SA 4IB5A 3RAIA 5IZFA 4L44A 1Q3WA 2VNWA 3NUXA 4FV4A 4G17A 3SRVA 3UNZA 4I5MA 4LUEA 3R7EA 5EOLA 2XJ1A 3BHTA 2XF0A 3CGOA 3GB2A 3VBQA 3C4ZA 4WKQA 1PXKA 4ACGA 4V05A 3R7VA 4QQJA 2V55A 4IM2A 1RE8A 1K2PA 3WYXA 4EQMA 3PIXA 4YJPA 1JPAA 1YI3A 4FT0A 1RDQE 3ODZX 3A62A 3L8VA 4O91A 1ATPE 5BMMA 3ZONA 2E9OA 4MQ2A 3ZBXA 3W2SA 3ZLYA 4AE6A 5IISA 4FL2A 5IQBA 4D9UA 3P23A 4EH3A 4FT5A 2BDFA 2GU8A 5EHYA 3RPSA 3O8TA 3F5GA 2E9VA 3QXOA 4O86A 3NYNA 4NEUA 5C1QB 3GFWA 5DI1A 4AXAA 1BUHA 3LXPA 3QKLA 4BWPA 3LM5A 4D58A 3EYHA 5IMXA 5JT2A 3QRUA 3SDJA 4ZLYA 4JR3A 5T6KA 3NVKI 4BGHA 4U7ZA 4DLJA 2GTNA 3ZLXA 2ZJWA 4ZY6A 3UDBA 2EXEA 3L9PA 1YQJA 1XMLA 1V0PA 3HNGA 2BIYA 4J97A 2RF9A 3WZEA 3JVRA 4BGGA 2O65A 5CVGA 4ASEA 3IDPA 3NUAA 2FB8A 4AZFA 2IW6A 4I6LA 2ZMDA 2W17A 2WPAA 4MH7A 3ZC6A 3BYUA 1Q97A 2HCKA 4O6EA 3DGKA 2YM3A 3GBZA 2UW4A 5AP6A 5EK7A 3A60A 3R8VA 3W2PA 4F6WA