3REPA

Crystal structure of the ilk/alpha-parvin core complex (mnatp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
268
structure length
268
Chain Sequence
b'HSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQSPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVSKLMKICMNEDPAKRPKFDMIVPILEKMQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin-linked kinase
publication title Crystal structure of the ILK/alpha-parvin core complex (MnATP)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 80
structure length 268
sequence length 268
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3repA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3repA01
2JGZA 3MI9A 3G6GA 3NUYA 3QQGA 3NUNA 3BHUA 4JNWA 4EORA 4RWIA 3EB0A 4G5JA 5AIKA 5L8LA 1Q61A 3UDBA 1TKIA 3ODZX 4J52A 4KBCA 5H3QA 1Q8TA 2GSFA 3K5VA 4CZYB 4PRJA 3GENA 4JG6A 3W8QA 3G0FA 3R1QA 2XK4A 1A06A 4JDIA 4FL3A 5CNNA 4LI5A 2OW3A 3ULZA 4FNZA 4MXAA 2X8EA 3LMHA 2IG7A 5C26A 1M17A 4BTKA 4ZEGA 4H39A 4CV9A 3QQFA 1Q3DA 2BAKA 1WBOA 3GCSA 4PX6A 3FE3A 5AUYA 3KXMA 5JSMA 1FMOE 5GNKA 2I0VA 4DFZE 2QO7A 5JKGA 4BCMA 3U9CA 2OK1A 4HNFA 5HNBA 4YZBA 4FKLA 4OGRA 3G90X 4AA5A 3FWQA 4B0GA 4R3RA 5LJJA 2QQ7A 3BLHA 3TACA 3KRJA 4HPTE 4Y46A 5HZNA 4RJ6A 3UP2A 4UZDA 5IA3A 5L6WL 2QKWB 3EQDA 4YR8A 2BILB 2VWBA 5AA9A 5IF1A 5GIOE 3NW5A 4RFYA 3TL8A 3P86A 4JAIA 3C4WA 4R1VA 3RPRA 4KIQA 4BDHA 4RC3A 3SW7A 4FKTA 4QMSA 3UPZA 4QMLA 5B0XA 4N70A 2FO0A 1TQPA 3VUKA 4EH9A 1STCE 3C4FA 2PMOX 3PXKA 1ZXEA 2QG7A 2SRCA 3DB6A 1JSTA 4RC2A 5DHJA 5B2KA 4KUJA 3F5PA 4U8ZA 4QMWA 1O6LA 1OIRA 3A99A 2P2IA 4YBJA 3R7YA 1Q8YA 4YJTA 3TZ9A 4JIKA 4WIHA 4U9AA 1UNHA 4DC2A 3C4XA 2R3MA 4XRJA 2WQBA 2XIRA 2WQEA 2WQOA 5J1VA 4O7WA 5CU3A 4I0TA 3JR1A 3NYNA 4W4YA 3Q32A 1SNUA 2R7IA 5C01A 4RVLA 4EH5A 4FNWA 5IUGA 4AA0A 4HVGA 3HAVA 2VX3A 3HV4A 3LQ8A 3WF9A 3ZTXA 3N4TA 3RWPA 4FIGA 2B7AA 2C3IB 3OWLA 2BDFA 3CGFA 5F9EA 4CLJA 4FTRA 3DZOA 3QWKA 4L00A 3GC9A 4FTKA 1Y91A 3QC4A 4WG3A 3SX9A 3IQ7A 5CAUA 4FKJA 5JZNA 4QP3A 3T3VA 4CNHA 4C2VA 5JGDA 3GC0A 1R1WA 3SV0A 1W82A 2JKOA 2WMUA 3L8VA 1KE6A 3L9MA 3PE1A 3R71A 4IEBA 4C34A 4L6QA 3LFQA 3QA8A 3DY7A 2CGWA 4XP2A 5BVKA 3VS0A 4BGQA 5J9LA 4ZOGA 1UU8A 2CKPA 5AV1A 2YISA 3H9RA 3LVPA 1CKIA 4Q9ZA 4QYHA 3EN4A 4RIWA 3E64A 3Q04A 3GU7A 2HIWA 3NIEA 3W2SA 4EBVA 1H27A 4FSYA 2AC5A 2PE2A 5DR6A 4LV5A 3RM7A 1R39A 3KVXA 1PXPA 4BCIA 2A0CX 2ZDUA 2GQRA 3MVLA 4LOQA 3ZO2A 4C61A 1IAJA 2O2UA 3MB6A 4DGGA 3NUAA 2HWOA 3EQFA 5CQUA 4AXAA 2XJ2A 2YJSA 3Q6WA 1WMKA 1H1SA 4DEBA 1FQ1B 5HLWA 2Y0AA 3UZPA 3G15A 3NYXA 2YEXA 3B2WA 3OOMA 4GK3A 5E92A 3MFRA 4Q9SA 4M68A 3TNPC 1GY3A 2OIDA 4BI0A 4D2VA 1PYEA 3H0YA 2XK3A 3EFKA 3AC3A 4RJ5A 2W17A 3C0GA 1R78A 2C47A 2OICA 3WYYA 3ZONA 5AUTA 2XKCA 3LCSA 4MKCA 4CKJA 4IX6A 2W1FA 2ITPA 3FDNA 3TTJA 5E8UA 2OH4A 1XH6A 2Y4PA 3E62A 3EN7A 3M1SA 2ZV8A 1WVXA 3FI3A 4EH3A 5AA8A 5FG8A 1BUHA 4I93A 2BRHA 4R8QA 4BCKA 1KOBA 5JK3A 4EK6A 3LHJA 3R2BA 2GQGA 1URWA 4ZTHA 1SVGA 5HO6A 4EQMA 5CANA 4EEVA 3MDYA 3LFFA 2JAMA 5E8WA 5HO8A 4K8AA 4EK8A 1KE7A 4RWJA 3IW5A 2CCIA 3QQKA 2QG5A 3T9IA 3W2CA 4APCA 5K0XA 3UOLA 1GZ8A 3LOKA 2WMWA 3DGKA 3OW3A 2XZSA 3WE8A 4DA5A 1LR4A 3VBQA 3D14A 4RIYA 4N0SA 2BZHB 3ORXA 2REIA 2YAAA 3EQBA 4JRVA 4M3QA 3ZO1A 3A4PA 5TF9A 5L2TA 3R02A 2BUJA 3QD2B 1REKA 2ZM3A 5C8MA 3R8UA 2C5VA 4CFWA 4LUEA 4EHGA 3KRLA 3R6XA 2VTJA 3HUCA 3LFSA 3V5JA 4O6EA 4DTBA 4ONAA 4GU9A 4M7IA 3OS3A 4R5YA 4ASZA 4P5ZA 3DT1A 5HD4A 4ZS4A 3VO3A 3U4WA 5LVMA 2G2HA 4V05A 5H2UA 4BL1A 1H1RA 3BE2A 4IDVA 4JAJA 3T8OA 5I9WA 5L2WA 1ZOGA 3GGFA 3BI6A 3KL8A 3OBJA 4LG4A 3TIYA 1QPJA 3UPXA 4G6LA 4RC4A 3OC1A 2HZ0A 3PWYA 4EKLA 4ENYA 4R6VA 2UZWE 3LFNA 3F7ZA 5KKRC 3FI8A 4TYEA 3NS9A 4U40A 4BF2A 4RIWB 4CT1A 2PL0A 5HNGA 3KXNA 4PL3A 3HRBA 5I9XA 1ZYCA 5IQFA 3ZH8A 4D1ZA 4E5AX 4X0MA 2Y8OA 5H8GA 4P5QA 4F1MA 2Y6OA 5DEYA 5LWMA 4UXLA 3R21A 2VV9A 4C02A 5C1QB 1BX6A 1K3AA 5AM7A 3L8XA 4EK4A 2PPQA 4MBJA 5H8EA 5EHYA 5GINE 4L68A 3EN9A 3GOKA 4XV3A 1Y8GA 4EL9A 2ACXA 3PJ3A 1SYKA 4AACA 1H07A 2A27A 2XNPA 4F7SA 4NTTA 2UVZA 4UMQA 2GNFA 4FZ7A 3EMGA 1YKRA 4ANOA 4QMUA 5F20A 4Q5HA 5IH5A 4LGHA 2YIYA 3DJ5A 1YQJA 1P4FA 1KOAA 2QU5A 5KZ0A 3PLAE 3VJOA 5DH3A 4U80A 4F09A 4ERKA 4JDHA 3BZ3A 5ITAA 4ANMA 1UKHA 2F57A 2VO0A 3WBLA 2YCFA 3EKNA 4NFMA 3QTSA 4O0SA 5AM6A 5FP5A 2XIXA 4FZAB 4DINA 3OUKA 4ANLA 3PSBA 4ASDA 3EKKA 1QCFA 3EWHA 3MY0A 5AP2A 5ETAA 4D4VA 5JN2A 2GTMA 2PU8A 4O21A 2I0HA 4QYEA 4C36A 3PIZA 4RIYB 5ANDA 2XRWA 2X6EA 4UB7A 3BBTB 2B4SB 3KC3A 4C37A 3ZCLA 3CS9A 4MXZA 3BEGA 4MNFA 3OG7A 2R4BA 4YJNA 4UY9A 4EUTA 1F0QA 3IDBA 2YM7A 4I22A 5CT0A 4NYEA 5D41A 4DT9A 2ZAZA 2HZNA 4OBPA 4NM0A 4ZTSA 3FMKA 4A4LA 5M4CA 1U5RA 2IN6A 4IFCA 4RVMA 4TWNA 3H30A 2G15A 3HV5A 4QQCA 2J9MA 3V6RA 3KMMA 3HV6A 5I3RA 4UWYA 1OBDA 3MIAA 4FVPA 4X3FA 2PZPA 4FEWA 1F5QA 4FNXA 1FGKA 3DCVA 4J8NA 4FSWA 4FV6A 2HWPA 5JFXA 1PKGA 1XH9A 2P55A 2RFSA 4IX5A 4MX9A 4OR5A 5AV2A 4E4LA 2PVNA 1FGIA 3GEQA 4M14A 2NNWB 2HAKA 4Y73A 3E8NA 4EI4A 5AP6A 3QUEA 1ZRZA 2YFXA 2OF2A 2OXDA 5GZAA 4UWCA 3VC4A 4X21A 4I6FA 4O2ZA 5ANOA 3Q4UA 4RBLA 5BVFA 2XYUA 3F7WA 4IAZA 5EOBA 3U6HA 4D0WA 4D2TA 5KMOA 4ZMFA 4AUAA 1E1XA 4CFVA 3ZMMA 2PK9A 4I5CA 5HIBA 4IANA 5M57A 4EJ7A 3MH3A 2ITVA 5HG5A 2BMCA 2C6EA 1BI8A 2FVDA 4D9TA 4O2PA 2BR1A 3JY0A 5M08A 2HENA 4CLIA 3R63A 3L9NA 2V22A 2VTHA 3MPAA 5I9YA 3VS7A 4FG8A 3DKCA 3QRJA 4M8TA 2NP8A 4IE9A 5H8BA 5HVKA 1ZZLA 4PMPA 4MEDA 4CQEA 3P0MA 2H9VA 3FXXA 2ZMCA 4J99A 4M84A 4BWXA 1GZOA 4CRLA 3KFAA 3Q3BA 2ZV2A 5CEIA 4C2WA 4DFLA 5AAEA 2ETRA 3KKVA 3R9DA 4X3JA 1HOWA 5HLNA 3BU5A 5FQDC 4KD1A 3D83A 5ANGA 4F4PA 3BGZA 4C62A 2ZDTA 3ODYX 4CSVA 3O8UA 3RK9A 3BGPA 1Z57A 3LPBA 4FBXA 4FODA 3V5WA 4BZDA 2P4IA 2C4GA 2YDJA 5CX9A 2YM4A 5D7AA 2Z7LA 5HCZA 5K9IA 2WOTA 4WA9A 5CLPA 5LVLA 4D1XA 5G1XA 4A9SA 3LJ1A 4DFXE 5EW9A 2WB8A 3RK7A 1U54A 2WMRA 4S31A 5CAVA 3HKOA 5J8IA 3KGAA 4CFXA 5IH6A 4HYHA 3MH2A 2OXXA 4YC3A 4J97A 4TYJA 4RPVA 3NSZA 4ZSEA 3IOPA 5C9CA 3KN6A 3HV3A 4NM7A 3IO7A 5AR3A 2ERKA 4XV1A 5K0KA 4FSZA 4GL9A 4O7VA 3DLZA 3FMHA 5C03A 2RG5A 3KK9A 4IAYA 5E8YA 4AP7A 4JQ7A 1MRVA 2XRUA 3H9FA 2Z7SA 3FXZA 1G8SA 1Q99A 2Z7RA 4U81A 2B0QA 2BHHA 4X3FB 4BCJA 4QTBA 4X3FC 3DV3A 4R1YA 4FV2A 4U45A 5I3OA 2FSTX 4RX8A 2OLCA 4UMTA 5EQYA 5HE0A 3I0QA 3RHXA 4GS6A 5CF6A 5AUZA 3WZEA 2J5EA 1DAYA 1URCA 3R8MA 2XCKA 4IQ6A 3PIXA 2XIZA 2CCHA 4WNPA 4WNOA 3ZRLA 4YSJA 5CZIA 3TNWA 3QCSA 1EH4A 3GU5A 2RFEA 5DR9A 3V04A 5E1SA 1SZMA 5J87A 2X8DA 2ETMA 1MP8A 3ZOSA 1M2RA 1M2PA 3P4KA 4QQTA 4NFNA 4BRXA 3D5XA 4F6WA 2XJ0A 1H0WA 3KY2A 3POOA 4DFNA 2ZM4A 4IC7A 4TYHA 2V7AA 3FMEA 4G34A 2X81A 3QQLA 5I9UA 3ZXTA 4F65A 5IQBA 3BV2A 3QUDA 2JBPA 4J7BA 2GNJA 5E8TA 3R83A 4D58A 4DF3A 2Z7QA 3R8PA 4DCEA 2O5KA 3QZHA 4BIDA 2PUPA 3GNIB 4F9YA 3R7GA 3VRZA 3CGOA 4ZSJA 1QPDA 3GOPA 4JR7A 3UVPA 3JY9A 3N9XA 2QR8A 3NYOA 2X7OA 2GCDA 3PJ1A 3E88A 4QMOA 4Z16A 5B7VA 3CTQA 3CPBA 5HEZA 1M14A 3LFAA 4I4FA 4V01A 3EQGA 3OWPA 2C0IA 4G9CA 4YJVA 5CF4A 4NL0A 3KU2A 5HGIA 5TT7A 4D2WA 5IA4A 4CKRA 4QMZA 1M52A 1VYZA 4XG4A 3KRRA 4C0TA 5LQFA 1K2PA 5BVEA 1OUKA 1E1VA 5BVWA 4G6NA 1W7HA 5HIDA 1U54B 3ORPA 2J0LA 4O1OA 5HORA 3R73A 3LCKA 1RE8A 1H8FA 3G9LX 2EXEA 4EC9A 1BKXA 2V5QA 3Q9ZA 3OT8A 4BBEA 1AD5A 5CSXA 3O71A 2BFYA 5CF8A 4C7TA 4I4EA 4BDKA 4II5A 2Q0BA 5LOHA 4D4SA 3UTOA 5JFSA 1PY5A 2WQMA 4IB5A 4I1ZA 3S95A 2CGXA 4Z9LA 3RAIA 2C5XA 3UMXA 4B8MA 4D2SA 5JFWA 5IG1A 2W9FB 3N4UA 2ETKA 4E93A 1MUOA 1PJKA 1SNXA 2VX0A 4CMTA 4NU1A 4AN9A 4DG3E 4KRDA 1Y6BA 3LW0A 3NMUF 5BUIA 4RX9A 4GIHA 2JBOA 2WIHA 3MJ1A 3OT3A 4CG9A 2WNTA 1NA7A 2ZV7A 4YZ9A 4HGSA 5FTQA 3OTUA 5BNJA 5LWNA 1JWHA 4I0SA 1WBTA 3ZXZA 2VWXA 3MVHA 4BIEA 3RMFA 5M06A 3QBNA 3MB7A 2BVAA 2FUMA 4XG3A 2JKKA 3RPVA 5CEMA 3TV4A 3GP0A 3D94A 1KE8A 4HGTA 2UZUE 5ANJA 1Q24A 1XQZA 4AN2A 5HG7A 3A8XA 1L8TA 3LCOA 3CTJA 4RMZA 1OVEA 1BLXA 4ITJA 2CDZA 2FSMX 4YU2A 2XNOA 2RFDA 1PXOA 1PYXA 5CSVA 3UIMA 2GNIA 2O0UA 2OJIA 3Q9YA 3DNEA 3ZDIA 3A7JA 3FI2A 2CPKE 3F66A 4TYHB 4CZUA 2W9ZB 1ZWSA 5E4HA 4PP9A 4WG4A 4F63A 3L9LA 4IBMA 3QWJA 2XBJA 5EYKA 3CSVA 4J53A 5L8KA 4DGLC 2CKQA 2ITTA 3LCTA 3EOCA 3I4BA 4GJ2A 3RP9A 5EI2A 3OXIA 5GZ8A 2XP2A 4MBIA 2WMQA 4TWPA 4D4YA 3PY1A 3FJQE 4IAIA 2OIBA 5HG8A 3P9JA 4Y72A 4YTCA 2WTDA 3CCNA 3ZBXA 3WARA 3O0GA 3D2KA 3COIA 2PVJA 3II5A 2XNBA 5EDQA 3TNQB 1Z9XA 4G3FA 5HNIX 1GNGA 5A4CA 1IAHA 3FC2A 1YHSA 5L8JA 3HZTA 2PE1A 4WUAA 4FTAA 2R3PA 4WBBB 1UVRA 4EOJA 5CEPA 3G5DA 4CGAA 4PTGA 3JYAA 1Q41A 5FEDA 3VS4A 4KS7A 2XB7A 4S34A 3V6SA 3WIKA 5IA0A 2Y4IB 4LGDA 3RHKA 4NT4A 5HTCA 5JRQA 4RWLA 4BTFA 4EYJA 3V5LA 2W96B 4KRCA 4RWKA 4NM3A 5JGBA 2CLQA 3OXTA 4FE2A 5HLPA 3KCKA 5KNJA 3EQIA 1CTPE 3CJGA 4WT6A 5FDXA 3ORNA 3NAXA 4FG7A 3ZYAA 3F5UA 2CN8A 4KKHA 2W1EA 3F3WA 5F94A 3MYGA 1APME 4XJ0A 4IHPA 3RINA 4EYMA 2OJ9A 5ANEA 4TZRA 1JQHA 4XS2A 2R3LA 5L3AA 4U0IA 3PP1A 3PJCA 4YJPA 3F69A 4G3CA 4YNEA 3QD0A 4IB1A 4GG5A 2BFXA 4FKIA 2Q0NA 1TQIA 1RJBA 3JXWA 4L42A 4WRGA 3IW7A 3COHA 4XYFA 5GJFA 3PYYA 2QVSE 4RX7A 4BTJA 4C35A 2ESMA 4G16A 1OKWA 1Q62A 1OPJA 1OM1A 3LFEA 4FNYA 4PDSA 4F0FA 2JC6A 3IG7A 4FTQA 2YCQA 5KMKA 3CBLA 3VWAA 4I6BA 4QMVA 4FV7A 3TKHA 3MJ2A 3OY3A 3P08A 3AQVA 4K77A 3OROA 3OUNB 3Q9XA 4IX4A 1TVOA 3V5QA 3PPJA 4D55A 5BMSA 2X0GA 3MVMA 2R2PA 1Q97A 4KSPA 1U4DA 2PYWA 1UNLA 5BPYA 3K54A 4FKUA 1J3HA 3TV7A 5C4LA 3LCDA 3DJ6A 1XHAA 2OSCA 4S30A 5D7VA 5HVYA 4DTAA 2CMWA 2GFSA 5IQEA 4Q5EA 4QP2A 1WFCA 3LQ5A 4ZY4A 4FKQA 5AFVA 5K4JA 5AP1A 4ACMA 3WIGA 4B8LA 2QO2A 4U42A 4MVFA 5IQGA 2QU6A 2W0JA 4IAKA 3WE4A 3ZFMA 1UV5A 4CT2A 3BHVA 3R1SA 2VGPA 2JDTA 4E5BA 5A4QA 4GW8A 3NCZA 3ZRKA 1J91A 4DEIA 1ND4A 5HVJA 1ZARA 2HW7A 1FMKA 4PDYA 4IXPA 4Y83A 4HYSA 5CS6A 4O7YA 2UZTA 3K3IA 4JX7A 3FLYA 2EWAA 4S2ZA 4FIEA 5TO8A 1LEWA 2QC6A 3QAME 2UW5A 2UW4A 3ORMA 4UEUA 4AZTA 3KXXA 5E8VA 4L8MA 2VNYA 1KV2A 2JDRA 5ANIA 4F0IA 4OTDA 3SLSA 3SD0A 3F5XA 3W2QA 3QA0A 3FPMA 3PSDA 3RNIA 4EOLA 3EZVA 1J7LA 4Z7GA 3PUPA 4ITIA 3VJNA 3A8WA 2CHLA 3AC1A 3NIZA 4U6RA 1Q3WA 3HLLA 5KHXA 1Y8YA 3C4CA 4FK6A 5EDRA 2FB8A 1FVTA 1PXNA 2J90A 5CT7A 5K3YA 2YM3A 4FT9A 4ACGA 2JDOA 2I1MA 5E7RA 3EN6A 4WNMA 1PXJA 5IA5A 3W33A 1WBPA 2PSQA 2CLXA 3VS1A 3CQEA 4IZYA 3UNZA 2WU6A 3CD8A 4F08A 4FZ6A 3R1YA 3FL4A 1B6CB 1IR3A 4E20A 3QZIA 3KULA 2E9PA 4WSQA 1ZY5A 2X6DA 5FXQA 4ZZNA 4C38A 3BX5A 5M55A 3BYVA 2ITQA 3AC4A 3R8ZA 3VULA 4AGDA 4O7RA 3K3JA 3ZEPA 5HICA 3LFDA 2VTPA 4GCJA 4FX3A 3SXFA 4F64A 3RK5A 4O27B 1GJOA 3B2TA 4BGHA 4ZTNA 3TN8A 4DH8A 3GQIA 2W1DA 4FT3A 5LARA 4WKQA 4ALWA 3GI3A 5J95A 3R2YA 2W1IA 3EQCA 4WG5A 4EHZA 2V7OA 3VUGA 4FUYA 4CYJA 3BYUA 3TJDA 5J7BA 3MV5A 1H24A 4FV3A 3MPMA 4KIKB 4G6OA 3IS5A 5IKWA 4RIXA 4ID7A 2BAQA 3QXPA 4GV1A 5DWRA 1RW8A 3VRYA 3QKKA 5E8XA 4TYGA 2HCKA 5J79A 4QMQA 2F4JA 2VWIA 5I4NA 3CE3A 4XHKB 5DRBA 1HCKA 4L52A 4X6RA 5CXZA 1R3CA 3U54A 3BCEA 3HECA 3A4OX 4FTUA 4JBVA 3R00A 2OZOA 4HYUA 1OL5A 3ROCA 3VW8A 4ACHA 5AADA 1DAWA 4DG2E 3VS6A 2UZVA 1YRPA 3HX4A 3I79A 4U7ZA 3ZS5A 4BKJA 3UYSA 4PPCA 5DVRA 4ARKA 5EKNA 3BHYA 3GU4A 2XBAA 2YWVA 2NRYA 3R30A 5FM2A 4Q2AA 3MS9A 1YI4A 2QD9A 2W06A 3AC2A 3PG1A 4DE4A 1XBAA 3D9VA 4J98A 5KHWA 1P5EA 5HX8A 1ZYDA 2BRMA 3AC5A 4CZTA 1H08A 1YI3A 5CTPA 3G2FA 4H36A 4NIFA 2P0CA 4X6QC 4F1OA 5AUWA 4DFUA 1YWRA 5IMXA 5KZIA 1P2AA 3DQXA 3FBVA 3TM0A 2B53A 4LOOA 4D5KA 1DI8A 2YHVA 2GDOA 1JKLA 3OF0A 5GJDA 3QL8A 5TOZA 2ITZA 5M44A 2HZ4A 1Q8ZA 4EC8A 3UC3A 1FPUA 3Q9WA 3LXPA 1LEZA 5CVHA 4NSTA 4EWHA 2W5HA 5AUUA 1XBCA 1AQ1A 5HCYA 3UG2A 5FTGA 3BWJA 1PW2A 2KTYA 2UZOA 4CFMA 4H1JA 4JOAA 4K2RA 4XV2A 4HPUE 2P2HA 4V04A 4BCPA 2BROA 4QMYA 3NVMB 3SVVA 5FEEA 1YOLA 4R3CA 2OJGA 1B39A 4NM5A 5DEWA 1P4OA 2W1ZA 2C6OA 4KIPA 3ATTA 3LIJA 4XBRA 3FI4A 2AC3A 2E9OA 4AAAA 3FQHA 3U9NA 4FTMA 2HELA 2J7TA 4O0TA 3R9OA 4WRSA 4EHEA 3VS5A 2QOQA 3C5IA 3GU8A 4EK5A 3TUCA 4A4OA 3FSFA 2WKMA 1ZZ2A 2VTNA 3ZBFA 2GMXA 4O83A 4UYAA 5L4QA 4YLLA 4YURA 2CKOA 3HNGA 5AP4A 4BIBA 2EU9A 4WD5A 2IJMA 4PP7A 3W32A 5L6OA 4E7WA 4CYIA 4RQKA 5KBQA 4NKSA 3C4EA 4I3ZA 3GCVA 3OXZA 4QP7A 2HW6A 4AZFA 1XH8A 3KEXA 3OD6X 4RIXB 2JAVA 5EYCA 4CFUA 3V8WA 5B2MA 1WBVA 3QRKA 2XJ1A 3VAPA 5M07A 4GT3A 4MBLA 4N6YA 2P33A 3B8RA 3P7AA 3IPHA 4C4FA 1GIIA 3PG3A 4A9RA 5ETIA 2VTIA 4K0YA 3FLQA 4TT7A 3Q4CA 3TUBA 1K9AA 1OIYA 5AR7A 5ACBC 1W0XC 2RFNA 3O7LD 1H1WA 3FZOA 4O81A 2JKMA 5TE0A 2R3QA 3WF6A 4RZWA 4LMNA 4G9RA 3G0EA 1S9IA 4IDTA 3W10A 3OCGA 4A7CA 1PF8A 5LCJA 2VX1A 3UOJA 4RZVA 5KKRB 4LRJA 4XV9A 1YW2A 3AD6A 3FEGA 4FGRA 1KWPA 2J51A 3CQUA 4JIAA 4KA3A 4CG8A 1M2QA 5FUTA 3CPCA 3R7IA 4NIFB 4YP8A 3TI1A 4YNOA 3DAEA 1R0EA 4W4WA 1ZYSA 2JIUA 4EZ5A 3ZUTA 1S9JA 4QQJA 5TR6A 1FVVA 3I6WA 4ZZOA 3OOGA 3PPKA 2OFUA 4O0UA 4HGEA 4JQEA 4QD6A 3RI1A 5CSPA 3RM6A 3I7CA 2WTJA 3AT4A 1MQBA 1WVWA 5E90A 1YXTA 4MCVA 3DTWA 3OCTA 2YM5A 4YJUA 4A07A 5I9VA 1WZYA 4KSQA 2WMTA 4H3PA 2XS0A 3SC1A 4EWQA 3BYSA 1J1BA 3F9NA 3FMNA 2BHEA 3EFWA 2PMLX 4TXCA 4O82A 5M09A 4K6ZA 5D12A 1P14A 4BCFA 4BYIA 2R3HA 3VBWA 2IZUA 4NZWB 4AT4A 4RG0A 3IKAA 3M2WA 4OTFA 4U5JA 3KA0A 1W84A 4DGMA 1BL7A 5EM6A 5C8NA 1V1KA 5BUJA 4WUNA 3LZBA 3KVWA 3UOHA 4BDAA 1GIJA 2J2IB 3D5UA 3LJ2A 3ZC6A 3RPYA 4M66A 2XKFA 3JVRA 1OL7A 2I0YA 3NZ0A 3QKMA 4NCTC 4YJSA 4NUSA 2IZTA 3NW6A 1ZAOA 3B8QA 3AT3A 2G9XA 3UYTA 4AOTA 4HOKA 5HCXA 2ZB1A 3PFQA 3GCUA 3EQPA 3QX2A 3MESA 3L9PA 5CU2A 4GK2A 3I0OA 1YHVA 5AR5A 2B52A 3WILA 5JZJA 5T6KA 5KE0A 4LM5A 1OL2A 4ZLZA 4MD7E 4DBNA 5LXMA 1V0OA 4FEUA 4W8EA 4L44A 4JX3A 3EN5A 3VBVA 2IVTA 3BQRA 1YVJA 1W83A 2QI8A 3GUBA 4C3FA 3QYZA 2IWIA 4QMPA 5B2LA 2R0UA 3DKFA 4HCVA 5EH0A 2XVDA 2ITNA 4PNKA 3AMAA 3EL8A 4M0ZA 4W4VA 5L2IA 1SMHA 5T3QA 1WAKA 3GCQA 5D11A 2VTQA 3LMGA 5KMJA 4P2KA 4QYGA 5DLSA 3VUTA 4F7JA 2OZAA 4XRLA 3LM5A 2YN8A 2IVUA 4PDPA 4ZXTA 2XNGA 3MFUA 3HP5A 4CTBA 4ASEA 4FTIA 4CMUA 4FIIA 5A3XA 4DEEA 3BKBA 4X2NA 4M67A 4DLJA 5D9HA 4R7HA 3FHIA 2UW7A 2UW6A 5EM5A 4K33A 4OTHA 5EI8A 1VJYA 4R5SA 5IH4A 3OWJA 4K1BA 4E6CA 2P3GX 2WD1A 3P78A 4OT6A 4TWOA 4FL1A 5A4TA 4X7QA 3EHAA 3S00A 2C6LA 4FIJA 4AS0A 4USDA 3MY1A 3DKGA 4J1RA 4OTRA 2VRXA 4QRCA 2BPMA 2J5FA 3DBCA 4F9CA 3FLWA 4CFFA 5HO7A 1H00A 4LUDA 4FKVA 2VWZA 4TNBA 4QTDA 2FSLX 3HDNA 4OTIA 2UZBA 3UBDA 5KCVA 2VO6A 3TNIA 2C69A 3GT8A 4ZZMA 5I0BA 5IPJA 2C5NA 5ETFA 4PTEA 2PUNA 4FSQA 4GKIA 3UVQA 2WEVA 4GYIA 3GU6A 1T45A 4IM2A 4QPAA 3QGYA 4NJ3A 3MA6A 2W99B 2QNJA 4KB8A 4EOIA 2YLEA 4X2JA 2VN9A 2VO3A 5D10A 3Q5ZA 3ULIA 3UQFA 1O6YA 4W4XA 3ORLA 5K4IA 5A54A 4GUEA 4MWHA 3H10A 3TZ7A 4EH8A 4EOKA 3PTGA 5KMIA 3P1AA 3IECA 3QLFA 4BWKA 4N57A 4FYNA 3Q96A 4W8DA 2AUHA 3E8CA 3E87A 1OL6A 3G33A 4LFIA 3UMWA 3RGFA 4PMTA 2LAVA 3EQHA 5LMKA 2V55A 5AJQA 3VNTA 3HP2A 3HRCA 2JIIA 3VN9A 2C3LA 4KNBA 4I21A 3RPSA 2PY3A 1CDKA 2QOBA 1JOWB 3F82A 3FHRA 3G51A 3NUSA 5IUHA 3ZZEA 4IAFA 3MA3A 5LVNA 3IW4A 3POZA 4BCGA 3A7IA 4GIIA 4E3CA 4O22A 3HMNA 3V5TA 3TKIA 4B4LA 5CVGA 2DS1A 1RQQA 3F2RA 3IGOA 1GIHA 5FBOA 4L67A 5F1ZA 3PXRA 5KMNA 5HIEA 4D5HA 4UBAA 5IMEA 5ETCA 3O51A 5M4UA 3SG8A 2HZIA 5FDPA 4QPSA 4XH6A 3MPTA 3NUXA 2OZAB 1UNGA 3OCBA 3O8TA 3RPOA 3H4JA 3QGWA 4C57A 3CLYA 3IW8A 3GFEA 4FEVA 2J0MB 1YDSE 2XK8A 2VTAA 3RAKA 2J0IA 3PA4A 1UA2A 2X9EA 2YM8A 1OKZA 2VTTA 3CR0A 2RG6A 3COMA 1RDQE 4DEGA 4R78A 4O7LA 3U55A 3SQQA 2XCHA 4FR4A 2XH5A 2H6DA 2G2IA 2R3JA 2C3JA 3BWFA 4XEYA 3W2PA 3FKLA 5A9UA 4EONA 4BFMA 2JIVA 4QOXA 2C68A 5DI1A 3OTVA 3DZQA 4OBOA 4BTMA 4ZLYA 3ZHPC 4J95A 2OJJA 3DAKA 4PF4A 1VYWA 2XYNA 4FTNA 4NW6A 4O91A 4EOQA 4D4RA 4MWIA 4LL5A 2E9VA 3EYHA 1KV1A 4DCAA 3LXLA 4DN5A 2CNVA 3HYHA 4QTCA 3DXQA 2C5OA 3U4UA 1FBNA 3E5AA 4ENXA 2QHNA 2QOLA 1KUTA 4K18A 3D4QA 3O17A 4K11A 3C50A 3LMIA 2YA9A 2WPAA 3QTUA 1ZOHA 2Z8CA 3FLSA 4WOVA 4Y95A 3ATSA 2R3RA 2R3FA 3S1HA 3R7UA 4F7LA 1JPAA 1DI9A 1SVEA 1QL6A 3BV3A 3R8LA 4ANNA 3I5NA 2G01A 2R3NA 2YM6A 3K2LA 4FC0A 4MNEA 3WZDA 4GFOA 5E8ZA 5EW8A 2Z02A 2I0EA 3HL7A 3NLBA 5DPVA 1UKIA 1FVRA 4ZS0A 3ZLSA 4M15A 2WTIA 4W9XA 4AGCA 2UVXA 4LV8A 2XMYA 1PKDA 2W1HA 5EYMA 2C6MA 4ALVA 4OAVB 5CNOA 4BCQA 4DH1A 5KUPA 2BTSA 2ZJWA 3Q4TA 4PV0A 4EH4A 4P4CA 3IDCA 3VW6A 4HCUA 4GFGA 1WBSA 2J0KA 4IB3A 2IW6A 4HVSA 2XNNA 2J4ZA 4YO6A 3SAYA 4IWQA 1KE9A 4QMNA 1NY3A 3ZC5A 1NVSA 5LMKC 3JUHA 4NW5A 5GJGA 2ONLC 4G1WA 3WF5A 2IPXA 3PZHA 3WOWA 3E8DA 4PMSA 5KO1A 3P7CA 3DNDA 4L45A 4XG8A 4IFGA 2CN5A 2WXVA 3NR9A 2Z60A 3QD3A 5DT4A 3SDJA 5AAFA 4AGUA 3AXWA 3FLNC 3SXRA 2OWBA 2G1TA 1VR2A 4FT0A 4EOPA 4JJRA 4ZJVA 4QPMA 2WO6A 4E4NA 4F9AA 3L8PA 1X8BA 1H28A 5HKMA 5FP6A 4IWDA 5EKOA 3ETAA 2FGIA 4FSUA 4G5PA 2WFYA 2BDJA 3LE6A 3ENMA 4Y85A 5FRIA 3VBYA 4QP8A 3BPRA 3H3CA 4YTIA 1ZYJA 5JQ8A 1V0PA 3Q5IA 4FOCA 1B38A 2YCSA 5HBJA 4FTOA 1H26A 1XH4A 3DDPA 3FPQA 1IASA 1OB3A 5EHLA 4QMMA 4AE9A 3DPKA 2CNUA 4BR3A 1Q8UA 4YLJA 1KSWA 3LFCA 4MHAA 1LP4A 2VGOA 4V0GA 3LFBA 4AFEA 3E8EA 4BHNA 5A6OA 3KF4A 3VIDA 5CAPA 2A1AB 2BIKB 4USFA 1OL1A 3A7GA 4PPAA 1PMEA 1OKVA 1H01A 4OLIA 3HAMA 2WMAA 4TKSA 2IVVA 3COKA 5KBRA 5BQ0A 2XK9A 3Q52A 1OI9A 1YOJA 1GZNA 2VTOA 5HTBA 3PVBA 4AU8A 2R7BA 3IOKA 2WIPA 3MBLA 4AE6A 5AX3A 5D1JA 3F2AA 4GT4A 5IU2A 1YWNA 2EB3A 5KMMA 5CU4A 3V01A 4DEDA 3HMPA 3QXOA 4WNKA 3Q2MA 4YTFA 1JBPE 2YIXA 4FSRA 3PIYA 4WSYA 5BVDA 4N4SA 3NUUA 5AR8A 5EQPA 3CD3A 4FKOA 3EZRA 5HD7A 3NDMA 3R7OA 5J5TA 4G17A 2PE0A 5EK7A 3U6JA 4BBFA 4MNEB 4XCUA 5FXRA 3ORTA 3DK6A 3BIZA 3R01A 1DM2A 1NT2A 3UGCA 1OECA 3E92A 4U43A 4XUFA 3FC1X 2JFLA 4S32A 2WU7A 2H34A 4TY1A 4HZRA 2FA2A 2WTKC 4GVJA 4YJRA 3LM0A 3SKCA 5CALA 3H0ZA 4S33A 2CGVA 4E8AA 2BKKA 1NVQA 4OT5A 5C27A 1G3NA 4BVUA 4TTHB 5A4EA 5EYDA 2XIKA 3RTPA 5HU9A 4YPDA 4MXYA 3UE4A 3ZFYA 4OUCA 4KINA 4XMOA 4JDKA 4PMMA 4P90A 2BZJA 4H3BA 1F3MC 5M51A 4YZMA 5LVOA 5IEVA 2UV2A 4MAOA 2GU8A 4YMJA 3S0OA 4YHTA 4NWMA 3ORZA 4HW7A 4UYNA 1YXXA 4O0WA 5AV4A 4GUBA 4IWOA 5CQWA 4X2FA 3R9RA 2ZM1A 2X8IA 2PVMA 2HY0A 3FKNA 3UJGA 3BE9A 4JBOA 4FA2A 4GKHA 3PY3A 3W18A 3KREA 4IIRA 3TCPA 5DGZA 2GHMA 4FTTA 4BN1A 5CEOA 1MRUA 4O7TA 3NRMA 4C4IA 5CEKA 2A2AA 3QTQA 4GVAA 5FGKA 3HMOA 2PUIA 4ACCA 5CU6A 3KF7A 3PY0A 2VU3A 4Y5QA 3A7FA 3TT0A 4YJQA 3HV7A 4L01A 4LYNA 3UC4A 5ACKA 4V0GB 3W1FA 4I5MA 2IW8A 3HA6A 4E4XA 3E7OA 4OTGA 3VQHA 3HRFA 3C13A 3VQUA 2JITA 2UZEA 3DU8A 3BU3A 3RCDA 4FZDB 4F0GA 3RAHA 3ZSGA 2ZV9A 3QZFA 3RNYA 5J5SA 4O7SA 2F7XE 4G3DA 4MF0A 4HGLA 4R3PA 2W4KA 5DG5A 1JVPP 3DK7A 3M42A 3R7VA 4TL0A 2PULA 3BU6A 3PXFA 4XP3A 5AWMA 3UO6A 2XK7A 4FOBA 4MF1A 3ZUVA 1JKKA 3ZZWA 3EL7A 4GFMA 1TQMA 4ACDA 5HTIA 4J8MA 3UOKA 4LRKA 2A4LA 2JEDA 4MXOA 3UVRA 2DYLA 2JDVA 5IUIA 4YZDA 4IW0A 4U41A 5IA2A 3F6XA 4UALA 3QC9A 3VHEA 5A4LA 4C58A 3EJ1A 5BUEA 2UUEA 4XLIA 1R0PA 4KAOA 1YI6A 3ANQA 1QMZA 1IEPA 3PDTA 3TWJA 4ZLOA 1I44A 1XH7A 3KMWA 4UZHA 4E1ZA 3C0HA 5HG9A 3TG1A 4BWPA 3R0TA 3AC8A 4EUUA 5M53A 3QCXA 3W8LA 2OO8X 4FVQA 4IWPA 1U46A 4BCOA 5JQ5A 5I5ZA 3O2MA 3QU0A 4CEGA 2VWUA 4UWBA 4BDJA 3BLRA 5FD2A 1JAMA 1CSNA 3LAUA 3ORIA 4LGGA 4ZY6A 4EHVA 4IZAA 1PMVA 4TPTA 4IM3A 1H1PA 1NW1A 4ZSGA 4FIHA 5FWKK 3KCFA 5AR2A 4JS8A 4M13A 4PNIA 1W98A 2JFMA 3MFTA 4JVGA 5J1WA 4IVDA 4J96A 5GIPE 2HY81 4GU6A 3PJ2A 4ZJJA 1PRYA 5ICPA 5J9ZA 5IQAA 4JT3A 4XG7A 1JLUE 2OFVA 2ZVAA 4EH6A 3ELJA 1PXIA 1YWVA 4B9DA 4DGOA 4FL2A 4FMQA 5GHVA 3MW1A 4FTCA 2GS6A 4R7IA 3RKBA 3NW7A 1XO2B 1XBBA 2R3KA 3N51A 4FV9A 4CCBA 2PHKA 3DOGA 2PVHA 3O50A 3FAAA 4IC8A 4QYFA 3C1XA 4UXQA 5AP7A 4ANSA 4ERWA 1XR1A 5CY3A 3CKXA 2UVYA 3O8PA 4EZ7A 4KS8A 3KQ7A 5JGAA 4C59A 2XM9A 3BQCA 3QALE 3CP9A 3MTFA 2BRBA 3ENHA 4M12A 4DITA 3NNXA 5C8KA 5L2QA 5IISA 3GBZA 3OEFX 4M0YA 4XX9A 4L3JA 3TTIA 4MQ2A 4AT5A 3E3BX 5TKDA 3PRIA 5CYIA 3BYMA 3DBEA 2FYSA 2VZ6A 1OPKA 2YDIA 4PQNA 5CWZA 5DYJA 2O63A 3ZSHA 5AX9A 2W5BA 2CKEA 3DBFA 2C3KA 2C6TA 4GJ3A 4E6AA 1T46A 4BCHA 4BKYA 3LXNA 2X2LA 4A06A 4HJOA 3OZ6A 2C6IA 2B1PA 4AZEA 1H4LA 3U51A 2GHGA 3QLGA 2WMXA 4P7EA 3UO5A 4JL9A 1FOTA 4MH7A 4E73A 2HXLA 4F70A 2VD5A 3U6IA 4CQGA 3QTRA 3UQCA 2OXYA 4G3EA 4C3PA 3NWWA 1XWSA 1OPLA 4M97A 4N6ZA 4X2GA 4NTSA 2ZOQA 3OFMA 4F1TA 2GNLA 3BHTA 4TWCA 1YOMA 4D1SA 2EUFB 1U59A 3DK3A 4RA4A 2YZLA 2EVAA 2YLFA 4L46A 4GEOA 5HBHA 3WZKA 4XOZA 4IJ9A 5JMSA 3BHHA 4IB0A 3DAJA 4C4EA 3R8VA 4U3ZA 5G6VA 3VF9A 3ZLWA 1KE5A 2PMIA 2YZAA 4NJDA 5AV0A 3UQGA 3VBTA 2ITYA 3NAYA 2XF0A 5I9ZA 2WTCA 4JXFA 3CQWA 1Q8WA 1ZOEA 5E9EA 4FEQA 4O96A 4H3QA 4AX8A 5IQDA 2UZLA 2QOOA 4DFBA 2C6DA 3PVGA 2W05A 2ZMDA 3I6UA 3IK3A 2W4OA 1BYGA 4YZCA 4HCTA 2GFCA 5CENA 3D0EA 2XEZA 2CNQA 3NNUA 4PDOA 3Q4ZA 2OI4X 4I5HA 4IH8A 3UG1A 4FEXA 3R22A 5AP3A 4BDDA 3L1SA 1H1QA 2VTSA 4RLKA 4XNEA 3BBWA 3JS2A 4NCTA 4QQ5A 3KULB 4DG0E 3C51A 2YIRA 1H25A 3V8SA 2JD5A 3RJCA 3ZRMA 3AD5A 2Q83A 3OW4A 2C6KA 4AW2A 2I40A 5CAQA 3QZGA 2X9FA 1L3RE 4KIOA 1CMKE 1E9HA 2QLUA 1J7UA 1PHKA 2WAJA 3FV8A 3I1AA 4HZSA 2UW0A 2VUWA 3MFSA 3FZTA 2BALA 3QX4A 4IVAA 4PTCA 4ZK5A 3P5KA 3TXOA 3ZM4A 4QTEA 4FKSA 4KWPA 3F5GA 3MSSA 3R9NA 5IEXA 2YACA 2C1AA 5IQIA 5DIAA 2VNWA 4CTCA 1OKYA 5DBXA 2BIYA 2NRUA 2WMSA 3I5ZA 4QYYA 4BDIA 1LPUA 3SHEA 4GYGA 2GNHA 4BI2A 5KMLA 2OBJA 3GC8A 3C9WA 2ERZE 3MY5A 3FL5A 4O1PA 3VUMA 2X1NA 4EBWA 2FH9A 4I24A 1M7QA 4MXXA 5E91A 4ALUA 2BAJA 1JNKA 2WOUA 5EW3A 4RGJA 4YJOA 4OTQA 3F3TA 3SA0A 4BY9E 4DYMA 3PRFA 2NPQA 5DN3A 3OP5A 3UIUA 3MGYA 3EH9A 5IDNA 3OY1A 4ASXA 4C4GA 2A19B 2Z2WA 3EIDA 3NYVA 2XKEA 2WTVA 4O0YA 3DS6A 4AW1A 4EJNA 4OW8A 1JSUA 1W8CA 2O64A 4Z7HA 5LVPA 4BC6A 4C4HA 3DA6A 2OH0E 4PY1A 2QOKA 4FT5A 5FEQA 5IA1A 4JBPA 4EH2A 4FTLA 2R0IA 2YJRA 1H0VA 1PXLA 3PXZA 3TDWA 4ZTQA 1OMWA 2AYPA 3A62A 4O6LA 5FXSA 3DDQA 5DR2A 2Y6MA 4FUXA 4ZIMA 5LCKA 3FSKA 3E93A 3PP0A 5CXHA 3VVHA 4A9TA 4EZ3A 4EKKA 4YPSA 4GG7A 4X2KA 4I6HA 3I81A 4AG8A 3SGCA 4QP4A 4IAAA 1WBWA 3CY2A 5AUVA 2WTWA 1ZMUA 1BI7A 1CM8A 4DH3A 4E26A 3AOXA 2GHLA 4IZ7A 4KKGA 1BL6A 3QUPA 2X2MA 5CZHA 2ITOA 2C5YA 2QODA 3UNJA 1I09A 3PVWA 4AOIA 4EOOA 2GNGA 2V0DA 1IRKA 4MYGA 5M56A 3R04A 1MRYA 5HE1A 2PUUA 3ITZA 3MIYA 4CRSA 4RVTA 2EXCX 2J0JA 2RIOA 3A60A 2QCSA 4QT1A 4YHFA 3QHWA 4EOSA 3T3UA 4JG7A 4ZMEA 3GVUA 1CKJA 3HMMA 4IVCA 5EDPA 4DEHA 3SW4A 3EYGA 3GQLA 4BDGA 1BMKA 3NGAA 4A9YA 3TDVA 2VTRA 3LLAA 2X7GA 4D28A 1OZ1A 2C30A 3PJ8A 3ZSIA 4FZFB 2XNEA 3P23A 4A9UA 4F9BA 4LL0A 4O7NA 4GH2A 1UWJA 4KBKA 1OIQA 4FK3A 4L7FA 3QTWA 5ANKA 3RZBA 4BI1A 3S2PA 4ORKA 5HE2A 4BDBA 5EQEA 4DH5A 3LQ3A 5LMBA 4I94A 2OJFE 4QMTA 5BX0A 3ZM9A 2B9JA 5LMAA 4ZTMA 3KB7A 4RJ7A 1PXMA 4PL5A 2B9HA 3CXWA 4FKPA 4F7NA 3QD4A 4JDJA 3ZO3A 2VTMA 3BLQA 3ALNA 4F99A 5K5NA 5C4KA 5CSWA 3AGLA 5F95A 3F3UA 4W9WA 1G5SA 2W5AA 2OU7A 3JVSA 3SOCA 3KXZA 5AP5A 2GS2A 2WZJA 5K5XA 2PVLA 4FKGA 5JEBA 3BYOA 2GPHA 3K5UA 4L3LA 4RQVA 4D9UA 3I7BA 3NEWA 3O96A 2R3GA 4O0XA 4DEAA 4AFJA 3LJ0A 1UU3A 4OTPA 3R1NA 5AUXA 3QQUA 5J9YA 4KKEA 2E9UA 3TUDA 1O9UA 5HBEA 1NVRA 4E5WA 4QO9A 5DE2A 4FIFA 1Z5MA 4IACA 4RJ3A 3QQJA 4O38A 2RKUA 3IONA 3DJ7A 3AT2A 2YWPA 2B55A 2B54A 3DLSA 4IADA 4QP1A 4TRLA 4Z55A 3GB2A 4XBUA 4FV0A 3QF9A 4FKWA 3V51A 4BZOA 4CFNA 3GFWA 4LQMA 3FZRA 4QTAA 4Z3VA 3FQEA 3S4QA 2GQSA 2DQ7X 5DT3A 2CSNA 4IX3A 5HHWA 4XG9A 4B99A 2PZRA 5L2SA 2CJMA 3WF8A 3ID6C 4ITHA 3HVCA 3O23A 4O0VA 1XH5A 4BCNA 2UZNA 3DBDA 2JKQA 2ITXA 2HK5A 4IVBA 3ET7A 3FZSA 3HMIA 3OMVA 4PPBA 5JT2A 2JLDA 3PXYA 3QCQA 4WO5A 4D2PA 4I23A 3DBQA 4E6DA 2R3IA 3VUDA 3GC7A 5AAGA 1ZLTA 2NO3A 2H96A 1U5QA 4CD0A 4MD9E 4PWNA 3N4VA 3RBWA 2QHMA 5JH6A 3SRVA 2HYYA 2RGPA 1WCCA 2WEIA 2VWVA 4XG2A 1OGUA 3W2RA 2XUUA 2I6LA 4JLCA 4B7TA 4ZP5A 4EK3A 2ONLA 1GZKA 4QMXA 5HU3A 1PXKA 3RALA 2VTLA 2B9IA 1Q4LA 2FSOX 2PZIA 4AN3A 4DTKA 3PZEA 3GCPA 4I41A 5CAOA 4CXAA 2C1BA 1OBGA 4HVDA 1Y6AA 4KBAA 4I6QA 1OIUA 2QOIA 1OUYA 2UW9A 2W1GA 2WELA 4YC8A 4RVKA 3LXKA 1IA9A 2B9FA 5AR4A 2F9GA 4AZSA 1DS5A 1ZMWA 3F2NA 2QLQA 3C7QA 5DT0A 3SXSA 4RFMA 1MQ4A 2OKRA 3F61A 2EB2A 3LLTA 4J71A 3NUPA 3CJFA 4PL4A 3VF8A 4DGNA 4HVIA 1YXSA 2IVSA 4FT7A 2OGVA 3KN5A 3VUHA 3R7EA 2UW3A 3ROYA 5EG3A 4XLVA 2QO9A 3C0IA 1REJA 3Q60A 4UV0A 2C0OA 5JRSA 3V5PA 3VS3A 4AZVA 2LGCA 4GSBA 2F2CB 3KMUA 5A6NA 3BGQA 3O7LB 3R28A 4XOYA 3REPA 4O84A 4L7SA 1WVYA 4XP0A 3D2IA 4U3YA 4EQUA 4O86A 5DA3A 3CEKA 4JR3A 4FG9A 2YCRA 3ERKA 4JRNA 4ZTRA 4IJPA 2QURA 3LKMA 4RA5A 2IZSA 3D7ZA 3FLZA 1A9UA 4DH7A 2XIYA 3DFAA 3HUBA 3KXGA 3SOAA 4AW0A 4YHJA 5H9BA 4DFYA 2E9NA 4C3RA 4ANBA 4CV8A 2Y9QA 1FINA 2O3PA 5CSHA 4RJ4A 2BTRA 4BYJA 5DNRA 3UO4A 3NVKI 4AZWA 3CKWA 4B6LA 2F7ZE 3E63A 5IDPA 4JG8A 4I5PA 3CC6A 4TW9A 4UN0C 2EXMA 2WMVA 3OVVA 3F3VA 3AGMA 4IZ5A 5FTOA 2XM8A 2WQNA 4TYIA 3GXLA 3NCGA 5DMZA 4BICA 4E4MA 3ACJA 3NNVA 2W4JA 3AG9A 4GK4A 2QOHA 5F4NA 3THBA 4MK0A 4FSMA 3Q2JA 1YXVA 3P7BA 5EI6A 3PVUA 3QRIA 4RLLA 5HOAA 4HNIA 3W2OA 2VWYA 1J1CA 3S3IA 4EQCA 4CVAA 4FV8A 4RT7A 1ERKA 4TNDA 5HI2A 3SRVB 5A14A 4FV1A 2RSVA 5JFVA 4DBXA 3RWQA 3QTZA 5E1EA 1QPEA 3RAWA 2VAGA 2X4FA 3DXNA 3BEAA 3WZUA 3ORKA 2C0TA 2G2FA 3FKOA 5BMMA 4WBOA 5EM7A 3QRUA 4RIOA 5AV3A 5CEQA 4UX9A 4RJ8A 3KXHA 4QP6A 2QKRA 5DOSA 2ITWA 4YGAA 3OWKA 4H1MA 2ITUA 3TZ8A 3OCSA 2PVKA 3TV6A 4JI9A 1YHWA 5AIRA 3ZFXA 5DRDA 3DB8A 3IGGA 3T9TA 2XKDA 3OEZA 3PA5A 4G3GA 4ZY5A 5CU0A 2IO6A 2IW9A 3E3PA 3ZLXA 2PZ5A 3FMJA 3CY3A 2V62A 4O0RA 2XK6A 5BVNA 2J6MA 2XEYA 4E6QA 3Q6UA 1Q5KA 3C4ZA 3QCYA 3VUIA 5CVFA 3UIBA 1YDRE 2BCJA 4JBQA 3DTCA 5GZ9A 4M69A 2IZRA 5HESA 2WMBA 3CTHA 4YUQA 3ZDUA 4I20A 4APPA 3U8WA 1UU9A 5AP0A 2KULA 4BGGA 4F6UA 3RCJA 4DAWA 2ZB0A 1A48A 4QNAA 3FY2A 3UIXA 2PVYA 4WHZA 4FVRA 2Y7JA 2BRGA 3FYKX 2PWLA 1M7NA 3FMLA 1JSVA 2ZYBA 4GT5A 4AQCA 3TNHA 2X2KA 2YABA 4L3PA 3D15A 4D0XA 5J7HA 1J7IA 4QNYA 2QOFA 4HYIA 5AMNA 4OAUC 3QTXA 2X4ZA 3QKLA 2GTNA 3PA3A 4OBQA 4DLIA 5BYLA 4CKIA 3QFVA 1O6KA 3L8SA 3MN3A 4FF8A 3R9HA 4G31A 4I0RA 2BZIB 2W7XA 4A4XA 3UZTA 1OITA 4MD8E 4AOJA 4ANQA 3V8TA 4UMUA 2PTKA 2UW8A 4K9YA 2R64A 3DFCB 5IQCA 2CGUA 3TEIA 3NPCA 2OIQA 4CMOA 1ZYLA 2HXQA 5HE3A 1ZY4A 3W16A 4O7ZA 2BDWA 3VBXA 4QP9A 2RF9A 1XJDA 2RL5A 4AA4A 4FYOA 2X7FA 4YTHA 1ATPE 4L53A 4FI1A 1VZOA 5EOLA 5FM3A 3H9OA 2HOGA 3WYXA 4R7BA 3U87A 1GAGA 2F49A 4NEUA 1SVHA 2VO7A 3NX8A 3TKUA 3P79A 3PPZA 4BBMA 3MWUA 5HX6A 3TIZA 4LRMA 3V3VA 2UZDA 4GRBA 3WF7A 2BZKB 2YDKA 3IW6A 4BDCA 4NH1A 2WTKB 2PVFA 4IMYA 3FYJX 4NKAA 4MXCA 2W1CA 4OTWA 5T68A 1Y57A 4MTAA 4Y5HA 3A61A 2QONA 2R5TA 3MVJA 3PXQA 4LMUA 5CF5A 4H05A 1UU7A 3E7VA 3UODA 3OHTA 4AF3A 3DKOA 4JQ8A 1QPCA 3F3ZA 5IZFA 3D7TA 4GMYA 3RVGA 4R77A 1SM2A 3M11A 3WI6A 4RSSA 4U44A 3UNKA 2O65A 4YLKA 4TN6A 4YSMA 2GS7A 1HCLA 1YDTE 3PE2A 4YZNA 5FBNC 1JKSA 2WGJA 2OG8A 3IDPA 4BDEA 2XA4A 3MH0A 1IG1A 5EM8A 2YIWA 3QYWA 4I92A 4AW5A 3NNWA 5L6PA 1PMUA 3KK8A 3F88A 3FUPA 1ZMVA 3HDMA 4C33A 3HEGA 3QQHA 4RRVA 4EH7A 2QR7A 5EHOA 3UZRA 5A46A 3FMMA 2F7EE 4FSTA 2R3OA 3TZMA 5M4IA 3DXPA 2E2BA 4L9IA 2JDSA 4PUZA 3TJCA 3KRXA 5CASA 2F2UA 3PWDA 4ZTLA 4U79A 4HVHA 3ZEWA 4AT3A 4FGBA 5KX8A 4M69B 3ZU7A 4BKZA 2WHBA 3AD4A 2BRNA 4LOPA 3FXWA 1XKKA 2OF4A 4FTJA 2X39A 3FQSA 3ZLYA 4YO4A 5IQHA 2O8YA 3A7HA 3JPVA 4UMRA 5BVOA 4BB4A 2Y4IC 2YAKA 3A2CA 3HA8A 4L43A 5FLFA 3UP7A 2QOCA 3ACKA 3MH1A 1IA8A 2YITA 3ALOA 4UMPA 4H58A 1NXKA 3DQWA 3FMDA 3G6HA 5IEYA 4ZSAA 2YIQA 5BYZA 5CI7A 5BYYA 3BRBA 1G8AA 4EOMA 1WBNA 3Q53A 2PZYA 3PLSA 4FV5A 4BDFA 5HQ0A 5E8SA 3RZFA 1V0BA 2PMNX 3VS2A 1GOLA 3FZPA 4FSNA 2PVRA 4MQ1A 2R9SA 2VWWA 3AMYA 1LUFA 3EFLA 4FICA 4YC6A 4DHFA 4USEA 4IM0A 1AGWA 3EQRA 4XG6A 4BZNA 3QRTA 4C4JA 4FV4A 2H8HA 2XNMA 4D2RA 3MTLA 4G2FA 3CIKA 4YBKA 2DWBA 3WZJA 4BHZA 4CCUA 4C8BA 5CI6A 1CKPA 4AGWA 4AWIA 1JKTA 4ZAUA 2YERA 4F9WA 3ANRA 3I60A 4RFZA 2BKZA 5AEPA 3W55A 3SG9A 1YXUA 2J50A 4KABA 3QTIA 4FKRA 3C5UA 4KIKA 3ZUUA 3ZO4A 1PMNA 3D5VA 3FY0A 1UWHA 3FZ1A 4ZJIA 5EFQA 4NK9A 4Y8DA 3VHKA 3KRWA 4ZSLA 4DT8A 3BELA 3D7TB 4U97A 3QHRA 3G9NA 3PSCA 3OBGA 4RX5A 2I7QA 3HGKA 3AMBA 4F6SA 1VEBA 5M4FA 3EFJA 3D5WA 2DUVA 5DFPA
chains in the Genus database with same CATH superfamily
2JGZA 3MI9A 3G6GA 3NUYA 3QQGA 3NUNA 3BHUA 4JNWA 4EORA 4RWIA 3EB0A 4G5JA 5AIKA 5L8LA 1Q61A 3UDBA 1TKIA 3ODZX 4J52A 4KBCA 5H3QA 1Q8TA 2GSFA 3K5VA 4CZYB 4PRJA 3GENA 4JG6A 3W8QA 3G0FA 3R1QA 2XK4A 1A06A 4JDIA 4FL3A 5CNNA 4LI5A 2OW3A 3ULZA 4FNZA 4MXAA 2X8EA 3LMHA 2IG7A 5C26A 1M17A 4BTKA 4ZEGA 4H39A 4CV9A 3QQFA 1OGYA 1Q3DA 2BAKA 1WBOA 3GCSA 4PX6A 3FE3A 5AUYA 3KXMA 5JSMA 1FMOE 5GNKA 2I0VA 4DFZE 2QO7A 5JKGA 4BCMA 3U9CA 2OK1A 4HNFA 5HNBA 4YZBA 4FKLA 4OGRA 1XMMA 3G90X 4AA5A 3FWQA 4B0GA 4R3RA 4MUQA 5LJJA 2QQ7A 3BLHA 3TACA 3KRJA 4HPTE 4Y46A 5HZNA 4RJ6A 3UP2A 4UZDA 5IA3A 5L6WL 2QKWB 3EQDA 4YR8A 2BILB 2VWBA 5AA9A 5IF1A 5GIOE 3NW5A 4RFYA 4DDGA 3TL8A 3P86A 4JAIA 3C4WA 4R1VA 3RPRA 4KIQA 1W2FA 4RC3A 4BDHA 4FKTA 4QMSA 3SW7A 4QMLA 5B0XA 4N70A 2FO0A 1TQPA 3VUKA 4EH9A 1STCE 3C4FA 2PMOX 3PXKA 1ZXEA 2QG7A 2SRCA 3DB6A 1JSTA 4RC2A 5DHJA 5B2KA 4KUJA 3F5PA 4U8ZA 4QMWA 1O6LA 1OIRA 3A99A 2P2IA 4YBJA 3R7YA 1Q8YA 4YJTA 3TZ9A 4JIKA 4WIHA 4U9AA 1UNHA 4DC2A 3C4XA 2R3MA 4XRJA 2WQBA 2XIRA 2WQEA 2WQOA 5J1VA 4O7WA 5CU3A 4I0TA 3JR1A 3NYNA 4W4YA 3Q32A 1SNUA 2R7IA 5C01A 4RVLA 4EH5A 4FNWA 5IUGA 4AA0A 4HVGA 3HAVA 2VX3A 3HV4A 3LQ8A 3WF9A 3ZTXA 3N4TA 3RWPA 4FIGA 2B7AA 2C3IB 3UDTA 3OWLA 2BDFA 3CGFA 5F9EA 4CLJA 4FTRA 3DZOA 3QWKA 4L00A 3GC9A 4FTKA 1Y91A 3QC4A 4WG3A 3SX9A 3IQ7A 5CAUA 4FKJA 5JZNA 4QP3A 3T3VA 4CNHA 4C2VA 5JGDA 3GC0A 1R1WA 3SV0A 1W82A 2JKOA 2WMUA 3L8VA 1KE6A 3L9MA 3PE1A 3R71A 4IEBA 4C34A 4L6QA 3LFQA 3QA8A 3DY7A 2CGWA 4XP2A 5BVKA 3VS0A 4BGQA 5J9LA 4ZOGA 1UU8A 2CKPA 5AV1A 2YISA 3H9RA 3LVPA 1CKIA 4Q9ZA 4QYHA 3EN4A 4RIWA 3E64A 3Q04A 3GU7A 2HIWA 3NIEA 3W2SA 4EBVA 1H27A 4FSYA 2AC5A 2PE2A 5DR6A 4LV5A 3RM7A 1R39A 3KVXA 1PXPA 4BCIA 2A0CX 2ZDUA 2GQRA 3MVLA 4LOQA 3ZO2A 4C61A 1IAJA 2O2UA 3MB6A 4DGGA 3NUAA 2HWOA 3EQFA 5CQUA 4AXAA 4AAYA 2XJ2A 2YJSA 3Q6WA 1WMKA 1H1SA 4DEBA 1FQ1B 5HLWA 2Y0AA 3UZPA 3G15A 3NYXA 2YEXA 3B2WA 3OOMA 4GK3A 5E92A 3MFRA 4Q9SA 4M68A 3TNPC 1GY3A 2OIDA 4BI0A 4D2VA 1PYEA 3H0YA 2XK3A 3EFKA 3AC3A 4RJ5A 2W17A 3C0GA 1R78A 2C47A 2OICA 3WYYA 3ZONA 5AUTA 2XKCA 3LCSA 4MKCA 4CKJA 4IX6A 2W1FA 2ITPA 3FDNA 3TTJA 5E8UA 2OH4A 1XH6A 2Y4PA 3E62A 3EN7A 3M1SA 2ZV8A 1WVXA 3FI3A 4EH3A 5AA8A 4DHJA 5FG8A 1BUHA 4I93A 2BRHA 4R8QA 4BCKA 1KOBA 5JK3A 4EK6A 3LHJA 3R2BA 2GQGA 1URWA 4ZTHA 1SVGA 5HO6A 4EQMA 5CANA 4EEVA 3MDYA 3LFFA 2JAMA 5E8WA 5HO8A 4K8AA 4EK8A 1KE7A 4RWJA 3IW5A 2CCIA 3QQKA 4O4BB 2QG5A 3T9IA 3W2CA 4APCA 5K0XA 3UOLA 1GZ8A 3LOKA 2WMWA 3DGKA 3OW3A 2XZSA 3WE8A 4DA5A 1LR4A 3VBQA 3D14A 4RIYA 4N0SA 2BZHB 3ORXA 2REIA 2YAAA 3EQBA 4JRVA 4M3QA 3ZO1A 3A4PA 5TF9A 5L2TA 3R02A 2BUJA 3QD2B 1REKA 2ZM3A 5C8MA 3R8UA 2C5VA 4CFWA 4LUEA 4EHGA 3KRLA 3R6XA 2VTJA 3HUCA 3LFSA 3V5JA 4O6EA 3UDZA 4DTBA 4ONAA 4GU9A 4M7IA 3OS3A 4R5YA 4ASZA 4P5ZA 3DT1A 5HD4A 4ZS4A 3VO3A 3U4WA 5LVMA 2G2HA 4V05A 5H2UA 4BL1A 1H1RA 3BE2A 4IDVA 4JAJA 3T8OA 5I9WA 2XALA 5L2WA 1ZOGA 3GGFA 3BI6A 3KL8A 3OBJA 4LG4A 3TIYA 1QPJA 3UPXA 4G6LA 4RC4A 3OC1A 2HZ0A 3PWYA 4EKLA 4ENYA 4R6VA 2UZWE 3LFNA 2X0QA 3F7ZA 5KKRC 3FI8A 4TYEA 3NS9A 4U40A 4BF2A 4RIWB 4CT1A 2PL0A 5HNGA 3KXNA 4PL3A 3HRBA 5I9XA 1ZYCA 5IQFA 3ZH8A 4D1ZA 4E5AX 4X0MA 2Y8OA 5H8GA 4P5QA 4F1MA 2Y6OA 5DEYA 5LWMA 4UXLA 3R21A 2VV9A 4C02A 5C1QB 1BX6A 1K3AA 5AM7A 3L8XA 4EK4A 2PPQA 4MBJA 5H8EA 5EHYA 5GINE 4L68A 3EN9A 3GOKA 4XV3A 1Y8GA 4EL9A 2ACXA 3PJ3A 1SYKA 4AACA 1H07A 2A27A 2XNPA 4F7SA 4NTTA 2UVZA 4UMQA 2GNFA 4FZ7A 3EMGA 1YKRA 4ANOA 4QMUA 5F20A 4Q5HA 5IH5A 4LGHA 2YIYA 3DJ5A 1YQJA 1P4FA 1KOAA 2QU5A 5KZ0A 3PLAE 3VJOA 5DH3A 4U80A 4F09A 4ERKA 4JDHA 3BZ3A 5ITAA 4ANMA 1UKHA 2F57A 2VO0A 3WBLA 2YCFA 3EKNA 4NFMA 3QTSA 4O0SA 5AM6A 5FP5A 2XIXA 4FZAB 4DINA 3OUKA 4ANLA 3PSBA 4ASDA 3EKKA 4DHIB 1QCFA 3EWHA 3MY0A 5AP2A 5ETAA 4D4VA 5JN2A 2GTMA 2PU8A 4O21A 2I0HA 4QYEA 4C36A 3PIZA 4RIYB 5ANDA 2XRWA 2X6EA 4UB7A 3BBTB 2B4SB 3KC3A 4C37A 3ZCLA 3CS9A 4MXZA 3BEGA 4MNFA 3OG7A 2R4BA 4YJNA 4UY9A 4EUTA 1F0QA 3IDBA 2YM7A 4I22A 5CT0A 4NYEA 5D41A 4DT9A 2ZAZA 2HZNA 4OBPA 4NM0A 4ZTSA 3FMKA 4A4LA 5M4CA 1U5RA 2IN6A 4IFCA 4RVMA 4TWNA 3H30A 2G15A 3HV5A 4QQCA 2J9MA 3V6RA 3KMMA 3HV6A 5I3RA 4UWYA 1OBDA 3MIAA 4FVPA 4X3FA 2PZPA 4FEWA 1F5QA 4FNXA 1FGKA 3DCVA 4J8NA 4FSWA 4FV6A 2HWPA 5JFXA 1PKGA 1XH9A 2P55A 2RFSA 4IX5A 4MX9A 4OR5A 5AV2A 4E4LA 2PVNA 1FGIA 3GEQA 4M14A 2NNWB 2HAKA 4Y73A 3E8NA 4EI4A 5AP6A 3QUEA 1ZRZA 2YFXA 2OF2A 2OXDA 5GZAA 4UWCA 3VC4A 4X21A 4I6FA 4O2ZA 5ANOA 3Q4UA 4RBLA 5BVFA 2XYUA 3F7WA 4IAZA 5EOBA 3U6HA 4D0WA 4D2TA 5KMOA 4ZMFA 4AUAA 1E1XA 4CFVA 3ZMMA 2PK9A 4I5CA 5HIBA 4IANA 5M57A 4EJ7A 3MH3A 2ITVA 5HG5A 2BMCA 2C6EA 1BI8A 2FVDA 4D9TA 4O2PA 2BR1A 3JY0A 5M08A 2HENA 4CLIA 2X0OA 3L9NA 3R63A 4AQKA 2V22A 2VTHA 3MPAA 5I9YA 3VS7A 4FG8A 3DKCA 3QRJA 4M8TA 2NP8A 4IE9A 5H8BA 5HVKA 1ZZLA 3AKJA 4PMPA 4MEDA 4CQEA 3P0MA 2H9VA 3FXXA 2ZMCA 4J99A 4M84A 4BWXA 1GZOA 4CRLA 3KFAA 3Q3BA 2ZV2A 5CEIA 4C2WA 4DFLA 5AAEA 2ETRA 3KKVA 3R9DA 4X3JA 1HOWA 5HLNA 3BU5A 5FQDC 4KD1A 3D83A 5ANGA 4F4PA 3BGZA 4C62A 2ZDTA 3ODYX 4CSVA 3O8UA 3RK9A 3BGPA 1Z57A 3LPBA 4FBXA 4FODA 3V5WA 4BZDA 2P4IA 2C4GA 2YDJA 5CX9A 2YM4A 5D7AA 2Z7LA 5HCZA 5K9IA 2WOTA 4WA9A 5CLPA 5LVLA 4D1XA 5G1XA 4A9SA 3KIOC 3LJ1A 4DFXE 5EW9A 2WB8A 3RK7A 1U54A 2WMRA 4S31A 5CAVA 3HKOA 3W0MA 5J8IA 3KGAA 4CFXA 5IH6A 4HYHA 3MH2A 2OXXA 4YC3A 4J97A 4TYJA 4RPVA 3NSZA 4ZSEA 3IOPA 5C9CA 3KN6A 3HV3A 4NM7A 3IO7A 5AR3A 2ERKA 4XV1A 5K0KA 4FSZA 4GL9A 4O7VA 3DLZA 3FMHA 5C03A 2RG5A 3KK9A 4IAYA 5E8YA 4AP7A 1VLRA 4JQ7A 1MRVA 2XRUA 3H9FA 2Z7SA 3FXZA 1G8SA 1Q99A 2Z7RA 4U81A 2B0QA 2BHHA 4X3FB 4BCJA 4QTBA 4X3FC 3DV3A 4R1YA 4FV2A 4U45A 5I3OA 2FSTX 4RX8A 2OLCA 4UMTA 5EQYA 5HE0A 3I0QA 4DHZA 3RHXA 4GS6A 5CF6A 5AUZA 3WZEA 2J5EA 1DAYA 1URCA 3R8MA 2XCKA 4IQ6A 3PIXA 2XIZA 2CCHA 4WNPA 4WNOA 3ZRLA 4YSJA 5CZIA 3TNWA 3QCSA 1EH4A 3GU5A 2RFEA 5DR9A 3V04A 5E1SA 1SZMA 5J87A 2X8DA 2ETMA 1MP8A 3ZOSA 1M2RA 1M2PA 3P4KA 4QQTA 4NFNA 4BRXA 3D5XA 4F6WA 2XJ0A 1H0WA 3KY2A 3POOA 4DFNA 2ZM4A 4IC7A 4TYHA 2V7AA 3FMEA 4G34A 2X81A 3QQLA 5I9UA 3ZXTA 4F65A 5IQBA 3BV2A 3QUDA 2JBPA 4J7BA 2GNJA 5E8TA 3R83A 4D58A 4DF3A 2Z7QA 3R8PA 4DCEA 2O5KA 3QZHA 4BIDA 2PUPA 3W0OA 3GNIB 4F9YA 3R7GA 3VRZA 3CGOA 4ZSJA 1QPDA 3GOPA 4JR7A 3UVPA 3JY9A 3N9XA 2QR8A 3NYOA 2X7OA 2GCDA 3PJ1A 3E88A 4QMOA 4Z16A 5B7VA 3CTQA 3CPBA 5HEZA 1M14A 3LFAA 4I4FA 4V01A 3EQGA 3OWPA 2C0IA 4G9CA 4YJVA 5CF4A 4NL0A 3KU2A 5HGIA 5TT7A 4D2WA 5IA4A 4CKRA 3AKKA 4QMZA 1M52A 1VYZA 4XG4A 3KRRA 4C0TA 5LQFA 1K2PA 5BVEA 1OUKA 1E1VA 5BVWA 4G6NA 1W7HA 5HIDA 1U54B 3ORPA 2J0LA 4O1OA 5HORA 3R73A 3LCKA 1RE8A 1H8FA 3G9LX 2EXEA 4EC9A 1BKXA 2V5QA 3Q9ZA 3OT8A 4BBEA 1AD5A 5CSXA 3O71A 2BFYA 5CF8A 4C7TA 4AXCA 4I4EA 4BDKA 4II5A 2Q0BA 5LOHA 4D4SA 3UTOA 5JFSA 1PY5A 2WQMA 4IB5A 4I1ZA 3S95A 2CGXA 4Z9LA 3RAIA 2C5XA 3UMXA 4B8MA 4D2SA 5JFWA 5IG1A 2W9FB 3N4UA 2ETKA 4E93A 1MUOA 1PJKA 1SNXA 2VX0A 4CMTA 4NU1A 4AN9A 4DG3E 4KRDA 1Y6BA 3LW0A 3NMUF 5BUIA 4RX9A 4GIHA 2JBOA 2WIHA 3MJ1A 3OT3A 4CG9A 2WNTA 1NA7A 2ZV7A 4YZ9A 4HGSA 5FTQA 3OTUA 5BNJA 5LWNA 1JWHA 4I0SA 1WBTA 3ZXZA 2VWXA 3MVHA 4BIEA 3RMFA 5M06A 3QBNA 3MB7A 2BVAA 2FUMA 4XG3A 2JKKA 3RPVA 5CEMA 3TV4A 3W0PA 3GP0A 3D94A 1KE8A 4HGTA 2UZUE 5ANJA 1Q24A 1XQZA 4AN2A 5HG7A 3A8XA 1L8TA 3LCOA 3CTJA 4RMZA 1OVEA 1BLXA 4ITJA 2CDZA 2FSMX 4YU2A 2XNOA 2RFDA 1PXOA 1PYXA 5CSVA 3UIMA 3W0RA 2GNIA 2O0UA 2OJIA 3Q9YA 3DNEA 3ZDIA 3A7JA 3FI2A 2CPKE 3F66A 4TYHB 4CZUA 2W9ZB 1ZWSA 5E4HA 4PP9A 4WG4A 4F63A 3L9LA 4IBMA 3QWJA 2XBJA 5EYKA 3CSVA 4J53A 5L8KA 4DGLC 2CKQA 2ITTA 3LCTA 3EOCA 3I4BA 4GJ2A 3RP9A 5EI2A 3OXIA 5GZ8A 2XP2A 4MBIA 2WMQA 4TWPA 4D4YA 3PY1A 3FJQE 4IAIA 2OIBA 5HG8A 3P9JA 4Y72A 4YTCA 2WTDA 3CCNA 3ZBXA 3WARA 3O0GA 3D2KA 3COIA 2PVJA 3II5A 2XNBA 5EDQA 3TNQB 1Z9XA 4G3FA 5HNIX 1GNGA 5A4CA 1IAHA 3FC2A 1YHSA 5L8JA 3HZTA 2PE1A 4WUAA 4FTAA 2R3PA 4WBBB 1UVRA 4EOJA 5CEPA 3G5DA 4CGAA 4PTGA 3JYAA 1Q41A 5FEDA 3VS4A 4KS7A 2XB7A 4S34A 3V6SA 3WIKA 5IA0A 2Y4IB 4LGDA 3RHKA 4NT4A 5HTCA 5JRQA 4RWLA 4BTFA 4DDIA 4EYJA 3V5LA 2W96B 4KRCA 4RWKA 4NM3A 5JGBA 2CLQA 3OXTA 4FE2A 5HLPA 3KCKA 5KNJA 3TYKA 3EQIA 1CTPE 3CJGA 4WT6A 5FDXA 3ORNA 3NAXA 4FG7A 3ZYAA 3F5UA 2CN8A 4KKHA 2W1EA 3F3WA 5F94A 3MYGA 1APME 4XJ0A 4IHPA 3RINA 4EYMA 2OJ9A 5ANEA 4TZRA 1JQHA 4XS2A 2R3LA 5L3AA 4U0IA 3PP1A 3PJCA 4YJPA 3F69A 4G3CA 4YNEA 3QD0A 4IB1A 4GG5A 2BFXA 4FKIA 2Q0NA 1TQIA 1RJBA 3JXWA 4L42A 4WRGA 3IW7A 3COHA 4XYFA 5GJFA 3PYYA 2QVSE 4RX7A 4BTJA 4C35A 2ESMA 4G16A 4LDTA 1OKWA 1Q62A 1OPJA 1OM1A 3LFEA 4FNYA 4PDSA 4F0FA 2JC6A 3IG7A 4FTQA 2YCQA 5KMKA 3CBLA 3VWAA 4I6BA 4QMVA 4FV7A 3TKHA 3MJ2A 3OY3A 3P08A 3AQVA 4K77A 3OROA 3OUNB 3Q9XA 4IX4A 1TVOA 3V5QA 3PPJA 4D55A 5BMSA 3P5JC 2X0GA 3MVMA 2R2PA 1Q97A 4KSPA 1U4DA 2PYWA 1UNLA 5BPYA 3K54A 4FKUA 1J3HA 3TV7A 5C4LA 3LCDA 3DJ6A 1XHAA 2OSCA 4S30A 5D7VA 5HVYA 4DTAA 2CMWA 2GFSA 5IQEA 4Q5EA 4QP2A 1WFCA 3LQ5A 4ZY4A 4FKQA 5AFVA 5K4JA 5AP1A 4ACMA 3WIGA 4B8LA 2QO2A 4U42A 4MVFA 5IQGA 2XARA 2QU6A 2W0JA 4IAKA 3WE4A 3ZFMA 1UV5A 4CT2A 3BHVA 3R1SA 2VGPA 2JDTA 4E5BA 5A4QA 4GW8A 3NCZA 3ZRKA 1J91A 4DEIA 1ND4A 5HVJA 1ZARA 2HW7A 1FMKA 4PDYA 4IXPA 4Y83A 4HYSA 5CS6A 4O7YA 2UZTA 3K3IA 4JX7A 3FLYA 2EWAA 4S2ZA 4FIEA 5TO8A 1LEWA 2QC6A 3QAME 2UW5A 2UW4A 3ORMA 4UEUA 4AZTA 3KXXA 5E8VA 4L8MA 2VNYA 1KV2A 2JDRA 5ANIA 4F0IA 4OTDA 3SLSA 3SD0A 3F5XA 3W2QA 3QA0A 3FPMA 3PSDA 3RNIA 4EOLA 3EZVA 1J7LA 4Z7GA 3PUPA 4ITIA 3VJNA 3A8WA 2CHLA 3AC1A 3NIZA 4U6RA 1Q3WA 3HLLA 5KHXA 1Y8YA 3C4CA 4FK6A 5EDRA 2FB8A 1FVTA 1PXNA 2J90A 5CT7A 5K3YA 2YM3A 4FT9A 4ACGA 2JDOA 2I1MA 5E7RA 3EN6A 4WNMA 1PXJA 5IA5A 3W33A 1WBPA 2PSQA 2CLXA 3VS1A 3CQEA 4IZYA 3UNZA 2WU6A 3CD8A 4F08A 4FZ6A 3R1YA 3FL4A 1B6CB 1IR3A 4E20A 3QZIA 3KULA 2E9PA 4WSQA 1ZY5A 2X6DA 5FXQA 4ZZNA 4C38A 3BX5A 5M55A 3BYVA 2ITQA 3AC4A 3R8ZA 3VULA 4AGDA 4O7RA 3K3JA 3ZEPA 5HICA 3LFDA 2VTPA 4GCJA 4FX3A 3SXFA 4F64A 3RK5A 4O27B 1GJOA 3B2TA 4BGHA 4ZTNA 3TN8A 4DH8A 3GQIA 2W1DA 4FT3A 5LARA 4WKQA 4ALWA 3GI3A 5J95A 3R2YA 2W1IA 3EQCA 4WG5A 4EHZA 2V7OA 3VUGA 4FUYA 4O4DA 3BYUA 3TJDA 4CYJA 5J7BA 3MV5A 1H24A 4FV3A 3MPMA 4KIKB 4G6OA 3IS5A 5IKWA 4RIXA 4ID7A 2BAQA 3QXPA 4GV1A 5DWRA 1RW8A 3VRYA 3QKKA 5E8XA 4TYGA 2HCKA 5J79A 4QMQA 2F4JA 2VWIA 5I4NA 3CE3A 4XHKB 5DRBA 1HCKA 4L52A 4X6RA 5CXZA 1R3CA 3U54A 3BCEA 3HECA 3A4OX 4FTUA 4JBVA 3R00A 2OZOA 4HYUA 1OL5A 3ROCA 3VW8A 4ACHA 5AADA 1DAWA 4DG2E 3VS6A 2UZVA 1YRPA 3HX4A 3I79A 4U7ZA 3ZS5A 4BKJA 3UYSA 4PPCA 5DVRA 4ARKA 5EKNA 3BHYA 3GU4A 2XBAA 2YWVA 2NRYA 3R30A 5FM2A 4Q2AA 3BL9A 3MS9A 1YI4A 2QD9A 2W06A 3AC2A 3PG1A 4DE4A 1XBAA 3D9VA 4J98A 5KHWA 1P5EA 5HX8A 1ZYDA 2BRMA 3AC5A 4CZTA 1H08A 1YI3A 5CTPA 3G2FA 4H36A 4NIFA 2P0CA 4X6QC 4F1OA 5AUWA 4DFUA 1YWRA 5IMXA 5KZIA 1P2AA 3DQXA 3FBVA 3TM0A 2B53A 4LOOA 4D5KA 1DI8A 2YHVA 2GDOA 1JKLA 3OF0A 5GJDA 3QL8A 5TOZA 2ITZA 5M44A 2HZ4A 1Q8ZA 4EC8A 3UC3A 1FPUA 3Q9WA 3LXPA 1LEZA 5CVHA 4NSTA 4EWHA 2W5HA 5AUUA 1XBCA 1AQ1A 5HCYA 3UG2A 5FTGA 3BWJA 1PW2A 2KTYA 2UZOA 4CFMA 4H1JA 3UPZA 4JOAA 4K2RA 4XV2A 4HPUE 2P2HA 4V04A 4BCPA 2BROA 4QMYA 4BJJA 3NVMB 3SVVA 5FEEA 1YOLA 4R3CA 2OJGA 1B39A 4NM5A 5DEWA 1P4OA 2W1ZA 2C6OA 4KIPA 3ATTA 3LIJA 4XBRA 3FI4A 2AC3A 2E9OA 4AAAA 3FQHA 3U9NA 4FTMA 2HELA 2J7TA 4O0TA 3R9OA 4WRSA 4EHEA 3VS5A 2QOQA 3C5IA 3GU8A 4EK5A 3TUCA 4A4OA 3FSFA 2WKMA 1ZZ2A 2VTNA 3ZBFA 2GMXA 4O83A 4UYAA 5L4QA 4YLLA 4YURA 2CKOA 3HNGA 5AP4A 4BIBA 2EU9A 4WD5A 2IJMA 4PP7A 3W32A 5L6OA 4E7WA 4CYIA 4CVAA 4RQKA 5KBQA 4NKSA 3C4EA 4I3ZA 3GCVA 3OXZA 4QP7A 4QEBA 2HW6A 4AZFA 1XH8A 3KEXA 3OD6X 4RIXB 2JAVA 5EYCA 4CFUA 3V8WA 5B2MA 1WBVA 3QRKA 2XJ1A 3VAPA 5M07A 4GT3A 4MBLA 4N6YA 2P33A 3B8RA 3P7AA 3IPHA 4C4FA 1GIIA 3PG3A 4A9RA 5ETIA 2VTIA 4K0YA 3FLQA 4TT7A 3Q4CA 3TUBA 1K9AA 1OIYA 5AR7A 5ACBC 1W0XC 2RFNA 3O7LD 1H1WA 3FZOA 4O81A 2JKMA 5TE0A 2R3QA 3WF6A 4RZWA 4LMNA 4G9RA 3G0EA 1S9IA 4IDTA 3W10A 4O4EA 3OCGA 4A7CA 1PF8A 5LCJA 2VX1A 3UOJA 4RZVA 5KKRB 4LRJA 4XV9A 1YW2A 3AD6A 3FEGA 4FGRA 1KWPA 2J51A 3CQUA 4JIAA 4KA3A 3BL7A 4CG8A 1M2QA 5FUTA 3CPCA 3R7IA 4NIFB 4YP8A 3TI1A 4YNOA 3DAEA 1R0EA 4W4WA 1ZYSA 2JIUA 4EZ5A 3ZUTA 1S9JA 4QQJA 5TR6A 1FVVA 3I6WA 4ZZOA 2IEWA 3OOGA 3PPKA 2OFUA 4O0UA 4HGEA 4JQEA 4QD6A 3RI1A 5CSPA 3RM6A 3I7CA 2WTJA 3AT4A 1MQBA 1WVWA 5E90A 1YXTA 4MCVA 3DTWA 3OCTA 2YM5A 4YJUA 4A07A 5I9VA 1WZYA 4KSQA 2WMTA 4H3PA 2XS0A 3SC1A 4EWQA 3BYSA 1J1BA 3F9NA 3FMNA 2BHEA 3EFWA 2PMLX 4TXCA 4O82A 5M09A 4K6ZA 5D12A 1P14A 4BCFA 4BYIA 4BJJB 4FRFA 2R3HA 3VBWA 2IZUA 4NZWB 4AT4A 4RG0A 3IKAA 3M2WA 4OTFA 4U5JA 3KA0A 1W84A 4DGMA 1BL7A 5EM6A 5C8NA 1V1KA 5BUJA 4WUNA 3LZBA 3KVWA 3UOHA 4BDAA 1GIJA 2J2IB 3D5UA 3LJ2A 3ZC6A 3RPYA 4M66A 2XKFA 3JVRA 1OL7A 2I0YA 3NZ0A 3QKMA 4NCTC 4YJSA 4NUSA 2IZTA 3NW6A 1ZAOA 3B8QA 3AT3A 2G9XA 3UYTA 4AOTA 4HOKA 5HCXA 2ZB1A 3PFQA 3GCUA 3EQPA 3QX2A 3MESA 3L9PA 5CU2A 4GK2A 3I0OA 1YHVA 5AR5A 2B52A 3WILA 5JZJA 5T6KA 5KE0A 4LM5A 1OL2A 4ZLZA 4MD7E 4DBNA 5LXMA 1V0OA 4FEUA 4W8EA 4L44A 4JX3A 3EN5A 3VBVA 2IVTA 3BQRA 1YVJA 1W83A 2QI8A 3GUBA 4C3FA 3QYZA 3PFYA 2IWIA 4QMPA 5B2LA 1XMLA 2R0UA 3DKFA 4HCVA 5EH0A 2XVDA 2ITNA 4PNKA 3AMAA 3EL8A 4M0ZA 4W4VA 5L2IA 1SMHA 5T3QA 1WAKA 3GCQA 5D11A 2VTQA 3LMGA 5KMJA 4P2KA 4QYGA 5DLSA 3VUTA 4F7JA 2OZAA 4XRLA 3LM5A 2YN8A 2IVUA 4PDPA 4ZXTA 2XNGA 3MFUA 3HP5A 4CTBA 4ASEA 4FTIA 4CMUA 4FIIA 5A3XA 4DEEA 3BKBA 4X2NA 4M67A 4DLJA 5D9HA 4R7HA 3FHIA 2UW7A 2UW6A 3TMOA 5EM5A 4K33A 4OTHA 5EI8A 1VJYA 4R5SA 5IH4A 3OWJA 4K1BA 4E6CA 2P3GX 2WD1A 3P78A 4OT6A 4TWOA 4FL1A 5A4TA 4X7QA 3EHAA 3S00A 2C6LA 4FIJA 4AS0A 4USDA 3MY1A 3NFFB 3DKGA 4J1RA 4OTRA 2VRXA 4QRCA 2BPMA 2J5FA 3DBCA 4F9CA 4FJVA 3FLWA 4CFFA 5HO7A 1H00A 4LUDA 4FKVA 2VWZA 4TNBA 4QTDA 2FSLX 3HDNA 4OTIA 2UZBA 3UBDA 5KCVA 2VO6A 3TNIA 2C69A 3GT8A 4ZZMA 5I0BA 5IPJA 2C5NA 5ETFA 4PTEA 2PUNA 4FSQA 4GKIA 3UVQA 2WEVA 4GYIA 3GU6A 1T45A 4IM2A 4QPAA 3QGYA 4NJ3A 3MA6A 2W99B 2QNJA 4KB8A 4EOIA 2YLEA 4X2JA 2VN9A 2VO3A 5D10A 3Q5ZA 3ULIA 3UQFA 1O6YA 4W4XA