3REPA

Crystal structure of the ilk/alpha-parvin core complex (mnatp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
268
structure length
268
Chain Sequence
HSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQSPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVSKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin-linked kinase
publication title Crystal structure of the ILK/alpha-parvin core complex (MnATP)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 80
structure length 268
sequence length 268
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3repA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3repA01
3CD8A 1YW2A 2ZDUA 5G6VA 3OW3A 4OW8A 5IKWA 4G6NA 5IH4A 2IZTA 3NUNA 4PUZA 4RIXA 5IPJA 3F5PA 5CWZA 3P1AA 2P2IA 3PIYA 5CALA 5F94A 5AP2A 3EKNA 5EDPA 5HTBA 5K0XA 4ASDA 2X9EA 4I4EA 4MEDA 5EFQA 5HG5A 5IUHA 4DG2E 3JY0A 4F9CA 3TZMA 3ZFYA 3DQXA 4R1YA 4XS2A 3FXXA 5E8VA 3BQRA 2WZJA 3VS3A 4BTMA 2BZIB 2C3KA 4FKUA 3HMIA 5DLSA 3L9PA 3ORKA 5HGIA 2X2KA 1FBNA 4DE4A 2C68A 5HLPA 2HZ0A 3NIZA 1BYGA 3RNYA 3MSSA 2NRUA 3R73A 4I1ZA 3R9RA 2XVDA 4OAVB 4O7LA 4MXOA 3Q5IA 2YZLA 1T45A 1YHSA 5DR6A 3QQUA 3S0OA 4MWIA 2JIUA 3C4XA 4CFUA 3F3ZA 5JN2A 4AGCA 4FVRA 3FHRA 3R7GA 4O21A 4RVTA 4AZWA 2X4ZA 3OMVA 4XNEA 2QODA 4GL9A 3FMDA 4BYIA 4G31A 3WOWA 1Q24A 3F9NA 3NUSA 4KD1A 2V7OA 2W1GA 3EQHA 3U87A 4NTSA 4FSMA 3FMHA 4WUAA 5H9BA 3UIXA 2XBAA 3HMOA 1JNKA 2HZIA 2OU7A 3Q9YA 4OTHA 2VWIA 1FINA 1JKKA 4FSUA 4AGWA 4TW9A 4CKJA 4WNMA 4HPUE 3HMNA 5AA9A 5JRSA 4QTBA 5EHYA 4D0XA 4DFYA 4RA5A 4MVFA 5E1SA 4U44A 5ITAA 5EDQA 2W06A 3DXNA 2O5KA 4EK8A 2QLUA 3MESA 4XH6A 2Y4PA 3LJ2A 2RKUA 3BEGA 3AC3A 2CMWA 4OTQA 4L7FA 4GW8A 3UIUA 4ID7A 3UG2A 2OIQA 5CI6A 3UP2A 3EMGA 3HV5A 4RVLA 3QKMA 4IAZA 3OHTA 4NM3A 3TNHA 4ANBA 5HE2A 2W17A 3QF9A 3WF9A 1B6CB 3A8XA 3IO7A 4NU1A 4USEA 1NW1A 3E8CA 3GB2A 3TCPA 3A7FA 2UW7A 4DYMA 2QOKA 4I5HA 5BQ0A 3QKKA 2VX0A 5JFXA 2ZJWA 3LFDA 5AP4A 2YAAA 3MIYA 5KMJA 3G15A 2VN9A 4G3FA 3UTOA 4KSPA 2E9UA 3CY2A 4E6DA 4QQJA 3VJOA 2C6IA 4C8BA 3PSDA 5AUVA 2WMAA 2ZMCA 4HNIA 4DFXE 3E62A 1BI8A 2HXQA 4RX7A 3MV5A 2HOGA 1FMKA 2J5EA 5H2UA 2R3PA 4WOVA 4TXCA 5JZNA 1M7QA 5E92A 4ZTRA 3CJGA 1R39A 2UVYA 3NW7A 4FV6A 3NCGA 4Y5QA 3VBTA 5KKRC 1PRYA 4XG6A 3PZHA 5K9IA 4AZFA 3CGOA 4TWOA 2H9VA 4DGLC 1KSWA 2YITA 4KIKA 2YLEA 4NIFB 1GAGA 1KE5A 2YM8A 4QRCA 5CEQA 3DB8A 1JKTA 4GU9A 4C4HA 3CD3A 1XWSA 3MFUA 3UO6A 3MPAA 3V8SA 2X0GA 4MD9E 3UNJA 5BX0A 3C0IA 4TYEA 3Q04A 2PVLA 4YBJA 2WIPA 3V5WA 3BYSA 3QXPA 4FTAA 4L45A 4UYNA 2UW4A 3PPKA 1VEBA 2Y7JA 4EK4A 2BR1A 4O0RA 3UZPA 2W1ZA 5EM6A 5DMZA 4IB3A 4IWOA 4UMPA 1SVHA 3DXPA 4BI1A 4G9CA 4IDTA 4W4XA 3G9NA 3PP1A 3REPA 2B9JA 1V1KA 3O8PA 4FTQA 5J5SA 2W96B 3U55A 1U46A 5IQIA 3TG1A 2BDJA 3OVVA 4ASZA 2HAKA 3W18A 3P7BA 5A3XA 4C4FA 3SV0A 3ZLXA 2CNVA 5EQYA 3G0EA 4EK5A 3Q32A 4OUCA 4RJ6A 4EHEA 4ZTMA 3VS6A 4BTJA 3A4PA 4GRBA 3EIDA 4B7TA 2IG7A 3LFCA 3QTIA 2BZJA 1W84A 4LUEA 4BDDA 4JNWA 2PSQA 4D5KA 5HLNA 3AD5A 4R6VA 3LCTA 3D94A 2VWZA 3RPRA 4R77A 5M44A 3ZBFA 2YJRA 4FG8A 4D4SA 4IC7A 3VQUA 4BDEA 4BDGA 4EH5A 1OIUA 1VZOA 1WVXA 2Q0BA 2V7AA 5J95A 4FF8A 2G2IA 4CRSA 4PMPA 3ZM9A 2J51A 5CSHA 1H00A 3RVGA 3Q3BA 1YDRE 3PVBA 5CQWA 5AR4A 4AN3A 4D28A 4GK2A 3V01A 3ZRKA 2JDOA 3MY1A 2VD5A 4GYGA 3VS4A 2BAQA 4H3QA 3NYNA 1XJDA 4DHFA 5L2SA 4RX9A 1R0PA 2YM4A 4RJ7A 3E87A 1W98A 4RZWA 3P9JA 3GQLA 1BI7A 3AMAA 4EHZA 1IAHA 3QRUA 5E1EA 4FSTA 2VTHA 3D5UA 3FJQE 2C30A 4CYIA 2Z7RA 4ZZOA 5M56A 3SAYA 2UW8A 4QYGA 3OY1A 3PTGA 2BUJA 4XV2A 3G90X 4IJPA 4EOPA 4UZDA 1L8TA 5CZHA 3DLSA 5CENA 1PKDA 3QWKA 5A4EA 4DTKA 3FHIA 2HY0A 4QMZA 3GU6A 3QC9A 2WTVA 2QOOA 3ELJA 3OT3A 1YDSE 3MA3A 1XQZA 2YAKA 4IEBA 4GEOA 3LPBA 2BZHB 5HVJA 4YMJA 3P4KA 4C59A 4O84A 3E93A 2J0LA 1KE8A 5AP5A 1F3MC 1W0XC 4EH8A 3TTJA 4S32A 3FSFA 3NAYA 4YLKA 3Q4CA 4AS0A 2F7XE 2XKDA 1NA7A 4ZEGA 5KKRB 3UMWA 3N4UA 3FQEA 4Q2AA 5AIKA 1UU7A 1SVEA 3ACJA 2VTPA 1ZXEA 1IEPA 3H0ZA 1M2PA 4Z3VA 3MTFA 1W82A 2YWPA 3FUPA 4R3RA 4U45A 2YCFA 4O6LA 3HDNA 3HVCA 3FYJX 4FTRA 4IWDA 4H39A 3EL8A 3VS7A 4AUAA 3PY0A 2XF0A 4TNBA 4CMUA 3KL8A 5L2TA 4FL1A 1O9UA 3KRXA 5JK3A 3C4EA 4HGLA 1KV2A 4C3FA 2OGVA 2VTNA 3A60A 3C1XA 3HEGA 3AGLA 2W1CA 4RLLA 2QR7A 3RAIA 5HX8A 3NNXA 2PZRA 5G1XA 4ASEA 1OL1A 4IX5A 5K0KA 4YU2A 3ZU7A 5A54A 2YIQA 3F66A 3EHAA 2BFYA 3NYVA 4ZZNA 3R7IA 4C34A 2H96A 4JQEA 4BDFA 4LQMA 3FKOA 2R7BA 3QYZA 4D1XA 5HU3A 3ZZWA 1WCCA 4FTMA 3BLQA 3DKOA 5AR8A 3R7VA 4QMOA 4UWBA 1Y6AA 1WMKA 3R83A 4LRKA 5C27A 3LXKA 4W4VA 3ROYA 1WBNA 1WBVA 3DBEA 4IAKA 5B0XA 2JDVA 4DCEA 2CKQA 3PIZA 4A4XA 3A8WA 3AT4A 2ITWA 3IW8A 4LMUA 4RVMA 4CLJA 5KE0A 4OLIA 3G51A 3WZEA 3R2YA 2OXYA 2XK4A 4BHZA 5FGKA 2ZV7A 1XH7A 2X7OA 3COIA 2P33A 1H1SA 5K4IA 3R04A 3IDCA 5KUPA 2BRMA 1VYZA 4I20A 5GNKA 3P5KA 2GHGA 3I0QA 4RZVA 5BUEA 3QRIA 2A1AB 3AG9A 1OITA 2GCDA 2X4FA 2QKWB 4EOJA 4OAUC 2WPAA 5EM8A 3E8EA 3FZ1A 2GS7A 2Y8OA 3MH3A 3ZHPC 1EH4A 5I9XA 2VZ6A 2CNUA 2HW6A 4W8DA 4ZK5A 4W9XA 5DVRA 2IVVA 3BYMA 3F69A 4CD0A 3QBNA 1MUOA 4JDJA 4AOTA 3COHA 4RFMA 2UZWE 3FZSA 3E7VA 4BIEA 4C4JA 5JQ5A 4MNEA 5DE2A 4UX9A 5EI6A 4J95A 4JBPA 3BU6A 3NRMA 2BIYA 3I6UA 3QX4A 4O38A 3G6HA 4E6AA 1M14A 4D2WA 3S00A 4JBQA 2XCHA 5FLFA 1H07A 3JUHA 3H9FA 1OL7A 2DYLA 3QTSA 4ACMA 2VRXA 4XLVA 4IFCA 4GG7A 4QYYA 3GBZA 3R8UA 2VTAA 5M4UA 3VWAA 3W55A 4FR4A 3VN9A 3QTZA 4JBOA 4XRJA 5HESA 4F9AA 2XRUA 4NKAA 1JLUE 4LOQA 1XH9A 3UO5A 2BRHA 3LFNA 3MH1A 5M4IA 5M51A 3WILA 2W99B 3FL4A 4MXCA 3RPYA 3W2PA 2JDRA 4CT2A 3BWJA 3BHHA 2JC6A 1H28A 3R9NA 1ZZLA 4IMYA 4XV3A 5L8KA 2XK7A 5M08A 4BZDA 3WZJA 2OBJA 2O8YA 2YEXA 5ICPA 3QCSA 5HBEA 3U6IA 4G5PA 4XLIA 2BZKB 5T6KA 5L2IA 3LXPA 4ZSJA 2GS2A 1YDTE 4L52A 3FZTA 3S3IA 2UZLA 2FH9A 1G3NA 3G6GA 5FM3A 2ITXA 3GUBA 3F5UA 3L9NA 5EDRA 3IOKA 1Z57A 4RWKA 2BRBA 3OROA 3UC3A 1KWPA 2YWVA 3CGFA 2W1EA 3KULA 2NNWB 5KO1A 1WBSA 2GQGA 5A6NA 3ULIA 3TT0A 3A99A 2I40A 3B2WA 4FKQA 1GIIA 3C50A 1PMEA 1URCA 4QPAA 4QYHA 5IF1A 4F6UA 4UV0A 3F3VA 4NW6A 3CKXA 1OVEA 2IZRA 5CF5A 2QO2A 3QQJA 5I3RA 2WXVA 4FMQA 4PMSA 2BILB 2O64A 4QTDA 4QNAA 1H8FA 3UVRA 4FE2A 3FE3A 1H0VA 1ZOGA 2ACXA 2WO6A 4GUEA 3FLNC 3P78A 3R9HA 4AZSA 2GNGA 3BI6A 2P55A 1NVQA 4C2WA 2C1AA 3U51A 3VUTA 4B6LA 1OPJA 2J0KA 1P4OA 3FSKA 1OZ1A 3FMLA 3MTLA 3OOMA 4NM7A 1WVYA 2OKRA 4FKJA 4ARKA 3QA8A 4I6BA 4FZDB 4UMTA 4ANMA 4AG8A 4FG9A 2IW6A 5F1ZA 2PPQA 2P0CA 2QVSE 3BBWA 4JJRA 1J1CA 4XBUA 5HIBA 5IH6A 4DA5A 4MK0A 3OEFX 3DS6A 3SQQA 4O96A 1YOLA 5DEYA 3DTCA 4YZBA 3HV6A 4EH6A 1MP8A 2WQBA 3C4CA 4NSTA 4QP2A 5D12A 3GOPA 3M42A 2H6DA 2PZPA 3AMBA 5I9VA 5HBJA 4OTGA 4PL5A 4XV9A 4C35A 2IZSA 2YLFA 4YTFA 2Y9QA 4I23A 4I41A 3C13A 5T3QA 4ZAUA 3SOAA 4AE6A 4Y72A 5IQCA 5CS6A 1G5SA 3G0FA 4MXYA 4YBKA 3M2WA 4ZTHA 4EL9A 3Q4ZA 2EB3A 4UMQA 3A7JA 1ZOEA 3R1SA 3QRJA 3WF8A 4CZUA 5BVOA 3UQFA 5IQFA 5EYKA 3E64A 2C5NA 2XYNA 3AT2A 2CJMA 3PE2A 3IW4A 5L3AA 2E9NA 2F2UA 2RFDA 2O65A 4BKJA 2PMLX 3NW6A 4GVAA 3EN7A 3V51A 4EK6A 2OZOA 3HKOA 3ZUTA 4BZNA 4P5QA 4RGJA 3JY9A 4BDBA 4HYUA 3ZDUA 1Z5MA 5C26A 4MF0A 4U7ZA 2XBJA 1FGIA 2CSNA 2BIKB 3CP9A 4I93A 4FEWA 1JVPP 3TUDA 3RPOA 1PJKA 3LFAA 2OXXA 5BYLA 4BIBA 4TZRA 4QYEA 2Z7LA 3HA8A 2XUUA 4D1ZA 1ZARA 4LOOA 3OBGA 2YERA 4QMVA 2VWYA 4HVGA 3EL7A 1Q8WA 1J7LA 4AOIA 3ORNA 4GK3A 4NM0A 4PNKA 1GIHA 4A4LA 2ITOA 4FNYA 3VULA 3EFJA 3F3UA 2GTNA 3VVHA 3VC4A 4UMRA 4QMMA 4YJUA 2HENA 3A7IA 4EUTA 5J7BA 3I79A 2R3KA 3FC1X 4P90A 1ZLTA 2ZOQA 1PHKA 3BYUA 3Q52A 4X3FC 3UBDA 2C6EA 5IQEA 3R8LA 1H26A 3U4UA 4L8MA 2GQRA 1FPUA 4JDIA 5ANIA 4GIIA 2A0CX 3UDBA 3RWPA 4PMTA 1P4FA 3CXWA 3Q5ZA 4QMLA 1ZYCA 4F9YA 3IW5A 2QHMA 1CMKE 2VU3A 4LI5A 3EYHA 3PXQA 3SDJA 2C0OA 2AYPA 5AP6A 2WMWA 3E63A 4Z9LA 5AX9A 4RC3A 1V0OA 4IW0A 3QCYA 2H34A 4K1BA 4IX3A 3NNVA 3Q4UA 3SXRA 2GS6A 5IU2A 2VAGA 2XNNA 2ZM1A 3EFKA 1S9JA 4EOIA 3R02A 3LE6A 3OCSA 4ANOA 2W7XA 5LVOA 2JBOA 2NRYA 2OF4A 2GQSA 2XCKA 3HYHA 5EYDA 3HRCA 3PA4A 3VF9A 5I9YA 3UE4A 4D9UA 5AUUA 2HWPA 5HCYA 3R30A 3ZMMA 4BZOA 3PG1A 5CAVA 3GXLA 5GJDA 3KU2A 5LWMA 1Q8UA 4BDCA 3IW7A 1J7UA 4KIOA 1Y91A 3PJCA 3GU8A 4EC8A 5IDNA 5CYIA 3ZSIA 3FLSA 4EC9A 4AF3A 2W9FB 3D7ZA 3ALOA 3C51A 4Y73A 4BKYA 5FDXA 4YHJA 4DH8A 3C5UA 4E1ZA 4TYGA 2PZIA 4YUQA 5CU0A 3RM6A 2JKKA 4I3ZA 4AE9A 1U5QA 2ZM3A 3EZRA 4AT5A 3OCTA 4GT3A 5H8GA 4CKRA 5IMEA 4RIYA 3B8RA 3ZTXA 1LEZA 1CKPA 2VWUA 1DI8A 4DN5A 4FV1A 4WD5A 3OCGA 5CU3A 2BHHA 2C5OA 3Q60A 1Q5KA 2VO7A 3CTJA 4RJ8A 3W2CA 2BKZA 5GJFA 4DG3E 2CCHA 3LFSA 2X2LA 3DOGA 3HP5A 4IZAA 5IQDA 3K3IA 4C3RA 4WA9A 2WMXA 5AV2A 5HVKA 2FSLX 1TQIA 4M0ZA 4UYAA 4OBQA 5FRIA 1QMZA 4BBFA 4WNKA 4RLKA 4X2FA 4GMYA 3DPKA 4U81A 3C0HA 5AADA 2JIVA 4CMOA 5I4NA 4OTWA 3SVVA 2B1PA 4E20A 3AXWA 3QTXA 1JKLA 3RKBA 1ZYJA 4MAOA 2H8HA 1YI3A 2XM9A 3PXRA 4L01A 5D10A 3S95A 4KSQA 3O8TA 4FKSA 4QMTA 4HOKA 5IG1A 5AV3A 3FKLA 3S1HA 3ID6C 4PQNA 3F5GA 1FVTA 4K6ZA 1B38A 3W8LA 4I21A 2CKPA 2PMNX 2XNBA 5CEOA 2VGOA 3PPJA 4NJDA 3DCVA 4TYJA 3FDNA 4ZTLA 3UOKA 3K2LA 3FKNA 3WIKA 4X3FB 4IX4A 4RWIA 3DK3A 3RK5A 1ZYDA 4MBIA 5LCKA 2C0IA 4UMUA 4ENYA 2X7GA 3EQGA 4I5MA 3POOA 2FVDA 1KE9A 3C4ZA 4PP7A 3TN8A 2WTIA 4GUBA 3FI4A 2X8IA 4IB1A 4AN2A 1OKVA 3MVHA 4FKGA 4IVDA 1LR4A 4HGSA 2AUHA 4MH7A 4ANSA 5CF4A 2J0IA 3PWYA 2XKFA 3BGZA 1JSUA 3NUXA 4JX3A 4L00A 4BI0A 3QQGA 1YXVA 3MB6A 3E7OA 4CTBA 3DKGA 2WMBA 5ACKA 3KXGA 4ZLOA 1H4LA 2ZV8A 3ULZA 5L2WA 3EQRA 4Y85A 4S31A 5CEMA 4NJ3A 2PE0A 3IQ7A 3VBYA 5F20A 4C38A 2V5QA 3GGFA 1O6KA 4FTKA 4ZY6A 4ZJIA 3V5PA 3KK8A 4WRGA 4NZWB 4OR5A 3DJ6A 3QRKA 4U5JA 5B2MA 5HIEA 1REKA 2KULA 1VYWA 4UALA 2UZEA 4IZYA 2R2PA 2HY81 4YHTA 4MYGA 4PPBA 3AC1A 5AEPA 2OSCA 3ZEWA 4IZ7A 5JGBA 4GU6A 2Z7QA 4G9RA 4NEUA 5DI1A 5HICA 1YKRA 3KCKA 1IASA 4DEHA 4FV7A 5AUYA 5HE0A 3BHUA 3W2OA 2PHKA 5E7RA 5A4LA 4B9DA 3BGQA 1STCE 4GG5A 2GDOA 1K3AA 3PP0A 5LMKA 4IAIA 4XG7A 3ZXZA 4BRXA 4YZMA 1CDKA 3ZEPA 4EH7A 3R8MA 3QUEA 4M13A 4IHPA 2GMXA 4XV1A 4GJ3A 3PVGA 1LP4A 2YISA 5DT0A 3HDMA 2I6LA 3HUCA 4Y46A 2CNQA 3ZYAA 3EKKA 5CEIA 3W32A 3F5XA 2JDSA 2ZVAA 2WGJA 4FV0A 4YHFA 4O1PA 4BR3A 5E8YA 4AW2A 4E93A 5JGAA 5JFVA 3DBFA 3SC1A 1WVWA 2PY3A 4HPTE 4NWMA 3I7CA 3GC0A 4MCVA 4PF4A 4L43A 3THBA 1QPDA 3RK7A 2QG7A 4E5AX 3CQWA 4O7SA 3LXLA 5HTCA 4TWPA 3L8VA 2C6LA 4ERKA 2P4IA 3KRLA 4EZ5A 3ACKA 4R7IA 4QTAA 5HNIX 4NFMA 3AC5A 4EQUA 5KX8A 1YWNA 3FLWA 5FM2A 3ZFMA 5HCXA 3PXKA 3TUCA 3NUAA 3IGGA 4O2ZA 5A9UA 3O96A 3DBQA 2BMCA 3HRFA 4J98A 2Q83A 5HG9A 3TZ8A 2Y6MA 1XBBA 1Q97A 4HVDA 5HX6A 3GNIB 4G34A 4M69B 4D2RA 5BVWA 4MNFA 2BDFA 4UN0C 3Q6UA 3RAWA 2QONA 3Q9WA 4C0TA 3ORPA 5C1QB 4BYJA 4AACA 4MF1A 2IWIA 2ITNA 5LVLA 4C33A 3SRVB 4G3CA 4C37A 3EFLA 5KZIA 4B4LA 3ATTA 4YSJA 2G2HA 3SHEA 1ZWSA 5TR6A 1OBDA 4EJ7A 4IAFA 1YHWA 3OTVA 4IBMA 5EM5A 3V04A 1U4DA 3TKHA 3DBDA 2HXLA 1UA2A 1KOAA 4WNPA 4XBRA 3WYYA 5AMNA 4XCUA 4AT4A 3DDQA 4FKIA 5CANA 4F0FA 2FGIA 5D7VA 2HK5A 4D2PA 2IVTA 2C4GA 4FVQA 5B2KA 3OCBA 2VO6A 4DF3A 3TDWA 1OB3A 4NIFA 4ZS0A 2YDIA 4HZSA 4BI2A 2R64A 3LJ1A 4WNOA 4EQMA 2VO3A 2PZYA 3BPRA 3QGWA 5AR2A 5CEPA 3F2NA 4FTLA 4C3PA 3EN4A 4K2RA 5EW9A 4CT1A 2A4LA 4YJRA 4FTCA 2PMOX 2EXMA 3SG9A 4BTFA 2VNYA 3QTUA 1ZMVA 1OI9A 2QO9A 4QD6A 3QKLA 5DRDA 3BHVA 3VUIA 4CFNA 5AV4A 5BUIA 3ODZX 2J0JA 3GQIA 1NVSA 2JITA 3ODYX 4W4YA 1LEWA 2BRNA 3EQDA 4QYFA 5E8ZA 4RSSA 3OZ6A 2PE1A 3QD4A 3I7BA 4KRDA 4R1VA 3R2BA 4U8ZA 4GKIA 2G15A 2UUEA 4IZ5A 5FXRA 4BDIA 2W05A 4O7YA 4PY1A 3LVPA 1OL6A 2ZB0A 1M2QA 4PTCA 5CZIA 2F7EE 2VTTA 2WFYA 2XK8A 4FODA 4CFFA 1BL7A 4QMXA 4ZJJA 4EI4A 4RBLA 4I6FA 5CF6A 5J8IA 2DWBA 1U59A 3Q6WA 3H3CA 2C0TA 2CN5A 4IAYA 2WNTA 2CGXA 4QP1A 4DEEA 1JSVA 4MXAA 5GJGA 4F70A 3A2CA 4C02A 4YSMA 3W16A 3IK3A 3ZO4A 4DEIA 5IEXA 3F2RA 4U3YA 2YCRA 3HV7A 1YXUA 4PNIA 3UNZA 4FGBA 1W7HA 3KEXA 4DLIA 4O7RA 4RFYA 5AJQA 2UZOA 2WIHA 3PRIA 3BU3A 2CKEA 4BTKA 5HIDA 3DZOA 3W1FA 1ZYLA 3LM5A 4QTEA 5IQBA 4BWKA 3BCEA 1SMHA 2VTQA 4ACCA 4QMNA 5HD4A 5A4CA 4JXFA 5IQAA 2EXEA 2PK9A 3R28A 4JVGA 4EZ3A 4FEUA 5E9EA 4H1MA 5CSVA 4LOPA 3NVKI 2JBPA 2JKOA 1PXMA 3ORIA 4K33A 4WBBB 3CCNA 4O1OA 1XH6A 4M12A 5DFPA 4D2SA 2OIBA 3NX8A 2W1IA 2UZBA 3R63A 3RNIA 5DYJA 5KMNA 5EHLA 3O2MA 4O0XA 2IO6A 1MRVA 4W9WA 5H8EA 3TTIA 3GT8A 5A6OA 4XG9A 4U97A 3AD4A 3VBQA 2OFVA 4EOKA 1GZOA 3MVLA 4YO6A 3SXSA 4G1WA 5KMIA 5L6PA 1H01A 4ZTSA 3TWJA 4TT7A 5CT7A 3ZFXA 1UNHA 4FT3A 3TNQB 4R7HA 2WTDA 3M1SA 3DGKA 3GP0A 5EKOA 2GHMA 3N9XA 4HZRA 3HAMA 4JDKA 1OKYA 4FTIA 4G16A 4D4VA 3SLSA 5EQPA 3E92A 3E88A 3IKAA 4FSYA 4N6ZA 4E4XA 5KHXA 3I0OA 5CY3A 4LRJA 3WARA 3FLZA 3RZFA 2OZAB 1PXOA 4RJ3A 4AW1A 4C62A 2ITQA 5K5XA 4DTBA 3FMNA 2OXDA 5F95A 4E3CA 3QZFA 3EFWA 4K77A 5J9ZA 1HCLA 2B53A 2ESMA 5LXMA 2JFLA 3DQWA 4BCHA 4G3DA 5M57A 1I09A 5IUIA 3T9TA 1VR2A 3GENA 4BIDA 4DG0E 4F08A 2PTKA 3GFWA 1J1BA 4XMOA 4AOJA 5DOSA 4YZDA 1ND4A 5L8LA 5M07A 2ETKA 2Z8CA 3SG8A 4H36A 4QMQA 4S2ZA 3TNWA 2C3LA 2XIXA 4WSQA 3ANQA 4LMNA 2QOQA 2XH5A 1DAYA 3PFQA 5AP1A 4JBVA 2OF2A 4ZLYA 4ZSEA 4BCMA 4YGAA 2O3PA 2C6TA 3BV3A 3G9LX 3RJCA 3WIGA 4UWYA 1RW8A 1TVOA 1AGWA 4O7TA 4CG9A 3FLYA 4X7QA 3LLTA 3T8OA 3E3BX 4X0MA 5CXZA 2BKKA 3MPMA 3S4QA 4R5YA 4I0RA 1U54B 4FIFA 2WQEA 2VGPA 5GINE 3BEAA 4ITHA 2ITUA 3VBWA 4E4MA 3DJ5A 2IZUA 2QG5A 4YJQA 2VTIA 3NGAA 4F9BA 2EUFB 4U43A 3AMYA 1ZY5A 2XJ2A 5AUXA 3UNKA 3DAJA 4WG3A 3QTRA 4HCTA 1Q61A 1QCFA 1QL6A 5FEQA 5GIOE 1OUYA 3TDVA 3KRJA 1Y57A 5FWKK 3TNPC 4LL0A 3UMXA 5FG8A 3HGKA 5TKDA 3R0TA 5IA5A 3GC9A 3ITZA 4RFZA 4RT7A 4X2NA 3QXOA 3WZKA 4OTFA 4FZFB 2XNEA 2WQOA 4FEVA 3QD3A 3GI3A 5ETAA 2XNGA 4O2PA 3TV7A 1BL6A 4IVBA 4DINA 2C6MA 3LIJA 1Q41A 5E8XA 5DR9A 4O7NA 2X39A 1SNXA 4D58A 2C3IB 1YOJA 4GH2A 4AA5A 1YXSA 5AM6A 2WAJA 2HW7A 4RQVA 4BWXA 4ACDA 3C5IA 3BYVA 4F65A 2PUPA 4TYHA 4FNXA 3QHWA 2VTOA 1JQHA 2QOBA 4J8NA 4EOOA 4PMMA 2BCJA 4YJNA 4B8LA 3H10A 1PYXA 2VWXA 4FZ7A 4MKCA 4IC8A 1IG1A 3D7TA 3KCFA 4BY9E 4Q5HA 4M7IA 1URWA 5TE0A 4O86A 5HE3A 2W0JA 4U79A 5H3QA 1Y8GA 3BZ3A 4F64A 4Y95A 4YPSA 3FY0A 2PZ5A 3D2IA 2ITTA 3I5NA 4P7EA 4ZSGA 3R9OA 4F0IA 3HV4A 2YIYA 2YIXA 3DY7A 3NS9A 5BVEA 4GYIA 4CV8A 3LCSA 2YHVA 4EK3A 5IUGA 1HOWA 4OTDA 3PVUA 3VW6A 2R3HA 2R3QA 3ZO2A 4JS8A 3I60A 5HCZA 4HVSA 4I0SA 2X9FA 3TL8A 3UVPA 2ZM4A 1SZMA 2FSOX 3W8QA 3KXMA 4ITJA 3D83A 2AC5A 3PSBA 4Y5HA 5BVFA 1UU8A 3GU7A 4BBEA 3L9LA 3FXZA 2ERKA 4IWPA 5M4FA 4L3LA 4CZYB 3CY3A 4MNEB 5D11A 4XX9A 2C5XA 4FIJA 3LQ8A 5J5TA 3ORXA 2JKQA 3HAVA 4WUNA 4AZVA 3MGYA 1H1PA 3OBJA 4CNHA 3F3TA 5J9YA 1BLXA 4NT4A 3O7LB 5CAUA 3MH2A 4O91A 4YNEA 3II5A 2J4ZA 2J2IB 1BMKA 4E5WA 4LYNA 4IXPA 2DUVA 2EU9A 4EKKA 1Q99A 4JR7A 4BN1A 4O7VA 4ZS4A 4EWQA 3Q53A 2XK9A 4KWPA 5ANGA 4IH8A 4JIAA 1WBTA 4K8AA 2JD5A 4E8AA 3NVMB 3V5TA 4K9YA 4L44A 1FVRA 4AAAA 3COKA 4UB7A 3DZQA 3MFSA 3FEGA 2B55A 2R3RA 5FBOA 2UW6A 4BWPA 3KXZA 2YN8A 1DI9A 2GPHA 5JSMA 4H1JA 4FSRA 2XA4A 3SA0A 4Y8DA 5AUWA 4QOXA 2ZV9A 2PVYA 1PXJA 4YR8A 5I9ZA 3R00A 3BKBA 5C8NA 4IDVA 2YDJA 2WELA 1I44A 1Q8YA 5C01A 4FGRA 1ZY4A 2ITPA 2B9HA 3MI9A 3VRYA 2V55A 1IA9A 3OT8A 3QUDA 4RRVA 5DPVA 4CYJA 1H1RA 5KBRA 3U9NA 4MX9A 4BDKA 3RPVA 4YC8A 4Z7HA 5AR5A 1ZOHA 4CXAA 1F0QA 1APME 2X7FA 3MA6A 4RA4A 4XG3A 3QQHA 3D4QA 2QNJA 5CAQA 3D15A 3IECA 5J1VA 2A19B 4XG4A 4AW0A 4RX5A 1CKJA 4S33A 3JXWA 2E9OA 2B54A 3FMEA 4ZY4A 4KBKA 5CSWA 3WZDA 2PULA 5FTGA 4GFOA 5HORA 4J1RA 3QTQA 3UGCA 3TV4A 3LFBA 3Q9XA 5CI7A 2X81A 4J99A 3JS2A 5E90A 3RPSA 4AZEA 4FL3A 1JKSA 3V8TA 2Z60A 5KMMA 1UWJA 3KXXA 2PU8A 4XP0A 5IA4A 3GCUA 4KUJA 3E5AA 4L3PA 4L67A 3VBXA 3FMKA 4C7TA 2HZNA 3AC2A 4YTHA 4BCPA 4XG8A 4V0GB 2UW0A 2PMIA 4BGQA 2XKEA 2IPXA 3V6RA 3DNDA 1TQPA 2UZDA 1PYEA 5B7VA 2VNWA 4WT6A 2XIZA 4NKSA 4O22A 4G6LA 4OBPA 3KK9A 3OWLA 2WTWA 4WIHA 5IMXA 5E8WA 4BCFA 3NNUA 3QC4A 3QWJA 3VS5A 4BB4A 2YZAA 5LVNA 5DH3A 4QNYA 2XEYA 3RTPA 4FK6A 4F0GA 2WKMA 5HU9A 4O0WA 4FNWA 4JG7A 3VUKA 3ZRMA 4BGGA 5LOHA 4IE9A 3DK7A 5KZ0A 1P2AA 2F2CB 5EYCA 3ZOSA 3FMMA 3LJ0A 2E9VA 4PDPA 4X2KA 4GK4A 4Z16A 4TN6A 1KOBA 3C4FA 3FYKX 4N57A 3VUGA 4I6HA 2WTKC 5AFVA 2F57A 3PZEA 1DM2A 4NM5A 1R78A 4TTHB 4BCKA 3CEKA 4YJPA 3CC6A 1LPUA 5AR7A 5I9UA 2XS0A 5EI8A 2YCQA 3BGPA 3DFCB 3WE4A 4DFLA 3NWWA 3PY1A 5TF9A 3TXOA 5AAGA 2VTSA 2CCIA 3D5WA 3MH0A 5BYYA 2GSFA 3C0GA 3RP9A 4IM3A 3DDPA 3EH9A 2QQ7A 2YIWA 4GFGA 4AFEA 2VUWA 5KMOA 5GIPE 5LVPA 2O0UA 5I3OA 4FT0A 3V5QA 3H30A 1PXPA 1WBPA 2GNLA 3CLYA 3OXIA 4OTRA 5EK7A 4OT5A 1E1VA 3HP2A 1YVJA 3ZLWA 2BAKA 4ALVA 4FV8A 4TWNA 2C5YA 3CR0A 2A2AA 4I5PA 3KVXA 5BVNA 3OXZA 4I5CA 2OIDA 2WMRA 4FT9A 3HMPA 3PSCA 1JWHA 4FV5A 3ORMA 3T9IA 4DFZE 4F99A 3RCJA 2GHLA 5AA8A 4NCTA 5BMSA 4HJOA 4YJVA 4CGAA 4WG5A 3Q4TA 3K5UA 3R7EA 1Q4LA 3FQSA 1XO2B 5HTIA 5AM7A 3EQPA 1RE8A 4U3ZA 3QL8A 3LFQA 4A06A 3PVWA 2YIRA 5AAEA 4DBXA 4R8QA 2UW5A 3CTQA 4PDOA 4EOQA 2O63A 1Y6BA 2QU6A 4IAAA 2WHBA 4CFWA 4L46A 4IVCA 4DT8A 4GSBA 3F3WA 3MFTA 3QX2A 4I94A 3ZUVA 4YO4A 4I92A 2ONLA 1KE6A 1FQ1B 2PUUA 3DU8A 3W33A 3HMMA 3DBCA 3UVQA 4MTAA 1Q3WA 3ZUUA 2JAMA 4IQ6A 3BHYA 1YI4A 3COMA 3LCDA 4HYHA 4IVAA 3ZM4A 3O71A 4PRJA 2R3LA 5HOAA 4CCUA 4BL1A 5EKNA 4XYFA 3ERKA 3POZA 2VTJA 4D4RA 5L4QA 2X6DA 3LFFA 4HW7A 3ZS5A 2JDTA 5EH0A 4J96A 4ZMEA 1OGUA 4G5JA 5C8MA 4E6CA 1RJBA 4XHKB 3VUMA 3OWKA 1UNGA 5L6OA 1OPKA 3D9VA 3A4OX 1PXLA 3EJ1A 4CTCA 1AQ1A 5EHOA 4IB0A 4RIWA 2HCKA 4U80A 3VF8A 2PWLA 5M09A 4DBNA 2FSMX 2JLDA 5IDPA 2OI4X 5E8TA 4II5A 3KF4A 3O51A 1LUFA 2RIOA 3DJ7A 4FICA 4LGGA 4RMZA 2LAVA 3ZH8A 4BDAA 3D2KA 2J6MA 5A4TA 3VRZA 3DFAA 3MYGA 4DFBA 4KNBA 1ZZ2A 3N51A 5LJJA 2WMVA 2W1FA 3LLAA 3GFEA 3PLSA 4M66A 5K5NA 3D5VA 5LMKC 3F6XA 1XHAA 3O8UA 4I4FA 2GNIA 2HELA 2WTKB 4AGUA 3W10A 2REIA 3NSZA 4KAOA 2CDZA 4FKRA 4FT5A 4JDHA 3AC4A 5FXSA 4RWJA 3V6SA 3I6WA 3QALE 4EQCA 2OLCA 2XYUA 2B9FA 5GZ9A 3OEZA 3TKIA 4M0YA 3ZSHA 3PLAE 3ZBXA 3FWQA 4APPA 2BAJA 2VWBA 2Y0AA 3P0MA 4FIIA 3RM7A 4CQEA 5CLPA 2XRWA 1ZMWA 4XG2A 2J9MA 2C69A 4LUDA 4AXAA 1K9AA 1VJYA 2CN8A 3KMWA 4EH3A 4TYIA 4AWIA 4M97A 3MY5A 3IS5A 3QA0A 4BCQA 1W8CA 4XEYA 5JFWA 3IONA 5AV0A 4BC6A 4FSWA 4HCUA 3AT3A 5HD7A 3K54A 4UY9A 5DNRA 4FUXA 2WOTA 5EI2A 3E3PA 3KFAA 4C36A 2WTCA 5EOLA 5K3YA 1JOWB 3QD0A 2UZNA 4FV3A 4L53A 3DKFA 4UXLA 5KCVA 3AQVA 4TNDA 5F4NA 4AX8A 1XKKA 4DGGA 4V01A 3PE1A 1T46A 4D4YA 5AR3A 2BVAA 3OFMA 3QZHA 4A9YA 2C3JA 4FTNA 2W4KA 2LGCA 3D5XA 1PY5A 1Y8YA 2VX3A 2X8EA 1R3CA 2UVZA 3LMHA 5T68A 3FZPA 4C4GA 1HCKA 5FUTA 5ANOA 5HO6A 4CLIA 4YZCA 3VW8A 3GU5A 5TT7A 4B8MA 3FXWA 4H05A 3KB7A 3CE3A 5JRQA 3RWQA 5IZFA 2VO0A 4R78A 4UEUA 3RGFA 5M4CA 4EONA 4H3BA 4CVAA 2I0EA 1FGKA 1XH4A 3PYYA 3OS3A 3GCSA 3K3JA 4I0TA 4L3JA 4XUFA 4AFJA 5HO7A 4NW5A 3TUBA 3QGYA 2W1HA 3BIZA 4GS6A 4PTEA 4A9UA 2PVFA 3WF7A 4DFNA 3FI2A 3PIXA 4ZXTA 3WBLA 1YXTA 2AC3A 2OJFE 5EYMA 1SYKA 4ALWA 5FP6A 3TJCA 3JPVA 3MBLA 2WU6A 3BYOA 1K2PA 5FP5A 3ORZA 3HUBA 4JL9A 3RINA 1SM2A 3FI8A 2CHLA 1P5EA 3JVSA 3LW0A 1H27A 2VTLA 4X2JA 2VTMA 4CV9A 2W4JA 2ZB1A 4YTCA 4A9TA 4M68A 3R21A 4RIXB 3ZCLA 2BDWA 3ENMA 4JRNA 4ZTNA 2E2BA 3HNGA 4U42A 4ANNA 4FYNA 2XNPA 5FD2A 1GZ8A 2CPKE 1IAJA 1PF8A 3ZC5A 2WU7A 4PL4A 3GCPA 4V04A 3ZDIA 3QZGA 2XNMA 4FKOA 4XOZA 4U0IA 1GNGA 4W4WA 2I7QA 2GFSA 4GFMA 5FTQA 4D0WA 3GCVA 5J79A 3ATSA 4QMSA 5FTOA 1OL2A 2PUIA 4F6SA 4KINA 4L7SA 5HZNA 3CQUA 1UKHA 1SNUA 3B8QA 1YRPA 2PVNA 3FMJA 4FTTA 4NTTA 5E91A 2IW9A 4C4EA 4Q9ZA 3A61A 2R0IA 3R7YA 3CPBA 5DN3A 5EW3A 4MBJA 4M69A 5AAFA 3NW5A 2GNJA 2PVKA 4U6RA 3L9MA 5CNOA 1JSTA 1PW2A 2EWAA 3R6XA 4ASXA 4NL0A 4ITIA 2QCSA 2IJMA 2OJ9A 3OUNB 4WG4A 3SRVA 4HGTA 4R7BA 4WRSA 3NEWA 2G2FA 4DEDA 3UP7A 3R7UA 4MHAA 3DV3A 4FKTA 3Q2JA 3DK6A 5I0BA 5K4JA 3F7WA 2FUMA 3GC8A 2QI8A 3KXNA 4QP4A 4APCA 3D14A 5CVHA 3ZONA 2OJGA 5CSPA 2J0MB 4B0GA 4E5BA 3TKUA 5GZAA 2JGZA 3W2RA 4E4LA 5HNBA 2FA2A 4YPDA 4L42A 2CKOA 2XIKA 2R3OA 4FL2A 5M53A 4WSYA 3UPZA 3RAHA 4J71A 4P2KA 5IA0A 5J9LA 1CSNA 4GT4A 4GKHA 3BHTA 2HYYA 3OWPA 5J7HA 3KC3A 5BVDA 4EHGA 4UXQA 2WMUA 4N70A 3UODA 4IFGA 4EWHA 1SVGA 5KHWA 3UOJA 4GV1A 2RF9A 5DA3A 1WFCA 4A9RA 5A4QA 2NO3A 5M55A 1H08A 4TKSA 5GZ8A 1GIJA 4FKPA 4ACGA 2IN6A 1H1WA 4OT6A 3UC4A 5HVYA 3O0GA 3EQBA 1DAWA 2B4SB 2FYSA 1UWHA 3GU4A 3DB6A 3LKMA 2P3GX 4JI9A 4M15A 5FQDC 3VHEA 2NP8A 3UQCA 5M06A 4FYOA 4IJ9A 3FPQA 4HYSA 3ZLSA 4I24A 2X2MA 1E9HA 4HYIA 4YZ9A 1S9IA 5AP7A 2XB7A 1OIRA 2BHEA 1JAMA 2RFEA 3BLHA 5LARA 2OK1A 3KQ7A 3TIZA 3RAKA 3OG7A 3U9CA 4CFVA 4ZSAA 2QOLA 1AD5A 2W5HA 2ITYA 2BFXA 3NDMA 3V8WA 4ONAA 2BRGA 3DNEA 2OJJA 4FK3A 3PJ3A 4JG6A 4QP7A 5CU2A 4CSVA 5BVKA 2DQ7X 3P79A 1OPLA 5JFSA 5CF8A 2QLQA 2GNFA 4CKIA 5CTPA 4ZOGA 3JVRA 1YXXA 3JR1A 4KIKB 2QKRA 3QU0A 4FEQA 2OH4A 4MXZA 3UIBA 4M8TA 3LM0A 4YNOA 1KE7A 5DGZA 3JYAA 3ZO3A 3A7HA 4KS7A 4QPSA 5L8JA 2OH0E 2HZ4A 3H4JA 1YWRA 2C6DA 4WKQA 4ANQA 3UZRA 3R1YA 3R8PA 1OIYA 1BX6A 2V62A 2XIYA 1H0WA 2R3GA 2PVHA 3UJGA 3O7LD 5EQEA 4G6OA 3WE8A 2VX1A 1PKGA 3H9OA 5HO8A 4QP8A 4J53A 3TI1A 4DAWA 1TQMA 3ZO1A 3FC2A 3B2TA 2PVMA 4F7JA 5IA3A 3N4VA 2WEIA 1GOLA 4KIQA 1JBPE 3ZRLA 4MBLA 2W5AA 4QMUA 3VJNA 5KBQA 4NH1A 3RHKA 3QHRA 4DGOA 5B2LA 1JPAA 3M11A 1ATPE 2GTMA 2RG6A 4F6WA 5CX9A 3P23A 3BQCA 3Q2MA 4QP6A 4F1OA 3QAME 4D2VA 3KRRA 5H8BA 2C6KA 3H0YA 4EJNA 4ZJVA 1PXIA 3NZ0A 3GC7A 5DBXA 4QQ5A 3P7CA 2XZSA 2UVXA 3IPHA 3L8SA 4H3PA 3I81A 5JH6A 4FI1A 4O82A 1ZYSA 3SW7A 3OC1A 4PX6A 2WMSA 2WTJA 3NAXA 3TJDA 3ZLYA 4QMPA 4EOMA 5FBNC 1CTPE 4LV8A 2FSTX 1M17A 3PJ8A 2OZAA 2ZAZA 3CJFA 4FZ6A 2F7ZE 2J7TA 4UBAA 4RPVA 3CPCA 3VAPA 4DH5A 4LL5A 3PJ2A 4F1TA 3OY3A 5AP3A 4DTAA 3NMUF 3L1SA 1M2RA 4OTPA 5LMAA 3RZBA 5JT2A 2WMTA 2I0HA 3PRFA 4TPTA 5AUZA 3ZXTA 5KNJA 4C58A 2G9XA 4S34A 4BCJA 5TO8A 4RC2A 4F7LA 4YP8A 4CEGA 5CXHA 3FL5A 4HVIA 1IRKA 3PWDA 4WO5A 3SXFA 1X8BA 3LHJA 5IISA 1J7IA 3EQIA 3R7OA 2CLXA 3EYGA 2EVAA 4KKEA 4EUUA 4RJ4A 3LXNA 4CG8A 3P7AA 2JEDA 3QQLA 4HVHA 5A46A 4C2VA 3U6JA 1U54A 3IG7A 3NUYA 4S30A 5ANDA 1KUTA 4R5SA 5HG8A 4GCJA 4FV9A 5HE1A 2C5VA 2HWOA 4YJSA 2WOUA 4GJ2A 2XKCA 1BKXA 3UYTA 3MJ2A 4M67A 4JT3A 3FBVA 3E8NA 2B0QA 4O7ZA 1H24A 2QOCA 5FXQA 3LAUA 4KB8A 4AZTA 3NUUA 4LRMA 1O6LA 4K18A 2UZTA 4O27B 2XJ1A 1QPCA 3RI1A 4DGNA 2OWBA 1NXKA 2QO7A 3TNIA 4D5HA 1XR1A 4MXXA 5AX3A 4FKVA 4HCVA 3CQEA 3F2AA 3MJ1A 3DKCA 4EH9A 2NPQA 3UIMA 2WMQA 2R0UA 2PVRA 3OF0A 3QZIA 3R01A 1RDQE 2RFNA 1RQQA 2WB8A 4IX6A 4OGRA 5DEWA 5FEEA 2QHNA 2W1DA 3ROCA 2Z2WA 2V22A 4RG0A 4YJTA 1GJOA 4N4SA 4IIRA 1Q3DA 5JZJA 3DXQA 2UZUE 4GVJA 3FZOA 4O0SA 3RHXA 5LWNA 3KY2A 3AOXA 2RGPA 1FVVA 3BV2A 3MVJA 2UW9A 3R1QA 3MVMA 2EB2A 4JOAA 5AWMA 5C8KA 1A48A 2X8DA 3G5DA 5D1JA 3R8ZA 3H9RA 4IANA 4EOLA 5C4KA 2PE2A 4NYEA 3O17A 3TACA 1A9UA 3OTUA 2FO0A 2CGWA 4PPCA 1R0EA 4HNFA 3WF6A 4ZZMA 2R5TA 2F49A 3OXTA 4EOSA 4BVUA 3F7ZA 5DT4A 5IQGA 3TM0A 4ZP5A 4K0YA 1UNLA 3FQHA 4KKGA 1IA8A 5IH5A 2IVUA 1M52A 2W5BA 4D2TA 5CU6A 4FC0A 3N4TA 2OICA 4IM2A 3WI6A 4DH1A 3VNTA 4I22A 5I5ZA 3HV3A 4LV5A 4QPMA 5DT3A 3V3VA 4G3EA 4JLCA 4D9TA 4DCAA 4RQKA 3NUPA 2OFUA 3SX9A 1PMUA 2VTRA 3MWUA 4BDHA 3RK9A 3PXYA 4KA3A 4O0YA 4FZAB 1MQ4A 4JRVA 2J90A 4FUYA 1YWVA 2JFMA 1GZKA 4ERWA 1B39A 2B9IA 2UV2A 3EQFA 3KGAA 3QUPA 4GT5A 4TYHB 4LG4A 1UU9A 4EYMA 2YDKA 4DEBA 4FVPA 3NPCA 2A27A 2RG5A 1PXKA 2YM5A 3L8XA 3QQKA 1OL5A 2GNHA 3BELA 3D7TB 3TEIA 3GCQA 2BPMA 4FTOA 4IACA 4V05A 3PA3A 1OMWA 2ETRA 2RFSA 3ORTA 5JEBA 3R22A 3R1NA 3Q96A 4IB5A 3PXFA 4DEGA 2XEZA 4AA4A 2JIIA 2YM3A 1Q8ZA 3C4WA 2Y6OA 4FSNA 4X21A 3HLLA 3ORLA 3DT1A 4YC3A 5L6WL 2W4OA 3MY0A 2OG8A 3QRTA 4IWQA 3QLGA 2I0VA 4N0SA 3CBLA 2BTSA 4AP7A 3IW6A 1GZNA 4PTGA 4C57A 4CQGA 4PDYA 2J5FA 3PDTA 5L2QA 1BUHA 2P2HA 4MD8E 1Z9XA 5DHJA 3E8DA 4CCBA 5D7AA 1CM8A 4YLJA 2YM6A 3CTHA 2EXCX 1OKZA 2BALA 2C6OA 2ETMA 5AV1A 3CKWA 3QD2B 3BE9A 1TKIA 1M7NA 4P4CA 4J97A 5D41A 4BCGA 3P08A 4TRLA 4MD7E 4Q9SA 2PVJA 2XNOA 5BPYA 2VWVA 3LMIA 4RIOA 4JG8A 3VS0A 3DTWA 1GY3A 3OP5A 3FPMA 4E73A 4Q5EA 3K5VA 5ETFA 3BRBA 5CU4A 1WBOA 3T3UA 1WAKA 2UZVA 3L8PA 3NIEA 3LOKA 4J7BA 1UU3A 5DRBA 3LQ5A 5ANKA 2R3FA 1V0PA 3ETAA 3KN5A 4F63A 1G8AA 3G2FA 3OWJA 4O83A 3BX5A 3EB0A 3PA5A 4PPAA 3LCOA 4FKWA 4HGEA 3HX4A 4L68A 5C9CA 4DGMA 5JQ8A 3LCKA 3PG3A 1P14A 4M3QA 4QQTA 3BE2A 2V0DA 2G01A 3F88A 4YC6A 3D0EA 3VS1A 1OUKA 3ENHA 3KULB 3EWHA 4N6YA 4CZTA 2QR8A 3HECA 3QCXA 5J87A 4JQ8A 3FY2A 3IGOA 4QQCA 2XM8A 3UQGA 1YOMA 2R3MA 5CEKA 2O2UA 4JAIA 1CKIA 4QMWA 5IA2A 3U8WA 4J52A 3KMMA 3SKCA 2YM7A 3ZC6A 2ZYBA 3PJ1A 1KV1A 1PMVA 4V0GA 4AU8A 5I9WA 3AD6A 3DAEA 1OM1A 3V5JA 4AGDA 5JMSA 4ZTQA 4NCTC 4ALUA 4FTJA 3ALNA 4NK9A 3FLQA 4B99A 4IM0A 4UWCA 4UZHA 3RCDA 5CVFA 2WD1A 4FNZA 2J50A 4XRLA 4E6QA 4AT3A 5J1WA 3T3VA 3MDYA 3TV6A 2R3IA 4CRLA 4TL0A 4EEVA 3HRBA 1E1XA 1OIQA 5CSXA 3VUHA 4E26A 4FA2A 1R1WA 3IDBA 1ERKA 5C4LA 4PWNA 5TOZA 3R8VA 3G33A 3OOGA 3GVUA 4QTCA 2ONLC 1YQJA 1F5QA 1REJA 3O23A 3PXZA 4JAJA 3UOHA 4A9SA 4CFXA 4DH3A 2XK3A 4X6QC 5EG3A 2GFCA 4G17A 5DWRA 4FIGA 3KF7A 5E8SA 3BLRA 4EH4A 4KKHA 4FSQA 4QP3A 4FBXA 3EZVA 4PL3A 3WF5A 4XP2A 2X6EA 4F1MA 4XOYA 4D55A 3HZTA 1XH8A 3LFEA 4QT1A 5KMKA 4FOCA 5AIRA 5CAPA 3UYSA 3QFVA 2FB8A 4USFA 2XMYA 1NY3A 3FAAA 4EZ7A 1QPEA 2G1TA 4JIKA 4NFNA 2WEVA 2YABA 3NYXA 4YJOA 2KTYA 2QOFA 5AUTA 3FI3A 2QU5A 3VBVA 4M84A 3DAKA 4JX7A 3P86A 4E7WA 2UW3A 2CGUA 5GHVA 3LQ3A 3QYWA 1OECA 3KN6A 2WQMA 4FT7A 4G3GA 2ZV2A 2QOIA 3PUPA 2Q0NA 4X2GA 4YURA 4J8MA 1PXNA 1UKIA 4ZSLA 1L3RE 1MRYA 4K11A 3U54A 3I5ZA 5JKGA 4CFMA 1PMNA 5E8UA 1FMOE 2ERZE 3QLFA 3SOCA 4BDJA 5HG7A 4LGHA 5HLWA 2QOHA 1H1QA 4RC4A 2PYWA 3GOKA 2ZDTA 3NCZA 4AW5A 4BCOA 2F4JA 2OW3A 4M14A 2Y4IC 4RJ5A 4Z7GA 2IW8A 1WBWA 3S2PA 3ZZEA 5HNGA 4OBOA 4EHVA 1XBAA 5CAOA 3R71A 2R3NA 1IR3A 4RWLA 4BHNA 1XH5A 2JKMA 4MQ1A 4F9WA 2XIRA 3EOCA 5ETCA 2YA9A 1YHVA 3SD0A 5IA1A 4PDSA 5DIAA 4U40A 4AN9A 2YJSA 2RSVA 1G8SA 1OKWA 3VUDA 2R9SA 5IEVA 4FSZA 4EBWA 5JGDA 4TY1A 5CQUA 3PY3A 3CSVA 5E4HA 5FEDA 2DS1A 2R4BA 3EN6A 3MB7A 3TZ9A 4AQCA 4FEXA 4KBAA 4KBCA 3BWFA 4O81A 2C1BA 2I1MA 2W9ZB 2WQNA 5C03A 4O0TA 1NT2A 4ORKA 2QD9A 2Z02A 1ZAOA 3CS9A 3AC8A 3NR9A 4X3JA 4ANLA 4IADA 4DFUA 2YACA 4QMYA 3MN3A 4FG7A 3ZSGA 3NYOA 2B7AA 3MPTA 4GIHA 4QP9A 5BMMA 4AA0A 4FKLA 5F9EA 2VWWA 3F61A 4E4NA 3C9WA 3VIDA 4ZY5A 4U9AA 4R3CA 4X6RA 1WZYA 4DT9A 4F09A 4ENXA 5DG5A 4EORA 4XJ0A 1J3HA 5HQ0A 2ITVA 3A62A 3LZBA 4EH2A 2QC6A 4EYJA 2BTRA 2ITZA 4KIPA 1XBCA 2BROA 3TZ7A 4C4IA 5LCJA 3KVWA 5CASA 4LM5A 1NVRA 1UVRA 2HIWA 3KKVA 3EN9A 3LMGA 4BGHA 1H25A 2OJIA 1MRUA 3V5LA 4L6QA 3OUKA 3AGMA 3MFRA 5HI2A 5ACBC 4PV0A 3VHKA 4DITA 5ETIA 2XJ0A 4Z55A 1QPJA 3HL7A 4A4OA 2C47A 2I0YA 2YCSA 3ET7A 4FV2A 4LGDA 3UOLA 4A7CA 3O50A 3W2QA 4O0UA 2PUNA 3MIAA 5FDPA 4DEAA 4O6EA 4FIEA 3WYXA 4EKLA 3BU5A 3FZRA 5KMLA 3OD6X 4BBMA 3SGCA 4JQ7A 4TWCA 4WBOA 4H58A 4FX3A 5HEZA 3I4BA 2VV9A 5ANEA 5IQHA 3I1AA 3UZTA 4FOBA 5LMBA 4RVKA 5EM7A 3IDPA 3KMUA 3R9DA 3OW4A 3RALA 1U5RA 2E9PA 3VQHA 4RIWB 2B52A 4RIYB 5BUJA 3UG1A 5ANJA 2JAVA 2XK6A 4ZLZA 4EBVA 3CIKA 3MW1A 4X3FA 3QCQA 3W2SA 2R7IA 3HA6A 5LQFA 2OO8X 4NUSA 3FV8A 4BKZA 4Y83A 2R3JA 1W83A 4XP3A 4KS8A 4A07A 2F9GA 3SW4A 4BCIA 4CMTA 1DS5A 4MQ2A 1Q62A 4ZIMA 4DC2A 3EN5A 4DH7A 5CT0A 5EW8A 4BCNA 4F7SA 5DR2A 3KA0A 2Y4IB 4OTIA 2IVSA 4R3PA 3GEQA 3RMFA 4F4PA 3DLZA 3NNWA 1UV5A 1MQBA 4BF2A 1J91A 2CGVA 3QQFA 2XP2A 4P5ZA 4USDA 3MS9A 4YZNA 4C61A 3KRWA 2RL5A 3NLBA 4FTUA 5HKMA 5AP0A 5BNJA 4KRCA 2YFXA 3ANRA 4MWHA 3VO3A 5IEYA 4ZMFA 4JR3A 4G2FA 3TIYA 3U4WA 4KABA 4FV4A 4L9IA 4FIHA 2X1NA 4ACHA 4BFMA 4DLJA 5LVMA 4D1SA 2SRCA 5BYZA 3U6HA 1YI6A 1ZRZA 3DA6A 4O0VA 2CLQA 5HBHA 3EQCA 3IOPA 4O7WA 3C7QA 4WHZA 4BICA 2QURA 2ZMDA 1Q8TA 3QTWA 3A7GA 5EOBA 3KXHA 1ZMUA 5CNNA 5CVGA 3KREA 4LFIA 3F82A 4I6QA 4RX8A 4YLLA 1FOTA 3Q9ZA 3BBTB 2PL0A 1O6YA 1V0BA 2GU8A 5D9HA 3UO4A 3VS2A 4YTIA 3PPZA 4PP9A 4F7NA 5A14A 4W8EA 1A06A 3WZUA 2Z7SA 3UPXA 1OBGA 5HHWA 3RBWA 4QO9A 4U41A
chains in the Genus database with same CATH superfamily
3CD8A 1YW2A 2ZDUA 5G6VA 3OW3A 4OW8A 5IKWA 4G6NA 5IH4A 2IZTA 3NUNA 4PUZA 4RIXA 5IPJA 3F5PA 5CWZA 3P1AA 2P2IA 3PIYA 5CALA 5F94A 5AP2A 3EKNA 5EDPA 5HTBA 5K0XA 4ASDA 2X9EA 4I4EA 4MEDA 5EFQA 5HG5A 5IUHA 4DG2E 3JY0A 4F9CA 4O4BB 3TZMA 3ZFYA 3DQXA 4R1YA 4XS2A 3FXXA 5E8VA 3BQRA 2WZJA 3VS3A 4BTMA 2BZIB 2C3KA 4FKUA 3HMIA 5DLSA 3L9PA 3ORKA 5HGIA 2X2KA 1FBNA 4DE4A 2C68A 5HLPA 2HZ0A 3NIZA 1BYGA 3RNYA 3MSSA 2NRUA 3R73A 4I1ZA 3R9RA 2XVDA 4OAVB 4O7LA 4MXOA 3Q5IA 2YZLA 1T45A 1YHSA 5DR6A 3QQUA 3S0OA 4MWIA 2JIUA 3C4XA 4CFUA 3F3ZA 5JN2A 4AGCA 4FVRA 3FHRA 3R7GA 4O21A 4RVTA 4AZWA 2X4ZA 3OMVA 4XNEA 2QODA 4GL9A 3FMDA 4BYIA 4G31A 3WOWA 1Q24A 1W2FA 3F9NA 3NUSA 2V7OA 2W1GA 3EQHA 4KD1A 3U87A 4NTSA 4FSMA 3FMHA 4WUAA 5H9BA 3UIXA 2XBAA 3HMOA 1JNKA 2HZIA 2OU7A 3Q9YA 4OTHA 2VWIA 1FINA 1JKKA 4FSUA 4AGWA 4TW9A 4CKJA 4WNMA 4HPUE 3HMNA 5AA9A 5JRSA 4QTBA 5EHYA 4D0XA 4DFYA 4RA5A 4MVFA 5E1SA 4U44A 5ITAA 5EDQA 2W06A 3DXNA 2O5KA 4EK8A 2QLUA 3MESA 4XH6A 2Y4PA 3LJ2A 2RKUA 3BEGA 3AC3A 2CMWA 4OTQA 4L7FA 4GW8A 3UIUA 4ID7A 3UG2A 2OIQA 5CI6A 3UP2A 3EMGA 3HV5A 4RVLA 3QKMA 4IAZA 3OHTA 4NM3A 3TNHA 4ANBA 5HE2A 2W17A 3QF9A 3WF9A 1B6CB 3A8XA 3IO7A 4NU1A 4USEA 1NW1A 3E8CA 3GB2A 3TCPA 3A7FA 2UW7A 4DYMA 2QOKA 4I5HA 5BQ0A 3QKKA 2VX0A 5JFXA 2ZJWA 3LFDA 5AP4A 2YAAA 3MIYA 5KMJA 3G15A 2VN9A 4G3FA 3UTOA 4KSPA 2E9UA 3CY2A 4E6DA 4QQJA 3VJOA 2C6IA 4C8BA 3PSDA 5AUVA 2WMAA 2ZMCA 4HNIA 4DFXE 1TZDA 3E62A 1BI8A 2HXQA 4RX7A 3MV5A 2HOGA 1FMKA 2J5EA 5H2UA 2R3PA 4WOVA 4TXCA 5JZNA 1M7QA 5E92A 4ZTRA 3CJGA 1R39A 2UVYA 3NW7A 4FV6A 3NCGA 4Y5QA 3VBTA 5KKRC 1PRYA 4XG6A 3PZHA 5K9IA 4AZFA 3CGOA 4TWOA 2H9VA 4DGLC 1KSWA 2YITA 4KIKA 2YLEA 4NIFB 1GAGA 1KE5A 2YM8A 4QRCA 5CEQA 3DB8A 1JKTA 4GU9A 4C4HA 3CD3A 1XWSA 3MFUA 3UO6A 3MPAA 3V8SA 2X0GA 4MD9E 3UNJA 5BX0A 3C0IA 4TYEA 3Q04A 2PVLA 4YBJA 2WIPA 3V5WA 3BYSA 3QXPA 4FTAA 4L45A 4UYNA 2UW4A 3PPKA 1VEBA 2Y7JA 4EK4A 2BR1A 4O0RA 3UZPA 2W1ZA 5EM6A 5DMZA 4IB3A 4IWOA 4UMPA 1SVHA 3DXPA 4BI1A 4G9CA 4IDTA 4W4XA 3G9NA 3PP1A 3REPA 2B9JA 1V1KA 3O8PA 4FTQA 5J5SA 2W96B 1G8JA 3U55A 1U46A 5IQIA 3TG1A 2BDJA 3OVVA 4ASZA 2HAKA 3W18A 3P7BA 5A3XA 4C4FA 3SV0A 3ZLXA 2CNVA 5EQYA 3G0EA 4EK5A 3BLAA 3Q32A 4OUCA 4RJ6A 4EHEA 4ZTMA 3VS6A 4BTJA 3A4PA 4GRBA 3EIDA 4B7TA 2IG7A 3LFCA 3QTIA 2BZJA 1W84A 4LUEA 4BDDA 4JNWA 2PSQA 4D5KA 5HLNA 3AD5A 4R6VA 3LCTA 3D94A 2VWZA 4JMQA 3RPRA 4R77A 5M44A 3ZBFA 2YJRA 4FG8A 4D4SA 4IC7A 3VQUA 4BDEA 4BDGA 4EH5A 1OIUA 1VZOA 1WVXA 2Q0BA 2V7AA 5J95A 4FF8A 2G2IA 4CRSA 4PMPA 3ZM9A 2J51A 5CSHA 1H00A 3RVGA 3Q3BA 1YDRE 3PVBA 5CQWA 5AR4A 4AN3A 4D28A 4GK2A 3V01A 3ZRKA 2JDOA 3MY1A 2VD5A 4GYGA 3VS4A 2BAQA 4H3QA 3NYNA 1XJDA 4DHFA 5L2SA 4RX9A 1R0PA 2YM4A 4RJ7A 3E87A 1W98A 4RZWA 4AAYA 3P9JA 3GQLA 1BI7A 3AMAA 4EHZA 1IAHA 3QRUA 5E1EA 4FSTA 2VTHA 3D5UA 3FJQE 2C30A 4CYIA 2Z7RA 4ZZOA 5M56A 3SAYA 2UW8A 4QYGA 3OY1A 3PTGA 2BUJA 4XV2A 3G90X 4IJPA 4EOPA 4UZDA 1L8TA 5CZHA 3DLSA 5CENA 1PKDA 3QWKA 5A4EA 4DTKA 3FHIA 2HY0A 4QMZA 3GU6A 3QC9A 2WTVA 2QOOA 3ELJA 3OT3A 1YDSE 3MA3A 1XQZA 2YAKA 4IEBA 4GEOA 3LPBA 2BZHB 5HVJA 4YMJA 3P4KA 4C59A 4O84A 3E93A 2J0LA 1KE8A 5AP5A 1F3MC 1W0XC 4EH8A 3TTJA 4LDTA 4S32A 3FSFA 3NAYA 4YLKA 3Q4CA 4AS0A 2F7XE 2XKDA 1NA7A 4ZEGA 5KKRB 3UMWA 3N4UA 3FQEA 4Q2AA 5AIKA 1UU7A 1SVEA 3ACJA 2VTPA 1ZXEA 1IEPA 3H0ZA 1M2PA 4Z3VA 3MTFA 1W82A 2YWPA 3FUPA 4R3RA 4U45A 2YCFA 4O6LA 3HDNA 3HVCA 3FYJX 4FTRA 4IWDA 4H39A 3EL8A 3VS7A 4AUAA 3PY0A 2XF0A 4TNBA 4CMUA 3KL8A 5L2TA 4FL1A 1O9UA 3KRXA 5JK3A 3C4EA 4HGLA 1KV2A 4C3FA 2OGVA 2VTNA 3A60A 3C1XA 3HEGA 3AGLA 2W1CA 4RLLA 2QR7A 3RAIA 5HX8A 3NNXA 2PZRA 5G1XA 4ASEA 1OL1A 4IX5A 5K0KA 4YU2A 3ZU7A 5A54A 2YIQA 3F66A 3EHAA 2BFYA 3NYVA 4ZZNA 3R7IA 4C34A 2H96A 4JQEA 4BDFA 4LQMA 3FKOA 2R7BA 3QYZA 4D1XA 5HU3A 3ZZWA 1WCCA 4FTMA 3BLQA 3DKOA 5AR8A 3R7VA 4QMOA 4UWBA 1Y6AA 1WMKA 3W0OA 3R83A 4LRKA 5C27A 3LXKA 4W4VA 3ROYA 1WBNA 1WBVA 3DBEA 4IAKA 5B0XA 2JDVA 4DCEA 2CKQA 3PIZA 4A4XA 3A8WA 3AT4A 2ITWA 3IW8A 4LMUA 4RVMA 4CLJA 5KE0A 4OLIA 3G51A 3WZEA 3R2YA 2OXYA 2XK4A 4BHZA 5FGKA 2ZV7A 1XH7A 2X7OA 3COIA 2P33A 1H1SA 5K4IA 3R04A 3IDCA 5KUPA 2BRMA 1VYZA 4I20A 5GNKA 3P5KA 3P5JC 2GHGA 3I0QA 4RZVA 5BUEA 3QRIA 2A1AB 3AG9A 1OITA 2GCDA 2X4FA 2QKWB 4EOJA 4OAUC 2WPAA 5EM8A 3E8EA 3FZ1A 2GS7A 2Y8OA 3MH3A 3ZHPC 1EH4A 5I9XA 2VZ6A 2CNUA 2HW6A 4W8DA 4ZK5A 4W9XA 5DVRA 2IVVA 3BYMA 3F69A 4CD0A 3QBNA 1MUOA 4JDJA 4AOTA 3COHA 4RFMA 2UZWE 3FZSA 3E7VA 4BIEA 4C4JA 5JQ5A 4MNEA 5DE2A 4UX9A 5EI6A 4J95A 4JBPA 3BU6A 3NRMA 2BIYA 3I6UA 3QX4A 4O38A 2X0PA 3G6HA 4E6AA 1M14A 4D2WA 3S00A 4JBQA 2XCHA 5FLFA 1H07A 3JUHA 3H9FA 1OL7A 2DYLA 3QTSA 4ACMA 2VRXA 4XLVA 4IFCA 4GG7A 4QYYA 3GBZA 3R8UA 2VTAA 5M4UA 3VWAA 3W55A 4FR4A 3VN9A 3QTZA 4JBOA 4XRJA 5HESA 1TFFA 4F9AA 2XRUA 4NKAA 1JLUE 4LOQA 1XH9A 3UO5A 2BRHA 3LFNA 3MH1A 5M4IA 5M51A 3WILA 2W99B 3FL4A 4MXCA 3RPYA 3W2PA 2JDRA 4CT2A 3BWJA 3BHHA 2JC6A 1H28A 3R9NA 1ZZLA 4IMYA 4XV3A 5L8KA 2XK7A 5M08A 4BZDA 3WZJA 2OBJA 2O8YA 2YEXA 5ICPA 3QCSA 5HBEA 3U6IA 4G5PA 4XLIA 2BZKB 5T6KA 5L2IA 3LXPA 4ZSJA 2GS2A 1YDTE 4L52A 3FZTA 3S3IA 2UZLA 2FH9A 1G3NA 3G6GA 5FM3A 2ITXA 3GUBA 3F5UA 3L9NA 5EDRA 4AQKA 3IOKA 1Z57A 4RWKA 2BRBA 3OROA 3UC3A 1KWPA 2YWVA 3CGFA 2W1EA 3KULA 2NNWB 5KO1A 1WBSA 2GQGA 5A6NA 3ULIA 3TT0A 3A99A 3B2WA 2I40A 2X0OA 4FKQA 1GIIA 3C50A 1PMEA 1URCA 4QPAA 4QYHA 5IF1A 4F6UA 4UV0A 2XAMA 3F3VA 4NW6A 3CKXA 1OVEA 2IZRA 5CF5A 2QO2A 3QQJA 5I3RA 2WXVA 4FMQA 4PMSA 2BILB 2O64A 4QTDA 4QNAA 1H8FA 3UVRA 4FE2A 3FE3A 1H0VA 1ZOGA 2ACXA 2WO6A 4GUEA 3FLNC 3P78A 3R9HA 4AZSA 2GNGA 3BI6A 2P55A 1NVQA 4C2WA 2C1AA 3U51A 3VUTA 4B6LA 1OPJA 2J0KA 1P4OA 3FSKA 1OZ1A 3FMLA 3MTLA 3OOMA 4NM7A 1WVYA 2OKRA 4FKJA 4ARKA 3QA8A 4I6BA 4FZDB 4UMTA 4ANMA 4AG8A 4FG9A 2IW6A 5F1ZA 2PPQA 2P0CA 2QVSE 3BBWA 4JJRA 1J1CA 4XBUA 5HIBA 5IH6A 4DA5A 4MK0A 3OEFX 3DS6A 3SQQA 4O96A 1YOLA 5DEYA 3DTCA 4YZBA 3HV6A 4EH6A 1MP8A 2WQBA 3C4CA 4NSTA 4QP2A 5D12A 3GOPA 3M42A 2H6DA 2PZPA 3AMBA 5I9VA 5HBJA 4OTGA 4PL5A 4XV9A 4C35A 2IZSA 2YLFA 4YTFA 2Y9QA 4I23A 4I41A 3C13A 5T3QA 4ZAUA 3SOAA 4AE6A 4Y72A 5IQCA 5CS6A 1G5SA 3G0FA 4MXYA 4YBKA 3M2WA 4ZTHA 4EL9A 3Q4ZA 2EB3A 4UMQA 3A7JA 1ZOEA 3R1SA 3QRJA 3WF8A 4CZUA 5BVOA 3UQFA 5IQFA 5EYKA 3E64A 2C5NA 2XYNA 3AT2A 2CJMA 3PE2A 3IW4A 3O5AA 5L3AA 2E9NA 2F2UA 2RFDA 2O65A 4BKJA 2PMLX 3NW6A 4GVAA 3EN7A 3V51A 4EK6A 2OZOA 3HKOA 3ZUTA 4BZNA 4P5QA 4RGJA 3JY9A 4BDBA 4HYUA 3ZDUA 1Z5MA 5C26A 4MF0A 4U7ZA 2XBJA 1FGIA 2CSNA 2BIKB 3CP9A 4I93A 4FEWA 1JVPP 3TUDA 3RPOA 1PJKA 3LFAA 2OXXA 5BYLA 4BIBA 4TZRA 4QYEA 2Z7LA 3HA8A 2XUUA 4D1ZA 4DDIA 1ZARA 4LOOA 3OBGA 2YERA 4QMVA 2VWYA 4HVGA 3EL7A 1Q8WA 1J7LA 4QDEA 4AOIA 3ORNA 4GK3A 4NM0A 4PNKA 1GIHA 4A4LA 2ITOA 4FNYA 3VULA 3EFJA 3F3UA 2GTNA 3VVHA 3VC4A 4UMRA 4QMMA 4YJUA 2HENA 3A7IA 4EUTA 5J7BA 3I79A 2R3KA 3FC1X 4P90A 1ZLTA 2ZOQA 1PHKA 3BYUA 3Q52A 4X3FC 3UBDA 4O4FA 2C6EA 5IQEA 3R8LA 1H26A 3U4UA 3AKJA 4L8MA 2GQRA 1FPUA 4JDIA 5ANIA 4GIIA 2A0CX 3UDBA 3RWPA 4PMTA 1P4FA 3CXWA 3Q5ZA 4QMLA 1ZYCA 4F9YA 3IW5A 2QHMA 1CMKE 2VU3A 4LI5A 3EYHA 3PXQA 3SDJA 2C0OA 2AYPA 5AP6A 2WMWA 3E63A 4Z9LA 5AX9A 4RC3A 1V0OA 4IW0A 3QCYA 2H34A 4K1BA 4IX3A 3NNVA 3Q4UA 3SXRA 2GS6A 5IU2A 2VAGA 2XNNA 2ZM1A 3EFKA 1S9JA 4EOIA 3R02A 3LE6A 3OCSA 4ANOA 2W7XA 5LVOA 2JBOA 2NRYA 2OF4A 2GQSA 2XCKA 3HYHA 5EYDA 3HRCA 3PA4A 3VF9A 5I9YA 3UE4A 4D9UA 5AUUA 2HWPA 5HCYA 3R30A 3ZMMA 4BZOA 3PG1A 5CAVA 3GXLA 5GJDA 3KU2A 5LWMA 1Q8UA 4BDCA 3IW7A 1J7UA 4KIOA 1Y91A 3PJCA 3GU8A 4EC8A 5IDNA 5CYIA 3ZSIA 3FLSA 4EC9A 4AF3A 2W9FB 3D7ZA 3ALOA 3C51A 4Y73A 4BKYA 5FDXA 4YHJA 4DH8A 3C5UA 4E1ZA 4TYGA 2PZIA 4YUQA 5CU0A 3RM6A 2JKKA 4I3ZA 4AE9A 1U5QA 2ZM3A 3EZRA 4AT5A 3OCTA 4GT3A 5H8GA 4CKRA 5IMEA 4RIYA 3B8RA 3ZTXA 1LEZA 1CKPA 2VWUA 1DI8A 4DN5A 4FV1A 4WD5A 3OCGA 5CU3A 2BHHA 2C5OA 3Q60A 1Q5KA 2VO7A 3CTJA 4RJ8A 3W2CA 2BKZA 5GJFA 4DG3E 2CCHA 3LFSA 2X2LA 3DOGA 3HP5A 4IZAA 5IQDA 3K3IA 4C3RA 4WA9A 2WMXA 5AV2A 5HVKA 2FSLX 1TQIA 4M0ZA 4UYAA 4OBQA 5FRIA 1QMZA 4BBFA 4WNKA 4RLKA 4X2FA 4GMYA 3DPKA 4U81A 3C0HA 5AADA 2JIVA 4CMOA 5I4NA 4OTWA 3SVVA 2B1PA 4E20A 3NFGB 3AXWA 3QTXA 1JKLA 3RKBA 1ZYJA 4MAOA 2H8HA 1YI3A 3VONA 2XM9A 3PXRA 4L01A 5D10A 3UDZA 3S95A 4KSQA 3O8TA 4FKSA 4QMTA 4HOKA 5IG1A 5AV3A 3FKLA 3S1HA 3ID6C 3TYKA 4PQNA 3F5GA 1FVTA 4K6ZA 1B38A 3W8LA 4I21A 2CKPA 2PMNX 2XNBA 3PFYA 5CEOA 2VGOA 3PPJA 4NJDA 3DCVA 4TYJA 3FDNA 4ZTLA 3UOKA 3K2LA 3FKNA 3WIKA 4X3FB 4IX4A 4RWIA 3DK3A 3RK5A 1ZYDA 4MBIA 5LCKA 2C0IA 4UMUA 4ENYA 2X7GA 3EQGA 4I5MA 3POOA 2FVDA 1KE9A 3C4ZA 4PP7A 3TN8A 2WTIA 4GUBA 3W0QA 3FI4A 2X8IA 4IB1A 4AN2A 1OKVA 3MVHA 4FKGA 4IVDA 1LR4A 4HGSA 2AUHA 4MH7A 4ANSA 5CF4A 2J0IA 3PWYA 2XKFA 3BGZA 1JSUA 3NUXA 4JX3A 4L00A 4BI0A 3UDTA 3QQGA 1YXVA 3MB6A 3E7OA 4CTBA 3DKGA 2WMBA 5ACKA 3KXGA 4ZLOA 1H4LA 2ZV8A 3ULZA 5L2WA 3EQRA 4Y85A 4S31A 5CEMA 4NJ3A 2PE0A 3IQ7A 3VBYA 5F20A 4C38A 2V5QA 3GGFA 1O6KA 4FTKA 4ZY6A 4ZJIA 3V5PA 3KK8A 4WRGA 4NZWB 4OR5A 3DJ6A 3QRKA 4U5JA 5B2MA 5HIEA 1REKA 2KULA 1VYWA 4UALA 2UZEA 4IZYA 2R2PA 2HY81 4YHTA 4MYGA 4PPBA 3AC1A 5AEPA 2OSCA 3ZEWA 4IZ7A 5JGBA 4GU6A 2Z7QA 4G9RA 4NEUA 5DI1A 5HICA 1YKRA 3KCKA 1IASA 4DEHA 4FV7A 5AUYA 5HE0A 3BHUA 3W2OA 2PHKA 5E7RA 5A4LA 4B9DA 3BGQA 1STCE 4GG5A 2GDOA 3NFFB 1K3AA 3PP0A 5LMKA 4IAIA 4DHIB 4XG7A 3ZXZA 4BRXA 4YZMA 1CDKA 3ZEPA 4EH7A 3UDSA 3R8MA 3QUEA 4M13A 4IHPA 2GMXA 4XV1A 4GJ3A 3PVGA 2IF8A 1LP4A 2YISA 1G8KA 5DT0A 3HDMA 2I6LA 3HUCA 4Y46A 2CNQA 3ZYAA 3EKKA 5CEIA 3W32A 3F5XA 2JDSA 2ZVAA 5BV3A 2WGJA 4FV0A 4YHFA 4O1PA 4BR3A 5E8YA 4AW2A 4E93A 5JGAA 5JFVA 3DBFA 3SC1A 1WVWA 2PY3A 4HPTE 4NWMA 3I7CA 3GC0A 4MCVA 4PF4A 4L43A 3THBA 1QPDA 3RK7A 2QG7A 4E5AX 3CQWA 4O7SA 3LXLA 5HTCA 4TWPA 3L8VA 2C6LA 4ERKA 2P4IA 3KRLA 4EZ5A 3ACKA 4R7IA 4QTAA 5HNIX 4NFMA 3AC5A 4EQUA 5KX8A 1YWNA 3FLWA 5FM2A 3ZFMA 5HCXA 3PXKA 3TUCA 3NUAA 3IGGA 4O2ZA 5A9UA 3O96A 3W0MA 3DBQA 2BMCA 3HRFA 4J98A 2Q83A 5HG9A 3TZ8A 2Y6MA 1XBBA 1Q97A 4HVDA 5HX6A 3GNIB 4G34A 4M69B 4D2RA 5BVWA 4MNFA 2BDFA 4UN0C 3Q6UA 3RAWA 2QONA 3Q9WA 4C0TA 3ORPA 5C1QB 4BYJA 4AACA 4MF1A 2IWIA 2ITNA 5LVLA 4C33A 3SRVB 4G3CA 4C37A 3EFLA 5KZIA 4B4LA 3ATTA 4YSJA 2G2HA 3SHEA 1ZWSA 5TR6A 1OBDA 4EJ7A 4IAFA 1YHWA 3OTVA 4IBMA 5EM5A 3V04A 1U4DA 3TKHA 3DBDA 2HXLA 1UA2A 1KOAA 4WNPA 4XBRA 3WYYA 5AMNA 4XCUA 4AT4A 3DDQA 4FKIA 5CANA 4F0FA 2FGIA 5D7VA 2HK5A 4D2PA 2IVTA 2C4GA 4FVQA 5B2KA 3OCBA 2VO6A 4DF3A 3TDWA 1OB3A 4NIFA 4ZS0A 2YDIA 4HZSA 4BI2A 2R64A 3LJ1A 4WNOA 4EQMA 2VO3A 2PZYA 3BPRA 3QGWA 5AR2A 5CEPA 3F2NA 4FTLA 4C3PA 3EN4A 4K2RA 5EW9A 4CT1A 2A4LA 4YJRA 4FTCA 2PMOX 2EXMA 3SG9A 4BTFA 2VNYA 3QTUA 1ZMVA 1OI9A 2QO9A 4QD6A 3QKLA 5DRDA 3BHVA 3VUIA 4CFNA 5AV4A 5BUIA 3ODZX 2J0JA 3GQIA 4FJVA 1NVSA 2JITA 3ODYX 4W4YA 1LEWA 2BRNA 3EQDA 4QYFA 5E8ZA 4RSSA 3OZ6A 2PE1A 3QD4A 3I7BA 4KRDA 4R1VA 3R2BA 4U8ZA 4GKIA 2G15A 2UUEA 4IZ5A 5FXRA 4BDIA 2W05A 4O7YA 4PY1A 3LVPA 1OL6A 2ZB0A 1M2QA 4PTCA 5CZIA 2F7EE 2VTTA 2WFYA 2XK8A 4FODA 4CFFA 1BL7A 4QMXA 4ZJJA 4EI4A 4RBLA 4I6FA 5CF6A 5J8IA 2DWBA 4AXDA 1U59A 3Q6WA 3H3CA 2C0TA 2CN5A 4IAYA 2WNTA 2CGXA 1W2CA 4QP1A 4DEEA 1JSVA 4MXAA 5GJGA 4F70A 3A2CA 4C02A 4YSMA 3W16A 3IK3A 3ZO4A 4DEIA 5IEXA 3F2RA 4U3YA 2YCRA 3HV7A 1YXUA 4PNIA 3UNZA 4FGBA 1W7HA 3KEXA 4DLIA 4O7RA 4RFYA 5AJQA 2UZOA 2WIHA 3PRIA 3BU3A 2CKEA 4BTKA 5HIDA 3DZOA 3W1FA 1ZYLA 3LM5A 4QTEA 5IQBA 4BWKA 3BCEA 1SMHA 2VTQA 4ACCA 4QMNA 5HD4A 5A4CA 4JXFA 5IQAA 2EXEA 2PK9A 3R28A 4JVGA 4EZ3A 4FEUA 5E9EA 4AXFA 4H1MA 5CSVA 4LOPA 3W0NA 3NVKI 2JBPA 2JKOA 1PXMA 3ORIA 4K33A 4WBBB 3CCNA 4O1OA 1XH6A 4M12A 5DFPA 4D2SA 2OIBA 3NX8A 2W1IA 2UZBA 3R63A 3RNIA 5DYJA 5KMNA 5EHLA 3O2MA 4O0XA 2IO6A 1MRVA 4W9WA 5H8EA 3TTIA 3GT8A 5A6OA 4XG9A 4U97A 3AD4A 3VBQA 2OFVA 4EOKA 1GZOA 3MVLA 4YO6A 3SXSA 4G1WA 5KMIA 5L6PA 1H01A 4ZTSA 3TWJA 4TT7A 5CT7A 3ZFXA 1UNHA 4FT3A 3TNQB 4R7HA 2WTDA 3M1SA 3DGKA 3GP0A 5EKOA 2GHMA 3N9XA 4HZRA 3HAMA 4JDKA 1OKYA 4FTIA 4G16A 4D4VA 3SLSA 5EQPA 3E92A 3E88A 3IKAA 4FSYA 4N6ZA 4E4XA 5KHXA 3I0OA 5CY3A 4LRJA 3WARA 3FLZA 3RZFA 2OZAB 1PXOA 4RJ3A 4AW1A 4C62A 2ITQA 5K5XA 4DTBA 3FMNA 2OXDA 5F95A 4E3CA 3QZFA 3EFWA 4K77A 5J9ZA 1HCLA 2B53A 2ESMA 5LXMA 2JFLA 3DQWA 4BCHA 4G3DA 5M57A 1I09A 5IUIA 3T9TA 1VR2A 3GENA 4BIDA 4DG0E 4F08A 2PTKA 3GFWA 1J1BA 4XMOA 4AOJA 5DOSA 4YZDA 1ND4A 5L8LA 5M07A 2ETKA 2Z8CA 3SG8A 2IEWA 4H36A 4QMQA 4S2ZA 3TNWA 2C3LA 2XIXA 3W0SA 4WSQA 3ANQA 4LMNA 2QOQA 2XH5A 1DAYA 3PFQA 5AP1A 4JBVA 2OF2A 4ZLYA 4ZSEA 4BCMA 4YGAA 2O3PA 2C6TA 3BV3A 3G9LX 3RJCA 3WIGA 4UWYA 1RW8A 1TVOA 1AGWA 4O7TA 4CG9A 3FLYA 4X7QA 3LLTA 3T8OA 3E3BX 4X0MA 5CXZA 2BKKA 3MPMA 3S4QA 4R5YA 4I0RA 1U54B 4FIFA 2WQEA 2VGPA 5GINE 3BEAA 4ITHA 2ITUA 3VBWA 4E4MA 3DJ5A 2IZUA 2QG5A 4YJQA 2VTIA 3NGAA 4F9BA 2EUFB 4U43A 3AMYA 1ZY5A 2XJ2A 5AUXA 3UNKA 3DAJA 4WG3A 3QTRA 4HCTA 1Q61A 1QCFA 1QL6A 5FEQA 5GIOE 1OUYA 3TDVA 3KRJA 1Y57A 5FWKK 3TNPC 4LL0A 3UMXA 5FG8A 3HGKA 5TKDA 3R0TA 5IA5A 3GC9A 3ITZA 4RFZA 4RT7A 4X2NA 3QXOA 3WZKA 4OTFA 4FZFB 2XNEA 2WQOA 4FEVA 3QD3A 3GI3A 5ETAA 2XNGA 4O2PA 3TV7A 1BL6A 4IVBA 4DINA 2C6MA 3LIJA 1Q41A 5E8XA 5DR9A 4O7NA 2X39A 1SNXA 4D58A 2C3IB 1YOJA 4GH2A 4AA5A 1YXSA 5AM6A 2WAJA 2HW7A 4RQVA 4BWXA 4ACDA 3C5IA 3BYVA 4F65A 2PUPA 4TYHA 4FNXA 3QHWA 2VTOA 1JQHA 2QOBA 4J8NA 4EOOA 4PMMA 2BCJA 4YJNA 4B8LA 3H10A 1PYXA 2VWXA 4FZ7A 4MKCA 4IC8A 1IG1A 3D7TA 3KCFA 4BY9E 4Q5HA 4M7IA 1URWA 5TE0A 4O86A 5HE3A 2W0JA 4U79A 5H3QA 1Y8GA 3BZ3A 4F64A 4Y95A 4YPSA 3FY0A 2PZ5A 3D2IA 2ITTA 3I5NA 4P7EA 4ZSGA 3R9OA 4F0IA 3HV4A 2YIYA 2YIXA 3DY7A 3NS9A 5BVEA 4GYIA 4CV8A 4O4DA 3LCSA 2YHVA 4EK3A 5IUGA 1HOWA 4OTDA 3PVUA 1ST0A 2XAOA 3VW6A 2R3HA 2X0QA 2R3QA 3ZO2A 4JS8A 3I60A 5HCZA 2NYAA 4HVSA 4I0SA 2X9FA 3TL8A 3UVPA 2ZM4A 1SZMA 2FSOX 3W8QA 3KXMA 4ITJA 3D83A 2AC5A 3PSBA 4Y5HA 5BVFA 1OGYA 1UU8A 3GU7A 4BBEA 3L9LA 3FXZA 2ERKA 4IWPA 5M4FA 4L3LA 4CZYB 3CY3A 4MNEB 5D11A 4XX9A 2C5XA 4FIJA 3LQ8A 5J5TA 3ORXA 2JKQA 3HAVA 4WUNA 4AZVA 3MGYA 1H1PA